2YFWB

Heterotetramer structure of kluyveromyces lactis cse4,h4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
ITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Cell cycle
total genus 24
structure length 66
sequence length 66
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfwB00
2NQBD 1BH9A 4ZBJB 1P34D 2F8NK 3AZHD 3NQJA 3W99D 4CAYA 4Z5TD 4WU8A 1P34C 5DNMB 3AZKD 3AZFC 1HQ3D 2NZDA 3KXBA 3X1SA 5B0ZC 5G49B 4NE3A 3X1VD 1HQ3C 2YFWB 3B0BA 4H9NB 1ID3D 3W97D 3X1VC 2FJ7B 3LZ1D 4ZUXD 4X23C 3C1CB 3TU4B 4YS3B 5B2JD 3UT9B 3WKJB 5B1LB 1ID3C 1F66B 3W97C 4XUJD 5AV8B 4ZUXC 3X1TB 5DNMC 5JA4B 4WNNA 5B33B 5B2JC 5B2ID 3RELA 5B1MD 4XUJC 3MVDB 3B0DC 4LD9B 2RVQD 3B6FB 3AZJB 3AZED 4J8XA 1KX5C 3W98B 2BYKA 2LY8A 3AZID 2RVQC 3AYWB 1P3KA 5CPID 2AROB 3C1CC 3X1UC 3AZIC 5F99B 3WKJC 5C3IC 5B40C 1P3PB 5AV5A 5CPIC 2PYOD 5AVBA 1BH8A 1WWSA 1KX4A 3REIC 3LELB 3KWQA 3WAAD 3WA9C 4YM6C 3REKD 4JJNC 3AZNA 3KSYA 4H9QA 3AV2B 3WAAC 1P3IC 3REKC 3MGSA 4HGAC 5FUGA 5GT3C 3AZGD 5CPKD 2CV5A 5B32D 3AZLA 3MNND 3LJAA 1P3PC 1P3GC 3AZMC 5JRGB 5AV9C 3NQJB 5B32C 3C1BD 5B31C 3VH5W 2NQBA 1P3LB 4WU8B 4WU9D 1U35D 1P34A 3KUYD 5BNXA 3C1BC 3AZHA 1S32D 2NZDB 2BYMB 1P3BD 3W99A 4Z5TA 4WV4B 4J8VB 4WU9C 3AZKA 3REJD 1HQ3A 4E45A 1F1EA 3VH5A 3X1VA 3REJC 4H9OA 5JRGC 1ID3A 3AN2D 4Z66D 3W97A 5KDMA 3LZ1A 3W96D 4ZUXA 4WNNB 3RELB 5B2JA 4DRBA 4XUJA 5CPJD 3UTBD 4J8XB 3WTPD 1TZYD 2BYKB 5B2IA 3A6ND 5B1MA 5E5AC 1P3AD 5CPJC 1B67A 5GSUB 1P3KB 3AZEA 5GT0D 3WTPC 1P3AC 3AZIA 1ZLAD 4QLCD 5BT1C 5AVBB 5AVCD 5AV6D 5CPIA 2HUEC 4KHAA 1P3FB 1KX4B 4J8WD 1M1AD 1M18B 1ZLAC 4R8PC 3KWQB 4QLCC 5AVCC 5AV6C 2PYOA 5B0YC 4J8WC 1M1AC 5DNNB 3MGQD 3REHC 3AZNB 1AOIB 1P3MC 5CP6D 3MGPB 3MGRC 3WAAA 3MGSB 3REKA 1H3OA 5FUGB 2CV5B 3AV1D 5CP6C 5CHLB 3LJAB 4J8UB 3AZFD 1M19B 1P3FC 3AV1C 3AZGA 1EQZD 3UTAB 5CPKA 5B32A 5AY8C 3MNNA 5B32G 5B0ZD 5GXQB 5DNNC 3AZHB 1EQZC 3LZ0B 1P3OD 3C1BA 4XZQB 4Z5TB 3AZKB 4X23D 3AFAC 4WU9A 1U35A 3KUYA 1S32A 4CSRA 1P3OC 1P3BA 1Q9CA 4UUZB 4ZBJC 4KGCB 2YFVA 5DNMD 1M19C 4H9OB 3REJA 1KX3B 2HIOB 3LZ1B 4H9SC 1JFIA 1KX5D 3LZ0C 3AN2A 4Z66A 2FJ7D 4NE5A 3W96A 3C1CD 4KUDB 3X1UD 4YS3D 5B2IB 3O62B 2F8ND 5B24B 3UT9D 5B1MB 5B40D 3WKJD 4NE6A 2FJ7C 3UTBA 5CPJA 3AZEB 4YS3C 3TU4C 5B33D 1WWIA 3WTPA 3UT9C 1TZYA 3A6NA 5B1LC 3REID 1F66C 1P3AA 2HIOC 5AV8C 4LD9D 3X1TC 3WA9D 4YM6D 3B6FD 4JJND 4E44A 4KHAB 5B33C 1HTAA 5GT0A 4AWLB 3W98D 3MVDC 4LD9C 3B0CW 1ZLAA 1P3ID 3B6FC 3AZJC 2PYOB 5AVCA 5AV6A 4KUDC 3W98C 4J8WA 5GT3D 1M1AA 5F99D 3NQUB 5B24C 3AYWC 1P3PD 3B6GB 1P3GD 2AROC 3AZMD 3MGQA 5AV9D 5F99C 1ULYA 1BH9B 5B31D 4H9RA 3LELD 5CP6A 4G91B 4CAYB 3AV1A 3LELC 3MNNB 3AV2D 1R4VA 3AZFA 3KXBB 3AV2C 1EQZA 3X1SB 1TAFA 5B0ZA 1U35B 3KUYB 1S32B 4CSRB 5JRGD 1P3OA 1P3LD 4WU8D 2YFVB 4X23A 2L5AA 1P3LC 4WU8C 4J8VD 5DNMA 4H9SA 5BS7C 2NZDC 5E5AD 4J8VC 3AN2B 5G49A 3W96B 2CWEA 3V9RA 1KX5A 1N1JA 5BT1D 3B0CT 3VH6W 2FJ7A 3C1CA 3X1UA 4YS3A 3A6NB 2F8NA 2IO5B 3UT9A 5B40A 5AV5B 4R8PD 3WKJA 2F8NG 1BH8B 5GT0B 5B0YD 3RELC 3REHD 5B33A 1BFMA 3REIA 1P3MD 3MGRD 5GSUD 4J8XC 4LD9A 4WZSB 3WA9A 4YM6A 3B6FA 4JJNA 4H9QB 3W98A 3VH6A 3VH5T 5GSUC 1P3KC 1P3IA 3MGQB 4G92B 1P3FD 3AZLB 5GT3A 4H9RB 5F99A 2IO5C 1M18D 4DRAA 5AY8D 1P3PA 5AVBC 1P3GA 1KX4C 3AZMA 5DNND 1M18C 5AV9A 2NQBB 3KWQC 5B31A 1AOID 3MGPD 5B31G 1KU5A 1P34B 5BNXB 3AZFB 3AZNC 3AFAD 3W99B 1AOIC 1A7WA 3MGPC 3AV2A 3MGSC 3R45A 5B0ZB 4J8UD 1M19D 1HQ3B 4G92C 2CV5C 5BNVA 3AZLC 3LJAC 3UTAD 3X1VB 4J8UC 4X23B 5GXQD 5JRGA 3UTAC 3LZ0D 2NQBC 1ID3B 4XZQD 3W97B 5KDMB 1P3LA 4ZUXB 5GXQC 3AZHC 5B2JB 3VH6T 5BS7A 3W99C 4XZQC 4Z5TC 4XUJB 3B0DB 2BYMA 3AZKC 4J8VA 4KGCD 3V9RB 3TU4D 1KX5B 1N1JB 5B1LD 1F66D 1KX3D 5E5AA 2HIOD 5AV8D 3X1TD 4KGCC 3X1UB 2F8NB 3AZIB 2F8NH 4H9PA 5C3IB 5B40B 1KX3C 3MVDD 4EO5B 3LZ1C 3AZJD 5CPIB 4Z2MG 4KUDD 3O62D 5B24D 3REIB 4R8PA 3AYWD 4QLCA 3WA9B 4YM6B 4JJNB 2AROD 5B0YA 5B2IC 3O62C 3REHA 5B1MC 4M6BA 3WAAB 1P3MA 1P3IB 3MGRA 3REKB 3AZEC 5GSUA 1H3OB 2JSSA 4HGAB 5GT3B 4EO5C 1P3GB 4AWLC 3AZGB 3AZMB 5AV9B 5CPKB 1P3FA 5B32B 5B31B 1M18A 5AY8A 3B6GD 2PYOC 5BO0A 3C1BB 5DNNA 3B6GC 1AOIA 3R45B 3MGPA 4WU9B 3AFAA 5BNVB 1B6WA 1P3BB 4J8UA 4G91C 3REJB 3AZGC 5CPKC 1M19A 2NZDD 3MNNC 3KXBD 3UTAA 3X1SD 1JFIB 5GXQA 3KXBC 3LZ0A 3X1SC 4XZQA 4Z66B 1U35C 3KUYC 1S32C 2YFWA 1P3BC 5E5AB 4H9NA 3UTBB 5CPJB 4UUZA 3WTPB 3RELD 1TZYB 3WTPE 3TU4A 4KGCA 4H9PB 1P3AB 5B1LA 1F66A 1KX3A 4Z2MH 2HIOA 5AV8A 4J8XD 3X1TA 2HUEB 5JA4A 1ZLAB 4R8PB 3MVDA 3AN2C 4QLCB 5AVCB 4Z66C 1P3KD 5AV6B 3AZJA 3W96C 5B0YB 4J8WB 1M1AB 4KUDA 3REHB 3O62A 5B24A 1P3MB 5AV5D 3MGRB 3UTBC 3AYWA 5AVBD 2AROA 1KX4D 1TZYC 3A6NC 5CP6B 4NFTA 5AV5C 3KWQD 5GT0C 3AZND 3AV1B 3LELA 5AY8B 3MGSD 5BO0B 1EQZB 2CV5D 3AZLD 3LJAD 1TAFB 3NQUA 3B6GA 3MGQC 3AFAB 1P3OB
