2YFWB

Heterotetramer structure of kluyveromyces lactis cse4,h4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
ITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
total genus 24
structure length 66
sequence length 66
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfwB00
1ID3D 3KXBB 4YS3A 3KXBC 3AZEB 3AZEC 5AVBD 3B6FA 5B24A 5BT1D 1M1AB 4KGCC 4WU9A 3B6FD 2YFWB 1ZLAA 3AZLB 3AZLC 5CPJD 1KX3D 1KU5A 1WWIA 5AVCC 5AVCB 1M19D 3O62B 3O62C 3UT9D 1N1JB 4QLCB 4QLCC 1TZYD 5G49A 2F8NA 3C1CB 5DNMA 3AZKD 4X23B 3LZ1B 4X23C 1AOIA 4H9OA 5CPID 4YM6D 3REIB 3REIC 1HQ3C 3X1SB 5CPKD 3X1SC 2L5AA 2F8NK 3KUYA 3WAAA 5JA4A 5AV8D 3KUYD 3UTBD 1P3GA 1P3LA 3UTAB 1P3KA 5B1LB 5B1LC 5GT0D 2RVQD 4KHAA 1M18A 4CAYA 1P3KD 3WTPD 1P3FA 3RELD 2FJ7D 2HIOA 4ZUXB 4ZUXC 5AV6A 3NQUB 1P34D 4J8UA 3VH5T 1U35A 3W97D 3AZFA 4J8UD 1U35D 3B6GA 3WA9B 3WA9C 5B24B 1P3BD 3X1TD 4E45A 1ZLAB 5AY8A 3TU4A 4WU8B 3AV1A 4WU8C 4JJND 3KWQD 2PYOB 2PYOC 1S32D 5B32B 1KX5B 5B32C 1KX5C 1BH8B 4XZQA 5KDMB 3REJA 1P3OD 5JRGB 2CV5D 5JRGC 4H9NB 3REJD 2F8NB 3MGRD 5DNMB 5B1MB 3MVDB 5B1MC 3MVDC 3R45A 1HTAA 3AZGB 3AZGC 3LZ0D 3X1VA 1P3MB 5JA4B 1P3MC 3VH5A 3AZMA 3WKJA 4LD9D 1P3AA 2YFVB 3LJAB 3AZMD 4Z66B 4H9SA 4Z66C 3LJAC 3KSYA 5BNXA 1P3LB 3AZJA 1R4VA 5BNVB 1M18B 1M18C 1F66D 3AZJD 3KXBD 5B32G 4R8PC 3AZED 2HIOB 2HIOC 5CP6C 5AV9B 5AV9C 5B2JA 4KGCD 4J8WB 5B31A 4J8WC 3AZLD 5BS7C 3NQJA 5E5AA 3REHB 3REHC 5B0YA 3C1BD 3A6NB 3A6NC 1WWSA 3O62D 2AROB 5E5AD 2AROC 5GT3C 5GT3B 4WZSB 1KX4A 5B0ZB 4QLCD 5B0ZC 1JFIA 5AY8B 3AV1B 3AV1C 4Z5TB 1F1EA 4Z5TC 3W98A 5DNND 4XZQB 3REID 1ID3A 1HQ3D 3X1SD 2NZDC 3AYWB 3AYWC 5B33B 3MNNB 3MNNC 5B33C 4G92B 4G92C 3AN2B 3AN2C 3W99B 3W99C 3AZIB 3AZIC 3AFAB 3AFAC 5CPJA 1M1AC 1KX3A 4H9QB 1B6WA 1M19A 3B0CT 4ZBJB 3VH6T 3UT9A 3MGSB 3MGSC 1TZYA 1P3AB 5B40B 5B40C 3AZKA 5BNXB 3X1UB 3X1UC 5B2IB 4YM6A 5B2IC 5CPIA 3C1CC 1ULYA 4J8VB 1TAFA 3MGQB 3MGQC 4J8VC 3LZ1C 5CPKA 4DRBA 5AV8A 1BH9B 4EO5B 4EO5C 5B2JB 5B2JC 3UTBA 4J8XB 4NFTA 5B31B 4J8XC 4WU8D 4NE6A 4WNNB 3NQJB 2PYOD 5GT0A 5B32D 1KX5D 3UTAC 3WTPA 4NE3A 3RELA 1EQZB 1EQZC 4H9RB 3REKB 1KX4B 3REKC 3AV2A 1KX4C 2FJ7A 3AZNB 3AZNC 1P34A 3VH6A 2BYMA 3MVDD 5C3IB 3W97A 4UUZA 5C3IC 3AV2D 3W98B 5GXQB 5GXQC 3AZHB 3AZHC 1ID3B 1ID3C 3LELB 1P3IB 5AV5A 3LELC 1P3IC 3AZGD 5AVBB 5AVBC 4YS3B 5BT1C 1H3OA 2BYKA 4YS3C 1P3BA 5AV5D 3X1TA 1P3MD 3VH5W 3B6FB 3B6FC 1BFMA 5B24C 1KX3B 4JJNA 3KWQA 4Z66D 4WU9B 4WU9C 1S32A 1ZLAC 1M19B 4NE5A 1P3OA 4H9PA 2CV5A 1TZYB 3MGRA 4R8PD 3AZKB 5CP6D 5G49B 5AV9D 4E44A 5BO0A 5DNMC 1TAFB 1AOIB 5CPKB 4J8WD 1AOIC 4H9OB 3LZ0A 4XUJA 5F99A 3REHD 5AV8B 2JSSA 3KUYB 4LD9A 3KUYC 3A6ND 4XUJD 3WAAB 3WAAC 5F99D 5GT3D 3MGPA 5B0ZD 5GSUA 5FUGA 3MGPD 4KUDD 3W96D 1P3GB 1P3GC 1P3LC 1P3PD 5GSUD 1P3KB 1F66A 1P3KC 2NQBD 3RELB 3KXBA 2NZDD 4KHAB 3AZEA 3AYWD 4CAYB 5B33D 3MNND 4DRAA 1P3FB 1P3FC 1P34B 4KGCA 4UUZB 3AFAD 2YFWA 3AZLA 5AV6B 1M1AD 5AV6C 4J8UB 4J8UC 1U35B 1U35C 5AVCA 2F8NG 3C1BA 3AZFB 3AZFC 3B6GB 3O62A 3B6GC 3X1TB 5AVCD 1N1JA 4QLCA 3MGSD 4JJNB 5B40D 5DNNA 4X23A 3TU4B 5AY8C 3TU4C 5B2ID 3C1CD 1P3OB 3REIA 1P3OC 1HQ3A 2CV5B 2CV5C 3X1SA 4X23D 3LZ1D 4XZQC 3REJB 3REJC 4G91B 4G91C 4J8XD 3R45B 5B1LA 4WV4B 3UTAD 4LD9B 4LD9C 5B1LD 3X1VB 1EQZD 3X1VC 4ZBJC 3AZMB 3AZMC 3WKJB 3WKJC 4ZUXA 3NQUA 1P3AC 3B0CW 4H9SC 3VH6W 5GXQD 4ZUXD 3AZHD 1F66B 3AZJB 3AZJC 3LELD 1P3ID 3WA9A 1Q9CA 4YS3D 4KGCB 3WA9D 5B24D 4WU8A 4M6BA 4WU9D 2PYOA 1ZLAD 5B31C 5B32A 1KX5A 3C1BB 1BH8A 2HUEB 2HUEC 3V9RA 5KDMA 3C1BC 5JRGA 5E5AB 5E5AC 5B0YB 4H9NA 5B0YC 5JRGD 1JFIB 5B1MA 3MVDA 5DNNB 5DNNC 2F8ND 1HQ3B 5DNMD 5B1MD 3W98C 1AOID 1B67A 3AZGA 2F8NH 1P3MA 3B0BA 3WAAD 2YFVA 3LJAA 4Z66A 2IO5B 2IO5C 5CPJB 5CPJC 3WTPE 1KX3C 3LJAD 5BNVA 1P3GD 1P3LD 1M19C 5B31G 3UT9B 4R8PA 3UT9C 1M18D 1P3FD 5CP6A 1TZYC 5AV9A 2HIOD 3AZKC 4J8WA 5CPIB 4YM6B 5CPIC 4YM6C 5AV6D 5BS7A 4CSRA 3REHA 5CPKC 3AZFD 4HGAB 3A6NA 4HGAC 3B6GD 4Z2MH 2AROA 5GT3A 2CWEA 5AV8C 5B0ZA 2AROD 4KUDA 4Z5TA 3UTBB 3W96A 3UTBC 5AY8D 3TU4D 1P3PA 3AV1D 3V9RB 2NQBA 4Z5TD 5GT0B 5GT0C 2RVQC 2NZDA 3AYWA 5B33A 4XZQD 3WTPB 3MNNA 3WTPC 3RELC 3AN2A 3W99A 3B0DB 1A7WA 3B0DC 3AZIA 3AV2B 3AV2C 3AFAA 2FJ7B 2FJ7C 3AN2D 1M1AA 1P34C 3W99D 2BYMB 3AZID 3W97B 3W97C 4H9QA 5CHLB 5AV5B 5AV5C 3MGSA 1H3OB 2BYKB 3X1VD 1P3BB 1P3BC 3X1TC 3WKJD 5B40A 3X1UA 5B2IA 3C1CA 1P3AD 3KWQB 4JJNC 3KWQC 4J8VA 3MGQA 1S32B 3LZ1A 1S32C 3X1UD 4H9PB 4J8VD 3MGQD 4R8PB 1BH9A 5CP6B 3MGRB 3MGRC 4J8XA 2LY8A 5B2JD 5BO0B 4WNNA 4CSRB 5B31D 3UTAA 3LZ0B 4XUJB 3LZ0C 4XUJC 1EQZA 4AWLB 5F99B 4AWLC 5F99C 5B0YD 4H9RA 3REKA 4Z2MG 3MGPB 3AZNA 3MGPC 4KUDB 4KUDC 3REKD 1KX4D 3W96C 3W96B 5GXQA 5GSUB 1P3PB 5FUGB 5GSUC 3AZND 3AZHA 1P3PC 2NQBC 2NQBB 3W98D 3LELA 1P3IA 2NZDB 5AVBA 1F66C
