3AZFA

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFQTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfA00
1ID3A 4WU8B 4J8XC 4UUZA 5GSUC 3AYWB 1TAFB 5B33D 3WTPE 3AZNC 1U35B 3W96A 3MGPC 1ZLAC 4Z5TD 4WNNB 1P3OB 5BNVA 2YFVA 3REJC 5B0ZC 5B24B 3WA9C 3AV1D 5DNNB 4M6BA 1M1AC 4KUDC 3C1CB 3KUYC 3VH5A 3KXBD 4CAYA 3WTPD 4G92B 2CV5D 4Z66D 4XUJC 4WU8D 1P3GC 5B2IB 3W97C 1P3BC 3AZKD 3AYWD 5GT0A 1TZYB 1U35D 5DNMC 5GT3C 3REHB 5CPIC 1P3OD 2BYMA 5AV5B 3O62C 3MVDB 3C1BC 5B24D 5DNND 4J8XA 1P3PB 1BH8A 4NE3A 3C1CD 1F66C 5E5AC 5GSUA 3W98A 3AZMB 3MGRC 3WAAB 2AROC 1AOIC 3MGPA 5CP6C 3AN2C 1ZLAA 3AZKA 4AWLB 4KGCC 2F8NA 3UTBC 3WKJA 5AY8D 3REJA 1TZYD 4EO5C 5B0ZA 3TU4C 3X1VB 5FUGB 3WA9A 1M1AA 4KUDA 3REHD 5JRGC 3KUYA 3X1SC 1HQ3A 3X1UB 5CPKC 4HGAC 5AV5D 1WWIA 4J8UC 4XUJA 1P3GA 3W97A 4LD9B 3UTAC 1P3PD 4KHAA 3WAAD 1P3AA 2LY8A 3W99B 2FJ7B 5CPIA 5CPJC 1P3KA 1KX5C 1M19C 3C1BA 2F8NG 3X1VD 3KWQB 4X23C 2RVQD 1F66A 5B1LC 3X1UD 4H9QA 1KX4C 5B32C 2AROA 3B6FC 4NE5A 4LD9D 5CP6A 3AN2A 3LELC 1Q9CA 4KGCA 2NZDB 3B0BA 4DRBA 4WU9C 1P3IC 4G91C 1KX3B 2FJ7D 3MGSB 5CPKA 3X1TC 4ZUXD 3AZIC 4J8WB 1EQZC 3VH6T 5G49B 3KWQD 3B6GB 1KU5A 2HIOB 3VH6W 1P3LB 3AFAC 3LJAD 5AVBC 1JFIA 5AV9C 5C3IC 5AVCB 3A6NC 4UUZB 2NZDD 3AZLC 5AV6B 1KX5A 1M19A 5BT1D 3AZGC 3W96B 4X23A 1KX3D 1P3FA 3B0CT 3MGSD 4ZUXA 1KX4A 5BNVB 2HUEB 2YFVB 4J8WD 3B0CW 3B6FA 5B0YC 3UT9C 2HIOD 4CAYB 1P3LD 5B40C 3AV2A 5AV8A 1ID3D 1P3MC 2F8NK 3X1TA 3RELC 3AZIA 1M18C 3AZFC 3W96D 1BFMA 4H9PB 3AZJC 4H9OB 2BYMB 4YS3C 3AFAA 4J8VC 3AV1B 5AVBA 3MNNC 4E44A 5AV9A 3A6NA 3MGQA 1BH8B 3W98B 3LZ0C 3AZGA 1ZLAB 3AZKB 4XZQC 5B31C 2F8NB 3WKJB 5B2JA 5GT0D 5B0YA 2PYOC 3WA9B 3KUYB 4R8PC 1HQ3B 5B33C 1S32C 4XUJB 1P3MA 2YFWB 4J8XD 3W98D 4JJNC 4KHAB 5GSUD 3RELA 4YM6C 1P3AB 1P3LA 3LZ1C 3MGPD 3B0DC 2IO5C 1ZLAD 3AZJA 5CPIB 5F99C 1P3KB 2F8ND 5AY8B 3WKJD 3WTPC 3REJD 5GXQC 4Z66C 5B0ZD 3WA9D 1M1AD 4KUDD 3KUYD 3LZ0A 1HQ3D 4H9QB 4XUJD 1P3GD 3W97D 1U35C 3AN2B 4QLCC 5B31A 4KGCB 5KDMB 3NQUA 1P3OC 1P3AD 3AZNA 2PYOA 1H3OB 2NQBC 5DNMD 5DNNC 4R8PA 5CPID 1P3KD 3O62D 4G92C 1S32A 3C1BD 5B2IC 1F66D 5CHLB 4JJNA 4CSRA 4YM6A 2AROD 3LZ1A 5CP6D 3AN2D 5BS7C 1P3BA 3REHC 5F99A 4KGCD 5GXQA 1M19B 5B31G 3MVDC 1KX5B 4ZBJC 5DNMA 5GT3A 4X23B 1P3FB 3X1SD 1P3PC 3O62A 5CPKD 4H9SC 4ZUXB 1KX4B 5BO0A 3AZMC 3B6FB 5E5AA 4QLCA 3MGRA 3AV2B 5AV8B 3LJAB 1AOIA 2NQBA 2RVQC 5CPJD 3UTBA 3X1TB 3TU4A 1M19D 1KX5D 4X23D 5JRGA 5B2IA 4LD9C 3X1SA 1P3FD 1KX4D 4J8UA 3AFAB 3B6FD 2L5AA 5AVBB 3UTAA 3W99C 5C3IB 3V9RB 5AV9B 3MGQB 3R45B 1P34C 3MVDA 1ID3B 1BH9A 3AV2D 5AV8D 3AZGB 4WV4B 4H9RA 3KWQC 5CPJA 3X1TD 3AZID 5B2JB 3AZMA 4E45A 1EQZD 5B0YB 2CWEA 4NE6A 5B1LA 5B32A 3REIC 2NZDC 3VH6A 3AFAD 5BT1C 5AVBD 5AV9D 5B1MC 5BNXA 3A6ND 3LELA 3MGQD 4WU9A 3RELB 1F1EA 3MGSC 1P3IA 3KSYA 4NFTA 4J8WC 3AZGD 3REKC 3B6GC 3AZJB 2HIOC 5GT0B 5B2JD 1EQZA 1P3LC 5B0YD 3W99A 5AVCC 3LZ0B 1P34A 3AZHC 4H9NA 5AV6C 2BYKA 3AZEC 1P3MD 5B32G 4J8XB 5GSUB 5B31B 3AZLA 3NQUB 3RELD 2HUEC 3AZNB 2F8NH 3MGPB 2PYOB 4R8PB 3AZJD 3REIA 3REJB 5B0ZB 3UT9A 1M1AB 4KUDB 5B1MA 4JJNB 3LZ0D 5B40A 4YM6B 1P3GB 3LZ1B 3W97B 3B0DB 1N1JA 3REKA 3B6GA 2IO5B 1P3BB 5B31D 4Z5TC 3VH5T 1M18A 3AZFA 3AZND 5DNMB 2PYOD 3VH5W 5GT3B 3AV1C 4Z2MG 4R8PD 5AVCA 3NQJA 4DRAA 3O62B 3KXBC 3AZHA 4YS3A 2CV5C 3W98C 5BO0B 4J8VA 5AV6A 3C1BB 3AZEA 1S32D 3MNNA 4WU8C 1F66B 5E5AB 4QLCB 4JJND 3MGRB 3AZKC 4YM6D 3AYWC 3WKJC 2AROB 1AOIB 3LZ1D 2NQBB 5CP6B 4XZQA 1P3BD 3UTBB 5F99D 1HQ3C 4EO5B 5GXQD 3TU4B 5B24C 5GT3D 5JRGB 3X1SB 1B6WA 3C1CC 5CPKB 4HGAB 5JA4A 5B33A 4J8UB 1P3AC 3UTAB 5E5AD 4QLCD 4H9PA 4Z5TA 3MGRD 1P3KC 4H9OA 5AY8C 1BH9B 1TZYC 4ZBJB 1AOID 2NQBD 1JFIB 4H9RB 3AV1A 5CPJB 3UTBD 3KXBA 3WTPA 2CV5A 1B67A 5AV5C 4Z66A 3TU4D 2JSSA 4WU8A 5JRGD 5B1LB 5B2ID 1WWSA 5B32B 3AYWA 1TAFA 3WAAC 4WZSB 4J8UD 1U35A 3UTAD 3LELB 5BNXB 4AWLC 4WU9B 4WNNA 1P3IB 1P3OA 3MVDD 5B24A 4G91B 3X1VC 5DNNA 2YFWA 3C1CA 1A7WA 3AZIB 3X1UC 3AZMD 1EQZB 5B1LD 1P34B 5B32D 5AY8A 1TZYA 4H9NB 2BYKB 5BS7A 3A6NB 4Z2MH 3LELD 3REHA 2FJ7C 3AZLB 1P3FC 4WU9D 1P3ID 5AV5A 4ZUXC 1R4VA 1ULYA 1P3PA 4H9SA 5KDMA 3REIB 3WAAA 3UT9B 3AV2C 5AV8C 3LJAC 1H3OA 3W99D 5B1MB 1P34D 5B40B 1P3MB 3X1VA 5FUGA 1N1JB 3REKB 1KX3C 3AZLD 3X1UA 1M18B 3AZFB 4LD9A 3MGQC 3NQJB 4YS3B 3AZHB 3REID 4J8VB 3AZEB 1ID3C 3MNNB 3UT9D 5B1MD 2FJ7A 5B40D 5B2JC 3W96C 3KWQA 3REKD 4XZQB 3B6GD 1M18D 3AZFD 3LJAA 5AVCD 5JA4B 4YS3D 3AZHD 2NZDA 5B33B 4J8VD 1S32B 5AV6D 3AZED 3MNND 1KX3A 4CSRB 3MGSA 1HTAA 4Z5TB 5GT0C 4J8WA 5G49A 4XZQD 2HIOA 3V9RA 5F99B 3KXBB 3WTPB 2CV5B 3R45A 5GXQB 4Z66B
