3AZFA

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFQTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfA00
5BT1C 5F99A 5GT0C 5AY8A 5GT0B 3VH5T 2JSSA 5KDMA 3AV2C 3AV2B 2AROB 5AVCD 3AZHA 3AZJA 5B32G 3LELB 3MNND 3NQUA 4WU9B 3AZMD 3AZJD 5B0YC 5B33B 3WKJA 3REHD 2CV5D 3X1SD 4H9QB 1P3GA 4J8WA 2F8NG 4KUDD 5B40B 4UUZB 1P3GD 5CP6C 1Q9CA 1P3PD 5CP6B 4J8XC 4J8XB 3W96A 3WTPA 3AFAA 1TZYD 2RVQC 1HQ3C 1HQ3B 5CPIC 3AZNB 5CPIB 1WWSA 5FUGB 1S32D 1P3OD 2LY8A 3KXBA 1P3MA 3AYWC 1AOID 1KU5A 5BT1D 3TU4A 3AYWB 3UT9B 3KXBD 3B6GD 3AV2D 5AV9C 4R8PB 3AZFB 5AV9B 3V9RB 4H9RB 4JJNA 3LZ1A 5B0YD 3LZ1D 4YS3C 4YS3B 1BFMA 3AZLC 3AZLB 3RELC 5B0ZB 1TAFB 4DRAA 5CP6D 4M6BA 3WTPE 3MGSA 3AN2B 1F66A 5CPID 3REJD 4DRBA 3AZKC 5DNMD 5B2IB 3REKB 4XUJA 3AV1C 2NQBA 3AV1B 1KX4C 1N1JB 1P3FD 3A6NC 1KX4B 4HGAB 5GSUA 2NZDC 4KHAB 5GSUD 5C3IC 5C3IB 3C1CA 5B32C 5JA4A 5B32B 3LJAC 3WAAC 3RELD 3KWQA 3AZEA 4QLCC 2F8NB 5AV8A 3C1BA 5G49A 4CAYB 4J8UC 4H9PB 3C1BD 3W97D 1BH9B 3O62D 3AZKD 3X1TC 3X1TB 5AVBD 4Z2MG 3B0CW 4LD9A 2YFVA 5F99C 3A6ND 5AY8C 3W99A 5AY8B 1P3BA 5KDMB 4ZUXA 2NZDD 1P3BD 1P3KD 3AZGD 4ZUXD 3MNNB 3AZMC 3LJAD 3AZHC 3AZMB 3AZJC 2YFWB 3AZJB 2FJ7A 5B31A 3WAAD 3NQUB 2FJ7D 5B31D 3REHB 1H3OA 1KX5A 2L5AA 3X1SB 2CV5B 4QLCD 5JRGA 3MGQA 4KUDB 1KX5D 3W98A 1P3GC 4J8WC 1P3GB 4J8UD 5JRGD 1P3PB 5BNXB 2HIOA 4KGCA 4NE3A 1TZYB 3W96C 3WTPC 4Z5TD 5BNVA 3AFAC 1KX3A 3X1VA 1S32B 2BYMA 3X1VD 1AOIB 3UTBA 3KXBC 3KXBB 3MGPA 3B6GC 3B6GB 5F99D 3TU4C 5AY8D 3TU4B 1JFIA 2IO5C 3MGPD 2IO5B 2HUEC 2HUEB 4NE6A 1M18A 4WNNB 1BH8A 1ULYA 3AZHD 3AZIA 4JJNC 1M18D 3LZ1C 5B0YB 3LZ1B 1ID3A 4H9OA 3B6FA 4J8VA 3WKJD 4J8WD 4YM6A 3NQJA 3MGSC 4E44A 3UTAA 5BO0B 3MGRA 3WTPD 3AFAD 1ZLAA 3W96D 4YM6D 2PYOA 1F66C 1ZLAD 1HTAA 3REJC 3REJB 2PYOD 3MVDA 5DNMC 5DNMB 5GXQA 1P3MD 5B24A 5CPJA 3TU4D 5GXQD 2F8NH 1P3FC 1P3FB 4Z66A 4XUJC 4XUJB 5B1MA 2NQBC 5B1LA 4WZSB 4Z66D 5GSUC 5GSUB 4JJND 4WU8A 3KUYA 1P3AA 4NFTA 3RELB 5GT0A 3KUYD 3AZEC 2AROA 3MGSD 5AV8C 3C1BC 3W97C 5AV8B 3C1BB 3W97B 4H9NA 3LELA 1F66D 4WU9A 3O62C 3O62B 3AZKB 1WWIA 5B33A 4AWLC 5AVBC 5AVBB 4H9QA 4CSRA 5B40A 5GT3A 5E5AA 3A6NB 4XUJD 4LD9C 2NQBD 2YFVB 5GT3D 2NZDB 1P3KC 1P3BC 1P3BB 1P3KB 3AZGC 3WA9A 4ZUXC 3AZNA 4WV4B 5FUGA 4ZUXB 3AZGB 3LJAB 3C1CD 3WA9D 3WAAB 2FJ7C 3AYWA 2FJ7B 5B31C 3UT9A 5B31B 3KWQD 3AZED 4ZBJC 4QLCB 3LZ0A 1KX5C 1H3OB 4R8PA 3AZFA 5AV9A 1KX5B 5JRGC 5AV8D 3MGQC 5JRGB 4J8UB 3LZ0D 3W98C 1EQZA 3V9RA 4H9RA 2HIOC 4KGCC 4Z5TC 4KGCB 5AV6A 4Z5TB 1EQZD 5CPKA 1M19A 1KX3C 5AV6D 5BNVB 4YS3A 5CPKD 1M19D 3X1VC 3X1VB 3R45B 5B0ZA 2BYMB 1TAFA 1P3LA 3UTBC 5F99B 4LD9D 3MGPC 3MGPB 3B0DC 3AN2A 3B0DB 3W99D 1P3IA 1B6WA 4X23A 1P3ID 4X23D 3AZHB 1M18C 5B2JA 1M18B 1BH8B 3AZIC 1U35A 5B2JD 5B2IA 3REKA 1ID3C 2F8NK 3WKJC 3WKJB 3B6FC 3B6FB 4Z2MH 4J8WB 3MGQD 1N1JA 3W98D 2BYKA 2HIOD 4KGCD 3W96B 3WTPB 4YM6C 3AFAB 4YM6B 3UTAC 3UTAB 3MGRC 1KX3D 3REIA 1ZLAC 5B32A 1ZLAB 2PYOC 2PYOB 3KSYA 1P3MC 1P3MB 1B67A 3UTBD 5GXQC 5GXQB 4G92C 4G92B 5B24C 4CAYA 5CPJC 4Z66C 3VH6W 5AV5A 4Z66B 5B1MC 5B1LC 1BH9A 4JJNB 5AV5D 3AZID 5B31G 4EO5C 1ID3D 4EO5B 3KUYC 4H9SA 4WU8C 3KUYB 3B6FD 4J8VD 3MGSB 5DNNA 5AVCA 2AROC 3UTAD 4XZQA 5DNND 3MGRD 3MNNA 1F66B 3AZMA 2YFWA 4XZQD 4H9NB 3LELC 4WU9C 5BS7A 5CHLB 3MVDD 3REHA 2CV5A 3X1SA 5B33C 4KUDA 5B24D 5CPJD 4CSRB 5B40C 1P3PA 5BNXA 2NQBB 5GT3C 1TZYA 5E5AC 5GT3B 5E5AB 1A7WA 5B1MD 1M1AA 5B1LD 1P34A 3X1UA 1M1AD 1P34D 3C1CC 3X1UD 3AZNC 3C1CB 1S32A 1F1EA 1P3OA 3WA9B 3WA9C 3B0CT 5JA4B 1AOIA 4WU8D 1P3AD 3KWQC 3B6GA 3KWQB 3AZEB 5GT0D 3UT9C 3AV2A 3LZ0C 5G49B 4R8PC 3LZ0B 2AROD 3AZFC 4WNNA 1EQZC 1EQZB 3VH6A 3LELD 5B0YA 4WU9D 5AV6C 5AV6B 5CPKC 1M19C 5CPKB 1M19B 4AWLB 5B33D 4UUZA 3B0BA 5B0ZC 5B40D 5CP6A 4J8XA 4LD9B 1P3LC 1P3LB 3W99C 5E5AD 3W99B 3VH5W 5BO0A 4J8XD 3AN2C 1HQ3A 5CPIA 1P3IC 2RVQD 4X23C 1P3IB 4X23B 1HQ3D 3AZND 3REJA 5DNMA 5B2JC 5B2JB 1U35C 3AYWD 5B2IC 1U35B 3REKC 3UT9D 4ZBJB 3MGQB 1P3FA 3VH6T 4R8PD 3AZFD 5AV9D 3W98B 4HGAC 2HIOB 1R4VA 4E45A 2BYKB 4G91C 4G91B 1KX3B 3REIC 3REIB 3AZLA 4YS3D 3RELA 3AZLD 5B0ZD 3UTBB 1P3LD 1JFIB 3W97A 3AN2D 5AV5C 3O62A 5AV5B 3AZKA 3AZIB 1ID3B 1U35D 4H9OB 5AVBA 5B2ID 4NE5A 3REKD 4J8VC 3AV1A 4J8VB 1KX4A 4H9SC 3A6NA 3AV1D 1KX4D 4KHAA 2NZDA 1P3KA 3NQJB 5DNNC 3AZGA 5AVCC 3VH5A 5DNNB 5AVCB 3MGRB 3LJAA 4XZQC 4XZQB 3MNNC 3REID 5B32D 3WAAA 3MVDC 3MVDB 5BS7C 2F8NA 4QLCA 3REHC 5B24B 3X1SC 5CPJB 2CV5C 4H9PA 2F8ND 4J8UA 4KUDC 2CWEA 1P3PC 5B1MB 5B1LB 4Z5TA 1TZYC 3X1TA 1M1AC 1M1AB 1P34C 3X1UC 1P34B 3X1UB 3X1TD 1S32C 3R45A 1P3OC 1P3OB 4WU8B 1P3AC 1P3AB 1AOIC