chains in the Genus database with same CATH superfamily
1ID3D 3KXBB 4YS3A 3KXBC 3AZEB 4DQYB 5AVBD 3AZEC 3B6FA 1PZRA 5B24A 5BT1D 1M1AB 4KGCC 4WU9A 3B6FD 2YFWB 1ZLAA 3AZLB 3AZLC 5CPJD 1KX3D 2Y2JA 1KU5A 1WWIA 5AVCB 5AVCC 1M19D 3O62B 3O62C 3UT9D 1N1JB 4QLCB 4QLCC 1TZYD 5G49A 2F8NA 3C1CB 5DNMA 3AZKD 4X23B 3LZ1B 4X23C 1AOIA 4H9OA 5CPID 4YM6D 3REIB 3REIC 1HQ3C 3X1SB 5CPKD 3X1SC 2L5AA 2F8NK 3KUYA 3WAAA 5JA4A 5AV8D 3KUYD 3UTBD 3A1IA 2Y2OA 1P3GA 1P3LA 3UTAB 1P3KA 5B1LB 5B1LC 5GT0D 2RVQD 1W2EA 4KHAA 1M18A 4CAYA 1P3KD 3WTPD 1P3FA 3RELD 2Y2IA 2FJ7D 2HIOA 4ZUXB 4ZUXC 5AV6A 3NQUB 1P34D 4J8UA 3VH5T 1U35A 3W97D 2JE5A 3AZFA 4J8UD 1U35D 3B6GA 3WA9B 3WA9C 5B24B 2JCHA 1P3BD 3X1TD 4E45A 1ZLAB 5AY8A 3TU4A 3EPKA 4WU8B 3AV1A 4WU8C 4JJND 3KWQD 2PYOB 2PYOC 2Y2NA 1S32D 5B32B 1KX5B 5B32C 1KX5C 1BH8B 4XZQA 5KDMB 3REJA 1P3OD 5JRGB 2CV5D 5JRGC 4H9NB 3REJD 2F8NB 3MGRD 5DNMB 5B1MB 3MVDB 5B1MC 3MVDC 2Y2LA 3R45A 1HTAA 3AZGB 3AZGC 2FFFB 3LZ0D 4UPKA 3X1VA 1P3MB 5JA4B 1P3MC 3VH5A 3AZMA 3WKJA 4LD9D 1P3AA 2YFVB 3LJAB 3AZMD 4Z66B 4H9SA 4Z66C 3LJAC 3KSYA 5BNXA 1P3LB 3EG5B 3AZJA 1R4VA 5BNVB 1M18B 1M18C 1F66D 3AZJD 3KXBD 5B32G 4R8PC 3AZED 2HIOB 2HIOC 5CP6C 5AV9B 5AV9C 5B2JA 4KGCD 4J8WB 5B31A 4J8WC 3AZLD 3F6TA 2G5HC 5BS7C 3NQJA 5E5AA 3REHB 3REHC 5B0YA 3C1BD 3A6NB 3A6NC 3AL0C 1WWSA 3O62D 2AROB 5E5AD 2AROC 5GT3C 5GT3B 4WZSB 1KX4A 5B0ZB 4QLCD 5B0ZC 1JFIA 5AY8B 3AV1B 3AV1C 4Z5TB 1F1EA 4Z5TC 3W98A 5DNND 4XZQB 3REID 1ID3A 1HQ3D 3X1SD 2NZDC 3AYWB 3AYWC 5B33B 3MNNB 3MNNC 5B33C 4G92B 2ZY4A 4G92C 3AN2B 3AN2C 3W99B 3W99C 3AZIB 3AZIC 3AFAB 3AFAC 2Y2QA 5CPJA 1M1AC 1KX3A 4H9QB 1B6WA 1M19A 3B0CT 4ZBJB 3VH6T 3UT9A 3MGSB 3IP4C 3MGSC 1TZYA 1P3AB 5B40B 5B40C 3AZKA 5BNXB 3X1UB 3X1UC 5B2IB 4YM6A 5B2IC 5CPIA 3C1CC 1ULYA 4J8VB 1TAFA 3MGQB 3MGQC 4J8VC 3LZ1C 5CPKA 1T3UA 4DRBA 5AV8A 1BH9B 4EO5B 4EO5C 5B2JB 5B2JC 3UTBA 4J8XB 4NFTA 5B31B 4J8XC 4WU8D 4NE6A 4WNNB 2BG1A 3NQJB 2PYOD 5GT0A 5B32D 1KX5D 3UTAC 3WTPA 4NE3A 3RELA 1EQZB 1EQZC 4H9RB 3REKB 1KX4B 3REKC 3AV2A 1KX4C 2FJ7A 3AZNB 3AZNC 1P34A 3VH6A 2BYMA 3MVDD 5C3IB 3W97A 4UUZA 5C3IC 2Y2KA 3AV2D 5GXQB 3W98B 5GXQC 3AZHB 3AZHC 4WJ3C 1ID3B 1ID3C 2Y2HA 3LELB 1P3IB 5AV5A 3LELC 1P3IC 3AZGD 5AVBB 5AVBC 2W8SA 2Y2MA 5BT1C 1H3OA 2BYKA 4YS3C 4YS3B 5AV5D 3X1TA 1P3BA 1P3MD 3VH5W 3B6FB 3B6FC 1BFMA 5B24C 1KX3B 4JJNA 3KWQA 4Z66D 4WU9B 4WU9C 1S32A 1ZLAC 1M19B 4NE5A 1P3OA 4H9PA 2CV5A 1TZYB 3MGRA 4R8PD 3AZKB 5CP6D 5G49B 5AV9D 4E44A 5BO0A 5DNMC 1TAFB 1AOIB 5CPKB 4J8WD 1AOIC 4H9OB 3LZ0A 4XUJA 5F99A 3REHD 5AV8B 2JSSA 3KUYB 4LD9A 3KUYC 3A6ND 4XUJD 3WAAB 3WAAC 5F99D 5GT3D 3MGPA 5B0ZD 5GSUA 5FUGA 3MGPD 4KUDD 3W96D 1P3GB 1P3GC 1P3LC 1P3PD 5GSUD 1P3KB 1F66A 1P3KC 2NQBD 3RELB 3KXBA 2NZDD 4KHAB 3AZEA 3AYWD 4CAYB 5B33D 3MNND 4DRAA 1P3FB 1P3FC 1P34B 4KGCA 4UUZB 3AFAD 2YFWA 3AZLA 5AV6B 1M1AD 5AV6C 4J8UB 4J8UC 1U35B 1U35C 2XD5A 5AVCA 2F8NG 2RIQA 3C1BA 3AZFB 3AZFC 3B6GB 3O62A 3B6GC 3X1TB 5AVCD 1N1JA 4QLCA 3MGSD 4JJNB 5B40D 5DNNA 4X23A 3TU4B 5AY8C 3TU4C 5B2ID 3C1CD 1P3OB 3REIA 1P3OC 1HQ3A 2CV5B 2CV5C 3X1SA 4X23D 3LZ1D 4XZQC 3REJB 3REJC 2ZY5A 3H0LC 4G91B 4G91C 4J8XD 3R45B 5B1LA 3A1KA 4WV4B 3UTAD 4LD9B 3EPJA 4LD9C 5B1LD 3X1VB 1EQZD 3X1VC 4ZBJC 3AZMB 3AZMC 3WKJB 3WKJC 4ZUXA 3NQUA 1P3AC 3B0CW 4H9SC 3VH6W 5GXQD 4ZUXD 3AZHD 1F66B 3AZJB 3AZJC 3LELD 1P3ID 3WA9A 1Q9CA 4YS3D 4KGCB 3WA9D 5B24D 4WU8A 4M6BA 4WU9D 2PYOA 1ZLAD 5B31C 2Y2PA 5B32A 1KX5A 3C1BB 1BH8A 2HUEB 2HUEC 3V9RA 5KDMA 3C1BC 5JRGA 5E5AB 5E5AC 5B0YB 4H9NA 5B0YC 5JRGD 1JFIB 5B1MA 3MVDA 5DNNB 5DNNC 2F8ND 1HQ3B 5DNMD 5B1MD 3W98C 1AOID 1B67A 3AZGA 2F8NH 3P5JB 1Z2CB 1P3MA 2G5IC 3B0BA 3WAAD 2YFVA 3LJAA 4Z66A 2IO5B 2IO5C 5CPJB 5CPJC 3WTPE 1KX3C 3LJAD 2Y2GA 5BNVA 1P3GD 1P3LD 1M19C 2J8PA 5B31G 3UT9B 4R8PA 3UT9C 1M18D 1P3FD 5CP6A 1TZYC 5AV9A 2HIOD 3AZKC 4J8WA 5CPIB 4YM6B 5CPIC 4YM6C 5AV6D 5BS7A 4CSRA 3REHA 5CPKC 3AZFD 4HGAB 3A6NA 4HGAC 3EPHA 3B6GD 4Z2MH 2AROA 5GT3A 2CWEA 5AV8C 5B0ZA 3H0RC 2AROD 4KUDA 4Z5TA 3UTBB 3W96A 3UTBC 5AY8D 3TU4D 1P3PA 3AV1D 3KFUG 3V9RB 2NQBA 4Z5TD 5GT0B 5GT0C 2RVQC 2NZDA 3AYWA 5B33A 4XZQD 3WTPB 3MNNA 3WTPC 3RELC 3AN2A 2DQNC 3W99A 3B0DB 1A7WA 3B0DC 