chains in the Genus database with same CATH superfamily
1ID3A 4WU8B 4J8XC 4UUZA 5GSUC 3AYWB 1TAFB 2JCHA 5B33D 3WTPE 3AZNC 1U35B 3W96A 3MGPC 1ZLAC 4Z5TD 4WNNB 1P3OB 5BNVA 2YFVA 3REJC 5B0ZC 5B24B 3WA9C 2VQRA 5DNNB 4M6BA 3AV1D 1M1AC 4KUDC 3C1CB 3KUYC 3VH5A 3KXBD 2F2AC 4CAYA 3WTPD 4G92B 2CV5D 4Z66D 4XUJC 4WU8D 1P3GC 2ZY3A 5B2IB 3W97C 1P3BC 3AZKD 3AYWD 5GT0A 1TZYB 3EPKA 1U35D 5DNMC 2FFFB 5GT3C 3REHB 5CPIC 1P3OD 2BYMA 5AV5B 3O62C 3MVDB 3C1BC 5B24D 5DNND 4J8XA 2J8PA 1P3PB 1BH8A 4NE3A 3C1CD 1F66C 5E5AC 5GSUA 3W98A 3AZMB 3MGRC 3WAAB 2AROC 1AOIC 3MGPA 2Y2JA 5CP6C 3AN2C 1ZLAA 3AZKA 4AWLB 4KGCC 2F8NA 3UTBC 3WKJA 5AY8D 3REJA 1TZYD 3H0RC 4EO5C 5B0ZA 3TU4C 3X1VB 5FUGB 3WA9A 1M1AA 4KUDA 3REHD 5JRGC 3KUYA 3X1SC 2ZY5A 1HQ3A 3X1UB 5CPKC 4HGAC 5AV5D 1WWIA 4J8UC 2Y2HA 4XUJA 1P3GA 3W97A 4LD9B 2ZY4A 4WJ3C 3UTAC 1P3PD 4KHAA 3WAAD 1P3AA 2LY8A 3W99B 2FJ7B 5CPIA 5CPJC 1P3KA 1KX5C 1M19C 3C1BA 2F8NG 3X1VD 3KWQB 4X23C 2RVQD 1F66A 5B1LC 3X1UD 4H9QA 1KX4C 5B32C 2Y2MA 2AROA 3B6FC 4NE5A 4LD9D 5CP6A 3AN2A 3LELC 2Y2NA 1Q9CA 4KGCA 2NZDB 3B0BA 4DRBA 4WU9C 1P3IC 4G91C 1KX3B 2FJ7D 3MGSB 5CPKA 3X1TC 4ZUXD 3AZIC 4J8WB 1EQZC 3VH6T 5G49B 3KWQD 3B6GB 1KU5A 2HIOB 3VH6W 2Y2QA 1P3LB 3AFAC 3LJAD 5AVBC 1JFIA 5AV9C 5C3IC 5AVCB 3A6NC 2XD1A 4UUZB 4UPKA 2NZDD 3AZLC 5AV6B 1KX5A 1M19A 5BT1D 3AZGC 3W96B 4X23A 1KX3D 1P3FA 3B0CT 3MGSD 4ZUXA 1KX4A 5BNVB 2HUEB 2YFVB 4J8WD 3B0CW 3B6FA 5B0YC 3UT9C 3EPLA 2HIOD 4CAYB 1P3LD 5B40C 3AV2A 5AV8A 1ID3D 1P3MC 2F8NK 3X1TA 3RELC 3AZIA 1M18C 3AZFC 3W96D 1BFMA 4H9PB 3AZJC 4H9OB 2BYMB 4YS3C 3EPHA 3AFAA 4J8VC 3F6TA 5AVBA 3AV1B 3MNNC 4E44A 5AV9A 3A6NA 3MGQA 1BH8B 3W98B 3LZ0C 4DQYB 3AZGA 1ZLAB 3AZKB 4XZQC 5B31C 2F8NB 3WKJB 5B2JA 5GT0D 3AL0C 5B0YA 2PYOC 3WA9B 3KUYB 4R8PC 1HQ3B 5B33C 1S32C 4XUJB 1P3MA 2YFWB 3EG5B 4J8XD 3W98D 4JJNC 4KHAB 5GSUD 3RELA 4YM6C 1P3AB 1P3LA 3LZ1C 3MGPD 3B0DC 2IO5C 1ZLAD 3AZJA 5CPIB 5F99C 1P3KB 2Y2KA 2F8ND 5AY8B 2UWXA 3WTPC 3WKJD 3REJD 5GXQC 4Z66C 5B0ZD 3WA9D 1M1AD 4KUDD 3KUYD 2G5HC 3LZ0A 1HQ3D 4H9QB 4XUJD 1P3GD 3W97D 1U35C 3AN2B 4QLCC 5B31A 4KGCB 5KDMB 3NQUA 1P3OC 1P3AD 3AZNA 2PYOA 1H3OB 2NQBC 5DNMD 5DNNC 4R8PA 5CPID 1P3KD 3O62D 4G92C 1S32A 3C1BD 5B2IC 1F66D 5CHLB 4JJNA 4CSRA 4YM6A 2AROD 3LZ1A 5CP6D 3AN2D 5BS7C 1P3BA 3REHC 5F99A 4KGCD 5GXQA 1M19B 5B31G 3MVDC 1KX5B 4ZBJC 5DNMA 5GT3A 4X23B 1P3FB 3X1SD 1P3PC 3O62A 5CPKD 4H9SC 4ZUXB 1KX4B 5BO0A 3AZMC 3B6FB 5E5AA 4QLCA 3MGRA 3FDDA 3AV2B 5AV8B 3LJAB 1AOIA 2NQBA 2RVQC 5CPJD 3UTBA 3X1TB 3TU4A 1M19D 1KX5D 4X23D 5JRGA 1T3UA 5B2IA 4LD9C 3X1SA 1P3FD 1KX4D 4J8UA 3AFAB 3B6FD 2L5AA 5AVBB 2ZY2A 3W99C 5C3IB 3V9RB 5AV9B 3MGQB 3UTAA 3R45B 1P34C 3MVDA 1ID3B 1BH9A 3AV2D 5AV8D 3AZGB 2G5IC 4WV4B 4H9RA 3KWQC 5CPJA 3X1TD 3AZID 5B2JB 3AZMA 4E45A 1EQZD 5B0YB 2CWEA 4NE6A 5B1LA 5B32A 3REIC 2NZDC 3VH6A 3AFAD 5BT1C 5AVBD 5AV9D 5B1MC 5BNXA 3A6ND 3LELA 3MGQD 4WU9A 3RELB 1F1EA 3MGSC 1P3IA 3KSYA 4NFTA 4J8WC 3AZGD 3IP4C 3REKC 2JE5A 3B6GC 1W2EA 3AZJB 2HIOC 5GT0B 5B2JD 1EQZA 1P3LC 3EPJA 5B0YD 3W99A 5AVCC 3LZ0B 1P34A 3AZHC 4H9NA 5AV6C 2BYKA 3AZEC 1P3MD 5B32G 4J8XB 5GSUB 5B31B 3AZLA 3NQUB 3RELD 2HUEC 3AZNB 2F8NH 3MGPB 2PYOB 4R8PB 3AZJD 3REIA 3REJB 5B0ZB 3UT9A 1M1AB 4KUDB 5B1MA 4JJNB 3LZ0D 5B40A 4YM6B 1P3GB 3LZ1B 3W97B 3B0DB 3P5JB 1N1JA 3REKA 3B6GA 2IO5B 1P3BB 5B31D 4Z5TC 3VH5T 1M18A 3AZFA 3AZND 5DNMB 2PYOD 3VH5W 5GT3B 3AV1C 4Z2MG 4R8PD 5AVCA 3NQJA 4DRAA 3O62B 3KXBC 3AZHA 4YS3A 2CV5C 3W98C 5BO0B 4J8VA 5AV6A 3C1BB 3AZEA 1S32D 3MNNA 4WU8C 1F66B 5E5AB 4QLCB 4JJND 3A1IA 2BG1A 3MGRB 3AZKC 4YM6D 3AYWC 3WKJC 2AROB 1AOIB 3LZ1D 2NQBB 5CP6B 2DF4C 2DQNC 4XZQA 1P3BD 3UTBB 5F99D 1HQ3C 4EO5B 5GXQD 3TU4B 5B24C 5GT3D 5JRGB 3X1SB 1B6WA 3C1CC 5CPKB 4HGAB 5JA4A 5B33A 4J8UB 1P3AC 3UTAB 5E5AD 4QLCD 4H9PA 4Z5TA 3MGRD 1P3KC 3H0MC 4H9OA 5AY8C 1BH9B 1TZYC 4ZBJB 1AOID 2Y2GA 2NQBD 1JFIB 4H9RB 3AV1A 5CPJB 3UTBD 3KXBA 3WTPA 2CV5A 3A1KA 1B67A 5AV5C 4Z66A 2Y2PA 2JSSA 3TU4D 