chains in the Genus database with same CATH superfamily
5BT1C 5F99A 5GT0C 5AY8A 5GT0B 3VH5T 2JSSA 5KDMA 3AV2C 3AV2B 2AROB 5AVCD 3AZHA 3AZJA 5B32G 3LELB 3MNND 3NQUA 4WU9B 3EPKA 3AZMD 3AZJD 5B0YC 5B33B 3WKJA 3REHD 2Y2LA 2CV5D 3X1SD 4H9QB 1P3GA 4J8WA 2F8NG 4KUDD 5B40B 4UUZB 1P3GD 5CP6C 1Q9CA 1P3PD 5CP6B 1W2EA 4J8XC 4J8XB 3W96A 3WTPA 3AFAA 1TZYD 2RVQC 1HQ3C 2Y2JA 1HQ3B 5CPIC 3AZNB 5CPIB 1WWSA 5FUGB 1S32D 1T3UA 1P3OD 2LY8A 3KXBA 1P3MA 3AYWC 1AOID 1KU5A 5BT1D 3TU4A 3AYWB 3UT9B 3KXBD 3B6GD 3AV2D 5AV9C 4R8PB 3AZFB 5AV9B 3V9RB 4H9RB 4JJNA 3LZ1A 3EPJA 3H0LC 5B0YD 3LZ1D 4YS3C 4YS3B 1BFMA 3AZLC 3AZLB 3RELC 5B0ZB 1TAFB 2FFFB 4DRAA 5CP6D 4M6BA 3WTPE 3MGSA 3AN2B 1F66A 5CPID 2ZY4A 3REJD 4DRBA 3AZKC 5DNMD 5B2IB 3REKB 2F2AC 2JE5A 2Y2QA 4XUJA 3AV1C 2NQBA 3AV1B 1KX4C 1N1JB 1P3FD 3A6NC 1KX4B 4HGAB 3A1IA 5GSUA 2NZDC 4KHAB 5GSUD 5C3IC 5C3IB 3C1CA 5B32C 5JA4A 5B32B 3LJAC 3WAAC 3RELD 3KWQA 3AZEA 3H0MC 4QLCC 2F8NB 5AV8A 3C1BA 5G49A 4CAYB 2JCHA 4J8UC 4H9PB 3C1BD 3W97D 1Z2CB 2G5IC 1BH9B 3O62D 3AZKD 3X1TC 3X1TB 5AVBD 4Z2MG 3B0CW 4LD9A 2YFVA 5F99C 3A6ND 5AY8C 3W99A 5AY8B 1P3BA 5KDMB 4ZUXA 2NZDD 1P3BD 1P3KD 3AZGD 4ZUXD 3MNNB 3AZMC 3LJAD 3AZHC 3AZMB 3AZJC 2YFWB 3AZJB 2FJ7A 5B31A 3WAAD 3NQUB 3P5JB 2FJ7D 5B31D 3REHB 1H3OA 1KX5A 2L5AA 3X1SB 2CV5B 4QLCD 5JRGA 3MGQA 4KUDB 1KX5D 3W98A 1P3GC 4J8WC 1P3GB 4J8UD 5JRGD 1P3PB 5BNXB 2HIOA 4KGCA 4NE3A 1TZYB 3W96C 3WTPC 4Z5TD 5BNVA 3AFAC 1KX3A 3X1VA 1S32B 3EPHA 2BYMA 3X1VD 1AOIB 3UTBA 3KXBC 3KXBB 3MGPA 3B6GC 3B6GB 5F99D 3TU4C 5AY8D 3TU4B 1JFIA 2IO5C 3MGPD 2IO5B 2HUEC 2HUEB 4NE6A 1M18A 4WNNB 1BH8A 1ULYA 3AZHD 3AZIA 4JJNC 1M18D 3LZ1C 5B0YB 3LZ1B 1ID3A 2UWXA 4H9OA 3B6FA 4J8VA 3WKJD 4J8WD 4YM6A 3NQJA 3MGSC 4E44A 3UTAA 5BO0B 3MGRA 3WTPD 3AFAD 1ZLAA 3W96D 4YM6D 2PYOA 1F66C 1ZLAD 1HTAA 3REJC 3REJB 2PYOD 3MVDA 5DNMC 5DNMB 5GXQA 1P3MD 5B24A 5CPJA 3TU4D 5GXQD 2F8NH 1P3FC 1P3FB 4Z66A 4XUJC 4XUJB 3EG5B 5B1MA 5B1LA 2NQBC 4WZSB 4Z66D 5GSUC 2Y2HA 5GSUB 4JJND 4WU8A 3KUYA 1P3AA 4NFTA 3RELB 5GT0A 3KUYD 3AZEC 2AROA 3MGSD 5AV8C 3C1BC 3W97C 5AV8B 3C1BB 3W97B 4H9NA 3LELA 1F66D 4WU9A 3O62C 3O62B 3AZKB 1WWIA 2ZY5A 5B33A 4AWLC 5AVBC 5AVBB 4H9QA 4CSRA 5B40A 5GT3A 5E5AA 3A6NB 4XUJD 4LD9C 2NQBD 2YFVB 2VQRA 5GT3D 2NZDB 1P3KC 2Y2NA 1P3BC 1P3BB 1P3KB 3AZGC 3WA9A 4ZUXC 3AZNA 4WV4B 5FUGA 4ZUXB 3AZGB 3LJAB 3C1CD 3WA9D 3WAAB 2FJ7C 3AYWA 2FJ7B 5B31C 3IP4C 5B31B 3UT9A 3KWQD 3AZED 4ZBJC 4QLCB 3LZ0A 1KX5C 1H3OB 4R8PA 3AZFA 5AV9A 1KX5B 5JRGC 5AV8D 3MGQC 5JRGB 4J8UB 3FDDA 3LZ0D 3W98C 1EQZA 3V9RA 4H9RA 2HIOC 4KGCC 4Z5TC 4KGCB 5AV6A 4Z5TB 1EQZD 5CPKA 1M19A 1KX3C 5AV6D 5BNVB 4YS3A 5CPKD 1M19D 3X1VC 3X1VB 3R45B 5B0ZA 2BYMB 1TAFA 1P3LA 3UTBC 5F99B 4LD9D 3MGPC 3MGPB 3B0DC 3AN2A 2Y2PA 3B0DB 3W99D 1P3IA 1B6WA 4X23A 1P3ID 4X23D 2XD1A 3AZHB 1M18C 5B2JA 1M18B 1BH8B 3AZIC 1U35A 5B2JD 5B2IA 3REKA 1ID3C 3KFUG 2F8NK 2Y2GA 3WKJC 1PZRA 3WKJB 3B6FC 3B6FB 2ZY2A 4Z2MH 4J8WB 3MGQD 1N1JA 3W98D 2G5HC 2BYKA 2HIOD 4KGCD 3W96B 3WTPB 4YM6C 3AFAB 4YM6B 3UTAC 3UTAB 3MGRC 2Y2KA 1KX3D 3REIA 1ZLAC 5B32A 3A1KA 1ZLAB 2PYOC 3F6TA 2PYOB 3KSYA 1P3MC 1P3MB 1B67A 3UTBD 5GXQC 5GXQB 4G92C 4G92B 2Y2IA 4CAYA 5B24C 5CPJC 2Y2MA 4Z66C 3VH6W 5AV5A 4Z66B 5B1MC 5B1LC 1BH9A 4JJNB 5AV5D 2ZM5A 3AZID 5B31G 4EO5C 1ID3D 4EO5B 3KUYC 4H9SA 4WU8C 3KUYB 3B6FD 4J8VD 3MGSB 5DNNA 5AVCA 2AROC 3UTAD 4XZQA 5DNND 3MGRD 3MNNA 1F66B 3AZMA 2YFWA 4XZQD 4H9NB 3LELC 4WU9C 4UPKA 5BS7A 5CHLB 3MVDD 3REHA 2CV5A 3X1SA 5B33C 4KUDA 5B24D 5CPJD 4CSRB 5B40C 1P3PA 5BNXA 2NQBB 5GT3C 1TZYA 5E5AC 3H0RC 5E5AB 5GT3B 1A7WA 5B1MD 1M1AA 5B1LD 4WJ3C 1P34A 3X1UA 1M1AD 1P34D 3C1CC 3X1UD 3AZNC 3C1CB 1S32A 1F1EA 1P3OA 3WA9B 3WA9C 3B0CT 5JA4B 1AOIA 4WU8D 1P3AD 3KWQC 3B6GA 3KWQB 3AZEB 5GT0D 3UT9C 3AV2A 3LZ0C 5G49B 4R8PC 3LZ0B 2AROD 3AZFC 4WNNA 1EQZC 1EQZB 3VH6A 3LELD 5B0YA 4WU9D 5AV6C 5AV6B 5CPKC 1M19C 5CPKB 1M19B 4AWLB 5B33D 4UUZA 3B0BA 5B0ZC 5B40D 5CP6A 4J8XA 4LD9B 1P3LC 1P3LB 3W99C 5E5AD 3W99B 3VH5W 5BO0A 4J8XD 3AN2C 1HQ3A 2DQNC 5CPIA 1P3IC 2RVQD 4X23C 1P3IB 4X23B 1HQ3D 3AZND 3AL0C 3REJA 5DNMA 5B2JC 2W8SA 5B2JB 1U35C 3AYWD 5B2IC 1U35B 3REKC 3UT9D 4ZBJB 3MGQB 1P3FA 3VH6T 4R8PD 3AZFD 5AV9D 3W98B 4HGAC 2HIOB 1R4VA 4E45A 2BYKB 4G91C 4G91B 1KX3B 3REIC 3REIB 3AZLA 4YS3D 3RELA 3AZLD 5B0ZD 3UTBB 1P3LD 1JFIB 3W97A 2DF4C 3AN2D 2ZY3A 5AV5C 3O62A 5AV5B 3AZKA 3AZIB 1ID3B 1U35D 4H9OB 5AVBA 5B2ID 4NE5A 3REKD 4J8VC 3AV1A 4J8VB 1KX4A 4H9SC 3A6NA 3AV1D 2RIQA 1KX4D 4KHAA 2Y2OA 2NZDA 1P3KA 3NQJB 5DNNC 3AZGA 5AVCC 3VH5A 5DNNB 5AVCB 3MGRB 3EPLA 3LJAA 4XZQC 4XZQB 3MNNC 3REID 5B32D 3WAAA 2BG1A 4DQYB 3MVDC 3MVDB 5BS7C 2J8PA 2F8NA 4QLCA 3REHC 2XD5A 5B24B 3X1SC 5CPJB 2CV5C 4H9PA 2F8ND 4J8UA 4KUDC 2CWEA 1P3PC 5B1MB 5B1LB 4Z5TA 1TZYC 3X1TA 1M1AC 1M1AB 1P34C 3X1UC 1P34B 3X1UB 3X1TD 1S32C 3R45A 1P3OC 1P3OB 4WU8B 1P3AC 1P3AB 1AOIC