3AZIA 3AV2B 3AV2C 3AFAA 2FJ7B 2FJ7C 3AN2D 1M1AA 1P34C 3W99D 2BYMB 2XD1A 3AZID 3W97B 3W97C 2DF4C 4H9QA 3H0MC 5CHLB 2ZY3A 5AV5B 5AV5C 3MGSA 2VQRA 1H3OB 2BYKB 3X1VD 1P3BB 1P3BC 3X1TC 3WKJD 5B40A 3X1UA 3FDDA 5B2IA 3C1CA 1P3AD 3KWQB 4JJNC 3KWQC 4J8VA 3MGQA 1S32B 3LZ1A 1S32C 3X1UD 4H9PB 2ZY2A 2ZM5A 4J8VD 3MGQD 4R8PB 2F2AC 1BH9A 5CP6B 3MGRB 3EPLA 3MGRC 4J8XA 5B2JD 2LY8A 5BO0B 4WNNA 4CSRB 5B31D 3UTAA 3LZ0B 4XUJB 3LZ0C 4XUJC 1EQZA 4AWLB 5F99B 4AWLC 5F99C 5B0YD 4H9RA 3REKA 2UWXA 4Z2MG 3MGPB 3AZNA 3MGPC 4KUDB 4KUDC 3REKD 1KX4D 3W96C 3W96B 5GXQA 5GSUB 1P3PB 5FUGB 5GSUC 3AZND 3AZHA 1P3PC 2NQBC 2NQBB 3W98D 3LELA 1P3IA 2NZDB 5AVBA 1F66C
chains in the Genus database with same CATH topology
1ID3D 3KXBB 4YS3A 3KXBC 3AZEB 4DQYB 5AVBD 3AZEC 3B6FA 1PZRA 5B24A 5BT1D 1M1AB 4KGCC 4WU9A 3B6FD 2YFWB 1ZLAA 3AZLB 3AZLC 5CPJD 1KX3D 2Y2JA 1KU5A 1WWIA 5AVCB 5AVCC 1M19D 3O62B 3O62C 3UT9D 1N1JB 4QLCB 4QLCC 1TZYD 5G49A 2F8NA 3C1CB 5DNMA 3AZKD 4X23B 3LZ1B 4X23C 1AOIA 4H9OA 5CPID 4YM6D 3REIB 3REIC 1HQ3C 3X1SB 5CPKD 3X1SC 2L5AA 2F8NK 3KUYA 3WAAA 5JA4A 5AV8D 3KUYD 3UTBD 3A1IA 2Y2OA 1P3GA 1P3LA 3UTAB 1P3KA 5B1LB 5B1LC 5GT0D 2RVQD 1W2EA 4KHAA 1M18A 4CAYA 1P3KD 3WTPD 1P3FA 3RELD 2Y2IA 2FJ7D 2HIOA 4ZUXB 4ZUXC 5AV6A 3NQUB 1P34D 4J8UA 3VH5T 1U35A 3W97D 2JE5A 3AZFA 4J8UD 1U35D 3B6GA 3WA9B 3WA9C 5B24B 2JCHA 1P3BD 3X1TD 4E45A 1ZLAB 5AY8A 3TU4A 3EPKA 4WU8B 3AV1A 4WU8C 4JJND 3KWQD 2PYOB 2PYOC 2Y2NA 1S32D 5B32B 1KX5B 5B32C 1KX5C 1BH8B 4XZQA 5KDMB 3REJA 1P3OD 5JRGB 2CV5D 5JRGC 4H9NB 3REJD 2F8NB 3MGRD 5DNMB 5B1MB 3MVDB 5B1MC 3MVDC 2Y2LA 3R45A 1HTAA 3AZGB 3AZGC 2FFFB 3LZ0D 4UPKA 3X1VA 1P3MB 5JA4B 1P3MC 3VH5A 3AZMA 3WKJA 4LD9D 1P3AA 2YFVB 3LJAB 3AZMD 4Z66B 4H9SA 4Z66C 3LJAC 3KSYA 5BNXA 1P3LB 3EG5B 3AZJA 1R4VA 5BNVB 1M18B 1M18C 1F66D 3AZJD 3KXBD 5B32G 4R8PC 3AZED 2HIOB 2HIOC 5CP6C 5AV9B 5AV9C 5B2JA 4KGCD 4J8WB 5B31A 4J8WC 3AZLD 3F6TA 2G5HC 5BS7C 3NQJA 5E5AA 3REHB 3REHC 5B0YA 3C1BD 3A6NB 3A6NC 3AL0C 1WWSA 3O62D 2AROB 5E5AD 2AROC 5GT3C 5GT3B 4WZSB 1KX4A 5B0ZB 4QLCD 5B0ZC 1JFIA 5AY8B 3AV1B 3AV1C 4Z5TB 1F1EA 4Z5TC 3W98A 5DNND 4XZQB 3REID 1ID3A 1HQ3D 3X1SD 2NZDC 3AYWB 3AYWC 5B33B 3MNNB 3MNNC 5B33C 4G92B 2ZY4A 4G92C 3AN2B 3AN2C 3W99B 3W99C 3AZIB 3AZIC 3AFAB 3AFAC 2Y2QA 5CPJA 1M1AC 1KX3A 4H9QB 1B6WA 1M19A 3B0CT 4ZBJB 3VH6T 3UT9A 3MGSB 3IP4C 3MGSC 1TZYA 1P3AB 5B40B 5B40C 3AZKA 5BNXB 3X1UB 3X1UC 5B2IB 4YM6A 5B2IC 5CPIA 3C1CC 1ULYA 4J8VB 1TAFA 3MGQB 3MGQC 4J8VC 3LZ1C 5CPKA 1T3UA 4DRBA 5AV8A 1BH9B 4EO5B 4EO5C 5B2JB 5B2JC 3UTBA 4J8XB 4NFTA 5B31B 4J8XC 4WU8D 4NE6A 4WNNB 2BG1A 3NQJB 2PYOD 5GT0A 5B32D 1KX5D 3UTAC 3WTPA 4NE3A 3RELA 1EQZB 1EQZC 4H9RB 3REKB 1KX4B 3REKC 3AV2A 1KX4C 2FJ7A 3AZNB 3AZNC 1P34A 3VH6A 2BYMA 3MVDD 5C3IB 3W97A 4UUZA 5C3IC 2Y2KA 3AV2D 5GXQB 3W98B 5GXQC 3AZHB 3AZHC 4WJ3C 1ID3B 1ID3C 2Y2HA 3LELB 1P3IB 5AV5A 3LELC 1P3IC 3AZGD 5AVBB 5AVBC 2W8SA 2Y2MA 5BT1C 1H3OA 2BYKA 4YS3C 4YS3B 5AV5D 3X1TA 1P3BA 1P3MD 3VH5W 3B6FB 3B6FC 1BFMA 5B24C 1KX3B 4JJNA 3KWQA 4Z66D 4WU9B 4WU9C 1S32A 1ZLAC 1M19B 4NE5A 1P3OA 4H9PA 2CV5A 1TZYB 3MGRA 4R8PD 3AZKB 5CP6D 5G49B 5AV9D 4E44A 5BO0A 5DNMC 1TAFB 1AOIB 5CPKB 4J8WD 1AOIC 4H9OB 3LZ0A 4XUJA 5F99A 3REHD 5AV8B 2JSSA 3KUYB 4LD9A 3KUYC 3A6ND 4XUJD 3WAAB 3WAAC 5F99D 5GT3D 3MGPA 5B0ZD 5GSUA 5FUGA 3MGPD 4KUDD 3W96D 1P3GB 1P3GC 1P3LC 1P3PD 5GSUD 1P3KB 1F66A 1P3KC 2NQBD 3RELB 3KXBA 2NZDD 4KHAB 3AZEA 3AYWD 4CAYB 5B33D 3MNND 4DRAA 1P3FB 1P3FC 1P34B 4KGCA 4UUZB 3AFAD 2YFWA 3AZLA 5AV6B 1M1AD 5AV6C 4J8UB 4J8UC 1U35B 1U35C 2XD5A 5AVCA 2F8NG 2RIQA 3C1BA 3AZFB 3AZFC 3B6GB 3O62A 3B6GC 3X1TB 5AVCD 1N1JA 4QLCA 3MGSD 4JJNB 5B40D 5DNNA 4X23A 3TU4B 5AY8C 3TU4C 5B2ID 3C1CD 1P3OB 3REIA 1P3OC 1HQ3A 2CV5B 2CV5C 3X1SA 4X23D 3LZ1D 4XZQC 3REJB 3REJC 2ZY5A 3H0LC 4G91B 4G91C 4J8XD 3R45B 5B1LA 3A1KA 4WV4B 3UTAD 4LD9B 3EPJA 4LD9C 5B1LD 3X1VB 1EQZD 3X1VC 4ZBJC 3AZMB 3AZMC 3WKJB 3WKJC 4ZUXA 3NQUA 1P3AC 3B0CW 4H9SC 3VH6W 5GXQD 4ZUXD 3AZHD 1F66B 3AZJB 3AZJC 3LELD 1P3ID 3WA9A 1Q9CA 4YS3D 4KGCB 3WA9D 5B24D 4WU8A 4M6BA 4WU9D 2PYOA 1ZLAD 5B31C 2Y2PA 5B32A 1KX5A 3C1BB 1BH8A 2HUEB 2HUEC 3V9RA 5KDMA 3C1BC 5JRGA 5E5AB 5E5AC 5B0YB 4H9NA 5B0YC 5JRGD 1JFIB 5B1MA 3MVDA 5DNNB 5DNNC 2F8ND 1HQ3B 5DNMD 5B1MD 3W98C 1AOID 1B67A 3AZGA 2F8NH 3P5JB 1Z2CB 1P3MA 2G5IC 3B0BA 3WAAD 2YFVA 3LJAA 4Z66A 2IO5B 2IO5C 5CPJB 5CPJC 3WTPE 1KX3C 3LJAD 2Y2GA 5BNVA 1P3GD 1P3LD 1M19C 2J8PA 5B31G 3UT9B 4R8PA 3UT9C 1M18D 