chains in the Genus database with same CATH superfamily
2NQBD 1BH9A 2Y2NA 2RIQA 4ZBJB 1P34D 1PZRA 2F8NK 3AZHD 3NQJA 3W99D 4CAYA 3A1IA 4Z5TD 4WU8A 1P34C 5DNMB 3AZKD 3AZFC 1HQ3D 2NZDA 2JCHA 3KXBA 3X1SA 5B0ZC 5G49B 4NE3A 3X1VD 1HQ3C 2YFWB 3B0BA 4H9NB 1ID3D 3W97D 3X1VC 2FJ7B 3LZ1D 4ZUXD 4X23C 3C1CB 3TU4B 4YS3B 5B2JD 3UT9B 3WKJB 2DF4C 5B1LB 1ID3C 1F66B 3W97C 4XUJD 5AV8B 4ZUXC 3X1TB 5DNMC 5JA4B 4WNNA 5B33B 5B2JC 5B2ID 3RELA 2J8PA 5B1MD 4XUJC 3MVDB 3B0DC 4LD9B 2RVQD 3B6FB 3AZJB 3AZED 4J8XA 1KX5C 3W98B 2BYKA 2LY8A 3AZID 2RVQC 3AYWB 1P3KA 5CPID 2AROB 2G5IC 3C1CC 3X1UC 3AZIC 5F99B 3WKJC 5C3IC 5B40C 1P3PB 5AV5A 5CPIC 2PYOD 5AVBA 1BH8A 3H0MC 1WWSA 1KX4A 3REIC 3LELB 3KWQA 3WAAD 2Y2QA 3WA9C 4YM6C 3REKD 4JJNC 2W8SA 3AZNA 3KSYA 4H9QA 3AV2B 3WAAC 1P3IC 3REKC 3MGSA 4HGAC 5FUGA 5GT3C 3AZGD 5CPKD 2CV5A 5B32D 3AZLA 3MNND 3LJAA 1P3PC 1P3GC 3AZMC 5JRGB 5AV9C 3NQJB 5B32C 3C1BD 5B31C 3VH5W 2NQBA 1P3LB 4WU8B 4WU9D 1U35D 1P34A 3KUYD 5BNXA 3C1BC 3AZHA 1S32D 2NZDB 2BYMB 1P3BD 3W99A 4Z5TA 4WV4B 4J8VB 1Z2CB 4WU9C 3AZKA 3REJD 1HQ3A 2Y2GA 4E45A 4UPKA 1F1EA 2BG1A 3VH5A 3X1VA 3REJC 4H9OA 5JRGC 1ID3A 2ZY2A 3AN2D 4Z66D 3W97A 5KDMA 3LZ1A 3W96D 4ZUXA 4WNNB 3RELB 5B2JA 4DRBA 4XUJA 5CPJD 3UTBD 4J8XB 3WTPD 1TZYD 2BYKB 5B2IA 3A6ND 5B1MA 5E5AC 1P3AD 5CPJC 1B67A 5GSUB 2Y2MA 1P3KB 3AZEA 5GT0D 3WTPC 1P3AC 3AZIA 1ZLAD 4QLCD 5BT1C 5AVBB 5AVCD 5AV6D 5CPIA 2HUEC 4KHAA 1P3FB 1KX4B 4J8WD 1M1AD 1M18B 1ZLAC 4R8PC 3KWQB 4QLCC 5AVCC 5AV6C 2PYOA 5B0YC 4J8WC 1M1AC 5DNNB 3MGQD 3REHC 3AZNB 1AOIB 1P3MC 5CP6D 3MGPB 3MGRC 3WAAA 3MGSB 3REKA 1H3OA 5FUGB 2CV5B 3AV1D 5CP6C 5CHLB 3LJAB 4J8UB 3AZFD 1M19B 1P3FC 3AV1C 3AZGA 1EQZD 3UTAB 5CPKA 5B32A 5AY8C 3MNNA 5B32G 5B0ZD 5GXQB 5DNNC 3AZHB 1EQZC 3LZ0B 1P3OD 3C1BA 4XZQB 4Z5TB 3AZKB 4X23D 3AFAC 4WU9A 1U35A 3KUYA 1S32A 4CSRA 1P3OC 1P3BA 1Q9CA 4UUZB 4ZBJC 4KGCB 2YFVA 5DNMD 1M19C 4H9OB 3REJA 1KX3B 2HIOB 3LZ1B 4H9SC 1JFIA 3EPJA 1KX5D 3LZ0C 2XD5A 3AN2A 4Z66A 2FJ7D 4NE5A 3W96A 3C1CD 4KUDB 3X1UD 4YS3D 5B2IB 3O62B 2F8ND 5B24B 3UT9D 5B1MB 5B40D 3WKJD 4NE6A 2FJ7C 3UTBA 5CPJA 3AZEB 4YS3C 3TU4C 5B33D 1WWIA 3WTPA 3UT9C 1TZYA 2Y2LA 5B1LC 3A6NA 3REID 1F66C 1P3AA 2FFFB 2HIOC 5AV8C 4LD9D 3X1TC 3WA9D 4YM6D 3B6FD 4JJND 4E44A 4KHAB 5B33C 1HTAA 5GT0A 4AWLB 3W98D 3MVDC 4LD9C 3B0CW 1ZLAA 1P3ID 3B6FC 3AZJC 2PYOB 5AVCA 3EPHA 5AV6A 4KUDC 3W98C 4J8WA 5GT3D 1M1AA 5F99D 3NQUB 5B24C 3AYWC 1P3PD 3B6GB 1P3GD 2AROC 3AZMD 3MGQA 5AV9D 5F99C 1ULYA 1BH9B 5B31D 4H9RA 3P5JB 3LELD 5CP6A 4G91B 4CAYB 3AV1A 3LELC 3MNNB 3AV2D 3AL0C 1R4VA 3FDDA 3AZFA 3KXBB 3A1KA 3AV2C 1EQZA 3X1SB 1TAFA 2JE5A 5B0ZA 1U35B 3KUYB 1S32B 4CSRB 5JRGD 1P3OA 1P3LD 4WU8D 2YFVB 4X23A 2L5AA 1P3LC 4WU8C 4J8VD 5DNMA 4H9SA 5BS7C 2NZDC 5E5AD 2VQRA 4J8VC 3AN2B 5G49A 3W96B 2CWEA 3V9RA 2DQNC 1KX5A 1N1JA 5BT1D 3B0CT 2Y2IA 3VH6W 2FJ7A 3C1CA 3X1UA 4YS3A 3A6NB 2F8NA 2IO5B 3UT9A 5B40A 5AV5B 4R8PD 3WKJA 2F8NG 1BH8B 5GT0B 5B0YD 3RELC 3REHD 5B33A 1BFMA 3REIA 1P3MD 3MGRD 5GSUD 4J8XC 4LD9A 4WZSB 3WA9A 4YM6A 3B6FA 4JJNA 4H9QB 3W98A 3VH6A 3VH5T 5GSUC 1P3KC 1P3IA 3MGQB 4G92B 1P3FD 3AZLB 5GT3A 4H9RB 5F99A 2IO5C 1M18D 4DRAA 5AY8D 1P3PA 5AVBC 1P3GA 1KX4C 3AZMA 5DNND 1M18C 5AV9A 2NQBB 3KWQC 5B31A 2ZM5A 1AOID 3MGPD 5B31G 1KU5A 1P34B 5BNXB 3AZFB 2UWXA 3AZNC 3AFAD 3W99B 1AOIC 1A7WA 3MGPC 3AV2A 3MGSC 3R45A 5B0ZB 2Y2KA 4J8UD 1M19D 1HQ3B 4G92C 2CV5C 5BNVA 3AZLC 3LJAC 3UTAD 3X1VB 4J8UC 2XD1A 4X23B 5GXQD 5JRGA 3UTAC 2Y2JA 3LZ0D 2NQBC 1ID3B 4XZQD 3W97B 5KDMB 1P3LA 4ZUXB 5GXQC 3EPKA 3AZHC 5B2JB 3VH6T 5BS7A 3W99C 4XZQC 4Z5TC 4XUJB 2ZY3A 3B0DB 2BYMA 3AZKC 4J8VA 4KGCD 3V9RB 3TU4D 1KX5B 1N1JB 2Y2PA 5B1LD 1F66D 1KX3D 5E5AA 2HIOD 5AV8D 3X1TD 4KGCC 3KFUG 3X1UB 2F8NB 3AZIB 2F8NH 4H9PA 5C3IB 5B40B 1KX3C 3MVDD 4EO5B 3LZ1C 3EPLA 3AZJD 5CPIB 4Z2MG 4KUDD 3O62D 2ZY5A 3H0RC 5B24D 3REIB 4R8PA 3AYWD 4QLCA 3WA9B 4YM6B 4JJNB 2AROD 5B0YA 5B2IC 3O62C 3REHA 5B1MC 4M6BA 3WAAB 1P3MA 1P3IB 3MGRA 3REKB 3AZEC 5GSUA 1H3OB 2JSSA 4HGAB 5GT3B 4EO5C 1P3GB 4AWLC 3AZGB 3AZMB 5AV9B 5CPKB 1P3FA 5B32B 5B31B 1M18A 2ZY4A 5AY8A 3B6GD 4WJ3C 2PYOC 5BO0A 3C1BB 5DNNA 3B6GC 1AOIA 3R45B 3MGPA 2Y2OA 4WU9B 3AFAA 5BNVB 1B6WA 