chains in the Genus database with same CATH topology
5BT1C 5F99A 5GT0C 5AY8A 5GT0B 3VH5T 2JSSA 5KDMA 3AV2C 3AV2B 2AROB 5AVCD 3AZHA 3AZJA 5B32G 3LELB 3MNND 3NQUA 4WU9B 3EPKA 3AZMD 3AZJD 5B0YC 5B33B 3WKJA 3REHD 2Y2LA 2CV5D 3X1SD 4H9QB 1P3GA 4J8WA 2F8NG 4KUDD 5B40B 4UUZB 1P3GD 5CP6C 1Q9CA 1P3PD 5CP6B 1W2EA 4J8XC 4J8XB 3W96A 3WTPA 3AFAA 1TZYD 2RVQC 1HQ3C 2Y2JA 1HQ3B 5CPIC 3AZNB 5CPIB 1WWSA 5FUGB 1S32D 1T3UA 1P3OD 2LY8A 3KXBA 1P3MA 3AYWC 1AOID 1KU5A 5BT1D 3TU4A 3AYWB 3UT9B 3KXBD 3B6GD 3AV2D 5AV9C 4R8PB 3AZFB 5AV9B 3V9RB 4H9RB 4JJNA 3LZ1A 3EPJA 3H0LC 5B0YD 3LZ1D 4YS3C 4YS3B 1BFMA 3AZLC 3AZLB 3RELC 5B0ZB 1TAFB 2FFFB 4DRAA 5CP6D 4M6BA 3WTPE 3MGSA 3AN2B 1F66A 5CPID 2ZY4A 3REJD 4DRBA 3AZKC 5DNMD 5B2IB 3REKB 2F2AC 2JE5A 2Y2QA 4XUJA 3AV1C 2NQBA 3AV1B 1KX4C 1N1JB 1P3FD 3A6NC 1KX4B 4HGAB 3A1IA 5GSUA 2NZDC 4KHAB 5GSUD 5C3IC 5C3IB 3C1CA 5B32C 5JA4A 5B32B 3LJAC 3WAAC 3RELD 3KWQA 3AZEA 3H0MC 4QLCC 2F8NB 5AV8A 3C1BA 5G49A 4CAYB 2JCHA 4J8UC 4H9PB 3C1BD 3W97D 1Z2CB 2G5IC 1BH9B 3O62D 3AZKD 3X1TC 3X1TB 5AVBD 4Z2MG 3B0CW 4LD9A 2YFVA 5F99C 3A6ND 5AY8C 3W99A 5AY8B 1P3BA 5KDMB 4ZUXA 2NZDD 1P3BD 1P3KD 3AZGD 4ZUXD 3MNNB 3AZMC 3LJAD 3AZHC 3AZMB 3AZJC 2YFWB 3AZJB 2FJ7A 5B31A 3WAAD 3NQUB 3P5JB 2FJ7D 5B31D 3REHB 1H3OA 1KX5A 2L5AA 3X1SB 2CV5B 4QLCD 5JRGA 3MGQA 4KUDB 1KX5D 3W98A 1P3GC 4J8WC 1P3GB 4J8UD 5JRGD 1P3PB 5BNXB 2HIOA 4KGCA 4NE3A 1TZYB 3W96C 3WTPC 4Z5TD 5BNVA 3AFAC 1KX3A 3X1VA 1S32B 3EPHA 2BYMA 3X1VD 1AOIB 3UTBA 3KXBC 3KXBB 3MGPA 3B6GC 3B6GB 5F99D 3TU4C 5AY8D 3TU4B 1JFIA 2IO5C 3MGPD 2IO5B 2HUEC 2HUEB 4NE6A 1M18A 4WNNB 1BH8A 1ULYA 3AZHD 3AZIA 4JJNC 1M18D 3LZ1C 5B0YB 3LZ1B 1ID3A 2UWXA 4H9OA 3B6FA 4J8VA 3WKJD 4J8WD 4YM6A 3NQJA 3MGSC 4E44A 3UTAA 5BO0B 3MGRA 3WTPD 3AFAD 1ZLAA 3W96D 4YM6D 2PYOA 1F66C 1ZLAD 1HTAA 3REJC 3REJB 2PYOD 3MVDA 5DNMC 5DNMB 5GXQA 1P3MD 5B24A 5CPJA 3TU4D 5GXQD 2F8NH 1P3FC 1P3FB 4Z66A 4XUJC 4XUJB 3EG5B 5B1MA 5B1LA 2NQBC 4WZSB 4Z66D 5GSUC 2Y2HA 5GSUB 4JJND 4WU8A 3KUYA 1P3AA 4NFTA 3RELB 5GT0A 3KUYD 3AZEC 2AROA 3MGSD 5AV8C 3C1BC 3W97C 5AV8B 3C1BB 3W97B 4H9NA 3LELA 1F66D 4WU9A 3O62C 3O62B 3AZKB 1WWIA 2ZY5A 5B33A 4AWLC 5AVBC 5AVBB 4H9QA 4CSRA 5B40A 5GT3A 5E5AA 3A6NB 4XUJD 4LD9C 2NQBD 2YFVB 2VQRA 5GT3D 2NZDB 1P3KC 2Y2NA 1P3BC 1P3BB 1P3KB 3AZGC 3WA9A 4ZUXC 3AZNA 4WV4B 5FUGA 4ZUXB 3AZGB 3LJAB 3C1CD 3WA9D 3WAAB 2FJ7C 3AYWA 2FJ7B 5B31C 3IP4C 5B31B 3UT9A 3KWQD 3AZED 4ZBJC 4QLCB 3LZ0A 1KX5C 1H3OB 4R8PA 3AZFA 5AV9A 1KX5B 5JRGC 5AV8D 3MGQC 5JRGB 4J8UB 3FDDA 3LZ0D 3W98C 1EQZA 3V9RA 4H9RA 2HIOC 4KGCC 4Z5TC 4KGCB 5AV6A 4Z5TB 1EQZD 5CPKA 1M19A 1KX3C 5AV6D 5BNVB 4YS3A 5CPKD 1M19D 3X1VC 3X1VB 3R45B 5B0ZA 2BYMB 1TAFA 1P3LA 3UTBC 5F99B 4LD9D 3MGPC 3MGPB 3B0DC 3AN2A 2Y2PA 3B0DB 3W99D 1P3IA 1B6WA 4X23A 1P3ID 4X23D 2XD1A 3AZHB 1M18C 5B2JA 1M18B 1BH8B 3AZIC 1U35A 5B2JD 5B2IA 3REKA 1ID3C 3KFUG 2F8NK 2Y2GA 3WKJC 1PZRA 3WKJB 3B6FC 3B6FB 2ZY2A 4Z2MH 4J8WB 3MGQD 1N1JA 3W98D 2G5HC 2BYKA 2HIOD 4KGCD 3W96B 3WTPB 4YM6C 3AFAB 4YM6B 3UTAC 3UTAB 3MGRC 2Y2KA 1KX3D 3REIA 1ZLAC 5B32A 3A1KA 1ZLAB 2PYOC 3F6TA 2PYOB 3KSYA 1P3MC 1P3MB 1B67A 3UTBD 5GXQC 5GXQB 4G92C 4G92B 2Y2IA 4CAYA 5B24C 5CPJC 2Y2MA 4Z66C 3VH6W 5AV5A 4Z66B 5B1MC 5B1LC 1BH9A 4JJNB 5AV5D 2ZM5A 3AZID 5B31G 4EO5C 1ID3D 4EO5B 3KUYC 4H9SA 4WU8C 3KUYB 3B6FD 4J8VD 3MGSB 5DNNA 5AVCA 2AROC 3UTAD 4XZQA 5DNND 3MGRD 3MNNA 1F66B 3AZMA 2YFWA 4XZQD 4H9NB 3LELC 4WU9C 4UPKA 5BS7A 5CHLB 3MVDD 3REHA 2CV5A 3X1SA 5B33C 4KUDA 5B24D 5CPJD 4CSRB 5B40C 1P3PA 5BNXA 2NQBB 5GT3C 1TZYA 5E5AC 3H0RC 5E5AB 5GT3B 1A7WA 5B1MD 1M1AA 5B1LD 4WJ3C 1P34A 3X1UA 1M1AD 1P34D 3C1CC 3X1UD 3AZNC 3C1CB 1S32A 1F1EA 1P3OA 3WA9B 3WA9C 3B0CT 5JA4B 1AOIA 4WU8D 1P3AD 3KWQC 3B6GA 3KWQB 3AZEB 5GT0D 3UT9C 3AV2A 3LZ0C 5G49B 4R8PC 3LZ0B 2AROD 3AZFC 4WNNA 1EQZC 1EQZB 3VH6A 3LELD 5B0YA 4WU9D 5AV6C 5AV6B 5CPKC 1M19C 5CPKB 1M19B 4AWLB 5B33D 4UUZA 