1P3FD 5CP6A 1TZYC 5AV9A 2HIOD 3AZKC 4J8WA 5CPIB 4YM6B 5CPIC 4YM6C 5AV6D 5BS7A 4CSRA 3REHA 5CPKC 3AZFD 4HGAB 3A6NA 4HGAC 3EPHA 3B6GD 4Z2MH 2AROA 5GT3A 2CWEA 5AV8C 5B0ZA 3H0RC 2AROD 4KUDA 4Z5TA 3UTBB 3W96A 3UTBC 5AY8D 3TU4D 1P3PA 3AV1D 3KFUG 3V9RB 2NQBA 4Z5TD 5GT0B 5GT0C 2RVQC 2NZDA 3AYWA 5B33A 4XZQD 3WTPB 3MNNA 3WTPC 3RELC 3AN2A 2DQNC 3W99A 3B0DB 1A7WA 3B0DC 3AZIA 3AV2B 3AV2C 3AFAA 2FJ7B 2FJ7C 3AN2D 1M1AA 1P34C 3W99D 2BYMB 2XD1A 3AZID 3W97B 3W97C 2DF4C 4H9QA 3H0MC 5CHLB 2ZY3A 5AV5B 5AV5C 3MGSA 2VQRA 1H3OB 2BYKB 3X1VD 1P3BB 1P3BC 3X1TC 3WKJD 5B40A 3X1UA 3FDDA 5B2IA 3C1CA 1P3AD 3KWQB 4JJNC 3KWQC 4J8VA 3MGQA 1S32B 3LZ1A 1S32C 3X1UD 4H9PB 2ZY2A 2ZM5A 4J8VD 3MGQD 4R8PB 2F2AC 1BH9A 5CP6B 3MGRB 3EPLA 3MGRC 4J8XA 5B2JD 2LY8A 5BO0B 4WNNA 4CSRB 5B31D 3UTAA 3LZ0B 4XUJB 3LZ0C 4XUJC 1EQZA 4AWLB 5F99B 4AWLC 5F99C 5B0YD 4H9RA 3REKA 2UWXA 4Z2MG 3MGPB 3AZNA 3MGPC 4KUDB 4KUDC 3REKD 1KX4D 3W96C 3W96B 5GXQA 5GSUB 1P3PB 5FUGB 5GSUC 3AZND 3AZHA 1P3PC 2NQBC 2NQBB 3W98D 3LELA 1P3IA 2NZDB 5AVBA 1F66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 D;  3KXB B;  4YS3 A;  3KXB C;  3AZE B;  3AZE C;  5AVB D;  3B6F A;  5B24 A;  5BT1 D;  1M1A B;  4KGC C;  4WU9 A;  3B6F D;  2YFW B;  1ZLA A;  3AZL B;  3AZL C;  5CPJ D;  1KX3 D;  1KU5 A;  1WWI A;  5AVC C;  5AVC B;  1M19 D;  3O62 B;  3O62 C;  3UT9 D;  1N1J B;  4QLC B;  4QLC C;  1TZY D;  5G49 A;  2F8N A;  3C1C B;  5DNM A;  3AZK D;  4X23 B;  3LZ1 B;  4X23 C;  1AOI A;  4H9O A;  5CPI D;  4YM6 D;  3REI B;  3REI C;  1HQ3 C;  3X1S B;  5CPK D;  3X1S C;  2L5A A;  2F8N K;  3KUY A;  3WAA A;  5JA4 A;  5AV8 D;  3KUY D;  3UTB D;  1P3G A;  1P3L A;  3UTA B;  1P3K A;  5B1L B;  5B1L C;  5GT0 D;  2RVQ D;  4KHA A;  1M18 A;  4CAY A;  1P3K D;  3WTP D;  1P3F A;  3REL D;  2FJ7 D;  2HIO A;  4ZUX B;  4ZUX C;  5AV6 A;  3NQU B;  1P34 D;  4J8U A;  3VH5 T;  1U35 A;  3W97 D;  3AZF A;  4J8U D;  1U35 D;  3B6G A;  3WA9 B;  3WA9 C;  5B24 B;  1P3B D;  3X1T D;  4E45 A;  1ZLA B;  5AY8 A;  3TU4 A;  4WU8 B;  3AV1 A;  4WU8 C;  4JJN D;  3KWQ D;  2PYO B;  2PYO C;  1S32 D;  5B32 B;  1KX5 B;  5B32 C;  1KX5 C;  1BH8 B;  4XZQ A;  5KDM B;  3REJ A;  1P3O D;  5JRG B;  2CV5 D;  5JRG C;  4H9N B;  3REJ D;  2F8N B;  3MGR D;  5DNM B;  5B1M B;  3MVD B;  5B1M C;  3MVD C;  3R45 A;  1HTA A;  3AZG B;  3AZG C;  3LZ0 D;  3X1V A;  1P3M B;  5JA4 B;  1P3M C;  3VH5 A;  3AZM A;  3WKJ A;  4LD9 D;  1P3A A;  2YFV B;  3LJA B;  3AZM D;  4Z66 B;  4H9S A;  4Z66 C;  3LJA C;  3KSY A;  5BNX A;  1P3L B;  3AZJ A;  1R4V A;  5BNV B;  1M18 B;  1M18 C;  1F66 D;  3AZJ D;  3KXB D;  5B32 G;  4R8P C;  3AZE D;  2HIO B;  2HIO C;  5CP6 C;  5AV9 B;  5AV9 C;  5B2J A;  4KGC D;  4J8W B;  5B31 A;  4J8W C;  3AZL D;  5BS7 C;  3NQJ A;  5E5A A;  3REH B;  3REH C;  5B0Y A;  3C1B D;  3A6N B;  3A6N C;  1WWS A;  3O62 D;  2ARO B;  5E5A D;  2ARO C;  5GT3 C;  5GT3 B;  4WZS B;  1KX4 A;  5B0Z B;  4QLC D;  5B0Z C;  1JFI A;  5AY8 B;  3AV1 B;  3AV1 C;  4Z5T B;  1F1E A;  4Z5T C;  3W98 A;  5DNN D;  4XZQ B;  3REI D;  1ID3 A;  1HQ3 D;  3X1S D;  2NZD C;  3AYW B;  3AYW C;  5B33 B;  3MNN B;  3MNN C;  5B33 C;  4G92 B;  4G92 C;  3AN2 B;  3AN2 C;  3W99 B;  3W99 C;  3AZI B;  3AZI C;  3AFA B;  3AFA C;  5CPJ A;  1M1A C;  1KX3 A;  4H9Q B;  1B6W A;  1M19 A;  3B0C T;  4ZBJ B;  3VH6 T;  3UT9 A;  3MGS B;  3MGS C;  1TZY A;  1P3A B;  5B40 B;  5B40 C;  3AZK A;  5BNX B;  3X1U B;  3X1U C;  5B2I B;  4YM6 A;  5B2I C;  5CPI A;  3C1C C;  1ULY A;  4J8V B;  1TAF A;  3MGQ B;  3MGQ C;  4J8V C;  3LZ1 C;  5CPK A;  4DRB A;  5AV8 A;  1BH9 B;  4EO5 B;  4EO5 C;  5B2J B;  5B2J C;  3UTB A;  4J8X B;  4NFT A;  5B31 B;  4J8X C;  4WU8 D;  4NE6 A;  4WNN B;  3NQJ B;  2PYO D;  5GT0 A;  5B32 D;  1KX5 D;  3UTA C;  3WTP A;  4NE3 A;  3REL A;  1EQZ B;  1EQZ C;  4H9R B;  3REK B;  1KX4 B;  3REK C;  3AV2 A;  1KX4 C;  2FJ7 A;  3AZN B;  3AZN C;  1P34 A;  3VH6 A;  2BYM A;  3MVD D;  5C3I B;  3W97 A;  4UUZ A;  5C3I C;  3AV2 D;  3W98 B;  5GXQ B;  5GXQ C;  3AZH B;  3AZH C;  1ID3 B;  1ID3 C;  3LEL B;  1P3I B;  5AV5 A;  3LEL C;  1P3I C;  3AZG D;  5AVB B;  5AVB C;  4YS3 B;  5BT1 C;  1H3O A;  2BYK A;  4YS3 C;  1P3B A;  5AV5 D;  3X1T A;  1P3M D;  3VH5 W;  3B6F B;  3B6F C;  1BFM A;  5B24 C;  1KX3 B;  4JJN A;  3KWQ A;  4Z66 D;  4WU9 B;  4WU9 C;  1S32 A;  1ZLA C;  1M19 B;  4NE5 A;  1P3O A;  4H9P A;  2CV5 A;  1TZY B;  3MGR A;  4R8P D;  3AZK B;  5CP6 D;  5G49 B;  5AV9 D;  