1P3BB 1W2EA 4J8UA 4G91C 3REJB 3AZGC 5CPKC 1M19A 3EG5B 2NZDD 3MNNC 3KXBD 3H0LC 3UTAA 3X1SD 1JFIB 5GXQA 2G5HC 3KXBC 3LZ0A 3X1SC 4XZQA 4Z66B 1U35C 3KUYC 1S32C 2YFWA 1P3BC 5E5AB 4H9NA 3UTBB 5CPJB 4UUZA 1T3UA 3WTPB 3RELD 1TZYB 3WTPE 3TU4A 4KGCA 4H9PB 1P3AB 5B1LA 1F66A 1KX3A 4Z2MH 2HIOA 5AV8A 4J8XD 3X1TA 3IP4C 2HUEB 5JA4A 1ZLAB 4R8PB 3MVDA 3AN2C 4QLCB 5AVCB 4Z66C 1P3KD 5AV6B 3AZJA 3W96C 5B0YB 4J8WB 1M1AB 4KUDA 3REHB 3O62A 5B24A 1P3MB 5AV5D 3MGRB 3UTBC 3AYWA 5AVBD 2AROA 1KX4D 1TZYC 3A6NC 5CP6B 4NFTA 5AV5C 3KWQD 5GT0C 3AZND 3AV1B 3LELA 5AY8B 3MGSD 2Y2HA 5BO0B 1EQZB 2CV5D 3AZLD 4DQYB 3LJAD 1TAFB 3NQUA 3B6GA 3F6TA 2F2AC 3MGQC 3AFAB 1P3OB
chains in the Genus database with same CATH topology
2NQBD 1BH9A 2Y2NA 2RIQA 4ZBJB 1P34D 1PZRA 2F8NK 3AZHD 3NQJA 3W99D 4CAYA 3A1IA 4Z5TD 4WU8A 1P34C 5DNMB 3AZKD 3AZFC 1HQ3D 2NZDA 2JCHA 3KXBA 3X1SA 5B0ZC 5G49B 4NE3A 3X1VD 1HQ3C 2YFWB 3B0BA 4H9NB 1ID3D 3W97D 3X1VC 2FJ7B 3LZ1D 4ZUXD 4X23C 3C1CB 3TU4B 4YS3B 5B2JD 3UT9B 3WKJB 2DF4C 5B1LB 1ID3C 1F66B 3W97C 4XUJD 5AV8B 4ZUXC 3X1TB 5DNMC 5JA4B 4WNNA 5B33B 5B2JC 5B2ID 3RELA 2J8PA 5B1MD 4XUJC 3MVDB 3B0DC 4LD9B 2RVQD 3B6FB 3AZJB 3AZED 4J8XA 1KX5C 3W98B 2BYKA 2LY8A 3AZID 2RVQC 3AYWB 1P3KA 5CPID 2AROB 2G5IC 3C1CC 3X1UC 3AZIC 5F99B 3WKJC 5C3IC 5B40C 1P3PB 5AV5A 5CPIC 2PYOD 5AVBA 1BH8A 3H0MC 1WWSA 1KX4A 3REIC 3LELB 3KWQA 3WAAD 2Y2QA 3WA9C 4YM6C 3REKD 4JJNC 2W8SA 3AZNA 3KSYA 4H9QA 3AV2B 3WAAC 1P3IC 3REKC 3MGSA 4HGAC 5FUGA 5GT3C 3AZGD 5CPKD 2CV5A 5B32D 3AZLA 3MNND 3LJAA 1P3PC 1P3GC 3AZMC 5JRGB 5AV9C 3NQJB 5B32C 3C1BD 5B31C 3VH5W 2NQBA 1P3LB 4WU8B 4WU9D 1U35D 1P34A 3KUYD 5BNXA 3C1BC 3AZHA 1S32D 2NZDB 2BYMB 1P3BD 3W99A 4Z5TA 4WV4B 4J8VB 1Z2CB 4WU9C 3AZKA 3REJD 1HQ3A 2Y2GA 4E45A 4UPKA 1F1EA 2BG1A 3VH5A 3X1VA 3REJC 4H9OA 5JRGC 1ID3A 2ZY2A 3AN2D 4Z66D 3W97A 5KDMA 3LZ1A 3W96D 4ZUXA 4WNNB 3RELB 5B2JA 4DRBA 4XUJA 5CPJD 3UTBD 4J8XB 3WTPD 1TZYD 2BYKB 5B2IA 3A6ND 5B1MA 5E5AC 1P3AD 5CPJC 1B67A 5GSUB 2Y2MA 1P3KB 3AZEA 5GT0D 3WTPC 1P3AC 3AZIA 1ZLAD 4QLCD 5BT1C 5AVBB 5AVCD 5AV6D 5CPIA 2HUEC 4KHAA 1P3FB 1KX4B 4J8WD 1M1AD 1M18B 1ZLAC 4R8PC 3KWQB 4QLCC 5AVCC 5AV6C 2PYOA 5B0YC 4J8WC 1M1AC 5DNNB 3MGQD 3REHC 3AZNB 1AOIB 1P3MC 5CP6D 3MGPB 3MGRC 3WAAA 3MGSB 3REKA 1H3OA 5FUGB 2CV5B 3AV1D 5CP6C 5CHLB 3LJAB 4J8UB 3AZFD 1M19B 1P3FC 3AV1C 3AZGA 1EQZD 3UTAB 5CPKA 5B32A 5AY8C 3MNNA 5B32G 5B0ZD 5GXQB 5DNNC 3AZHB 1EQZC 3LZ0B 1P3OD 3C1BA 4XZQB 4Z5TB 3AZKB 4X23D 3AFAC 4WU9A 1U35A 3KUYA 1S32A 4CSRA 1P3OC 1P3BA 1Q9CA 4UUZB 4ZBJC 4KGCB 2YFVA 5DNMD 1M19C 4H9OB 3REJA 1KX3B 2HIOB 3LZ1B 4H9SC 1JFIA 3EPJA 1KX5D 3LZ0C 2XD5A 3AN2A 4Z66A 2FJ7D 4NE5A 3W96A 3C1CD 4KUDB 3X1UD 4YS3D 5B2IB 3O62B 2F8ND 5B24B 3UT9D 5B1MB 5B40D 3WKJD 4NE6A 2FJ7C 3UTBA 5CPJA 3AZEB 4YS3C 3TU4C 5B33D 1WWIA 3WTPA 3UT9C 1TZYA 2Y2LA 5B1LC 3A6NA 3REID 1F66C 1P3AA 2FFFB 2HIOC 5AV8C 4LD9D 3X1TC 3WA9D 4YM6D 3B6FD 4JJND 4E44A 4KHAB 5B33C 1HTAA 5GT0A 4AWLB 3W98D 3MVDC 4LD9C 3B0CW 1ZLAA 1P3ID 3B6FC 3AZJC 2PYOB 5AVCA 3EPHA 5AV6A 4KUDC 3W98C 4J8WA 5GT3D 1M1AA 5F99D 3NQUB 5B24C 3AYWC 1P3PD 3B6GB 1P3GD 2AROC 3AZMD 3MGQA 5AV9D 5F99C 1ULYA 1BH9B 5B31D 4H9RA 3P5JB 3LELD 5CP6A 4G91B 4CAYB 3AV1A 3LELC 3MNNB 3AV2D 3AL0C 1R4VA 3FDDA 3AZFA 3KXBB 3A1KA 3AV2C 1EQZA 3X1SB 1TAFA 2JE5A 5B0ZA 1U35B 3KUYB 1S32B 4CSRB 5JRGD 1P3OA 1P3LD 4WU8D 2YFVB 4X23A 2L5AA 1P3LC 4WU8C 4J8VD 5DNMA 4H9SA 5BS7C 2NZDC 5E5AD 2VQRA 4J8VC 3AN2B 5G49A 3W96B 2CWEA 3V9RA 2DQNC 1KX5A 1N1JA 5BT1D 3B0CT 2Y2IA 3VH6W 2FJ7A 3C1CA 3X1UA 4YS3A 3A6NB 2F8NA 2IO5B 3UT9A 5B40A 5AV5B 4R8PD 3WKJA 2F8NG 1BH8B 5GT0B 5B0YD 3RELC 3REHD 5B33A 1BFMA 3REIA 1P3MD 3MGRD 5GSUD 4J8XC 4LD9A 4WZSB 3WA9A 4YM6A 3B6FA 4JJNA 4H9QB 3W98A 3VH6A 3VH5T 5GSUC 1P3KC 1P3IA 3MGQB 4G92B 1P3FD 3AZLB 5GT3A 4H9RB 5F99A 2IO5C 1M18D 4DRAA 5AY8D 1P3PA 5AVBC 1P3GA 1KX4C 3AZMA 5DNND 1M18C 5AV9A 2NQBB 3KWQC 5B31A 2ZM5A 1AOID 3MGPD 5B31G 1KU5A 1P34B 5BNXB 3AZFB 2UWXA 3AZNC 3AFAD 3W99B 1AOIC 1A7WA 3MGPC 3AV2A 3MGSC 3R45A 5B0ZB 2Y2KA 4J8UD 1M19D 1HQ3B 4G92C 2CV5C 5BNVA 3AZLC 3LJAC 3UTAD 3X1VB 4J8UC 2XD1A 4X23B 5GXQD 5JRGA 3UTAC 2Y2JA 3LZ0D 2NQBC 1ID3B 4XZQD 3W97B 5KDMB 1P3LA 4ZUXB 5GXQC 3EPKA 3AZHC 5B2JB 3VH6T 5BS7A 3W99C 4XZQC 4Z5TC 4XUJB 2ZY3A 3B0DB 2BYMA 3AZKC 4J8VA 4KGCD 3V9RB 3TU4D 1KX5B 1N1JB 2Y2PA 5B1LD 1F66D 1KX3D 5E5AA 2HIOD 5AV8D 3X1TD 4KGCC 3KFUG 3X1UB 2F8NB 3AZIB 2F8NH 4H9PA 5C3IB 5B40B 1KX3C 3MVDD 4EO5B 3LZ1C 3EPLA 3AZJD 