3B0BA 5B0ZC 5B40D 5CP6A 4J8XA 4LD9B 1P3LC 1P3LB 3W99C 5E5AD 3W99B 3VH5W 5BO0A 4J8XD 3AN2C 1HQ3A 2DQNC 5CPIA 1P3IC 2RVQD 4X23C 1P3IB 4X23B 1HQ3D 3AZND 3AL0C 3REJA 5DNMA 5B2JC 2W8SA 5B2JB 1U35C 3AYWD 5B2IC 1U35B 3REKC 3UT9D 4ZBJB 3MGQB 1P3FA 3VH6T 4R8PD 3AZFD 5AV9D 3W98B 4HGAC 2HIOB 1R4VA 4E45A 2BYKB 4G91C 4G91B 1KX3B 3REIC 3REIB 3AZLA 4YS3D 3RELA 3AZLD 5B0ZD 3UTBB 1P3LD 1JFIB 3W97A 2DF4C 3AN2D 2ZY3A 5AV5C 3O62A 5AV5B 3AZKA 3AZIB 1ID3B 1U35D 4H9OB 5AVBA 5B2ID 4NE5A 3REKD 4J8VC 3AV1A 4J8VB 1KX4A 4H9SC 3A6NA 3AV1D 2RIQA 1KX4D 4KHAA 2Y2OA 2NZDA 1P3KA 3NQJB 5DNNC 3AZGA 5AVCC 3VH5A 5DNNB 5AVCB 3MGRB 3EPLA 3LJAA 4XZQC 4XZQB 3MNNC 3REID 5B32D 3WAAA 2BG1A 4DQYB 3MVDC 3MVDB 5BS7C 2J8PA 2F8NA 4QLCA 3REHC 2XD5A 5B24B 3X1SC 5CPJB 2CV5C 4H9PA 2F8ND 4J8UA 4KUDC 2CWEA 1P3PC 5B1MB 5B1LB 4Z5TA 1TZYC 3X1TA 1M1AC 1M1AB 1P34C 3X1UC 1P34B 3X1UB 3X1TD 1S32C 3R45A 1P3OC 1P3OB 4WU8B 1P3AC 1P3AB 1AOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT1 C;  5F99 A;  5GT0 C;  5AY8 A;  5GT0 B;  3VH5 T;  2JSS A;  5KDM A;  3AV2 C;  3AV2 B;  2ARO B;  5AVC D;  3AZH A;  3AZJ A;  5B32 G;  3LEL B;  3MNN D;  3NQU A;  4WU9 B;  3AZM D;  3AZJ D;  5B0Y C;  5B33 B;  3WKJ A;  3REH D;  2CV5 D;  3X1S D;  4H9Q B;  1P3G A;  4J8W A;  2F8N G;  4KUD D;  5B40 B;  4UUZ B;  1P3G D;  5CP6 C;  1Q9C A;  1P3P D;  5CP6 B;  4J8X C;  4J8X B;  3W96 A;  3WTP A;  3AFA A;  1TZY D;  2RVQ C;  1HQ3 C;  1HQ3 B;  5CPI C;  3AZN B;  5CPI B;  1WWS A;  5FUG B;  1S32 D;  1P3O D;  2LY8 A;  3KXB A;  1P3M A;  3AYW C;  1AOI D;  1KU5 A;  5BT1 D;  3TU4 A;  3AYW B;  3UT9 B;  3KXB D;  3B6G D;  3AV2 D;  5AV9 C;  4R8P B;  3AZF B;  5AV9 B;  3V9R B;  4H9R B;  4JJN A;  3LZ1 A;  5B0Y D;  3LZ1 D;  4YS3 C;  4YS3 B;  1BFM A;  3AZL C;  3AZL B;  3REL C;  5B0Z B;  1TAF B;  4DRA A;  5CP6 D;  4M6B A;  3WTP E;  3MGS A;  3AN2 B;  1F66 A;  5CPI D;  3REJ D;  4DRB A;  3AZK C;  5DNM D;  5B2I B;  3REK B;  4XUJ A;  3AV1 C;  2NQB A;  3AV1 B;  1KX4 C;  1N1J B;  1P3F D;  3A6N C;  1KX4 B;  4HGA B;  5GSU A;  2NZD C;  4KHA B;  5GSU D;  5C3I C;  5C3I B;  3C1C A;  5B32 C;  5JA4 A;  5B32 B;  3LJA C;  3WAA C;  3REL D;  3KWQ A;  3AZE A;  4QLC C;  2F8N B;  5AV8 A;  3C1B A;  5G49 A;  4CAY B;  4J8U C;  4H9P B;  3C1B D;  3W97 D;  1BH9 B;  3O62 D;  3AZK D;  3X1T C;  3X1T B;  5AVB D;  4Z2M G;  3B0C W;  4LD9 A;  2YFV A;  5F99 C;  3A6N D;  5AY8 C;  3W99 A;  5AY8 B;  1P3B A;  5KDM B;  4ZUX A;  2NZD D;  1P3B D;  1P3K D;  3AZG D;  4ZUX D;  3MNN B;  3AZM C;  3LJA D;  3AZH C;  3AZM B;  3AZJ C;  2YFW B;  3AZJ B;  2FJ7 A;  5B31 A;  3WAA D;  3NQU B;  2FJ7 D;  5B31 D;  3REH B;  1H3O A;  1KX5 A;  2L5A A;  3X1S B;  2CV5 B;  4QLC D;  5JRG A;  3MGQ A;  4KUD B;  1KX5 D;  3W98 A;  1P3G C;  4J8W C;  1P3G B;  4J8U D;  5JRG D;  1P3P B;  5BNX B;  2HIO A;  4KGC A;  4NE3 A;  1TZY B;  3W96 C;  3WTP C;  4Z5T D;  5BNV A;  3AFA C;  1KX3 A;  3X1V A;  1S32 B;  2BYM A;  3X1V D;  1AOI B;  3UTB A;  3KXB C;  3KXB B;  3MGP A;  3B6G C;  3B6G B;  5F99 D;  3TU4 C;  5AY8 D;  3TU4 B;  1JFI A;  2IO5 C;  3MGP D;  2IO5 B;  2HUE C;  2HUE B;  4NE6 A;  1M18 A;  4WNN B;  1BH8 A;  1ULY A;  3AZH D;  3AZI A;  4JJN C;  1M18 D;  3LZ1 C;  5B0Y B;  3LZ1 B;  1ID3 A;  4H9O A;  3B6F A;  4J8V A;  3WKJ D;  4J8W D;  4YM6 A;  3NQJ A;  3MGS C;  4E44 A;  3UTA A;  5BO0 B;  3MGR A;  3WTP D;  3AFA D;  1ZLA A;  3W96 D;  4YM6 D;  2PYO A;  1F66 C;  1ZLA D;  1HTA A;  3REJ C;  3REJ B;  2PYO D;  3MVD A;  5DNM C;  5DNM B;  5GXQ A;  1P3M D;  5B24 A;  5CPJ A;  3TU4 D;  5GXQ D;  2F8N H;  1P3F C;  1P3F B;  4Z66 A;  4XUJ C;  4XUJ B;  5B1M A;  2NQB C;  5B1L A;  4WZS B;  4Z66 D;  5GSU C;  5GSU B;  4JJN D;  4WU8 A;  3KUY A;  1P3A A;  4NFT A;  3REL B;  5GT0 A;  3KUY D;  3AZE C;  2ARO A;  3MGS D;  5AV8 C;  3C1B C;  3W97 C;  5AV8 B;  3C1B B;  3W97 B;  4H9N A;  3LEL A;  1F66 D;  4WU9 A;  3O62 C;  3O62 B;  3AZK B;  1WWI A;  5B33 A;  4AWL C;  5AVB C;  5AVB B;  4H9Q A;  4CSR A;  5B40 A;  5GT3 A;  5E5A A;  3A6N B;  4XUJ D;  4LD9 C;  2NQB D;  2YFV B;  5GT3 D;  2NZD B;  1P3K C;  1P3B C;  1P3B B;  1P3K B;  3AZG C;  3WA9 A;  4ZUX C;  3AZN A;  4WV4 B;  5FUG A;  4ZUX B;  3AZG B;  3LJA B;  3C1C D;  3WA9 D;  3WAA B;  2FJ7 C;  3AYW A;  2FJ7 B;  5B31 C;  3UT9 A;  5B31 B;  3KWQ D;  3AZE D;  4ZBJ C;  4QLC B;  3LZ0 A;  1KX5 C;  1H3O B;  4R8P A;  3AZF A;  5AV9 A;  1KX5 B;  5JRG C;  5AV8 D;  3MGQ C;  5JRG B;  