3KFUG 4WU8A 5JRGD 5B1LB 5B2ID 1WWSA 5B32B 3AYWA 1TAFA 3WAAC 4WZSB 4J8UD 1U35A 3UTAD 3LELB 5BNXB 2ZM5A 4AWLC 4WU9B 4WNNA 1P3IB 1P3OA 3MVDD 5B24A 4G91B 3X1VC 5DNNA 2YFWA 2Y2OA 3C1CA 1A7WA 3AZIB 3X1UC 3AZMD 1EQZB 1PZRA 5B1LD 1P34B 5B32D 5AY8A 1TZYA 4H9NB 2BYKB 3H0LC 5BS7A 3A6NB 4Z2MH 3LELD 3REHA 2FJ7C 3AZLB 1P3FC 4WU9D 1P3ID 5AV5A 2Y2IA 4ZUXC 1R4VA 1ULYA 1P3PA 4H9SA 2XD5A 5KDMA 3REIB 3WAAA 3UT9B 3AV2C 5AV8C 3LJAC 1H3OA 3W99D 5B1MB 2Y2LA 1P34D 5B40B 1P3MB 3X1VA 5FUGA 1N1JB 3REKB 1KX3C 3AZLD 3X1UA 1M18B 3AZFB 4LD9A 2RIQA 3MGQC 3NQJB 4YS3B 3AZHB 3REID 4J8VB 3AZEB 1ID3C 3MNNB 3UT9D 5B1MD 2FJ7A 1Z2CB 5B40D 5B2JC 3W96C 3KWQA 3REKD 4XZQB 3B6GD 1M18D 3AZFD 3LJAA 5AVCD 5JA4B 4YS3D 3AZHD 2NZDA 5B33B 4J8VD 1S32B 5AV6D 3AZED 3MNND 1KX3A 4CSRB 3MGSA 1HTAA 4Z5TB 2W8SA 5GT0C 4J8WA 5G49A 4XZQD 2HIOA 3V9RA 5F99B 3KXBB 3WTPB 2CV5B 3R45A 5GXQB 4Z66B
chains in the Genus database with same CATH topology
1ID3A 4WU8B 4J8XC 4UUZA 5GSUC 3AYWB 1TAFB 2JCHA 5B33D 3WTPE 3AZNC 1U35B 3W96A 3MGPC 1ZLAC 4Z5TD 4WNNB 1P3OB 5BNVA 2YFVA 3REJC 5B0ZC 5B24B 3WA9C 2VQRA 5DNNB 4M6BA 3AV1D 1M1AC 4KUDC 3C1CB 3KUYC 3VH5A 3KXBD 2F2AC 4CAYA 3WTPD 4G92B 2CV5D 4Z66D 4XUJC 4WU8D 1P3GC 2ZY3A 5B2IB 3W97C 1P3BC 3AZKD 3AYWD 5GT0A 1TZYB 3EPKA 1U35D 5DNMC 2FFFB 5GT3C 3REHB 5CPIC 1P3OD 2BYMA 5AV5B 3O62C 3MVDB 3C1BC 5B24D 5DNND 4J8XA 2J8PA 1P3PB 1BH8A 4NE3A 3C1CD 1F66C 5E5AC 5GSUA 3W98A 3AZMB 3MGRC 3WAAB 2AROC 1AOIC 3MGPA 2Y2JA 5CP6C 3AN2C 1ZLAA 3AZKA 4AWLB 4KGCC 2F8NA 3UTBC 3WKJA 5AY8D 3REJA 1TZYD 3H0RC 4EO5C 5B0ZA 3TU4C 3X1VB 5FUGB 3WA9A 1M1AA 4KUDA 3REHD 5JRGC 3KUYA 3X1SC 2ZY5A 1HQ3A 3X1UB 5CPKC 4HGAC 5AV5D 1WWIA 4J8UC 2Y2HA 4XUJA 1P3GA 3W97A 4LD9B 2ZY4A 4WJ3C 3UTAC 1P3PD 4KHAA 3WAAD 1P3AA 2LY8A 3W99B 2FJ7B 5CPIA 5CPJC 1P3KA 1KX5C 1M19C 3C1BA 2F8NG 3X1VD 3KWQB 4X23C 2RVQD 1F66A 5B1LC 3X1UD 4H9QA 1KX4C 5B32C 2Y2MA 2AROA 3B6FC 4NE5A 4LD9D 5CP6A 3AN2A 3LELC 2Y2NA 1Q9CA 4KGCA 2NZDB 3B0BA 4DRBA 4WU9C 1P3IC 4G91C 1KX3B 2FJ7D 3MGSB 5CPKA 3X1TC 4ZUXD 3AZIC 4J8WB 1EQZC 3VH6T 5G49B 3KWQD 3B6GB 1KU5A 2HIOB 3VH6W 2Y2QA 1P3LB 3AFAC 3LJAD 5AVBC 1JFIA 5AV9C 5C3IC 5AVCB 3A6NC 2XD1A 4UUZB 4UPKA 2NZDD 3AZLC 5AV6B 1KX5A 1M19A 5BT1D 3AZGC 3W96B 4X23A 1KX3D 1P3FA 3B0CT 3MGSD 4ZUXA 1KX4A 5BNVB 2HUEB 2YFVB 4J8WD 3B0CW 3B6FA 5B0YC 3UT9C 3EPLA 2HIOD 4CAYB 1P3LD 5B40C 3AV2A 5AV8A 1ID3D 1P3MC 2F8NK 3X1TA 3RELC 3AZIA 1M18C 3AZFC 3W96D 1BFMA 4H9PB 3AZJC 4H9OB 2BYMB 4YS3C 3EPHA 3AFAA 4J8VC 3F6TA 5AVBA 3AV1B 3MNNC 4E44A 5AV9A 3A6NA 3MGQA 1BH8B 3W98B 3LZ0C 4DQYB 3AZGA 1ZLAB 3AZKB 4XZQC 5B31C 2F8NB 3WKJB 5B2JA 5GT0D 3AL0C 5B0YA 2PYOC 3WA9B 3KUYB 4R8PC 1HQ3B 5B33C 1S32C 4XUJB 1P3MA 2YFWB 3EG5B 4J8XD 3W98D 4JJNC 4KHAB 5GSUD 3RELA 4YM6C 1P3AB 1P3LA 3LZ1C 3MGPD 3B0DC 2IO5C 1ZLAD 3AZJA 5CPIB 5F99C 1P3KB 2Y2KA 2F8ND 5AY8B 2UWXA 3WTPC 3WKJD 3REJD 5GXQC 4Z66C 5B0ZD 3WA9D 1M1AD 4KUDD 3KUYD 2G5HC 3LZ0A 1HQ3D 4H9QB 4XUJD 1P3GD 3W97D 1U35C 3AN2B 4QLCC 5B31A 4KGCB 5KDMB 3NQUA 1P3OC 1P3AD 3AZNA 2PYOA 1H3OB 2NQBC 5DNMD 5DNNC 4R8PA 5CPID 1P3KD 3O62D 4G92C 1S32A 3C1BD 5B2IC 1F66D 5CHLB 4JJNA 4CSRA 4YM6A 2AROD 3LZ1A 5CP6D 3AN2D 5BS7C 1P3BA 3REHC 5F99A 4KGCD 5GXQA 1M19B 5B31G 3MVDC 1KX5B 4ZBJC 5DNMA 5GT3A 4X23B 1P3FB 3X1SD 1P3PC 3O62A 5CPKD 4H9SC 4ZUXB 1KX4B 5BO0A 3AZMC 3B6FB 5E5AA 4QLCA 3MGRA 3FDDA 3AV2B 5AV8B 3LJAB 1AOIA 2NQBA 2RVQC 5CPJD 3UTBA 3X1TB 3TU4A 1M19D 1KX5D 4X23D 5JRGA 1T3UA 5B2IA 4LD9C 3X1SA 1P3FD 1KX4D 4J8UA 3AFAB 3B6FD 2L5AA 5AVBB 2ZY2A 3W99C 5C3IB 3V9RB 5AV9B 3MGQB 3UTAA 3R45B 1P34C 3MVDA 1ID3B 1BH9A 3AV2D 5AV8D 3AZGB 2G5IC 4WV4B 4H9RA 3KWQC 5CPJA 3X1TD 3AZID 5B2JB 3AZMA 4E45A 1EQZD 5B0YB 2CWEA 4NE6A 5B1LA 5B32A 3REIC 2NZDC 3VH6A 3AFAD 5BT1C 5AVBD 5AV9D 5B1MC 5BNXA 3A6ND 3LELA 3MGQD 4WU9A 3RELB 1F1EA 3MGSC 1P3IA 3KSYA 4NFTA 4J8WC 3AZGD 3IP4C 3REKC 2JE5A 3B6GC 1W2EA 3AZJB 2HIOC 5GT0B 5B2JD 1EQZA 1P3LC 3EPJA 5B0YD 3W99A 5AVCC 3LZ0B 1P34A 3AZHC 4H9NA 5AV6C 2BYKA 3AZEC 1P3MD 5B32G 4J8XB 5GSUB 5B31B 3AZLA 3NQUB 3RELD 2HUEC 3AZNB 2F8NH 3MGPB 2PYOB 4R8PB 3AZJD 3REIA 3REJB 5B0ZB 3UT9A 1M1AB 4KUDB 5B1MA 4JJNB 3LZ0D 5B40A 4YM6B 1P3GB 3LZ1B 3W97B 3B0DB 3P5JB 1N1JA 3REKA 3B6GA 2IO5B 1P3BB 5B31D 4Z5TC 3VH5T 1M18A 3AZFA 3AZND 5DNMB 