5CPIB 4Z2MG 4KUDD 3O62D 2ZY5A 3H0RC 5B24D 3REIB 4R8PA 3AYWD 4QLCA 3WA9B 4YM6B 4JJNB 2AROD 5B0YA 5B2IC 3O62C 3REHA 5B1MC 4M6BA 3WAAB 1P3MA 1P3IB 3MGRA 3REKB 3AZEC 5GSUA 1H3OB 2JSSA 4HGAB 5GT3B 4EO5C 1P3GB 4AWLC 3AZGB 3AZMB 5AV9B 5CPKB 1P3FA 5B32B 5B31B 1M18A 2ZY4A 5AY8A 3B6GD 4WJ3C 2PYOC 5BO0A 3C1BB 5DNNA 3B6GC 1AOIA 3R45B 3MGPA 2Y2OA 4WU9B 3AFAA 5BNVB 1B6WA 1P3BB 1W2EA 4J8UA 4G91C 3REJB 3AZGC 5CPKC 1M19A 3EG5B 2NZDD 3MNNC 3KXBD 3H0LC 3UTAA 3X1SD 1JFIB 5GXQA 2G5HC 3KXBC 3LZ0A 3X1SC 4XZQA 4Z66B 1U35C 3KUYC 1S32C 2YFWA 1P3BC 5E5AB 4H9NA 3UTBB 5CPJB 4UUZA 1T3UA 3WTPB 3RELD 1TZYB 3WTPE 3TU4A 4KGCA 4H9PB 1P3AB 5B1LA 1F66A 1KX3A 4Z2MH 2HIOA 5AV8A 4J8XD 3X1TA 3IP4C 2HUEB 5JA4A 1ZLAB 4R8PB 3MVDA 3AN2C 4QLCB 5AVCB 4Z66C 1P3KD 5AV6B 3AZJA 3W96C 5B0YB 4J8WB 1M1AB 4KUDA 3REHB 3O62A 5B24A 1P3MB 5AV5D 3MGRB 3UTBC 3AYWA 5AVBD 2AROA 1KX4D 1TZYC 3A6NC 5CP6B 4NFTA 5AV5C 3KWQD 5GT0C 3AZND 3AV1B 3LELA 5AY8B 3MGSD 2Y2HA 5BO0B 1EQZB 2CV5D 3AZLD 4DQYB 3LJAD 1TAFB 3NQUA 3B6GA 3F6TA 2F2AC 3MGQC 3AFAB 1P3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB D;  1BH9 A;  4ZBJ B;  1P34 D;  2F8N K;  3AZH D;  3NQJ A;  3W99 D;  4CAY A;  4Z5T D;  4WU8 A;  1P34 C;  5DNM B;  3AZK D;  3AZF C;  1HQ3 D;  2NZD A;  3KXB A;  3X1S A;  5B0Z C;  5G49 B;  4NE3 A;  3X1V D;  1HQ3 C;  2YFW B;  3B0B A;  4H9N B;  1ID3 D;  3W97 D;  3X1V C;  2FJ7 B;  3LZ1 D;  4ZUX D;  4X23 C;  3C1C B;  3TU4 B;  4YS3 B;  5B2J D;  3UT9 B;  3WKJ B;  5B1L B;  1ID3 C;  1F66 B;  3W97 C;  4XUJ D;  5AV8 B;  4ZUX C;  3X1T B;  5DNM C;  5JA4 B;  4WNN A;  5B33 B;  5B2J C;  5B2I D;  3REL A;  5B1M D;  4XUJ C;  3MVD B;  3B0D C;  4LD9 B;  2RVQ D;  3B6F B;  3AZJ B;  3AZE D;  4J8X A;  1KX5 C;  3W98 B;  2BYK A;  2LY8 A;  3AZI D;  2RVQ C;  3AYW B;  1P3K A;  5CPI D;  2ARO B;  3C1C C;  3X1U C;  3AZI C;  5F99 B;  3WKJ C;  5C3I C;  5B40 C;  1P3P B;  5AV5 A;  5CPI C;  2PYO D;  5AVB A;  1BH8 A;  1WWS A;  1KX4 A;  3REI C;  3LEL B;  3KWQ A;  3WAA D;  3WA9 C;  4YM6 C;  3REK D;  4JJN C;  3AZN A;  3KSY A;  4H9Q A;  3AV2 B;  3WAA C;  1P3I C;  3REK C;  3MGS A;  4HGA C;  5FUG A;  5GT3 C;  3AZG D;  5CPK D;  2CV5 A;  5B32 D;  3AZL A;  3MNN D;  3LJA A;  1P3P C;  1P3G C;  3AZM C;  5JRG B;  5AV9 C;  3NQJ B;  5B32 C;  3C1B D;  5B31 C;  3VH5 W;  2NQB A;  1P3L B;  4WU8 B;  4WU9 D;  1U35 D;  1P34 A;  3KUY D;  5BNX A;  3C1B C;  3AZH A;  1S32 D;  2NZD B;  2BYM B;  1P3B D;  3W99 A;  4Z5T A;  4WV4 B;  4J8V B;  4WU9 C;  3AZK A;  3REJ D;  1HQ3 A;  4E45 A;  1F1E A;  3VH5 A;  3X1V A;  3REJ C;  4H9O A;  5JRG C;  1ID3 A;  3AN2 D;  4Z66 D;  3W97 A;  5KDM A;  3LZ1 A;  3W96 D;  4ZUX A;  4WNN B;  3REL B;  5B2J A;  4DRB A;  4XUJ A;  5CPJ D;  3UTB D;  4J8X B;  3WTP D;  1TZY D;  2BYK B;  5B2I A;  3A6N D;  5B1M A;  5E5A C;  1P3A D;  5CPJ C;  1B67 A;  5GSU B;  1P3K B;  3AZE A;  5GT0 D;  3WTP C;  1P3A C;  3AZI A;  1ZLA D;  4QLC D;  5BT1 C;  5AVB B;  5AVC D;  5AV6 D;  5CPI A;  2HUE C;  4KHA A;  1P3F B;  1KX4 B;  4J8W D;  1M1A D;  1M18 B;  1ZLA C;  4R8P C;  3KWQ B;  4QLC C;  5AVC C;  5AV6 C;  2PYO A;  5B0Y C;  4J8W C;  1M1A C;  5DNN B;  3MGQ D;  3REH C;  3AZN B;  1AOI B;  1P3M C;  5CP6 D;  3MGP B;  3MGR C;  3WAA A;  3MGS B;  3REK A;  1H3O A;  5FUG B;  2CV5 B;  3AV1 D;  5CP6 C;  5CHL B;  3LJA B;  4J8U B;  3AZF D;  1M19 B;  1P3F C;  3AV1 C;  3AZG A;  1EQZ D;  3UTA B;  5CPK A;  5B32 A;  5AY8 C;  3MNN A;  5B32 G;  5B0Z D;  5GXQ B;  5DNN C;  3AZH B;  1EQZ C;  3LZ0 B;  1P3O D;  3C1B A;  4XZQ B;  4Z5T B;  3AZK B;  4X23 D;  3AFA C;  4WU9 A;  1U35 A;  3KUY A;  1S32 A;  4CSR A;  1P3O C;  1P3B A;  1Q9C A;  4UUZ B;  4ZBJ C;  4KGC B;  2YFV A;  5DNM D;  1M19 C;  4H9O B;  3REJ A;  1KX3 B;  2HIO B;  3LZ1 B;  4H9S C;  1JFI A;  1KX5 D;  3LZ0 C;  3AN2 A;  4Z66 A;  2FJ7 D;  4NE5 A;  3W96 A;  3C1C D;  4KUD B;  3X1U D;  4YS3 D;  5B2I B;  3O62 B;  2F8N D;  5B24 B;  3UT9 D;  5B1M B;  5B40 D;  3WKJ D;  4NE6 A;  2FJ7 C;  3UTB A;  5CPJ A;  3AZE B;  4YS3 C;  3TU4 C;  5B33 D;  1WWI A;  3WTP A;  3UT9 C;  1TZY A;  3A6N A;  5B1L C;  3REI D;  1F66 C;  1P3A A;  2HIO C;  5AV8 C;  4LD9 D;  3X1T C;  3WA9 D;  4YM6 D;  3B6F D;  4JJN D;  4E44 A;  4KHA B;  5B33 C;  1HTA A;  5GT0 A;  4AWL B;  3W98 D;  3MVD C;  4LD9 C;  3B0C W;  1ZLA A;  1P3I D;  3B6F C;  3AZJ C;  2PYO B;  5AVC A;  5AV6 A;  4KUD C;  3W98 C;  4J8W A;  5GT3 D;  1M1A A;  5F99 D;  3NQU B;  5B24 C;  3AYW C;  1P3P D;  3B6G