4J8U B;  3LZ0 D;  3W98 C;  1EQZ A;  3V9R A;  4H9R A;  2HIO C;  4KGC C;  4Z5T C;  4KGC B;  5AV6 A;  4Z5T B;  1EQZ D;  5CPK A;  1M19 A;  1KX3 C;  5AV6 D;  5BNV B;  4YS3 A;  5CPK D;  1M19 D;  3X1V C;  3X1V B;  3R45 B;  5B0Z A;  2BYM B;  1TAF A;  1P3L A;  3UTB C;  5F99 B;  4LD9 D;  3MGP C;  3MGP B;  3B0D C;  3AN2 A;  3B0D B;  3W99 D;  1P3I A;  1B6W A;  4X23 A;  1P3I D;  4X23 D;  3AZH B;  1M18 C;  5B2J A;  1M18 B;  1BH8 B;  3AZI C;  1U35 A;  5B2J D;  5B2I A;  3REK A;  1ID3 C;  2F8N K;  3WKJ C;  3WKJ B;  3B6F C;  3B6F B;  4Z2M H;  4J8W B;  3MGQ D;  1N1J A;  3W98 D;  2BYK A;  2HIO D;  4KGC D;  3W96 B;  3WTP B;  4YM6 C;  3AFA B;  4YM6 B;  3UTA C;  3UTA B;  3MGR C;  1KX3 D;  3REI A;  1ZLA C;  5B32 A;  1ZLA B;  2PYO C;  2PYO B;  3KSY A;  1P3M C;  1P3M B;  1B67 A;  3UTB D;  5GXQ C;  5GXQ B;  4G92 C;  4G92 B;  5B24 C;  4CAY A;  5CPJ C;  4Z66 C;  3VH6 W;  5AV5 A;  4Z66 B;  5B1M C;  5B1L C;  1BH9 A;  4JJN B;  5AV5 D;  3AZI D;  5B31 G;  4EO5 C;  1ID3 D;  4EO5 B;  3KUY C;  4H9S A;  4WU8 C;  3KUY B;  3B6F D;  4J8V D;  3MGS B;  5DNN A;  5AVC A;  2ARO C;  3UTA D;  4XZQ A;  5DNN D;  3MGR D;  3MNN A;  1F66 B;  3AZM A;  2YFW A;  4XZQ D;  4H9N B;  3LEL C;  4WU9 C;  5BS7 A;  5CHL B;  3MVD D;  3REH A;  2CV5 A;  3X1S A;  5B33 C;  4KUD A;  5B24 D;  5CPJ D;  4CSR B;  5B40 C;  1P3P A;  5BNX A;  2NQB B;  5GT3 C;  1TZY A;  5E5A C;  5GT3 B;  5E5A B;  1A7W A;  5B1M D;  1M1A A;  5B1L D;  1P34 A;  3X1U A;  1M1A D;  1P34 D;  3C1C C;  3X1U D;  3AZN C;  3C1C B;  1S32 A;  1F1E A;  1P3O A;  3WA9 B;  3WA9 C;  3B0C T;  5JA4 B;  1AOI A;  4WU8 D;  1P3A D;  3KWQ C;  3B6G A;  3KWQ B;  3AZE B;  5GT0 D;  3UT9 C;  3AV2 A;  3LZ0 C;  5G49 B;  4R8P C;  3LZ0 B;  2ARO D;  3AZF C;  4WNN A;  1EQZ C;  1EQZ B;  3VH6 A;  3LEL D;  5B0Y A;  4WU9 D;  5AV6 C;  5AV6 B;  5CPK C;  1M19 C;  5CPK B;  1M19 B;  4AWL B;  5B33 D;  4UUZ A;  3B0B A;  5B0Z C;  5B40 D;  5CP6 A;  4J8X A;  4LD9 B;  1P3L C;  1P3L B;  3W99 C;  5E5A D;  3W99 B;  3VH5 W;  5BO0 A;  4J8X D;  3AN2 C;  1HQ3 A;  5CPI A;  1P3I C;  2RVQ D;  4X23 C;  1P3I B;  4X23 B;  1HQ3 D;  3AZN D;  3REJ A;  5DNM A;  5B2J C;  5B2J B;  1U35 C;  3AYW D;  5B2I C;  1U35 B;  3REK C;  3UT9 D;  4ZBJ B;  3MGQ B;  1P3F A;  3VH6 T;  4R8P D;  3AZF D;  5AV9 D;  3W98 B;  4HGA C;  2HIO B;  1R4V A;  4E45 A;  2BYK B;  4G91 C;  4G91 B;  1KX3 B;  3REI C;  3REI B;  3AZL A;  4YS3 D;  3REL A;  3AZL D;  5B0Z D;  3UTB B;  1P3L D;  1JFI B;  3W97 A;  3AN2 D;  5AV5 C;  3O62 A;  5AV5 B;  3AZK A;  3AZI B;  1ID3 B;  1U35 D;  4H9O B;  5AVB A;  5B2I D;  4NE5 A;  3REK D;  4J8V C;  3AV1 A;  4J8V B;  1KX4 A;  4H9S C;  3A6N A;  3AV1 D;  1KX4 D;  4KHA A;  2NZD A;  1P3K A;  3NQJ B;  5DNN C;  3AZG A;  5AVC C;  3VH5 A;  5DNN B;  5AVC B;  3MGR B;  3LJA A;  4XZQ C;  4XZQ B;  3MNN C;  3REI D;  5B32 D;  3WAA A;  3MVD C;  3MVD B;  5BS7 C;  2F8N A;  4QLC A;  3REH C;  5B24 B;  3X1S C;  5CPJ B;  2CV5 C;  4H9P A;  2F8N D;  4J8U A;  4KUD C;  2CWE A;  1P3P C;  5B1M B;  5B1L B;  4Z5T A;  1TZY C;  3X1T A;  1M1A C;  1M1A B;  1P34 C;  3X1U C;  1P34 B;  3X1U B;  3X1T D;  1S32 C;  3R45 A;  1P3O C;  1P3O B;  4WU8 B;  1P3A C;  1P3A B;  1AOI C; 
#chains in the Genus database with same CATH topology
 5BT1 C;  5F99 A;  5GT0 C;  5AY8 A;  5GT0 B;  3VH5 T;  2JSS A;  5KDM A;  3AV2 C;  3AV2 B;  2ARO B;  5AVC D;  3AZH A;  3AZJ A;  5B32 G;  3LEL B;  3MNN D;  3NQU A;  4WU9 B;  3EPK A;  3AZM D;  3AZJ D;  5B0Y C;  5B33 B;  3WKJ A;  3REH D;  2Y2L A;  2CV5 D;  3X1S D;  4H9Q B;  1P3G A;  4J8W A;  2F8N G;  4KUD D;  5B40 B;  4UUZ B;  1P3G D;  5CP6 C;  1Q9C A;  1P3P D;  5CP6 B;  1W2E A;  4J8X C;  4J8X B;  3W96 A;  3WTP A;  3AFA A;  1TZY D;  2RVQ C;  1HQ3 C;  2Y2J A;  1HQ3 B;  5CPI C;  3AZN B;  5CPI B;  1WWS A;  5FUG B;  1S32 D;  1T3U A;  1P3O D;  2LY8 A;  3KXB A;  1P3M A;  3AYW C;  1AOI D;  1KU5 A;  5BT1 D;  3TU4 A;  3AYW B;  3UT9 B;  3KXB D;  3B6G D;  3AV2 D;  5AV9 C;  4R8P B;  3AZF B;  5AV9 B;  3V9R B;  4H9R B;  4JJN A;  3LZ1 A;  3EPJ A;  3H0L C;  5B0Y D;  3LZ1 D;  4YS3 C;  4YS3 B;  1BFM A;  3AZL C;  3AZL B;  3REL C;  5B0Z B;  1TAF B;  2FFF B;  4DRA A;  5CP6 D;  4M6B A;  3WTP E;  3MGS A;  3AN2 B;  1F66 A;  5CPI D;  2ZY4 A;  3REJ D;  4DRB A;  3AZK C;  5DNM D;  5B2I B;  3REK B;  2F2A C;  2JE5 A;  2Y2Q A;  4XUJ A;  3AV1 C;  2NQB A;  3AV1 B;  1KX4 C;  1N1J B;  1P3F D;  3A6N C;  1KX4 B;  4HGA