4E44 A;  5BO0 A;  5DNM C;  1TAF B;  1AOI B;  5CPK B;  4J8W D;  1AOI C;  4H9O B;  3LZ0 A;  4XUJ A;  5F99 A;  3REH D;  5AV8 B;  2JSS A;  3KUY B;  4LD9 A;  3KUY C;  3A6N D;  4XUJ D;  3WAA B;  3WAA C;  5F99 D;  5GT3 D;  3MGP A;  5B0Z D;  5GSU A;  5FUG A;  3MGP D;  4KUD D;  3W96 D;  1P3G B;  1P3G C;  1P3L C;  1P3P D;  5GSU D;  1P3K B;  1F66 A;  1P3K C;  2NQB D;  3REL B;  3KXB A;  2NZD D;  4KHA B;  3AZE A;  3AYW D;  4CAY B;  5B33 D;  3MNN D;  4DRA A;  1P3F B;  1P3F C;  1P34 B;  4KGC A;  4UUZ B;  3AFA D;  2YFW A;  3AZL A;  5AV6 B;  1M1A D;  5AV6 C;  4J8U B;  4J8U C;  1U35 B;  1U35 C;  5AVC A;  2F8N G;  3C1B A;  3AZF B;  3AZF C;  3B6G B;  3O62 A;  3B6G C;  3X1T B;  5AVC D;  1N1J A;  4QLC A;  3MGS D;  4JJN B;  5B40 D;  5DNN A;  4X23 A;  3TU4 B;  5AY8 C;  3TU4 C;  5B2I D;  3C1C D;  1P3O B;  3REI A;  1P3O C;  1HQ3 A;  2CV5 B;  2CV5 C;  3X1S A;  4X23 D;  3LZ1 D;  4XZQ C;  3REJ B;  3REJ C;  4G91 B;  4G91 C;  4J8X D;  3R45 B;  5B1L A;  4WV4 B;  3UTA D;  4LD9 B;  4LD9 C;  5B1L D;  3X1V B;  1EQZ D;  3X1V C;  4ZBJ C;  3AZM B;  3AZM C;  3WKJ B;  3WKJ C;  4ZUX A;  3NQU A;  1P3A C;  3B0C W;  4H9S C;  3VH6 W;  5GXQ D;  4ZUX D;  3AZH D;  1F66 B;  3AZJ B;  3AZJ C;  3LEL D;  1P3I D;  3WA9 A;  1Q9C A;  4YS3 D;  4KGC B;  3WA9 D;  5B24 D;  4WU8 A;  4M6B A;  4WU9 D;  2PYO A;  1ZLA D;  5B31 C;  5B32 A;  1KX5 A;  3C1B B;  1BH8 A;  2HUE B;  2HUE C;  3V9R A;  5KDM A;  3C1B C;  5JRG A;  5E5A B;  5E5A C;  5B0Y B;  4H9N A;  5B0Y C;  5JRG D;  1JFI B;  5B1M A;  3MVD A;  5DNN B;  5DNN C;  2F8N D;  1HQ3 B;  5DNM D;  5B1M D;  3W98 C;  1AOI D;  1B67 A;  3AZG A;  2F8N H;  1P3M A;  3B0B A;  3WAA D;  2YFV A;  3LJA A;  4Z66 A;  2IO5 B;  2IO5 C;  5CPJ B;  5CPJ C;  3WTP E;  1KX3 C;  3LJA D;  5BNV A;  1P3G D;  1P3L D;  1M19 C;  5B31 G;  3UT9 B;  4R8P A;  3UT9 C;  1M18 D;  1P3F D;  5CP6 A;  1TZY C;  5AV9 A;  2HIO D;  3AZK C;  4J8W A;  5CPI B;  4YM6 B;  5CPI C;  4YM6 C;  5AV6 D;  5BS7 A;  4CSR A;  3REH A;  5CPK C;  3AZF D;  4HGA B;  3A6N A;  4HGA C;  3B6G D;  4Z2M H;  2ARO A;  5GT3 A;  2CWE A;  5AV8 C;  5B0Z A;  2ARO D;  4KUD A;  4Z5T A;  3UTB B;  3W96 A;  3UTB C;  5AY8 D;  3TU4 D;  1P3P A;  3AV1 D;  3V9R B;  2NQB A;  4Z5T D;  5GT0 B;  5GT0 C;  2RVQ C;  2NZD A;  3AYW A;  5B33 A;  4XZQ D;  3WTP B;  3MNN A;  3WTP C;  3REL C;  3AN2 A;  3W99 A;  3B0D B;  1A7W A;  3B0D C;  3AZI A;  3AV2 B;  3AV2 C;  3AFA A;  2FJ7 B;  2FJ7 C;  3AN2 D;  1M1A A;  1P34 C;  3W99 D;  2BYM B;  3AZI D;  3W97 B;  3W97 C;  4H9Q A;  5CHL B;  5AV5 B;  5AV5 C;  3MGS A;  1H3O B;  2BYK B;  3X1V D;  1P3B B;  1P3B C;  3X1T C;  3WKJ D;  5B40 A;  3X1U A;  5B2I A;  3C1C A;  1P3A D;  3KWQ B;  4JJN C;  3KWQ C;  4J8V A;  3MGQ A;  1S32 B;  3LZ1 A;  1S32 C;  3X1U D;  4H9P B;  4J8V D;  3MGQ D;  4R8P B;  1BH9 A;  5CP6 B;  3MGR B;  3MGR C;  4J8X A;  2LY8 A;  5B2J D;  5BO0 B;  4WNN A;  4CSR B;  5B31 D;  3UTA A;  3LZ0 B;  4XUJ B;  3LZ0 C;  4XUJ C;  1EQZ A;  4AWL B;  5F99 B;  4AWL C;  5F99 C;  5B0Y D;  4H9R A;  3REK A;  4Z2M G;  3MGP B;  3AZN A;  3MGP C;  4KUD B;  4KUD C;  3REK D;  1KX4 D;  3W96 C;  3W96 B;  5GXQ A;  5GSU B;  1P3P B;  5FUG B;  5GSU C;  3AZN D;  3AZH A;  1P3P C;  2NQB C;  2NQB B;  3W98 D;  3LEL A;  1P3I A;  2NZD B;  5AVB A;  1F66 C; 
#chains in the Genus database with same CATH topology
 1ID3 D;  3KXB B;  4YS3 A;  3KXB C;  3AZE B;  4DQY B;  5AVB D;  3AZE C;  3B6F A;  1PZR A;  5B24 A;  5BT1 D;  1M1A B;  4KGC C;  4WU9 A;  3B6F D;  2YFW B;  1ZLA A;  3AZL B;  3AZL C;  5CPJ D;  1KX3 D;  2Y2J A;  1KU5 A;  1WWI A;  5AVC B;  5AVC C;  1M19 D;  3O62 B;  3O62 C;  3UT9 D;  1N1J B;  4QLC B;  4QLC C;  1TZY D;  5G49 A;  2F8N A;  3C1C B;  5DNM A;  3AZK D;  4X23 B;  3LZ1 B;  4X23 C;  1AOI A;  4H9O A;  5CPI D;  4YM6 D;  3REI B;  3REI C;  1HQ3 C;  3X1S B;  5CPK D;  3X1S C;  2L5A A;  2F8N K;  3KUY A;  3WAA A;  5JA4 A;  5AV8 D;  3KUY D;  3UTB D;  3A1I A;  2Y2O A;  1P3G A;  1P3L A;  3UTA B;  1P3K A;  5B1L B;  5B1L C;  5GT0 D;  2RVQ D;  1W2E A;  4KHA A;  1M18 A;  4CAY A;  1P3K D;  3WTP D;  1P3F A;  3REL D;  2Y2I A;  2FJ7 D;  2HIO A;  4ZUX B;  4ZUX C;  5AV6 A;  3NQU B;  1P34 D;  4J8U A;  3VH5 T;  1U35 A;  3W97 D;  2JE5 A;  3AZF A;  4J8U D;  1U35 D;  3B6G A;  3WA9 B;  3WA9 C;  5B24 B;  2JCH A;  1P3B D;  3X1T D;  4E45 A;  1ZLA B;  5AY8 A;  3TU4 A;  3EPK A;  4WU8 B;  3AV1 A;  4WU8 C;  4JJN D;  3KWQ D;  2PYO B;  2PYO C;  2Y2N