B;  1P3G D;  2ARO C;  3AZM D;  3MGQ A;  5AV9 D;  5F99 C;  1ULY A;  1BH9 B;  5B31 D;  4H9R A;  3LEL D;  5CP6 A;  4G91 B;  4CAY B;  3AV1 A;  3LEL C;  3MNN B;  3AV2 D;  1R4V A;  3AZF A;  3KXB B;  3AV2 C;  1EQZ A;  3X1S B;  1TAF A;  5B0Z A;  1U35 B;  3KUY B;  1S32 B;  4CSR B;  5JRG D;  1P3O A;  1P3L D;  4WU8 D;  2YFV B;  4X23 A;  2L5A A;  1P3L C;  4WU8 C;  4J8V D;  5DNM A;  4H9S A;  5BS7 C;  2NZD C;  5E5A D;  4J8V C;  3AN2 B;  5G49 A;  3W96 B;  2CWE A;  3V9R A;  1KX5 A;  1N1J A;  5BT1 D;  3B0C T;  3VH6 W;  2FJ7 A;  3C1C A;  3X1U A;  4YS3 A;  3A6N B;  2F8N A;  2IO5 B;  3UT9 A;  5B40 A;  5AV5 B;  4R8P D;  3WKJ A;  2F8N G;  1BH8 B;  5GT0 B;  5B0Y D;  3REL C;  3REH D;  5B33 A;  1BFM A;  3REI A;  1P3M D;  3MGR D;  5GSU D;  4J8X C;  4LD9 A;  4WZS B;  3WA9 A;  4YM6 A;  3B6F A;  4JJN A;  4H9Q B;  3W98 A;  3VH6 A;  3VH5 T;  5GSU C;  1P3K C;  1P3I A;  3MGQ B;  4G92 B;  1P3F D;  3AZL B;  5GT3 A;  4H9R B;  5F99 A;  2IO5 C;  1M18 D;  4DRA A;  5AY8 D;  1P3P A;  5AVB C;  1P3G A;  1KX4 C;  3AZM A;  5DNN D;  1M18 C;  5AV9 A;  2NQB B;  3KWQ C;  5B31 A;  1AOI D;  3MGP D;  5B31 G;  1KU5 A;  1P34 B;  5BNX B;  3AZF B;  3AZN C;  3AFA D;  3W99 B;  1AOI C;  1A7W A;  3MGP C;  3AV2 A;  3MGS C;  3R45 A;  5B0Z B;  4J8U D;  1M19 D;  1HQ3 B;  4G92 C;  2CV5 C;  5BNV A;  3AZL C;  3LJA C;  3UTA D;  3X1V B;  4J8U C;  4X23 B;  5GXQ D;  5JRG A;  3UTA C;  3LZ0 D;  2NQB C;  1ID3 B;  4XZQ D;  3W97 B;  5KDM B;  1P3L A;  4ZUX B;  5GXQ C;  3AZH C;  5B2J B;  3VH6 T;  5BS7 A;  3W99 C;  4XZQ C;  4Z5T C;  4XUJ B;  3B0D B;  2BYM A;  3AZK C;  4J8V A;  4KGC D;  3V9R B;  3TU4 D;  1KX5 B;  1N1J B;  5B1L D;  1F66 D;  1KX3 D;  5E5A A;  2HIO D;  5AV8 D;  3X1T D;  4KGC C;  3X1U B;  2F8N B;  3AZI B;  2F8N H;  4H9P A;  5C3I B;  5B40 B;  1KX3 C;  3MVD D;  4EO5 B;  3LZ1 C;  3AZJ D;  5CPI B;  4Z2M G;  4KUD D;  3O62 D;  5B24 D;  3REI B;  4R8P A;  3AYW D;  4QLC A;  3WA9 B;  4YM6 B;  4JJN B;  2ARO D;  5B0Y A;  5B2I C;  3O62 C;  3REH A;  5B1M C;  4M6B A;  3WAA B;  1P3M A;  1P3I B;  3MGR A;  3REK B;  3AZE C;  5GSU A;  1H3O B;  2JSS A;  4HGA B;  5GT3 B;  4EO5 C;  1P3G B;  4AWL C;  3AZG B;  3AZM B;  5AV9 B;  5CPK B;  1P3F A;  5B32 B;  5B31 B;  1M18 A;  5AY8 A;  3B6G D;  2PYO C;  5BO0 A;  3C1B B;  5DNN A;  3B6G C;  1AOI A;  3R45 B;  3MGP A;  4WU9 B;  3AFA A;  5BNV B;  1B6W A;  1P3B B;  4J8U A;  4G91 C;  3REJ B;  3AZG C;  5CPK C;  1M19 A;  2NZD D;  3MNN C;  3KXB D;  3UTA A;  3X1S D;  1JFI B;  5GXQ A;  3KXB C;  3LZ0 A;  3X1S C;  4XZQ A;  4Z66 B;  1U35 C;  3KUY C;  1S32 C;  2YFW A;  1P3B C;  5E5A B;  4H9N A;  3UTB B;  5CPJ B;  4UUZ A;  3WTP B;  3REL D;  1TZY B;  3WTP E;  3TU4 A;  4KGC A;  4H9P B;  1P3A B;  5B1L A;  1F66 A;  1KX3 A;  4Z2M H;  2HIO A;  5AV8 A;  4J8X D;  3X1T A;  2HUE B;  5JA4 A;  1ZLA B;  4R8P B;  3MVD A;  3AN2 C;  4QLC B;  5AVC B;  4Z66 C;  1P3K D;  5AV6 B;  3AZJ A;  3W96 C;  5B0Y B;  4J8W B;  1M1A B;  4KUD A;  3REH B;  3O62 A;  5B24 A;  1P3M B;  5AV5 D;  3MGR B;  3UTB C;  3AYW A;  5AVB D;  2ARO A;  1KX4 D;  1TZY C;  3A6N C;  5CP6 B;  4NFT A;  5AV5 C;  3KWQ D;  5GT0 C;  3AZN D;  3AV1 B;  3LEL A;  5AY8 B;  3MGS D;  5BO0 B;  1EQZ B;  2CV5 D;  3AZL D;  3LJA D;  1TAF B;  3NQU A;  3B6G A;  3MGQ C;  3AFA B;  1P3O B; 
#chains in the Genus database with same CATH topology
 2NQB D;  1BH9 A;  2Y2N A;  2RIQ A;  4ZBJ B;  1P34 D;  1PZR A;  2F8N K;  3AZH D;  3NQJ A;  3W99 D;  4CAY A;  3A1I A;  4Z5T D;  4WU8 A;  1P34 C;  5DNM B;  3AZK D;  3AZF C;  1HQ3 D;  2NZD A;  2JCH A;  3KXB A;  3X1S A;  5B0Z C;  5G49 B;  4NE3 A;  3X1V D;  1HQ3 C;  2YFW B;  3B0B A;  4H9N B;  1ID3 D;  3W97 D;  3X1V C;  2FJ7 B;  3LZ1 D;  4ZUX D;  4X23 C;  3C1C B;  3TU4 B;  4YS3 B;  5B2J D;  3UT9 B;  3WKJ B;  2DF4 C;  5B1L B;  1ID3 C;  1F66 B;  3W97 C;  4XUJ D;  5AV8 B;  4ZUX C;  3X1T B;  5DNM C;  5JA4 B;  4WNN A;  5B33 B;  5B2J C;  5B2I D;  3REL A;  2J8P A;  5B1M D;  4XUJ C;  3MVD B;  3B0D C;  4LD9 B;  2RVQ D;  3B6F B;  3AZJ B;  3AZE D;  4J8X A;  1KX5 C;  3W98 B;  2BYK A;  2LY8 A;  3AZI D;  2RVQ C;  3AYW B;  1P3K A;  5CPI D;  2ARO B;  2G5I C;  3C1C C;  3X1U C;  3AZI C;  5F99 B;  3WKJ C;  5C3I C;  5B40 C;  1P3P B;  5AV5 A;  5CPI C;  2PYO D;  5AVB A;  1BH8 A;  3H0M C;  1WWS A;  1KX4 A;  3REI C;  3LEL B;  3KWQ A;  3WAA D;  2Y2Q A;  3WA9 C;  4YM6 C;  3REK D;  4JJN C;  2W8S A;  3AZN A;  3KSY A;  4H9Q A;  3AV2 B;  3WAA C;  1P3I