B;  3A1I A;  5GSU A;  2NZD C;  4KHA B;  5GSU D;  5C3I C;  5C3I B;  3C1C A;  5B32 C;  5JA4 A;  5B32 B;  3LJA C;  3WAA C;  3REL D;  3KWQ A;  3AZE A;  3H0M C;  4QLC C;  2F8N B;  5AV8 A;  3C1B A;  5G49 A;  4CAY B;  2JCH A;  4J8U C;  4H9P B;  3C1B D;  3W97 D;  1Z2C B;  2G5I C;  1BH9 B;  3O62 D;  3AZK D;  3X1T C;  3X1T B;  5AVB D;  4Z2M G;  3B0C W;  4LD9 A;  2YFV A;  5F99 C;  3A6N D;  5AY8 C;  3W99 A;  5AY8 B;  1P3B A;  5KDM B;  4ZUX A;  2NZD D;  1P3B D;  1P3K D;  3AZG D;  4ZUX D;  3MNN B;  3AZM C;  3LJA D;  3AZH C;  3AZM B;  3AZJ C;  2YFW B;  3AZJ B;  2FJ7 A;  5B31 A;  3WAA D;  3NQU B;  3P5J B;  2FJ7 D;  5B31 D;  3REH B;  1H3O A;  1KX5 A;  2L5A A;  3X1S B;  2CV5 B;  4QLC D;  5JRG A;  3MGQ A;  4KUD B;  1KX5 D;  3W98 A;  1P3G C;  4J8W C;  1P3G B;  4J8U D;  5JRG D;  1P3P B;  5BNX B;  2HIO A;  4KGC A;  4NE3 A;  1TZY B;  3W96 C;  3WTP C;  4Z5T D;  5BNV A;  3AFA C;  1KX3 A;  3X1V A;  1S32 B;  3EPH A;  2BYM A;  3X1V D;  1AOI B;  3UTB A;  3KXB C;  3KXB B;  3MGP A;  3B6G C;  3B6G B;  5F99 D;  3TU4 C;  5AY8 D;  3TU4 B;  1JFI A;  2IO5 C;  3MGP D;  2IO5 B;  2HUE C;  2HUE B;  4NE6 A;  1M18 A;  4WNN B;  1BH8 A;  1ULY A;  3AZH D;  3AZI A;  4JJN C;  1M18 D;  3LZ1 C;  5B0Y B;  3LZ1 B;  1ID3 A;  2UWX A;  4H9O A;  3B6F A;  4J8V A;  3WKJ D;  4J8W D;  4YM6 A;  3NQJ A;  3MGS C;  4E44 A;  3UTA A;  5BO0 B;  3MGR A;  3WTP D;  3AFA D;  1ZLA A;  3W96 D;  4YM6 D;  2PYO A;  1F66 C;  1ZLA D;  1HTA A;  3REJ C;  3REJ B;  2PYO D;  3MVD A;  5DNM C;  5DNM B;  5GXQ A;  1P3M D;  5B24 A;  5CPJ A;  3TU4 D;  5GXQ D;  2F8N H;  1P3F C;  1P3F B;  4Z66 A;  4XUJ C;  4XUJ B;  3EG5 B;  5B1M A;  5B1L A;  2NQB C;  4WZS B;  4Z66 D;  5GSU C;  2Y2H A;  5GSU B;  4JJN D;  4WU8 A;  3KUY A;  1P3A A;  4NFT A;  3REL B;  5GT0 A;  3KUY D;  3AZE C;  2ARO A;  3MGS D;  5AV8 C;  3C1B C;  3W97 C;  5AV8 B;  3C1B B;  3W97 B;  4H9N A;  3LEL A;  1F66 D;  4WU9 A;  3O62 C;  3O62 B;  3AZK B;  1WWI A;  2ZY5 A;  5B33 A;  4AWL C;  5AVB C;  5AVB B;  4H9Q A;  4CSR A;  5B40 A;  5GT3 A;  5E5A A;  3A6N B;  4XUJ D;  4LD9 C;  2NQB D;  2YFV B;  2VQR A;  5GT3 D;  2NZD B;  1P3K C;  2Y2N A;  1P3B C;  1P3B B;  1P3K B;  3AZG C;  3WA9 A;  4ZUX C;  3AZN A;  4WV4 B;  5FUG A;  4ZUX B;  3AZG B;  3LJA B;  3C1C D;  3WA9 D;  3WAA B;  2FJ7 C;  3AYW A;  2FJ7 B;  5B31 C;  3IP4 C;  5B31 B;  3UT9 A;  3KWQ D;  3AZE D;  4ZBJ C;  4QLC B;  3LZ0 A;  1KX5 C;  1H3O B;  4R8P A;  3AZF A;  5AV9 A;  1KX5 B;  5JRG C;  5AV8 D;  3MGQ C;  5JRG B;  4J8U B;  3FDD A;  3LZ0 D;  3W98 C;  1EQZ A;  3V9R A;  4H9R A;  2HIO C;  4KGC C;  4Z5T C;  4KGC B;  5AV6 A;  4Z5T B;  1EQZ D;  5CPK A;  1M19 A;  1KX3 C;  5AV6 D;  5BNV B;  4YS3 A;  5CPK D;  1M19 D;  3X1V C;  3X1V B;  3R45 B;  5B0Z A;  2BYM B;  1TAF A;  1P3L A;  3UTB C;  5F99 B;  4LD9 D;  3MGP C;  3MGP B;  3B0D C;  3AN2 A;  2Y2P A;  3B0D B;  3W99 D;  1P3I A;  1B6W A;  4X23 A;  1P3I D;  4X23 D;  2XD1 A;  3AZH B;  1M18 C;  5B2J A;  1M18 B;  1BH8 B;  3AZI C;  1U35 A;  5B2J D;  5B2I A;  3REK A;  1ID3 C;  3KFU G;  2F8N K;  2Y2G A;  3WKJ C;  1PZR A;  3WKJ B;  3B6F C;  3B6F B;  2ZY2 A;  4Z2M H;  4J8W B;  3MGQ D;  1N1J A;  3W98 D;  2G5H C;  2BYK A;  2HIO D;  4KGC D;  3W96 B;  3WTP B;  4YM6 C;  3AFA B;  4YM6 B;  3UTA C;  3UTA B;  3MGR C;  2Y2K A;  1KX3 D;  3REI A;  1ZLA C;  5B32 A;  3A1K A;  1ZLA B;  2PYO C;  3F6T A;  2PYO B;  3KSY A;  1P3M C;  1P3M B;  1B67 A;  3UTB D;  5GXQ C;  5GXQ B;  4G92 C;  4G92 B;  2Y2I A;  4CAY A;  5B24 C;  5CPJ C;  2Y2M A;  4Z66 C;  3VH6 W;  5AV5 A;  4Z66 B;  5B1M C;  5B1L C;  1BH9 A;  4JJN B;  5AV5 D;  2ZM5 A;  3AZI D;  5B31 G;  4EO5 C;  1ID3 D;  4EO5 B;  3KUY C;  4H9S A;  4WU8 C;  3KUY B;  3B6F D;  4J8V D;  3MGS B;  5DNN A;  5AVC A;  2ARO C;  3UTA D;  4XZQ A;  5DNN D;  3MGR D;  3MNN A;  1F66 B;  3AZM A;  2YFW A;  4XZQ D;  4H9N B;  3LEL C;  4WU9 C;  4UPK A;  5BS7 A;  5CHL B;  3MVD D;  3REH A;  2CV5 A;  3X1S A;  5B33 C;  4KUD A;  5B24 D;  5CPJ D;  4CSR B;  5B40 C;  1P3P A;  5BNX A;  2NQB B;  5GT3 C;  1TZY A;  5E5A C;  3H0R C;  5E5A B;  5GT3 B;  1A7W A;  5B1M D;  1M1A A;  5B1L D;  4WJ3 C;  1P34 A;  3X1U A;  1M1A D;  1P34 D;  3C1C C;  3X1U D;  3AZN C;  3C1C B;  1S32 A;  1F1E A;  1P3O A;  3WA9 B;  3WA9 C;  3B0C T;  5JA4 B;  1AOI A;  4WU8 D;  1P3A D;  3KWQ C;  3B6G A;  3KWQ B;  3AZE B;  5GT0 D;  3UT9 C;  3AV2 A;  3LZ0 C;  5G49 B;  4R8P C;  3LZ0 B;  2ARO D;  