2PYOD 3VH5W 5GT3B 3AV1C 4Z2MG 4R8PD 5AVCA 3NQJA 4DRAA 3O62B 3KXBC 3AZHA 4YS3A 2CV5C 3W98C 5BO0B 4J8VA 5AV6A 3C1BB 3AZEA 1S32D 3MNNA 4WU8C 1F66B 5E5AB 4QLCB 4JJND 3A1IA 2BG1A 3MGRB 3AZKC 4YM6D 3AYWC 3WKJC 2AROB 1AOIB 3LZ1D 2NQBB 5CP6B 2DF4C 2DQNC 4XZQA 1P3BD 3UTBB 5F99D 1HQ3C 4EO5B 5GXQD 3TU4B 5B24C 5GT3D 5JRGB 3X1SB 1B6WA 3C1CC 5CPKB 4HGAB 5JA4A 5B33A 4J8UB 1P3AC 3UTAB 5E5AD 4QLCD 4H9PA 4Z5TA 3MGRD 1P3KC 3H0MC 4H9OA 5AY8C 1BH9B 1TZYC 4ZBJB 1AOID 2Y2GA 2NQBD 1JFIB 4H9RB 3AV1A 5CPJB 3UTBD 3KXBA 3WTPA 2CV5A 3A1KA 1B67A 5AV5C 4Z66A 2Y2PA 2JSSA 3TU4D 3KFUG 4WU8A 5JRGD 5B1LB 5B2ID 1WWSA 5B32B 3AYWA 1TAFA 3WAAC 4WZSB 4J8UD 1U35A 3UTAD 3LELB 5BNXB 2ZM5A 4AWLC 4WU9B 4WNNA 1P3IB 1P3OA 3MVDD 5B24A 4G91B 3X1VC 5DNNA 2YFWA 2Y2OA 3C1CA 1A7WA 3AZIB 3X1UC 3AZMD 1EQZB 1PZRA 5B1LD 1P34B 5B32D 5AY8A 1TZYA 4H9NB 2BYKB 3H0LC 5BS7A 3A6NB 4Z2MH 3LELD 3REHA 2FJ7C 3AZLB 1P3FC 4WU9D 1P3ID 5AV5A 2Y2IA 4ZUXC 1R4VA 1ULYA 1P3PA 4H9SA 2XD5A 5KDMA 3REIB 3WAAA 3UT9B 3AV2C 5AV8C 3LJAC 1H3OA 3W99D 5B1MB 2Y2LA 1P34D 5B40B 1P3MB 3X1VA 5FUGA 1N1JB 3REKB 1KX3C 3AZLD 3X1UA 1M18B 3AZFB 4LD9A 2RIQA 3MGQC 3NQJB 4YS3B 3AZHB 3REID 4J8VB 3AZEB 1ID3C 3MNNB 3UT9D 5B1MD 2FJ7A 1Z2CB 5B40D 5B2JC 3W96C 3KWQA 3REKD 4XZQB 3B6GD 1M18D 3AZFD 3LJAA 5AVCD 5JA4B 4YS3D 3AZHD 2NZDA 5B33B 4J8VD 1S32B 5AV6D 3AZED 3MNND 1KX3A 4CSRB 3MGSA 1HTAA 4Z5TB 2W8SA 5GT0C 4J8WA 5G49A 4XZQD 2HIOA 3V9RA 5F99B 3KXBB 3WTPB 2CV5B 3R45A 5GXQB 4Z66B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 A;  4WU8 B;  4J8X C;  4UUZ A;  5GSU C;  3AYW B;  1TAF B;  5B33 D;  3WTP E;  3AZN C;  1U35 B;  3W96 A;  3MGP C;  1ZLA C;  4Z5T D;  4WNN B;  1P3O B;  5BNV A;  2YFV A;  3REJ C;  5B0Z C;  5B24 B;  3WA9 C;  3AV1 D;  5DNN B;  4M6B A;  1M1A C;  4KUD C;  3C1C B;  3KUY C;  3VH5 A;  3KXB D;  4CAY A;  3WTP D;  4G92 B;  2CV5 D;  4Z66 D;  4XUJ C;  4WU8 D;  1P3G C;  5B2I B;  3W97 C;  1P3B C;  3AZK D;  3AYW D;  5GT0 A;  1TZY B;  1U35 D;  5DNM C;  5GT3 C;  3REH B;  5CPI C;  1P3O D;  2BYM A;  5AV5 B;  3O62 C;  3MVD B;  3C1B C;  5B24 D;  5DNN D;  4J8X A;  1P3P B;  1BH8 A;  4NE3 A;  3C1C D;  1F66 C;  5E5A C;  5GSU A;  3W98 A;  3AZM B;  3MGR C;  3WAA B;  2ARO C;  1AOI C;  3MGP A;  5CP6 C;  3AN2 C;  1ZLA A;  3AZK A;  4AWL B;  4KGC C;  2F8N A;  3UTB C;  3WKJ A;  5AY8 D;  3REJ A;  1TZY D;  4EO5 C;  5B0Z A;  3TU4 C;  3X1V B;  5FUG B;  3WA9 A;  1M1A A;  4KUD A;  3REH D;  5JRG C;  3KUY A;  3X1S C;  1HQ3 A;  3X1U B;  5CPK C;  4HGA C;  5AV5 D;  1WWI A;  4J8U C;  4XUJ A;  1P3G A;  3W97 A;  4LD9 B;  3UTA C;  1P3P D;  4KHA A;  3WAA D;  1P3A A;  2LY8 A;  3W99 B;  2FJ7 B;  5CPI A;  5CPJ C;  1P3K A;  1KX5 C;  1M19 C;  3C1B A;  2F8N G;  3X1V D;  3KWQ B;  4X23 C;  2RVQ D;  1F66 A;  5B1L C;  3X1U D;  4H9Q A;  1KX4 C;  5B32 C;  2ARO A;  3B6F C;  4NE5 A;  4LD9 D;  5CP6 A;  3AN2 A;  3LEL C;  1Q9C A;  4KGC A;  2NZD B;  3B0B A;  4DRB A;  4WU9 C;  1P3I C;  4G91 C;  1KX3 B;  2FJ7 D;  3MGS B;  5CPK A;  3X1T C;  4ZUX D;  3AZI C;  4J8W B;  1EQZ C;  3VH6 T;  5G49 B;  3KWQ D;  3B6G B;  1KU5 A;  2HIO B;  3VH6 W;  1P3L B;  3AFA C;  3LJA D;  5AVB C;  1JFI A;  5AV9 C;  5C3I C;  5AVC B;  3A6N C;  4UUZ B;  2NZD D;  3AZL C;  5AV6 B;  1KX5 A;  1M19 A;  5BT1 D;  3AZG C;  3W96 B;  4X23 A;  1KX3 D;  1P3F A;  3B0C T;  3MGS D;  4ZUX A;  1KX4 A;  5BNV B;  2HUE B;  2YFV B;  4J8W D;  3B0C W;  3B6F A;  5B0Y C;  3UT9 C;  2HIO D;  4CAY B;  1P3L D;  5B40 C;  3AV2 A;  5AV8 A;  1ID3 D;  1P3M C;  2F8N K;  3X1T A;  3REL C;  3AZI A;  1M18 C;  3AZF C;  3W96 D;  1BFM A;  4H9P B;  3AZJ C;  4H9O B;  2BYM B;  4YS3 C;  3AFA A;  4J8V C;  3AV1 B;  5AVB A;  3MNN C;  4E44 A;  5AV9 A;  3A6N A;  3MGQ A;  1BH8 B;  3W98 B;  3LZ0 C;  3AZG A;  1ZLA B;  3AZK B;  4XZQ C;  5B31 C;  2F8N B;  3WKJ B;  5B2J A;  5GT0 D;  5B0Y A;  2PYO C;  3WA9 B;  3KUY B;  4R8P C;  1HQ3 B;  5B33 C;  1S32 C;  4XUJ B;  1P3M A;  2YFW B;  4J8X D;  3W98 D;  4JJN C;  4KHA B;  5GSU D;  3REL A;  4YM6 C;  1P3A B;  1P3L A;  3LZ1 C;  3MGP D;  3B0D C;  2IO5 C;  1ZLA D;  3AZJ A;  5CPI B;  5F99 C;  1P3K B;  2F8N D;  5AY8 B;  3WKJ D;  3WTP C;  3REJ D;  5GXQ C;  4Z66 C;  5B0Z D;  3WA9 D;  1M1A D;  4KUD D;  3KUY D;  3LZ0 A;  1HQ3 D;  4H9Q