A;  1S32 D;  5B32 B;  1KX5 B;  5B32 C;  1KX5 C;  1BH8 B;  4XZQ A;  5KDM B;  3REJ A;  1P3O D;  5JRG B;  2CV5 D;  5JRG C;  4H9N B;  3REJ D;  2F8N B;  3MGR D;  5DNM B;  5B1M B;  3MVD B;  5B1M C;  3MVD C;  2Y2L A;  3R45 A;  1HTA A;  3AZG B;  3AZG C;  2FFF B;  3LZ0 D;  4UPK A;  3X1V A;  1P3M B;  5JA4 B;  1P3M C;  3VH5 A;  3AZM A;  3WKJ A;  4LD9 D;  1P3A A;  2YFV B;  3LJA B;  3AZM D;  4Z66 B;  4H9S A;  4Z66 C;  3LJA C;  3KSY A;  5BNX A;  1P3L B;  3EG5 B;  3AZJ A;  1R4V A;  5BNV B;  1M18 B;  1M18 C;  1F66 D;  3AZJ D;  3KXB D;  5B32 G;  4R8P C;  3AZE D;  2HIO B;  2HIO C;  5CP6 C;  5AV9 B;  5AV9 C;  5B2J A;  4KGC D;  4J8W B;  5B31 A;  4J8W C;  3AZL D;  3F6T A;  2G5H C;  5BS7 C;  3NQJ A;  5E5A A;  3REH B;  3REH C;  5B0Y A;  3C1B D;  3A6N B;  3A6N C;  3AL0 C;  1WWS A;  3O62 D;  2ARO B;  5E5A D;  2ARO C;  5GT3 C;  5GT3 B;  4WZS B;  1KX4 A;  5B0Z B;  4QLC D;  5B0Z C;  1JFI A;  5AY8 B;  3AV1 B;  3AV1 C;  4Z5T B;  1F1E A;  4Z5T C;  3W98 A;  5DNN D;  4XZQ B;  3REI D;  1ID3 A;  1HQ3 D;  3X1S D;  2NZD C;  3AYW B;  3AYW C;  5B33 B;  3MNN B;  3MNN C;  5B33 C;  4G92 B;  2ZY4 A;  4G92 C;  3AN2 B;  3AN2 C;  3W99 B;  3W99 C;  3AZI B;  3AZI C;  3AFA B;  3AFA C;  2Y2Q A;  5CPJ A;  1M1A C;  1KX3 A;  4H9Q B;  1B6W A;  1M19 A;  3B0C T;  4ZBJ B;  3VH6 T;  3UT9 A;  3MGS B;  3IP4 C;  3MGS C;  1TZY A;  1P3A B;  5B40 B;  5B40 C;  3AZK A;  5BNX B;  3X1U B;  3X1U C;  5B2I B;  4YM6 A;  5B2I C;  5CPI A;  3C1C C;  1ULY A;  4J8V B;  1TAF A;  3MGQ B;  3MGQ C;  4J8V C;  3LZ1 C;  5CPK A;  1T3U A;  4DRB A;  5AV8 A;  1BH9 B;  4EO5 B;  4EO5 C;  5B2J B;  5B2J C;  3UTB A;  4J8X B;  4NFT A;  5B31 B;  4J8X C;  4WU8 D;  4NE6 A;  4WNN B;  2BG1 A;  3NQJ B;  2PYO D;  5GT0 A;  5B32 D;  1KX5 D;  3UTA C;  3WTP A;  4NE3 A;  3REL A;  1EQZ B;  1EQZ C;  4H9R B;  3REK B;  1KX4 B;  3REK C;  3AV2 A;  1KX4 C;  2FJ7 A;  3AZN B;  3AZN C;  1P34 A;  3VH6 A;  2BYM A;  3MVD D;  5C3I B;  3W97 A;  4UUZ A;  5C3I C;  2Y2K A;  3AV2 D;  5GXQ B;  3W98 B;  5GXQ C;  3AZH B;  3AZH C;  4WJ3 C;  1ID3 B;  1ID3 C;  2Y2H A;  3LEL B;  1P3I B;  5AV5 A;  3LEL C;  1P3I C;  3AZG D;  5AVB B;  5AVB C;  2W8S A;  2Y2M A;  5BT1 C;  1H3O A;  2BYK A;  4YS3 C;  4YS3 B;  5AV5 D;  3X1T A;  1P3B A;  1P3M D;  3VH5 W;  3B6F B;  3B6F C;  1BFM A;  5B24 C;  1KX3 B;  4JJN A;  3KWQ A;  4Z66 D;  4WU9 B;  4WU9 C;  1S32 A;  1ZLA C;  1M19 B;  4NE5 A;  1P3O A;  4H9P A;  2CV5 A;  1TZY B;  3MGR A;  4R8P D;  3AZK B;  5CP6 D;  5G49 B;  5AV9 D;  4E44 A;  5BO0 A;  5DNM C;  1TAF B;  1AOI B;  5CPK B;  4J8W D;  1AOI C;  4H9O B;  3LZ0 A;  4XUJ A;  5F99 A;  3REH D;  5AV8 B;  2JSS A;  3KUY B;  4LD9 A;  3KUY C;  3A6N D;  4XUJ D;  3WAA B;  3WAA C;  5F99 D;  5GT3 D;  3MGP A;  5B0Z D;  5GSU A;  5FUG A;  3MGP D;  4KUD D;  3W96 D;  1P3G B;  1P3G C;  1P3L C;  1P3P D;  5GSU D;  1P3K B;  1F66 A;  1P3K C;  2NQB D;  3REL B;  3KXB A;  2NZD D;  4KHA B;  3AZE A;  3AYW D;  4CAY B;  5B33 D;  3MNN D;  4DRA A;  1P3F B;  1P3F C;  1P34 B;  4KGC A;  4UUZ B;  3AFA D;  2YFW A;  3AZL A;  5AV6 B;  1M1A D;  5AV6 C;  4J8U B;  4J8U C;  1U35 B;  1U35 C;  2XD5 A;  5AVC A;  2F8N G;  2RIQ A;  3C1B A;  3AZF B;  3AZF C;  3B6G B;  3O62 A;  3B6G C;  3X1T B;  5AVC D;  1N1J A;  4QLC A;  3MGS D;  4JJN B;  5B40 D;  5DNN A;  4X23 A;  3TU4 B;  5AY8 C;  3TU4 C;  5B2I D;  3C1C D;  1P3O B;  3REI A;  1P3O C;  1HQ3 A;  2CV5 B;  2CV5 C;  3X1S A;  4X23 D;  3LZ1 D;  4XZQ C;  3REJ B;  3REJ C;  2ZY5 A;  3H0L C;  4G91 B;  4G91 C;  4J8X D;  3R45 B;  5B1L A;  3A1K A;  4WV4 B;  3UTA D;  4LD9 B;  3EPJ A;  4LD9 C;  5B1L D;  3X1V B;  1EQZ D;  3X1V C;  4ZBJ C;  3AZM B;  3AZM C;  3WKJ B;  3WKJ C;  4ZUX A;  3NQU A;  1P3A C;  3B0C W;  4H9S C;  3VH6 W;  5GXQ D;  4ZUX D;  3AZH D;  1F66 B;  3AZJ B;  3AZJ C;  3LEL D;  1P3I D;  3WA9 A;  1Q9C A;  4YS3 D;  4KGC B;  3WA9 D;  5B24 D;  4WU8 A;  4M6B A;  4WU9 D;  2PYO A;  1ZLA D;  5B31 C;  2Y2P A;  5B32 A;  1KX5 A;  3C1B B;  1BH8 A;  2HUE B;  2HUE C;  3V9R A;  5KDM A;  3C1B C;  5JRG A;  5E5A B;  5E5A C;  5B0Y B;  4H9N A;  5B0Y C;  5JRG D;  1JFI B;  5B1M A;  3MVD A;  5DNN B;  5DNN C;  2F8N D;  1HQ3 B;  5DNM D;  5B1M D;  3W98 C;  1AOI D;  1B67 A;  3AZG A;  2F8N H;  3P5J B;  1Z2C B;  1P3M A;  2G5I C;  3B0B A;  3WAA D;  2YFV A;  3LJA A;  4Z66 A;  2IO5 B;  2IO5 C;  5CPJ B;  5CPJ C;  3WTP E;  1KX3 C;  3LJA D;  2Y2G A;  5BNV A;  1P3G D;  1P3L D;  1M19 C;  2J8P A;  5B31 