3AZF C;  4WNN A;  1EQZ C;  1EQZ B;  3VH6 A;  3LEL D;  5B0Y A;  4WU9 D;  5AV6 C;  5AV6 B;  5CPK C;  1M19 C;  5CPK B;  1M19 B;  4AWL B;  5B33 D;  4UUZ A;  3B0B A;  5B0Z C;  5B40 D;  5CP6 A;  4J8X A;  4LD9 B;  1P3L C;  1P3L B;  3W99 C;  5E5A D;  3W99 B;  3VH5 W;  5BO0 A;  4J8X D;  3AN2 C;  1HQ3 A;  2DQN C;  5CPI A;  1P3I C;  2RVQ D;  4X23 C;  1P3I B;  4X23 B;  1HQ3 D;  3AZN D;  3AL0 C;  3REJ A;  5DNM A;  5B2J C;  2W8S A;  5B2J B;  1U35 C;  3AYW D;  5B2I C;  1U35 B;  3REK C;  3UT9 D;  4ZBJ B;  3MGQ B;  1P3F A;  3VH6 T;  4R8P D;  3AZF D;  5AV9 D;  3W98 B;  4HGA C;  2HIO B;  1R4V A;  4E45 A;  2BYK B;  4G91 C;  4G91 B;  1KX3 B;  3REI C;  3REI B;  3AZL A;  4YS3 D;  3REL A;  3AZL D;  5B0Z D;  3UTB B;  1P3L D;  1JFI B;  3W97 A;  2DF4 C;  3AN2 D;  2ZY3 A;  5AV5 C;  3O62 A;  5AV5 B;  3AZK A;  3AZI B;  1ID3 B;  1U35 D;  4H9O B;  5AVB A;  5B2I D;  4NE5 A;  3REK D;  4J8V C;  3AV1 A;  4J8V B;  1KX4 A;  4H9S C;  3A6N A;  3AV1 D;  2RIQ A;  1KX4 D;  4KHA A;  2Y2O A;  2NZD A;  1P3K A;  3NQJ B;  5DNN C;  3AZG A;  5AVC C;  3VH5 A;  5DNN B;  5AVC B;  3MGR B;  3EPL A;  3LJA A;  4XZQ C;  4XZQ B;  3MNN C;  3REI D;  5B32 D;  3WAA A;  2BG1 A;  4DQY B;  3MVD C;  3MVD B;  5BS7 C;  2J8P A;  2F8N A;  4QLC A;  3REH C;  2XD5 A;  5B24 B;  3X1S C;  5CPJ B;  2CV5 C;  4H9P A;  2F8N D;  4J8U A;  4KUD C;  2CWE A;  1P3P C;  5B1M B;  5B1L B;  4Z5T A;  1TZY C;  3X1T A;  1M1A C;  1M1A B;  1P34 C;  3X1U C;  1P34 B;  3X1U B;  3X1T D;  1S32 C;  3R45 A;  1P3O C;  1P3O B;  4WU8 B;  1P3A C;  1P3A B;  1AOI C; 
#chains in the Genus database with same CATH homology
 5BT1 C;  5F99 A;  5GT0 C;  5AY8 A;  5GT0 B;  3VH5 T;  2JSS A;  5KDM A;  3AV2 C;  3AV2 B;  2ARO B;  5AVC D;  3AZH A;  3AZJ A;  5B32 G;  3LEL B;  3MNN D;  3NQU A;  4WU9 B;  3EPK A;  3AZM D;  3AZJ D;  5B0Y C;  5B33 B;  3WKJ A;  3REH D;  2Y2L A;  2CV5 D;  3X1S D;  4H9Q B;  1P3G A;  4J8W A;  2F8N G;  4KUD D;  5B40 B;  4UUZ B;  1P3G D;  5CP6 C;  1Q9C A;  1P3P D;  5CP6 B;  1W2E A;  4J8X C;  4J8X B;  3W96 A;  3WTP A;  3AFA A;  1TZY D;  2RVQ C;  1HQ3 C;  2Y2J A;  1HQ3 B;  5CPI C;  3AZN B;  5CPI B;  1WWS A;  5FUG B;  1S32 D;  1T3U A;  1P3O D;  2LY8 A;  3KXB A;  1P3M A;  3AYW C;  1AOI D;  1KU5 A;  5BT1 D;  3TU4 A;  3AYW B;  3UT9 B;  3KXB D;  3B6G D;  3AV2 D;  5AV9 C;  4R8P B;  3AZF B;  5AV9 B;  3V9R B;  4H9R B;  4JJN A;  3LZ1 A;  3EPJ A;  3H0L C;  5B0Y D;  3LZ1 D;  4YS3 C;  4YS3 B;  1BFM A;  3AZL C;  3AZL B;  3REL C;  5B0Z B;  1TAF B;  2FFF B;  4DRA A;  5CP6 D;  4M6B A;  3WTP E;  3MGS A;  3AN2 B;  1F66 A;  5CPI D;  2ZY4 A;  3REJ D;  4DRB A;  3AZK C;  5DNM D;  5B2I B;  3REK B;  2F2A C;  2JE5 A;  2Y2Q A;  4XUJ A;  3AV1 C;  2NQB A;  3AV1 B;  1KX4 C;  1N1J B;  1P3F D;  3A6N C;  1KX4 B;  4HGA B;  3A1I A;  5GSU A;  2NZD C;  4KHA B;  5GSU D;  5C3I C;  5C3I B;  3C1C A;  5B32 C;  5JA4 A;  5B32 B;  3LJA C;  3WAA C;  3REL D;  3KWQ A;  3AZE A;  3H0M C;  4QLC C;  2F8N B;  5AV8 A;  3C1B A;  5G49 A;  4CAY B;  2JCH A;  4J8U C;  4H9P B;  3C1B D;  3W97 D;  1Z2C B;  2G5I C;  1BH9 B;  3O62 D;  3AZK D;  3X1T C;  3X1T B;  5AVB D;  4Z2M G;  3B0C W;  4LD9 A;  2YFV A;  5F99 C;  3A6N D;  5AY8 C;  3W99 A;  5AY8 B;  1P3B A;  5KDM B;  4ZUX A;  2NZD D;  1P3B D;  1P3K D;  3AZG D;  4ZUX D;  3MNN B;  3AZM C;  3LJA D;  3AZH C;  3AZM B;  3AZJ C;  2YFW B;  3AZJ B;  2FJ7 A;  5B31 A;  3WAA D;  3NQU B;  3P5J B;  2FJ7 D;  5B31 D;  3REH B;  1H3O A;  1KX5 A;  2L5A A;  3X1S B;  2CV5 B;  4QLC D;  5JRG A;  3MGQ A;  4KUD B;  1KX5 D;  3W98 A;  1P3G C;  4J8W C;  1P3G B;  4J8U D;  5JRG D;  1P3P B;  5BNX B;  2HIO A;  4KGC A;  4NE3 A;  1TZY B;  3W96 C;  3WTP C;  4Z5T D;  5BNV A;  3AFA C;  1KX3 A;  3X1V A;  1S32 B;  3EPH A;  2BYM A;  3X1V D;  1AOI B;  3UTB A;  3KXB C;  3KXB B;  3MGP A;  3B6G C;  3B6G B;  5F99 D;  3TU4 C;  5AY8 D;  3TU4 B;  1JFI A;  2IO5 C;  3MGP D;  2IO5 B;  2HUE C;  2HUE B;  4NE6 A;  1M18 A;  4WNN B;  1BH8 A;  1ULY A;  3AZH D;  3AZI A;  4JJN C;  1M18 D;  3LZ1 C;  5B0Y B;  3LZ1 B;  1ID3 A;  2UWX A;  4H9O A;  3B6F A;  4J8V A;  3WKJ D;  4J8W D;  4YM6 A;  3NQJ A;  3MGS C;  4E44 A;  3UTA A;  5BO0 B;  3MGR A;  3WTP D;  3AFA D;  1ZLA A;  3W96 D;  4YM6 D;  2PYO A;  1F66 C;  1ZLA D;  1HTA A;  3REJ C;  3REJ B;  2PYO D;  3MVD A;  5DNM C;  5DNM B;  5GXQ A;  1P3M D;  5B24 A;  5CPJ A;  3TU4 D;  5GXQ D;  2F8N H;  1P3F C;  1P3F B;  4Z66 A;  