B;  4XUJ D;  1P3G D;  3W97 D;  1U35 C;  3AN2 B;  4QLC C;  5B31 A;  4KGC B;  5KDM B;  3NQU A;  1P3O C;  1P3A D;  3AZN A;  2PYO A;  1H3O B;  2NQB C;  5DNM D;  5DNN C;  4R8P A;  5CPI D;  1P3K D;  3O62 D;  4G92 C;  1S32 A;  3C1B D;  5B2I C;  1F66 D;  5CHL B;  4JJN A;  4CSR A;  4YM6 A;  2ARO D;  3LZ1 A;  5CP6 D;  3AN2 D;  5BS7 C;  1P3B A;  3REH C;  5F99 A;  4KGC D;  5GXQ A;  1M19 B;  5B31 G;  3MVD C;  1KX5 B;  4ZBJ C;  5DNM A;  5GT3 A;  4X23 B;  1P3F B;  3X1S D;  1P3P C;  3O62 A;  5CPK D;  4H9S C;  4ZUX B;  1KX4 B;  5BO0 A;  3AZM C;  3B6F B;  5E5A A;  4QLC A;  3MGR A;  3AV2 B;  5AV8 B;  3LJA B;  1AOI A;  2NQB A;  2RVQ C;  5CPJ D;  3UTB A;  3X1T B;  3TU4 A;  1M19 D;  1KX5 D;  4X23 D;  5JRG A;  5B2I A;  4LD9 C;  3X1S A;  1P3F D;  1KX4 D;  4J8U A;  3AFA B;  3B6F D;  2L5A A;  5AVB B;  3UTA A;  3W99 C;  5C3I B;  3V9R B;  5AV9 B;  3MGQ B;  3R45 B;  1P34 C;  3MVD A;  1ID3 B;  1BH9 A;  3AV2 D;  5AV8 D;  3AZG B;  4WV4 B;  4H9R A;  3KWQ C;  5CPJ A;  3X1T D;  3AZI D;  5B2J B;  3AZM A;  4E45 A;  1EQZ D;  5B0Y B;  2CWE A;  4NE6 A;  5B1L A;  5B32 A;  3REI C;  2NZD C;  3VH6 A;  3AFA D;  5BT1 C;  5AVB D;  5AV9 D;  5B1M C;  5BNX A;  3A6N D;  3LEL A;  3MGQ D;  4WU9 A;  3REL B;  1F1E A;  3MGS C;  1P3I A;  3KSY A;  4NFT A;  4J8W C;  3AZG D;  3REK C;  3B6G C;  3AZJ B;  2HIO C;  5GT0 B;  5B2J D;  1EQZ A;  1P3L C;  5B0Y D;  3W99 A;  5AVC C;  3LZ0 B;  1P34 A;  3AZH C;  4H9N A;  5AV6 C;  2BYK A;  3AZE C;  1P3M D;  5B32 G;  4J8X B;  5GSU B;  5B31 B;  3AZL A;  3NQU B;  3REL D;  2HUE C;  3AZN B;  2F8N H;  3MGP B;  2PYO B;  4R8P B;  3AZJ D;  3REI A;  3REJ B;  5B0Z B;  3UT9 A;  1M1A B;  4KUD B;  5B1M A;  4JJN B;  3LZ0 D;  5B40 A;  4YM6 B;  1P3G B;  3LZ1 B;  3W97 B;  3B0D B;  1N1J A;  3REK A;  3B6G A;  2IO5 B;  1P3B B;  5B31 D;  4Z5T C;  3VH5 T;  1M18 A;  3AZF A;  3AZN D;  5DNM B;  2PYO D;  3VH5 W;  5GT3 B;  3AV1 C;  4Z2M G;  4R8P D;  5AVC A;  3NQJ A;  4DRA A;  3O62 B;  3KXB C;  3AZH A;  4YS3 A;  2CV5 C;  3W98 C;  5BO0 B;  4J8V A;  5AV6 A;  3C1B B;  3AZE A;  1S32 D;  3MNN A;  4WU8 C;  1F66 B;  5E5A B;  4QLC B;  4JJN D;  3MGR B;  3AZK C;  4YM6 D;  3AYW C;  3WKJ C;  2ARO B;  1AOI B;  3LZ1 D;  2NQB B;  5CP6 B;  4XZQ A;  1P3B D;  3UTB B;  5F99 D;  1HQ3 C;  4EO5 B;  5GXQ D;  3TU4 B;  5B24 C;  5GT3 D;  5JRG B;  3X1S B;  1B6W A;  3C1C C;  5CPK B;  4HGA B;  5JA4 A;  5B33 A;  4J8U B;  1P3A C;  3UTA B;  5E5A D;  4QLC D;  4H9P A;  4Z5T A;  3MGR D;  1P3K C;  4H9O A;  5AY8 C;  1BH9 B;  1TZY C;  4ZBJ B;  1AOI D;  2NQB D;  1JFI B;  4H9R B;  3AV1 A;  5CPJ B;  3UTB D;  3KXB A;  3WTP A;  2CV5 A;  1B67 A;  5AV5 C;  4Z66 A;  3TU4 D;  2JSS A;  4WU8 A;  5JRG D;  5B1L B;  5B2I D;  1WWS A;  5B32 B;  3AYW A;  1TAF A;  3WAA C;  4WZS B;  4J8U D;  1U35 A;  3UTA D;  3LEL B;  5BNX B;  4AWL C;  4WU9 B;  4WNN A;  1P3I B;  1P3O A;  3MVD D;  5B24 A;  4G91 B;  3X1V C;  5DNN A;  2YFW A;  3C1C A;  1A7W A;  3AZI B;  3X1U C;  3AZM D;  1EQZ B;  5B1L D;  1P34 B;  5B32 D;  5AY8 A;  1TZY A;  4H9N B;  2BYK B;  5BS7 A;  3A6N B;  4Z2M H;  3LEL D;  3REH A;  2FJ7 C;  3AZL B;  1P3F C;  4WU9 D;  1P3I D;  5AV5 A;  4ZUX C;  1R4V A;  1ULY A;  1P3P A;  4H9S A;  5KDM A;  3REI B;  3WAA A;  3UT9 B;  3AV2 C;  5AV8 C;  3LJA C;  1H3O A;  3W99 D;  5B1M B;  1P34 D;  5B40 B;  1P3M B;  3X1V A;  5FUG A;  1N1J B;  3REK B;  1KX3 C;  3AZL D;  3X1U A;  1M18 B;  3AZF B;  4LD9 A;  3MGQ C;  3NQJ B;  4YS3 B;  3AZH B;  3REI D;  4J8V B;  3AZE B;  1ID3 C;  3MNN B;  3UT9 D;  5B1M D;  2FJ7 A;  5B40 D;  5B2J C;  3W96 C;  3KWQ A;  3REK D;  4XZQ B;  3B6G D;  1M18 D;  3AZF D;  3LJA A;  5AVC D;  5JA4 B;  4YS3 D;  3AZH D;  2NZD A;  5B33 B;  4J8V D;  1S32 B;  5AV6 D;  3AZE D;  3MNN D;  1KX3 A;  4CSR B;  3MGS A;  1HTA A;  4Z5T B;  5GT0 C;  4J8W A;  5G49 A;  4XZQ D;  2HIO A;  3V9R A;  5F99 B;  3KXB B;  3WTP B;  2CV5 B;  3R45 A;  5GXQ B;  4Z66 B; 
#chains in the Genus database with same CATH topology