C;  3REK C;  3MGS A;  4HGA C;  5FUG A;  5GT3 C;  3AZG D;  5CPK D;  2CV5 A;  5B32 D;  3AZL A;  3MNN D;  3LJA A;  1P3P C;  1P3G C;  3AZM C;  5JRG B;  5AV9 C;  3NQJ B;  5B32 C;  3C1B D;  5B31 C;  3VH5 W;  2NQB A;  1P3L B;  4WU8 B;  4WU9 D;  1U35 D;  1P34 A;  3KUY D;  5BNX A;  3C1B C;  3AZH A;  1S32 D;  2NZD B;  2BYM B;  1P3B D;  3W99 A;  4Z5T A;  4WV4 B;  4J8V B;  1Z2C B;  4WU9 C;  3AZK A;  3REJ D;  1HQ3 A;  2Y2G A;  4E45 A;  4UPK A;  1F1E A;  2BG1 A;  3VH5 A;  3X1V A;  3REJ C;  4H9O A;  5JRG C;  1ID3 A;  2ZY2 A;  3AN2 D;  4Z66 D;  3W97 A;  5KDM A;  3LZ1 A;  3W96 D;  4ZUX A;  4WNN B;  3REL B;  5B2J A;  4DRB A;  4XUJ A;  5CPJ D;  3UTB D;  4J8X B;  3WTP D;  1TZY D;  2BYK B;  5B2I A;  3A6N D;  5B1M A;  5E5A C;  1P3A D;  5CPJ C;  1B67 A;  5GSU B;  2Y2M A;  1P3K B;  3AZE A;  5GT0 D;  3WTP C;  1P3A C;  3AZI A;  1ZLA D;  4QLC D;  5BT1 C;  5AVB B;  5AVC D;  5AV6 D;  5CPI A;  2HUE C;  4KHA A;  1P3F B;  1KX4 B;  4J8W D;  1M1A D;  1M18 B;  1ZLA C;  4R8P C;  3KWQ B;  4QLC C;  5AVC C;  5AV6 C;  2PYO A;  5B0Y C;  4J8W C;  1M1A C;  5DNN B;  3MGQ D;  3REH C;  3AZN B;  1AOI B;  1P3M C;  5CP6 D;  3MGP B;  3MGR C;  3WAA A;  3MGS B;  3REK A;  1H3O A;  5FUG B;  2CV5 B;  3AV1 D;  5CP6 C;  5CHL B;  3LJA B;  4J8U B;  3AZF D;  1M19 B;  1P3F C;  3AV1 C;  3AZG A;  1EQZ D;  3UTA B;  5CPK A;  5B32 A;  5AY8 C;  3MNN A;  5B32 G;  5B0Z D;  5GXQ B;  5DNN C;  3AZH B;  1EQZ C;  3LZ0 B;  1P3O D;  3C1B A;  4XZQ B;  4Z5T B;  3AZK B;  4X23 D;  3AFA C;  4WU9 A;  1U35 A;  3KUY A;  1S32 A;  4CSR A;  1P3O C;  1P3B A;  1Q9C A;  4UUZ B;  4ZBJ C;  4KGC B;  2YFV A;  5DNM D;  1M19 C;  4H9O B;  3REJ A;  1KX3 B;  2HIO B;  3LZ1 B;  4H9S C;  1JFI A;  3EPJ A;  1KX5 D;  3LZ0 C;  2XD5 A;  3AN2 A;  4Z66 A;  2FJ7 D;  4NE5 A;  3W96 A;  3C1C D;  4KUD B;  3X1U D;  4YS3 D;  5B2I B;  3O62 B;  2F8N D;  5B24 B;  3UT9 D;  5B1M B;  5B40 D;  3WKJ D;  4NE6 A;  2FJ7 C;  3UTB A;  5CPJ A;  3AZE B;  4YS3 C;  3TU4 C;  5B33 D;  1WWI A;  3WTP A;  3UT9 C;  1TZY A;  2Y2L A;  5B1L C;  3A6N A;  3REI D;  1F66 C;  1P3A A;  2FFF B;  2HIO C;  5AV8 C;  4LD9 D;  3X1T C;  3WA9 D;  4YM6 D;  3B6F D;  4JJN D;  4E44 A;  4KHA B;  5B33 C;  1HTA A;  5GT0 A;  4AWL B;  3W98 D;  3MVD C;  4LD9 C;  3B0C W;  1ZLA A;  1P3I D;  3B6F C;  3AZJ C;  2PYO B;  5AVC A;  3EPH A;  5AV6 A;  4KUD C;  3W98 C;  4J8W A;  5GT3 D;  1M1A A;  5F99 D;  3NQU B;  5B24 C;  3AYW C;  1P3P D;  3B6G B;  1P3G D;  2ARO C;  3AZM D;  3MGQ A;  5AV9 D;  5F99 C;  1ULY A;  1BH9 B;  5B31 D;  4H9R A;  3P5J B;  3LEL D;  5CP6 A;  4G91 B;  4CAY B;  3AV1 A;  3LEL C;  3MNN B;  3AV2 D;  3AL0 C;  1R4V A;  3FDD A;  3AZF A;  3KXB B;  3A1K A;  3AV2 C;  1EQZ A;  3X1S B;  1TAF A;  2JE5 A;  5B0Z A;  1U35 B;  3KUY B;  1S32 B;  4CSR B;  5JRG D;  1P3O A;  1P3L D;  4WU8 D;  2YFV B;  4X23 A;  2L5A A;  1P3L C;  4WU8 C;  4J8V D;  5DNM A;  4H9S A;  5BS7 C;  2NZD C;  5E5A D;  2VQR A;  4J8V C;  3AN2 B;  5G49 A;  3W96 B;  2CWE A;  3V9R A;  2DQN C;  1KX5 A;  1N1J A;  5BT1 D;  3B0C T;  2Y2I A;  3VH6 W;  2FJ7 A;  3C1C A;  3X1U A;  4YS3 A;  3A6N B;  2F8N A;  2IO5 B;  3UT9 A;  5B40 A;  5AV5 B;  4R8P D;  3WKJ A;  2F8N G;  1BH8 B;  5GT0 B;  5B0Y D;  3REL C;  3REH D;  5B33 A;  1BFM A;  3REI A;  1P3M D;  3MGR D;  5GSU D;  4J8X C;  4LD9 A;  4WZS B;  3WA9 A;  4YM6 A;  3B6F A;  4JJN A;  4H9Q B;  3W98 A;  3VH6 A;  3VH5 T;  5GSU C;  1P3K C;  1P3I A;  3MGQ B;  4G92 B;  1P3F D;  3AZL B;  5GT3 A;  4H9R B;  5F99 A;  2IO5 C;  1M18 D;  4DRA A;  5AY8 D;  1P3P A;  5AVB C;  1P3G A;  1KX4 C;  3AZM A;  5DNN D;  1M18 C;  5AV9 A;  2NQB B;  3KWQ C;  5B31 A;  2ZM5 A;  1AOI D;  3MGP D;  5B31 G;  1KU5 A;  1P34 B;  5BNX B;  3AZF B;  2UWX A;  3AZN C;  3AFA D;  3W99 B;  1AOI C;  1A7W A;  3MGP C;  3AV2 A;  3MGS C;  3R45 A;  5B0Z B;  2Y2K A;  4J8U D;  1M19 D;  1HQ3 B;  4G92 C;  2CV5 C;  5BNV A;  3AZL C;  3LJA C;  3UTA D;  3X1V B;  4J8U C;  2XD1 A;  4X23 B;  5GXQ D;  5JRG A;  3UTA C;  2Y2J A;  3LZ0 D;  2NQB C;  1ID3 B;  4XZQ D;  3W97 B;  5KDM B;  1P3L A;  4ZUX B;  5GXQ C;  3EPK A;  3AZH C;  5B2J B;  3VH6 T;  5BS7 A;  3W99 C;  4XZQ C;  4Z5T C;  4XUJ B;  2ZY3 A;  3B0D B;  2BYM A;  3AZK C;  4J8V A;  4KGC D;  3V9R B;  3TU4 D;  1KX5 B;  1N1J B;  2Y2P A;  5B1L D;  1F66 D;  1KX3 D;  5E5A A;  2HIO D;  5AV8 D;  3X1T D;  4KGC C;  3KFU G;  3X1U B;  2F8N B;  3AZI B;  2F8N H;  4H9P A;  5C3I B;  5B40 B;  1KX3 C;  3MVD D;  