G;  3UT9 B;  4R8P A;  3UT9 C;  1M18 D;  1P3F D;  5CP6 A;  1TZY C;  5AV9 A;  2HIO D;  3AZK C;  4J8W A;  5CPI B;  4YM6 B;  5CPI C;  4YM6 C;  5AV6 D;  5BS7 A;  4CSR A;  3REH A;  5CPK C;  3AZF D;  4HGA B;  3A6N A;  4HGA C;  3EPH A;  3B6G D;  4Z2M H;  2ARO A;  5GT3 A;  2CWE A;  5AV8 C;  5B0Z A;  3H0R C;  2ARO D;  4KUD A;  4Z5T A;  3UTB B;  3W96 A;  3UTB C;  5AY8 D;  3TU4 D;  1P3P A;  3AV1 D;  3KFU G;  3V9R B;  2NQB A;  4Z5T D;  5GT0 B;  5GT0 C;  2RVQ C;  2NZD A;  3AYW A;  5B33 A;  4XZQ D;  3WTP B;  3MNN A;  3WTP C;  3REL C;  3AN2 A;  2DQN C;  3W99 A;  3B0D B;  1A7W A;  3B0D C;  3AZI A;  3AV2 B;  3AV2 C;  3AFA A;  2FJ7 B;  2FJ7 C;  3AN2 D;  1M1A A;  1P34 C;  3W99 D;  2BYM B;  2XD1 A;  3AZI D;  3W97 B;  3W97 C;  2DF4 C;  4H9Q A;  3H0M C;  5CHL B;  2ZY3 A;  5AV5 B;  5AV5 C;  3MGS A;  2VQR A;  1H3O B;  2BYK B;  3X1V D;  1P3B B;  1P3B C;  3X1T C;  3WKJ D;  5B40 A;  3X1U A;  3FDD A;  5B2I A;  3C1C A;  1P3A D;  3KWQ B;  4JJN C;  3KWQ C;  4J8V A;  3MGQ A;  1S32 B;  3LZ1 A;  1S32 C;  3X1U D;  4H9P B;  2ZY2 A;  2ZM5 A;  4J8V D;  3MGQ D;  4R8P B;  2F2A C;  1BH9 A;  5CP6 B;  3MGR B;  3EPL A;  3MGR C;  4J8X A;  5B2J D;  2LY8 A;  5BO0 B;  4WNN A;  4CSR B;  5B31 D;  3UTA A;  3LZ0 B;  4XUJ B;  3LZ0 C;  4XUJ C;  1EQZ A;  4AWL B;  5F99 B;  4AWL C;  5F99 C;  5B0Y D;  4H9R A;  3REK A;  2UWX A;  4Z2M G;  3MGP B;  3AZN A;  3MGP C;  4KUD B;  4KUD C;  3REK D;  1KX4 D;  3W96 C;  3W96 B;  5GXQ A;  5GSU B;  1P3P B;  5FUG B;  5GSU C;  3AZN D;  3AZH A;  1P3P C;  2NQB C;  2NQB B;  3W98 D;  3LEL A;  1P3I A;  2NZD B;  5AVB A;  1F66 C; 
#chains in the Genus database with same CATH homology
 1ID3 D;  3KXB B;  4YS3 A;  3KXB C;  3AZE B;  4DQY B;  5AVB D;  3AZE C;  3B6F A;  1PZR A;  5B24 A;  5BT1 D;  1M1A B;  4KGC C;  4WU9 A;  3B6F D;  2YFW B;  1ZLA A;  3AZL B;  3AZL C;  5CPJ D;  1KX3 D;  2Y2J A;  1KU5 A;  1WWI A;  5AVC B;  5AVC C;  1M19 D;  3O62 B;  3O62 C;  3UT9 D;  1N1J B;  4QLC B;  4QLC C;  1TZY D;  5G49 A;  2F8N A;  3C1C B;  5DNM A;  3AZK D;  4X23 B;  3LZ1 B;  4X23 C;  1AOI A;  4H9O A;  5CPI D;  4YM6 D;  3REI B;  3REI C;  1HQ3 C;  3X1S B;  5CPK D;  3X1S C;  2L5A A;  2F8N K;  3KUY A;  3WAA A;  5JA4 A;  5AV8 D;  3KUY D;  3UTB D;  3A1I A;  2Y2O A;  1P3G A;  1P3L A;  3UTA B;  1P3K A;  5B1L B;  5B1L C;  5GT0 D;  2RVQ D;  1W2E A;  4KHA A;  1M18 A;  4CAY A;  1P3K D;  3WTP D;  1P3F A;  3REL D;  2Y2I A;  2FJ7 D;  2HIO A;  4ZUX B;  4ZUX C;  5AV6 A;  3NQU B;  1P34 D;  4J8U A;  3VH5 T;  1U35 A;  3W97 D;  2JE5 A;  3AZF A;  4J8U D;  1U35 D;  3B6G A;  3WA9 B;  3WA9 C;  5B24 B;  2JCH A;  1P3B D;  3X1T D;  4E45 A;  1ZLA B;  5AY8 A;  3TU4 A;  3EPK A;  4WU8 B;  3AV1 A;  4WU8 C;  4JJN D;  3KWQ D;  2PYO B;  2PYO C;  2Y2N A;  1S32 D;  5B32 B;  1KX5 B;  5B32 C;  1KX5 C;  1BH8 B;  4XZQ A;  5KDM B;  3REJ A;  1P3O D;  5JRG B;  2CV5 D;  5JRG C;  4H9N B;  3REJ D;  2F8N B;  3MGR D;  5DNM B;  5B1M B;  3MVD B;  5B1M C;  3MVD C;  2Y2L A;  3R45 A;  1HTA A;  3AZG B;  3AZG C;  2FFF B;  3LZ0 D;  4UPK A;  3X1V A;  1P3M B;  5JA4 B;  1P3M C;  3VH5 A;  3AZM A;  3WKJ A;  4LD9 D;  1P3A A;  2YFV B;  3LJA B;  3AZM D;  4Z66 B;  4H9S A;  4Z66 C;  3LJA C;  3KSY A;  5BNX A;  1P3L B;  3EG5 B;  3AZJ A;  1R4V A;  5BNV B;  1M18 B;  1M18 C;  1F66 D;  3AZJ D;  3KXB D;  5B32 G;  4R8P C;  3AZE D;  2HIO B;  2HIO C;  5CP6 C;  5AV9 B;  5AV9 C;  5B2J A;  4KGC D;  4J8W B;  5B31 A;  4J8W C;  3AZL D;  3F6T A;  2G5H C;  5BS7 C;  3NQJ A;  5E5A A;  3REH B;  3REH C;  5B0Y A;  3C1B D;  3A6N B;  3A6N C;  3AL0 C;  1WWS A;  3O62 D;  2ARO B;  5E5A D;  2ARO C;  5GT3 C;  5GT3 B;  4WZS B;  1KX4 A;  5B0Z B;  4QLC D;  5B0Z C;  1JFI A;  5AY8 B;  3AV1 B;  3AV1 C;  4Z5T B;  1F1E A;  4Z5T C;  3W98 A;  5DNN D;  4XZQ B;  3REI D;  1ID3 A;  1HQ3 D;  3X1S D;  2NZD C;  3AYW B;  3AYW C;  5B33 B;  3MNN B;  3MNN C;  5B33 C;  4G92 B;  2ZY4 A;  4G92 C;  3AN2 B;  3AN2 C;  3W99 B;  3W99 C;  3AZI B;  3AZI C;  3AFA B;  3AFA C;  2Y2Q A;  5CPJ A;  1M1A C;  1KX3 A;  4H9Q B;  1B6W A;  1M19 A;  3B0C T;  4ZBJ B;  3VH6 T;  3UT9 A;  3MGS B;  3IP4 C;  3MGS C;  1TZY A;  1P3A B;  5B40 B;  5B40 C;  3AZK A;  5BNX B;  3X1U B;  3X1U C;  5B2I B;  4YM6 A;  5B2I C;  5CPI A;  3C1C C;  1ULY A;  4J8V B;  1TAF A;  3MGQ B;  3MGQ C;  4J8V C;  3LZ1 C;  5CPK A;  1T3U A;  4DRB A;  5AV8 A;  1BH9 B;  4EO5 B;  4EO5 C;  5B2J B;  5B2J C;  3UTB A;  4J8X B;  4NFT A;  5B31 B;  4J8X C;  4WU8 D;  4NE6 A;  4WNN B;  2BG1 A;  3NQJ B;  2PYO D;  5GT0 A;  5B32 D;  1KX5 D;  3UTA C;  3WTP A;  4NE3 A;  3REL A;  1EQZ B;  1EQZ C;  4H9R B;  3REK B;  1KX4 B;  3REK C;  3AV2 A;  1KX4 C;  2FJ7 A;  3AZN B;  3AZN C;  1P34 A;  3VH6 A;  2BYM A;  3MVD D;  5C3I B;  3W97 A;  4UUZ A;  5C3I C;  2Y2K A;  3AV2 D;  5GXQ B;  3W98 B;  5GXQ C;  3AZH B;  3AZH C;  4WJ3 C;  1ID3 B;  1ID3 C;  2Y2H A;  3LEL B;  1P3I B;  5AV5 A;  3LEL C;  1P3I C;  3AZG D;  5AVB B;  5AVB C;  2W8S A;  2Y2M A;  5BT1 C;  1H3O A;  2BYK A;  4YS3 C;  4YS3 B;  5AV5 D;  3X1T A;  1P3B A;  1P3M D;  3VH5 W;  3B6F B;  3B6F C;  1BFM A;  5B24 C;  1KX3 B;  4JJN A;  3KWQ A;  4Z66 D;  4WU9 B;  4WU9 C;  1S32 A;  1ZLA C;  1M19 B;  4NE5 A;  1P3O A;  4H9P A;  2CV5 A;  1TZY B;  3MGR A;  4R8P D;  3AZK B;  5CP6 D;  5G49 B;  5AV9 D;  4E44 A;  5BO0 A;  5DNM C;  1TAF B;  1AOI B;  5CPK B;  4J8W D;  1AOI C;  4H9O B;  3LZ0 A;  4XUJ A;  5F99 A;  3REH D;  5AV8 B;  2JSS A;  3KUY B;  4LD9 A;  3KUY C;  3A6N D;  4XUJ D;  3WAA B;  3WAA C;  5F99 D;  5GT3 D;  3MGP A;  5B0Z D;  5GSU A;  5FUG A;  3MGP D;  4KUD D;  3W96 D;  1P3G B;  1P3G C;  1P3L C;  1P3P D;  5GSU D;  1P3K B;  1F66 A;  1P3K C;  2NQB D;  3REL B;  3KXB A;  2NZD D;  4KHA B;  3AZE A;  3AYW D;  4CAY B;  5B33 D;  3MNN D;  4DRA A;  1P3F B;  1P3F C;  1P34 B;  4KGC A;  4UUZ B;  3AFA D;  2YFW A;  3AZL A;  5AV6 B;  1M1A D;  5AV6 C;  4J8U B;  4J8U C;  1U35 B;  1U35 C;  2XD5 A;  5AVC A;  2F8N G;  2RIQ A;  3C1B A;  3AZF B;  3AZF C;  3B6G B;  3O62 A;  3B6G C;  3X1T B;  5AVC D;  1N1J A;  4QLC A;  3MGS D;  4JJN B;  5B40 D;  5DNN A;  4X23 A;  3TU4 B;  5AY8 C;  3TU4 C;  5B2I D;  3C1C D;  1P3O B;  3REI A;  1P3O C;  1HQ3 A;  2CV5 B;  2CV5 C;  3X1S A;  4X23 D;  3LZ1 D;  4XZQ C;  3REJ B;  3REJ C;  2ZY5 A;  3H0L C;  4G91 B;  4G91 C;  4J8X D;  3R45 B;  5B1L A;  3A1K A;  4WV4 B;  3UTA D;  4LD9 B;  3EPJ A;  4LD9 C;  5B1L D;  3X1V B;  1EQZ D;  3X1V C;  4ZBJ C;  3AZM B;  3AZM C;  3WKJ B;  3WKJ C;  4ZUX A;  3NQU A;  1P3A C;  3B0C W;  4H9S C;  3VH6 W;  5GXQ D;  4ZUX D;  3AZH D;  1F66 B;  3AZJ B;  3AZJ C;  3LEL D;  1P3I D;  3WA9 A;  1Q9C A;  4YS3 D;  4KGC B;  3WA9 D;  5B24 D;  4WU8 A;  4M6B A;  4WU9 D;  2PYO A;  1ZLA D;  5B31 C;  2Y2P A;  5B32 A;  1KX5 A;  3C1B B;  1BH8 A;  2HUE B;  2HUE C;  3V9R A;  5KDM A;  3C1B C;  5JRG A;  5E5A B;  5E5A C;  5B0Y B;  4H9N A;  5B0Y C;  5JRG D;  1JFI B;  5B1M A;  3MVD A;  5DNN B;  5DNN C;  2F8N D;  1HQ3 B;  5DNM D;  5B1M D;  3W98 C;  1AOI D;  1B67 A;  3AZG A;  2F8N H;  3P5J B;  1Z2C B;  1P3M A;  2G5I C;  3B0B A;  3WAA D;  2YFV A;  3LJA A;  4Z66 A;  2IO5 B;  2IO5 C;  5CPJ B;  5CPJ C;  3WTP E;  1KX3 C;  3LJA D;  2Y2G A;  5BNV A;  1P3G D;  1P3L D;  1M19 C;  2J8P A;  5B31 G;  3UT9 B;  4R8P A;  3UT9 C;  1M18 D;  1P3F D;  5CP6 A;  1TZY C;  5AV9 A;  2HIO D;  3AZK C;  4J8W A;  5CPI B;  4YM6 B;  5CPI C;  4YM6 C;  5AV6 D;  5BS7 A;  4CSR A;  3REH A;  5CPK C;  3AZF D;  4HGA B;  3A6N A;  4HGA C;  3EPH A;  3B6G D;  4Z2M H;  2ARO A;  5GT3 A;  2CWE A;  5AV8 C;  5B0Z A;  3H0R C;  2ARO D;  4KUD A;  4Z5T A;  3UTB B;  3W96 A;  3UTB C;  5AY8 D;  3TU4 D;  1P3P A;  3AV1 D;  3KFU G;  3V9R B;  2NQB A;  4Z5T D;  5GT0 B;  5GT0 C;  2RVQ C;  2NZD A;  3AYW A;  5B33 A;  4XZQ D;  3WTP B;  3MNN A;  3WTP C;  3REL C;  3AN2 A;  2DQN C;  3W99 A;  3B0D B;  1A7W A;  3B0D C;  3AZI A;  3AV2 B;  3AV2 C;  3AFA A;  2FJ7 B;  2FJ7 C;  3AN2 D;  1M1A A;  1P34 C;  3W99 D;  2BYM B;  2XD1 A;  3AZI D;  3W97 B;  3W97 C;  2DF4 C;  4H9Q A;  3H0M C;  5CHL B;  2ZY3 A;  5AV5 B;  5AV5 C;  3MGS A;  2VQR A;  1H3O B;  2BYK B;  3X1V D;  1P3B B;  1P3B C;  3X1T C;  3WKJ D;  5B40 A;  3X1U A;  3FDD A;  5B2I A;  3C1C A;  1P3A D;  3KWQ B;  4JJN C;  3KWQ C;  4J8V A;  3MGQ A;  1S32 B;  3LZ1 A;  1S32 C;  3X1U D;  4H9P B;  2ZY2 A;  2ZM5 A;  4J8V D;  3MGQ D;  4R8P B;  2F2A C;  1BH9 A;  5CP6 B;  3MGR B;  3EPL A;  3MGR C;  4J8X A;  5B2J D;  2LY8 A;  5BO0 B;  4WNN A;  4CSR B;  5B31 D;  3UTA A;  3LZ0 B;  4XUJ B;  3LZ0 C;  4XUJ C;  1EQZ A;  4AWL B;  5F99 B;  4AWL C;  5F99 C;  5B0Y D;  4H9R A;  3REK A;  2UWX A;  4Z2M G;  3MGP B;  3AZN A;  3MGP C;  4KUD B;  4KUD C;  3REK D;  1KX4 D;  3W96 C;  3W96 B;  5GXQ A;  5GSU B;  1P3P B;  5FUG B;  5GSU C;  3AZN D;  3AZH A;  1P3P C;  2NQB C;  2NQB B;  3W98 D;  3LEL A;  1P3I A;  2NZD B;  5AVB A;  1F66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...