 1ID3 A;  4WU8 B;  4J8X C;  4UUZ A;  5GSU C;  3AYW B;  1TAF B;  2JCH A;  5B33 D;  3WTP E;  3AZN C;  1U35 B;  3W96 A;  3MGP C;  1ZLA C;  4Z5T D;  4WNN B;  1P3O B;  5BNV A;  2YFV A;  3REJ C;  5B0Z C;  5B24 B;  3WA9 C;  2VQR A;  5DNN B;  4M6B A;  3AV1 D;  1M1A C;  4KUD C;  3C1C B;  3KUY C;  3VH5 A;  3KXB D;  2F2A C;  4CAY A;  3WTP D;  4G92 B;  2CV5 D;  4Z66 D;  4XUJ C;  4WU8 D;  1P3G C;  2ZY3 A;  5B2I B;  3W97 C;  1P3B C;  3AZK D;  3AYW D;  5GT0 A;  1TZY B;  3EPK A;  1U35 D;  5DNM C;  2FFF B;  5GT3 C;  3REH B;  5CPI C;  1P3O D;  2BYM A;  5AV5 B;  3O62 C;  3MVD B;  3C1B C;  5B24 D;  5DNN D;  4J8X A;  2J8P A;  1P3P B;  1BH8 A;  4NE3 A;  3C1C D;  1F66 C;  5E5A C;  5GSU A;  3W98 A;  3AZM B;  3MGR C;  3WAA B;  2ARO C;  1AOI C;  3MGP A;  2Y2J A;  5CP6 C;  3AN2 C;  1ZLA A;  3AZK A;  4AWL B;  4KGC C;  2F8N A;  3UTB C;  3WKJ A;  5AY8 D;  3REJ A;  1TZY D;  3H0R C;  4EO5 C;  5B0Z A;  3TU4 C;  3X1V B;  5FUG B;  3WA9 A;  1M1A A;  4KUD A;  3REH D;  5JRG C;  3KUY A;  3X1S C;  2ZY5 A;  1HQ3 A;  3X1U B;  5CPK C;  4HGA C;  5AV5 D;  1WWI A;  4J8U C;  2Y2H A;  4XUJ A;  1P3G A;  3W97 A;  4LD9 B;  2ZY4 A;  4WJ3 C;  3UTA C;  1P3P D;  4KHA A;  3WAA D;  1P3A A;  2LY8 A;  3W99 B;  2FJ7 B;  5CPI A;  5CPJ C;  1P3K A;  1KX5 C;  1M19 C;  3C1B A;  2F8N G;  3X1V D;  3KWQ B;  4X23 C;  2RVQ D;  1F66 A;  5B1L C;  3X1U D;  4H9Q A;  1KX4 C;  5B32 C;  2Y2M A;  2ARO A;  3B6F C;  4NE5 A;  4LD9 D;  5CP6 A;  3AN2 A;  3LEL C;  2Y2N A;  1Q9C A;  4KGC A;  2NZD B;  3B0B A;  4DRB A;  4WU9 C;  1P3I C;  4G91 C;  1KX3 B;  2FJ7 D;  3MGS B;  5CPK A;  3X1T C;  4ZUX D;  3AZI C;  4J8W B;  1EQZ C;  3VH6 T;  5G49 B;  3KWQ D;  3B6G B;  1KU5 A;  2HIO B;  3VH6 W;  2Y2Q A;  1P3L B;  3AFA C;  3LJA D;  5AVB C;  1JFI A;  5AV9 C;  5C3I C;  5AVC B;  3A6N C;  2XD1 A;  4UUZ B;  4UPK A;  2NZD D;  3AZL C;  5AV6 B;  1KX5 A;  1M19 A;  5BT1 D;  3AZG C;  3W96 B;  4X23 A;  1KX3 D;  1P3F A;  3B0C T;  3MGS D;  4ZUX A;  1KX4 A;  5BNV B;  2HUE B;  2YFV B;  4J8W D;  3B0C W;  3B6F A;  5B0Y C;  3UT9 C;  3EPL A;  2HIO D;  4CAY B;  1P3L D;  5B40 C;  3AV2 A;  5AV8 A;  1ID3 D;  1P3M C;  2F8N K;  3X1T A;  3REL C;  3AZI A;  1M18 C;  3AZF C;  3W96 D;  1BFM A;  4H9P B;  3AZJ C;  4H9O B;  2BYM B;  4YS3 C;  3EPH A;  3AFA A;  4J8V C;  3F6T A;  5AVB A;  3AV1 B;  3MNN C;  4E44 A;  5AV9 A;  3A6N A;  3MGQ A;  1BH8 B;  3W98 B;  3LZ0 C;  4DQY B;  3AZG A;  1ZLA B;  3AZK B;  4XZQ C;  5B31 C;  2F8N B;  3WKJ B;  5B2J A;  5GT0 D;  3AL0 C;  5B0Y A;  2PYO C;  3WA9 B;  3KUY B;  4R8P C;  1HQ3 B;  5B33 C;  1S32 C;  4XUJ B;  1P3M A;  2YFW B;  3EG5 B;  4J8X D;  3W98 D;  4JJN C;  4KHA B;  5GSU D;  3REL A;  4YM6 C;  1P3A B;  1P3L A;  3LZ1 C;  3MGP D;  3B0D C;  2IO5 C;  1ZLA D;  3AZJ A;  5CPI B;  5F99 C;  1P3K B;  2Y2K A;  2F8N D;  5AY8 B;  2UWX A;  3WTP C;  3WKJ D;  3REJ D;  5GXQ C;  4Z66 C;  5B0Z D;  3WA9 D;  1M1A D;  4KUD D;  3KUY D;  2G5H C;  3LZ0 A;  1HQ3 D;  4H9Q B;  4XUJ D;  1P3G D;  3W97 D;  1U35 C;  3AN2 B;  4QLC C;  5B31 A;  4KGC B;  5KDM B;  3NQU A;  1P3O C;  1P3A D;  3AZN A;  2PYO A;  1H3O B;  2NQB C;  5DNM D;  5DNN C;  4R8P A;  5CPI D;  1P3K D;  3O62 D;  4G92 C;  1S32 A;  3C1B D;  5B2I C;  1F66 D;  5CHL B;  4JJN A;  4CSR A;  4YM6 A;  2ARO D;  3LZ1 A;  5CP6 D;  3AN2 D;  5BS7 C;  1P3B A;  3REH C;  5F99 A;  4KGC D;  5GXQ A;  1M19 B;  5B31 G;  3MVD C;  1KX5 B;  4ZBJ C;  5DNM A;  5GT3 A;  4X23 B;  1P3F B;  3X1S D;  1P3P C;  3O62 A;  5CPK D;  4H9S C;  4ZUX B;  1KX4 B;  5BO0 A;  3AZM C;  3B6F B;  5E5A A;  4QLC A;  3MGR A;  3FDD A;  3AV2 B;  5AV8 B;  3LJA B;  1AOI A;  2NQB A;  2RVQ C;  5CPJ D;  3UTB A;  3X1T B;  3TU4 A;  1M19 D;  1KX5 D;  4X23 D;  5JRG A;  1T3U A;  5B2I A;  4LD9 C;  3X1S A;  1P3F D;  1KX4 D;  4J8U A;  3AFA B;  3B6F D;  2L5A A;  5AVB B;  2ZY2 A;  3W99 C;  5C3I B;  3V9R B;  5AV9 B;  3MGQ B;  3UTA A;  3R45 B;  1P34 C;  3MVD A;  1ID3 B;  1BH9 A;  3AV2 D;  5AV8 D;  3AZG B;  2G5I C;  4WV4 B;  4H9R A;  3KWQ C;  5CPJ A;  3X1T D;  3AZI D;  5B2J B;  3AZM A;  4E45 A;  1EQZ D;  5B0Y B;  2CWE A;  4NE6 A;  5B1L A;  5B32 A;  3REI C;  2NZD C;  3VH6 A;  3AFA D;  5BT1 C;  5AVB D;  5AV9 D;  5B1M C;  5BNX A;  3A6N D;  3LEL A;  3MGQ D;  4WU9 A;  3REL B;  1F1E A;  3MGS C;  1P3I A;  3KSY A;  4NFT A;  4J8W C;  3AZG D;  3IP4 C;  3REK C;  2JE5 A;  3B6G C;  1W2E A;  3AZJ B;  2HIO C;  5GT0 B;  5B2J D;  1EQZ A;  1P3L C;  3EPJ A;  5B0Y D;  3W99 A;  5AVC C;  3LZ0 B;  1P34 A;  3AZH C;  4H9N A;  5AV6 C;  