4XUJ C;  4XUJ B;  3EG5 B;  5B1M A;  5B1L A;  2NQB C;  4WZS B;  4Z66 D;  5GSU C;  2Y2H A;  5GSU B;  4JJN D;  4WU8 A;  3KUY A;  1P3A A;  4NFT A;  3REL B;  5GT0 A;  3KUY D;  3AZE C;  2ARO A;  3MGS D;  5AV8 C;  3C1B C;  3W97 C;  5AV8 B;  3C1B B;  3W97 B;  4H9N A;  3LEL A;  1F66 D;  4WU9 A;  3O62 C;  3O62 B;  3AZK B;  1WWI A;  2ZY5 A;  5B33 A;  4AWL C;  5AVB C;  5AVB B;  4H9Q A;  4CSR A;  5B40 A;  5GT3 A;  5E5A A;  3A6N B;  4XUJ D;  4LD9 C;  2NQB D;  2YFV B;  2VQR A;  5GT3 D;  2NZD B;  1P3K C;  2Y2N A;  1P3B C;  1P3B B;  1P3K B;  3AZG C;  3WA9 A;  4ZUX C;  3AZN A;  4WV4 B;  5FUG A;  4ZUX B;  3AZG B;  3LJA B;  3C1C D;  3WA9 D;  3WAA B;  2FJ7 C;  3AYW A;  2FJ7 B;  5B31 C;  3IP4 C;  5B31 B;  3UT9 A;  3KWQ D;  3AZE D;  4ZBJ C;  4QLC B;  3LZ0 A;  1KX5 C;  1H3O B;  4R8P A;  3AZF A;  5AV9 A;  1KX5 B;  5JRG C;  5AV8 D;  3MGQ C;  5JRG B;  4J8U B;  3FDD A;  3LZ0 D;  3W98 C;  1EQZ A;  3V9R A;  4H9R A;  2HIO C;  4KGC C;  4Z5T C;  4KGC B;  5AV6 A;  4Z5T B;  1EQZ D;  5CPK A;  1M19 A;  1KX3 C;  5AV6 D;  5BNV B;  4YS3 A;  5CPK D;  1M19 D;  3X1V C;  3X1V B;  3R45 B;  5B0Z A;  2BYM B;  1TAF A;  1P3L A;  3UTB C;  5F99 B;  4LD9 D;  3MGP C;  3MGP B;  3B0D C;  3AN2 A;  2Y2P A;  3B0D B;  3W99 D;  1P3I A;  1B6W A;  4X23 A;  1P3I D;  4X23 D;  2XD1 A;  3AZH B;  1M18 C;  5B2J A;  1M18 B;  1BH8 B;  3AZI C;  1U35 A;  5B2J D;  5B2I A;  3REK A;  1ID3 C;  3KFU G;  2F8N K;  2Y2G A;  3WKJ C;  1PZR A;  3WKJ B;  3B6F C;  3B6F B;  2ZY2 A;  4Z2M H;  4J8W B;  3MGQ D;  1N1J A;  3W98 D;  2G5H C;  2BYK A;  2HIO D;  4KGC D;  3W96 B;  3WTP B;  4YM6 C;  3AFA B;  4YM6 B;  3UTA C;  3UTA B;  3MGR C;  2Y2K A;  1KX3 D;  3REI A;  1ZLA C;  5B32 A;  3A1K A;  1ZLA B;  2PYO C;  3F6T A;  2PYO B;  3KSY A;  1P3M C;  1P3M B;  1B67 A;  3UTB D;  5GXQ C;  5GXQ B;  4G92 C;  4G92 B;  2Y2I A;  4CAY A;  5B24 C;  5CPJ C;  2Y2M A;  4Z66 C;  3VH6 W;  5AV5 A;  4Z66 B;  5B1M C;  5B1L C;  1BH9 A;  4JJN B;  5AV5 D;  2ZM5 A;  3AZI D;  5B31 G;  4EO5 C;  1ID3 D;  4EO5 B;  3KUY C;  4H9S A;  4WU8 C;  3KUY B;  3B6F D;  4J8V D;  3MGS B;  5DNN A;  5AVC A;  2ARO C;  3UTA D;  4XZQ A;  5DNN D;  3MGR D;  3MNN A;  1F66 B;  3AZM A;  2YFW A;  4XZQ D;  4H9N B;  3LEL C;  4WU9 C;  4UPK A;  5BS7 A;  5CHL B;  3MVD D;  3REH A;  2CV5 A;  3X1S A;  5B33 C;  4KUD A;  5B24 D;  5CPJ D;  4CSR B;  5B40 C;  1P3P A;  5BNX A;  2NQB B;  5GT3 C;  1TZY A;  5E5A C;  3H0R C;  5E5A B;  5GT3 B;  1A7W A;  5B1M D;  1M1A A;  5B1L D;  4WJ3 C;  1P34 A;  3X1U A;  1M1A D;  1P34 D;  3C1C C;  3X1U D;  3AZN C;  3C1C B;  1S32 A;  1F1E A;  1P3O A;  3WA9 B;  3WA9 C;  3B0C T;  5JA4 B;  1AOI A;  4WU8 D;  1P3A D;  3KWQ C;  3B6G A;  3KWQ B;  3AZE B;  5GT0 D;  3UT9 C;  3AV2 A;  3LZ0 C;  5G49 B;  4R8P C;  3LZ0 B;  2ARO D;  3AZF C;  4WNN A;  1EQZ C;  1EQZ B;  3VH6 A;  3LEL D;  5B0Y A;  4WU9 D;  5AV6 C;  5AV6 B;  5CPK C;  1M19 C;  5CPK B;  1M19 B;  4AWL B;  5B33 D;  4UUZ A;  3B0B A;  5B0Z C;  5B40 D;  5CP6 A;  4J8X A;  4LD9 B;  1P3L C;  1P3L B;  3W99 C;  5E5A D;  3W99 B;  3VH5 W;  5BO0 A;  4J8X D;  3AN2 C;  1HQ3 A;  2DQN C;  5CPI A;  1P3I C;  2RVQ D;  4X23 C;  1P3I B;  4X23 B;  1HQ3 D;  3AZN D;  3AL0 C;  3REJ A;  5DNM A;  5B2J C;  2W8S A;  5B2J B;  1U35 C;  3AYW D;  5B2I C;  1U35 B;  3REK C;  3UT9 D;  4ZBJ B;  3MGQ B;  1P3F A;  3VH6 T;  4R8P D;  3AZF D;  5AV9 D;  3W98 B;  4HGA C;  2HIO B;  1R4V A;  4E45 A;  2BYK B;  4G91 C;  4G91 B;  1KX3 B;  3REI C;  3REI B;  3AZL A;  4YS3 D;  3REL A;  3AZL D;  5B0Z D;  3UTB B;  1P3L D;  1JFI B;  3W97 A;  2DF4 C;  3AN2 D;  2ZY3 A;  5AV5 C;  3O62 A;  5AV5 B;  3AZK A;  3AZI B;  1ID3 B;  1U35 D;  4H9O B;  5AVB A;  5B2I D;  4NE5 A;  3REK D;  4J8V C;  3AV1 A;  4J8V B;  1KX4 A;  4H9S C;  3A6N A;  3AV1 D;  2RIQ A;  1KX4 D;  4KHA A;  2Y2O A;  2NZD A;  1P3K A;  3NQJ B;  5DNN C;  3AZG A;  5AVC C;  3VH5 A;  5DNN B;  5AVC B;  3MGR B;  3EPL A;  3LJA A;  4XZQ C;  4XZQ B;  3MNN C;  3REI D;  5B32 D;  3WAA A;  2BG1 A;  4DQY B;  3MVD C;  3MVD B;  5BS7 C;  2J8P A;  2F8N A;  4QLC A;  3REH C;  2XD5 A;  5B24 B;  3X1S C;  5CPJ B;  2CV5 C;  4H9P A;  2F8N D;  4J8U A;  4KUD C;  2CWE A;  1P3P C;  5B1M B;  5B1L B;  4Z5T A;  1TZY C;  3X1T A;  1M1A C;  1M1A B;  1P34 C;  3X1U C;  1P34 B;  3X1U B;  3X1T D;  1S32 C;  3R45 A;  1P3O C;  1P3O B;  4WU8 B;  1P3A C;  1P3A B;  1AOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...