4EO5 B;  3LZ1 C;  3EPL A;  3AZJ D;  5CPI B;  4Z2M G;  4KUD D;  3O62 D;  2ZY5 A;  3H0R C;  5B24 D;  3REI B;  4R8P A;  3AYW D;  4QLC A;  3WA9 B;  4YM6 B;  4JJN B;  2ARO D;  5B0Y A;  5B2I C;  3O62 C;  3REH A;  5B1M C;  4M6B A;  3WAA B;  1P3M A;  1P3I B;  3MGR A;  3REK B;  3AZE C;  5GSU A;  1H3O B;  2JSS A;  4HGA B;  5GT3 B;  4EO5 C;  1P3G B;  4AWL C;  3AZG B;  3AZM B;  5AV9 B;  5CPK B;  1P3F A;  5B32 B;  5B31 B;  1M18 A;  2ZY4 A;  5AY8 A;  3B6G D;  4WJ3 C;  2PYO C;  5BO0 A;  3C1B B;  5DNN A;  3B6G C;  1AOI A;  3R45 B;  3MGP A;  2Y2O A;  4WU9 B;  3AFA A;  5BNV B;  1B6W A;  1P3B B;  1W2E A;  4J8U A;  4G91 C;  3REJ B;  3AZG C;  5CPK C;  1M19 A;  3EG5 B;  2NZD D;  3MNN C;  3KXB D;  3H0L C;  3UTA A;  3X1S D;  1JFI B;  5GXQ A;  2G5H C;  3KXB C;  3LZ0 A;  3X1S C;  4XZQ A;  4Z66 B;  1U35 C;  3KUY C;  1S32 C;  2YFW A;  1P3B C;  5E5A B;  4H9N A;  3UTB B;  5CPJ B;  4UUZ A;  1T3U A;  3WTP B;  3REL D;  1TZY B;  3WTP E;  3TU4 A;  4KGC A;  4H9P B;  1P3A B;  5B1L A;  1F66 A;  1KX3 A;  4Z2M H;  2HIO A;  5AV8 A;  4J8X D;  3X1T A;  3IP4 C;  2HUE B;  5JA4 A;  1ZLA B;  4R8P B;  3MVD A;  3AN2 C;  4QLC B;  5AVC B;  4Z66 C;  1P3K D;  5AV6 B;  3AZJ A;  3W96 C;  5B0Y B;  4J8W B;  1M1A B;  4KUD A;  3REH B;  3O62 A;  5B24 A;  1P3M B;  5AV5 D;  3MGR B;  3UTB C;  3AYW A;  5AVB D;  2ARO A;  1KX4 D;  1TZY C;  3A6N C;  5CP6 B;  4NFT A;  5AV5 C;  3KWQ D;  5GT0 C;  3AZN D;  3AV1 B;  3LEL A;  5AY8 B;  3MGS D;  2Y2H A;  5BO0 B;  1EQZ B;  2CV5 D;  3AZL D;  4DQY B;  3LJA D;  1TAF B;  3NQU A;  3B6G A;  3F6T A;  2F2A C;  3MGQ C;  3AFA B;  1P3O B; 
#chains in the Genus database with same CATH homology
 2NQB D;  1BH9 A;  2Y2N A;  2RIQ A;  4ZBJ B;  1P34 D;  1PZR A;  2F8N K;  3AZH D;  3NQJ A;  3W99 D;  4CAY A;  3A1I A;  4Z5T D;  4WU8 A;  1P34 C;  5DNM B;  3AZK D;  3AZF C;  1HQ3 D;  2NZD A;  2JCH A;  3KXB A;  3X1S A;  5B0Z C;  5G49 B;  4NE3 A;  3X1V D;  1HQ3 C;  2YFW B;  3B0B A;  4H9N B;  1ID3 D;  3W97 D;  3X1V C;  2FJ7 B;  3LZ1 D;  4ZUX D;  4X23 C;  3C1C B;  3TU4 B;  4YS3 B;  5B2J D;  3UT9 B;  3WKJ B;  2DF4 C;  5B1L B;  1ID3 C;  1F66 B;  3W97 C;  4XUJ D;  5AV8 B;  4ZUX C;  3X1T B;  5DNM C;  5JA4 B;  4WNN A;  5B33 B;  5B2J C;  5B2I D;  3REL A;  2J8P A;  5B1M D;  4XUJ C;  3MVD B;  3B0D C;  4LD9 B;  2RVQ D;  3B6F B;  3AZJ B;  3AZE D;  4J8X A;  1KX5 C;  3W98 B;  2BYK A;  2LY8 A;  3AZI D;  2RVQ C;  3AYW B;  1P3K A;  5CPI D;  2ARO B;  2G5I C;  3C1C C;  3X1U C;  3AZI C;  5F99 B;  3WKJ C;  5C3I C;  5B40 C;  1P3P B;  5AV5 A;  5CPI C;  2PYO D;  5AVB A;  1BH8 A;  3H0M C;  1WWS A;  1KX4 A;  3REI C;  3LEL B;  3KWQ A;  3WAA D;  2Y2Q A;  3WA9 C;  4YM6 C;  3REK D;  4JJN C;  2W8S A;  3AZN A;  3KSY A;  4H9Q A;  3AV2 B;  3WAA C;  1P3I C;  3REK C;  3MGS A;  4HGA C;  5FUG A;  5GT3 C;  3AZG D;  5CPK D;  2CV5 A;  5B32 D;  3AZL A;  3MNN D;  3LJA A;  1P3P C;  1P3G C;  3AZM C;  5JRG B;  5AV9 C;  3NQJ B;  5B32 C;  3C1B D;  5B31 C;  3VH5 W;  2NQB A;  1P3L B;  4WU8 B;  4WU9 D;  1U35 D;  1P34 A;  3KUY D;  5BNX A;  3C1B C;  3AZH A;  1S32 D;  2NZD B;  2BYM B;  1P3B D;  3W99 A;  4Z5T A;  4WV4 B;  4J8V B;  1Z2C B;  4WU9 C;  3AZK A;  3REJ D;  1HQ3 A;  2Y2G A;  4E45 A;  4UPK A;  1F1E A;  2BG1 A;  3VH5 A;  3X1V A;  3REJ C;  4H9O A;  5JRG C;  1ID3 A;  2ZY2 A;  3AN2 D;  4Z66 D;  3W97 A;  5KDM A;  3LZ1 A;  3W96 D;  4ZUX A;  4WNN B;  3REL B;  5B2J A;  4DRB A;  4XUJ A;  5CPJ D;  3UTB D;  4J8X B;  3WTP D;  1TZY D;  2BYK B;  5B2I A;  3A6N D;  5B1M A;  5E5A C;  1P3A D;  5CPJ C;  1B67 A;  5GSU B;  2Y2M A;  1P3K B;  3AZE A;  5GT0 D;  3WTP C;  1P3A C;  3AZI A;  1ZLA D;  4QLC D;  5BT1 C;  5AVB B;  5AVC D;  5AV6 D;  5CPI A;  2HUE C;  4KHA A;  1P3F B;  1KX4 B;  4J8W D;  1M1A D;  1M18 B;  1ZLA C;  4R8P C;  3KWQ B;  4QLC C;  5AVC C;  5AV6 C;  2PYO A;  5B0Y C;  4J8W C;  1M1A C;  5DNN B;  3MGQ D;  3REH C;  3AZN B;  1AOI B;  1P3M C;  5CP6 D;  3MGP B;  3MGR C;  3WAA A;  3MGS B;  3REK A;  1H3O A;  5FUG B;  2CV5 B;  3AV1 D;  5CP6 C;  5CHL B;  3LJA B;  4J8U B;  3AZF D;  1M19 B;  1P3F C;  3AV1 C;  3AZG A;  1EQZ D;  3UTA B;  5CPK A;  5B32 A;  5AY8 C;  3MNN A;  5B32 G;  5B0Z D;  5GXQ B;  5DNN C;  3AZH B;  1EQZ C;  3LZ0 B;  1P3O D;  3C1B A;  4XZQ B;  4Z5T B;  3AZK B;  4X23 D;  3AFA C;  4WU9 A;  1U35 A;  3KUY A;  1S32 A;  4CSR A;  1P3O C;  1P3B A;  1Q9C A;  4UUZ B;  4ZBJ C;  4KGC B;  2YFV A;  5DNM D;  1M19 C;  4H9O B;  3REJ A;  1KX3 B;  2HIO B;  3LZ1 B;  4H9S C;  1JFI A;  3EPJ A;  1KX5 D;  3LZ0 C;  2XD5 A;  3AN2 A;  4Z66 A;  2FJ7 D;  4NE5 A;  3W96 A;  3C1C D;  4KUD B;  3X1U D;  4YS3 D;  5B2I B;  3O62 B;  2F8N D;  5B24 B;  3UT9 D;  5B1M B;  5B40 D;  3WKJ D;  4NE6 A;  2FJ7 C;  3UTB A;  5CPJ A;  3AZE B;  4YS3 C;  3TU4 C;  5B33 D;  1WWI A;  3WTP A;  3UT9 C;  1TZY A;  2Y2L A;  5B1L C;  3A6N A;  3REI D;  1F66 C;  1P3A A;  2FFF B;  2HIO C;  5AV8 C;  4LD9 D;  3X1T C;  3WA9 D;  4YM6 D;  3B6F D;  4JJN D;  4E44 A;  4KHA B;  5B33 C;  1HTA A;  5GT0 A;  4AWL B;  3W98 D;  3MVD C;  4LD9 C;  3B0C W;  1ZLA A;  1P3I D;  3B6F C;  3AZJ C;  2PYO B;  5AVC A;  3EPH A;  5AV6 A;  4KUD C;  3W98 C;  4J8W A;  5GT3 D;  1M1A A;  5F99 D;  3NQU B;  5B24 C;  3AYW C;  1P3P D;  3B6G B;  1P3G D;  2ARO C;  3AZM D;  3MGQ A;  5AV9 D;  5F99 C;  1ULY A;  1BH9 B;  5B31 D;  4H9R A;  3P5J B;  3LEL D;  5CP6 A;  4G91 B;  4CAY B;  3AV1 A;  3LEL C;  3MNN B;  3AV2 D;  3AL0 C;  1R4V A;  3FDD A;  3AZF A;  3KXB B;  3A1K A;  3AV2 C;  1EQZ A;  3X1S B;  1TAF A;  2JE5 A;  5B0Z A;  1U35 B;  3KUY B;  1S32 B;  4CSR B;  5JRG D;  1P3O A;  1P3L D;  4WU8 D;  2YFV B;  4X23 A;  2L5A A;  1P3L C;  4WU8 C;  4J8V D;  5DNM A;  4H9S A;  5BS7 C;  2NZD C;  5E5A D;  2VQR A;  4J8V C;  3AN2 B;  5G49 A;  3W96 B;  2CWE A;  3V9R A;  2DQN C;  1KX5 A;  1N1J A;  5BT1 D;  3B0C T;  2Y2I A;  3VH6 W;  2FJ7 A;  3C1C A;  3X1U A;  4YS3 A;  3A6N B;  2F8N A;  2IO5 B;  3UT9 A;  5B40 A;  5AV5 B;  4R8P D;  3WKJ A;  2F8N G;  1BH8 B;  5GT0 B;  5B0Y D;  3REL C;  3REH D;  5B33 A;  1BFM A;  3REI A;  1P3M D;  3MGR D;  5GSU D;  4J8X C;  4LD9 A;  4WZS B;  3WA9 A;  4YM6 A;  3B6F A;  4JJN A;  4H9Q B;  3W98 A;  3VH6 A;  3VH5 T;  5GSU C;  1P3K C;  1P3I A;  3MGQ B;  4G92 B;  1P3F D;  3AZL B;  5GT3 A;  4H9R B;  5F99 A;  2IO5 C;  1M18 D;  4DRA A;  5AY8 D;  1P3P A;  5AVB C;  1P3G A;  1KX4 C;  3AZM A;  5DNN D;  1M18 C;  5AV9 A;  2NQB B;  3KWQ C;  5B31 A;  2ZM5 A;  1AOI D;  3MGP D;  5B31 G;  1KU5 A;  1P34 B;  5BNX B;  3AZF B;  2UWX A;  3AZN C;  3AFA D;  3W99 B;  1AOI C;  1A7W A;  3MGP C;  3AV2 A;  3MGS C;  3R45 A;  5B0Z B;  2Y2K A;  4J8U D;  1M19 D;  1HQ3 B;  4G92 C;  2CV5 C;  5BNV A;  3AZL C;  3LJA C;  3UTA D;  3X1V B;  4J8U C;  2XD1 A;  4X23 B;  5GXQ D;  5JRG A;  3UTA C;  2Y2J A;  3LZ0 D;  2NQB C;  1ID3 B;  4XZQ D;  3W97 B;  5KDM B;  1P3L A;  4ZUX B;  5GXQ C;  3EPK A;  3AZH C;  5B2J B;  3VH6 T;  5BS7 A;  3W99 C;  4XZQ C;  4Z5T C;  4XUJ B;  2ZY3 A;  3B0D B;  2BYM A;  3AZK C;  4J8V A;  4KGC D;  3V9R B;  3TU4 D;  1KX5 B;  1N1J B;  2Y2P A;  5B1L D;  1F66 D;  1KX3 D;  5E5A A;  2HIO D;  5AV8 D;  3X1T D;  4KGC C;  3KFU G;  3X1U B;  2F8N B;  3AZI B;  2F8N H;  4H9P A;  5C3I B;  5B40 B;  1KX3 C;  3MVD D;  4EO5 B;  3LZ1 C;  3EPL A;  3AZJ D;  5CPI B;  4Z2M G;  4KUD D;  3O62 D;  2ZY5 A;  3H0R C;  5B24 D;  3REI B;  4R8P A;  3AYW D;  4QLC A;  3WA9 B;  4YM6 B;  4JJN B;  2ARO D;  5B0Y A;  5B2I C;  3O62 C;  3REH A;  5B1M C;  4M6B A;  3WAA B;  1P3M A;  1P3I B;  3MGR A;  3REK B;  3AZE C;  5GSU A;  1H3O B;  2JSS A;  4HGA B;  5GT3 B;  4EO5 C;  1P3G B;  4AWL C;  3AZG B;  3AZM B;  5AV9 B;  5CPK B;  1P3F A;  5B32 B;  5B31 B;  1M18 A;  2ZY4 A;  5AY8 A;  3B6G D;  4WJ3 C;  2PYO C;  5BO0 A;  3C1B B;  5DNN A;  3B6G C;  1AOI A;  3R45 B;  3MGP A;  2Y2O A;  4WU9 B;  3AFA A;  5BNV B;  1B6W A;  1P3B B;  1W2E A;  4J8U A;  4G91 C;  3REJ B;  3AZG C;  5CPK C;  1M19 A;  3EG5 B;  2NZD D;  3MNN C;  3KXB D;  3H0L C;  3UTA A;  3X1S D;  1JFI B;  5GXQ A;  2G5H C;  3KXB C;  3LZ0 A;  3X1S C;  4XZQ A;  4Z66 B;  1U35 C;  3KUY C;  1S32 C;  2YFW A;  1P3B C;  5E5A B;  4H9N A;  3UTB B;  5CPJ B;  4UUZ A;  1T3U A;  3WTP B;  3REL D;  1TZY B;  3WTP E;  3TU4 A;  4KGC A;  4H9P B;  1P3A B;  5B1L A;  1F66 A;  1KX3 A;  4Z2M H;  2HIO A;  5AV8 A;  4J8X D;  3X1T A;  3IP4 C;  2HUE B;  5JA4 A;  1ZLA B;  4R8P B;  3MVD A;  3AN2 C;  4QLC B;  5AVC B;  4Z66 C;  1P3K D;  5AV6 B;  3AZJ A;  3W96 C;  5B0Y B;  4J8W B;  1M1A B;  4KUD A;  3REH B;  3O62 A;  5B24 A;  1P3M B;  5AV5 D;  3MGR B;  3UTB C;  3AYW A;  5AVB D;  2ARO A;  1KX4 D;  1TZY C;  3A6N C;  5CP6 B;  4NFT A;  5AV5 C;  3KWQ D;  5GT0 C;  3AZN D;  3AV1 B;  3LEL A;  5AY8 B;  3MGS D;  2Y2H A;  5BO0 B;  1EQZ B;  2CV5 D;  3AZL D;  4DQY B;  3LJA D;  1TAF B;  3NQU A;  3B6G A;  3F6T A;  2F2A C;  3MGQ C;  3AFA B;  1P3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...