2BYK A;  3AZE C;  1P3M D;  5B32 G;  4J8X B;  5GSU B;  5B31 B;  3AZL A;  3NQU B;  3REL D;  2HUE C;  3AZN B;  2F8N H;  3MGP B;  2PYO B;  4R8P B;  3AZJ D;  3REI A;  3REJ B;  5B0Z B;  3UT9 A;  1M1A B;  4KUD B;  5B1M A;  4JJN B;  3LZ0 D;  5B40 A;  4YM6 B;  1P3G B;  3LZ1 B;  3W97 B;  3B0D B;  3P5J B;  1N1J A;  3REK A;  3B6G A;  2IO5 B;  1P3B B;  5B31 D;  4Z5T C;  3VH5 T;  1M18 A;  3AZF A;  3AZN D;  5DNM B;  2PYO D;  3VH5 W;  5GT3 B;  3AV1 C;  4Z2M G;  4R8P D;  5AVC A;  3NQJ A;  4DRA A;  3O62 B;  3KXB C;  3AZH A;  4YS3 A;  2CV5 C;  3W98 C;  5BO0 B;  4J8V A;  5AV6 A;  3C1B B;  3AZE A;  1S32 D;  3MNN A;  4WU8 C;  1F66 B;  5E5A B;  4QLC B;  4JJN D;  3A1I A;  2BG1 A;  3MGR B;  3AZK C;  4YM6 D;  3AYW C;  3WKJ C;  2ARO B;  1AOI B;  3LZ1 D;  2NQB B;  5CP6 B;  2DF4 C;  2DQN C;  4XZQ A;  1P3B D;  3UTB B;  5F99 D;  1HQ3 C;  4EO5 B;  5GXQ D;  3TU4 B;  5B24 C;  5GT3 D;  5JRG B;  3X1S B;  1B6W A;  3C1C C;  5CPK B;  4HGA B;  5JA4 A;  5B33 A;  4J8U B;  1P3A C;  3UTA B;  5E5A D;  4QLC D;  4H9P A;  4Z5T A;  3MGR D;  1P3K C;  3H0M C;  4H9O A;  5AY8 C;  1BH9 B;  1TZY C;  4ZBJ B;  1AOI D;  2Y2G A;  2NQB D;  1JFI B;  4H9R B;  3AV1 A;  5CPJ B;  3UTB D;  3KXB A;  3WTP A;  2CV5 A;  3A1K A;  1B67 A;  5AV5 C;  4Z66 A;  2Y2P A;  2JSS A;  3TU4 D;  3KFU G;  4WU8 A;  5JRG D;  5B1L B;  5B2I D;  1WWS A;  5B32 B;  3AYW A;  1TAF A;  3WAA C;  4WZS B;  4J8U D;  1U35 A;  3UTA D;  3LEL B;  5BNX B;  2ZM5 A;  4AWL C;  4WU9 B;  4WNN A;  1P3I B;  1P3O A;  3MVD D;  5B24 A;  4G91 B;  3X1V C;  5DNN A;  2YFW A;  2Y2O A;  3C1C A;  1A7W A;  3AZI B;  3X1U C;  3AZM D;  1EQZ B;  1PZR A;  5B1L D;  1P34 B;  5B32 D;  5AY8 A;  1TZY A;  4H9N B;  2BYK B;  3H0L C;  5BS7 A;  3A6N B;  4Z2M H;  3LEL D;  3REH A;  2FJ7 C;  3AZL B;  1P3F C;  4WU9 D;  1P3I D;  5AV5 A;  2Y2I A;  4ZUX C;  1R4V A;  1ULY A;  1P3P A;  4H9S A;  2XD5 A;  5KDM A;  3REI B;  3WAA A;  3UT9 B;  3AV2 C;  5AV8 C;  3LJA C;  1H3O A;  3W99 D;  5B1M B;  2Y2L A;  1P34 D;  5B40 B;  1P3M B;  3X1V A;  5FUG A;  1N1J B;  3REK B;  1KX3 C;  3AZL D;  3X1U A;  1M18 B;  3AZF B;  4LD9 A;  2RIQ A;  3MGQ C;  3NQJ B;  4YS3 B;  3AZH B;  3REI D;  4J8V B;  3AZE B;  1ID3 C;  3MNN B;  3UT9 D;  5B1M D;  2FJ7 A;  1Z2C B;  5B40 D;  5B2J C;  3W96 C;  3KWQ A;  3REK D;  4XZQ B;  3B6G D;  1M18 D;  3AZF D;  3LJA A;  5AVC D;  5JA4 B;  4YS3 D;  3AZH D;  2NZD A;  5B33 B;  4J8V D;  1S32 B;  5AV6 D;  3AZE D;  3MNN D;  1KX3 A;  4CSR B;  3MGS A;  1HTA A;  4Z5T B;  2W8S A;  5GT0 C;  4J8W A;  5G49 A;  4XZQ D;  2HIO A;  3V9R A;  5F99 B;  3KXB B;  3WTP B;  2CV5 B;  3R45 A;  5GXQ B;  4Z66 B; 
#chains in the Genus database with same CATH homology
 1ID3 A;  4WU8 B;  4J8X C;  4UUZ A;  5GSU C;  3AYW B;  1TAF B;  2JCH A;  5B33 D;  3WTP E;  3AZN C;  1U35 B;  3W96 A;  3MGP C;  1ZLA C;  4Z5T D;  4WNN B;  1P3O B;  5BNV A;  2YFV A;  3REJ C;  5B0Z C;  5B24 B;  3WA9 C;  2VQR A;  5DNN B;  4M6B A;  3AV1 D;  1M1A C;  4KUD C;  3C1C B;  3KUY C;  3VH5 A;  3KXB D;  2F2A C;  4CAY A;  3WTP D;  4G92 B;  2CV5 D;  4Z66 D;  4XUJ C;  4WU8 D;  1P3G C;  2ZY3 A;  5B2I B;  3W97 C;  1P3B C;  3AZK D;  3AYW D;  5GT0 A;  1TZY B;  3EPK A;  1U35 D;  5DNM C;  2FFF B;  5GT3 C;  3REH B;  5CPI C;  1P3O D;  2BYM A;  5AV5 B;  3O62 C;  3MVD B;  3C1B C;  5B24 D;  5DNN D;  4J8X A;  2J8P A;  1P3P B;  1BH8 A;  4NE3 A;  3C1C D;  1F66 C;  5E5A C;  5GSU A;  3W98 A;  3AZM B;  3MGR C;  3WAA B;  2ARO C;  1AOI C;  3MGP A;  2Y2J A;  5CP6 C;  3AN2 C;  1ZLA A;  3AZK A;  4AWL B;  4KGC C;  2F8N A;  3UTB C;  3WKJ A;  5AY8 D;  3REJ A;  1TZY D;  3H0R C;  4EO5 C;  5B0Z A;  3TU4 C;  3X1V B;  5FUG B;  3WA9 A;  1M1A A;  4KUD A;  3REH D;  5JRG C;  3KUY A;  3X1S C;  2ZY5 A;  1HQ3 A;  3X1U B;  5CPK C;  4HGA C;  5AV5 D;  1WWI A;  4J8U C;  2Y2H A;  4XUJ A;  1P3G A;  3W97 A;  4LD9 B;  2ZY4 A;  4WJ3 C;  3UTA C;  1P3P D;  4KHA A;  3WAA D;  1P3A A;  2LY8 A;  3W99 B;  2FJ7 B;  5CPI A;  5CPJ C;  1P3K A;  1KX5 C;  1M19 C;  3C1B A;  2F8N G;  3X1V D;  3KWQ B;  4X23 C;  2RVQ D;  1F66 A;  5B1L C;  3X1U D;  4H9Q A;  1KX4 C;  5B32 C;  2Y2M A;  2ARO A;  3B6F C;  4NE5 A;  4LD9 D;  5CP6 A;  3AN2 A;  3LEL C;  2Y2N A;  1Q9C A;  4KGC A;  2NZD B;  3B0B A;  4DRB A;  4WU9 C;  1P3I C;  4G91 C;  1KX3 B;  2FJ7 D;  3MGS B;  5CPK A;  3X1T C;  4ZUX D;  3AZI C;  4J8W B;  1EQZ C;  3VH6 T;  5G49 B;  3KWQ D;  3B6G B;  1KU5 A;  2HIO B;  3VH6 W;  2Y2Q A;  1P3L B;  3AFA C;  3LJA D;  5AVB C;  1JFI A;  5AV9 C;  5C3I C;  5AVC B;  3A6N C;  2XD1 A;  4UUZ B;  4UPK A;  2NZD D;  3AZL C;  5AV6 B;  1KX5 A;  1M19 A;  5BT1 D;  3AZG C;  3W96 B;  4X23 A;  1KX3 D;  1P3F A;  3B0C T;  3MGS D;  4ZUX A;  1KX4 A;  5BNV B;  2HUE B;  2YFV B;  4J8W D;  3B0C W;  3B6F A;  5B0Y C;  3UT9 C;  3EPL A;  2HIO D;  4CAY B;  1P3L D;  5B40 C;  3AV2 A;  5AV8 A;  1ID3 D;  1P3M C;  2F8N K;  3X1T A;  3REL C;  3AZI A;  1M18 C;  3AZF C;  3W96 D;  1BFM A;  4H9P B;  3AZJ C;  4H9O B;  2BYM B;  4YS3 C;  3EPH A;  3AFA A;  4J8V C;  3F6T A;  5AVB A;  3AV1 B;  3MNN C;  4E44 A;  5AV9 A;  3A6N A;  3MGQ A;  1BH8 B;  3W98 B;  3LZ0 C;  4DQY B;  3AZG A;  1ZLA B;  3AZK B;  4XZQ C;  5B31 C;  2F8N B;  3WKJ B;  5B2J A;  5GT0 D;  3AL0 C;  5B0Y A;  2PYO C;  3WA9 B;  3KUY B;  4R8P C;  1HQ3 B;  5B33 C;  1S32 C;  4XUJ B;  1P3M A;  2YFW B;  3EG5 B;  4J8X D;  3W98 D;  4JJN C;  4KHA B;  5GSU D;  3REL A;  4YM6 C;  1P3A B;  1P3L A;  3LZ1 C;  3MGP D;  3B0D C;  2IO5 C;  1ZLA D;  3AZJ A;  5CPI B;  5F99 C;  1P3K B;  2Y2K A;  2F8N D;  5AY8 B;  2UWX A;  3WTP C;  3WKJ D;  3REJ D;  5GXQ C;  4Z66 C;  5B0Z D;  3WA9 D;  1M1A D;  4KUD D;  3KUY D;  2G5H C;  3LZ0 A;  1HQ3 D;  4H9Q B;  4XUJ D;  1P3G D;  3W97 D;  1U35 C;  3AN2 B;  4QLC C;  5B31 A;  4KGC B;  5KDM B;  3NQU A;  1P3O C;  1P3A D;  3AZN A;  2PYO A;  1H3O B;  2NQB C;  5DNM D;  5DNN C;  4R8P A;  5CPI D;  1P3K D;  3O62 D;  4G92 C;  1S32 A;  3C1B D;  5B2I C;  1F66 D;  5CHL B;  4JJN A;  4CSR A;  4YM6 A;  2ARO D;  3LZ1 A;  5CP6 D;  3AN2 D;  5BS7 C;  1P3B A;  3REH C;  5F99 A;  4KGC D;  5GXQ A;  1M19 B;  5B31 G;  3MVD C;  1KX5 B;  4ZBJ C;  5DNM A;  5GT3 A;  4X23 B;  1P3F B;  3X1S D;  1P3P C;  3O62 A;  5CPK D;  4H9S C;  4ZUX B;  1KX4 B;  5BO0 A;  3AZM C;  3B6F B;  5E5A A;  4QLC A;  3MGR A;  3FDD A;  3AV2 B;  5AV8 B;  3LJA B;  1AOI A;  2NQB A;  2RVQ C;  5CPJ D;  3UTB A;  3X1T B;  3TU4 A;  1M19 D;  1KX5 D;  4X23 D;  5JRG A;  1T3U A;  5B2I A;  4LD9 C;  3X1S A;  1P3F D;  1KX4 D;  4J8U A;  3AFA B;  3B6F D;  2L5A A;  5AVB B;  2ZY2 A;  3W99 C;  5C3I B;  3V9R B;  5AV9 B;  3MGQ B;  3UTA A;  3R45 B;  1P34 C;  3MVD A;  1ID3 B;  1BH9 A;  3AV2 D;  5AV8 D;  3AZG B;  2G5I C;  4WV4 B;  4H9R A;  3KWQ C;  5CPJ A;  3X1T D;  3AZI D;  5B2J B;  3AZM A;  4E45 A;  1EQZ D;  5B0Y B;  2CWE A;  4NE6 A;  5B1L A;  5B32 A;  3REI C;  2NZD C;  3VH6 A;  3AFA D;  5BT1 C;  5AVB D;  5AV9 D;  5B1M C;  5BNX A;  3A6N D;  3LEL A;  3MGQ D;  4WU9 A;  3REL B;  1F1E A;  3MGS C;  1P3I A;  3KSY A;  4NFT A;  4J8W C;  3AZG D;  3IP4 C;  3REK C;  2JE5 A;  3B6G C;  1W2E A;  3AZJ B;  2HIO C;  5GT0 B;  5B2J D;  1EQZ A;  1P3L C;  3EPJ A;  5B0Y D;  3W99 A;  5AVC C;  3LZ0 B;  1P34 A;  3AZH C;  4H9N A;  5AV6 C;  2BYK A;  3AZE C;  1P3M D;  5B32 G;  4J8X B;  5GSU B;  5B31 B;  3AZL A;  3NQU B;  3REL D;  2HUE C;  3AZN B;  2F8N H;  3MGP B;  2PYO B;  4R8P B;  3AZJ D;  3REI A;  3REJ B;  5B0Z B;  3UT9 A;  1M1A B;  4KUD B;  5B1M A;  4JJN B;  3LZ0 D;  5B40 A;  4YM6 B;  1P3G B;  3LZ1 B;  3W97 B;  3B0D B;  3P5J B;  1N1J A;  3REK A;  3B6G A;  2IO5 B;  1P3B B;  5B31 D;  4Z5T C;  3VH5 T;  1M18 A;  3AZF A;  3AZN D;  5DNM B;  2PYO D;  3VH5 W;  5GT3 B;  3AV1 C;  4Z2M G;  4R8P D;  5AVC A;  3NQJ A;  4DRA A;  3O62 B;  3KXB C;  3AZH A;  4YS3 A;  2CV5 C;  3W98 C;  5BO0 B;  4J8V A;  5AV6 A;  3C1B B;  3AZE A;  1S32 D;  3MNN A;  4WU8 C;  1F66 B;  5E5A B;  4QLC B;  4JJN D;  3A1I A;  2BG1 A;  3MGR B;  3AZK C;  4YM6 D;  3AYW C;  3WKJ C;  2ARO B;  1AOI B;  3LZ1 D;  2NQB B;  5CP6 B;  2DF4 C;  2DQN C;  4XZQ A;  1P3B D;  3UTB B;  5F99 D;  1HQ3 C;  4EO5 B;  5GXQ D;  3TU4 B;  5B24 C;  5GT3 D;  5JRG B;  3X1S B;  1B6W A;  3C1C C;  5CPK B;  4HGA B;  5JA4 A;  5B33 A;  4J8U B;  1P3A C;  3UTA B;  5E5A D;  4QLC D;  4H9P A;  4Z5T A;  3MGR D;  1P3K C;  3H0M C;  4H9O A;  5AY8 C;  1BH9 B;  1TZY C;  4ZBJ B;  1AOI D;  2Y2G A;  2NQB D;  1JFI B;  4H9R B;  3AV1 A;  5CPJ B;  3UTB D;  3KXB A;  3WTP A;  2CV5 A;  3A1K A;  1B67 A;  5AV5 C;  4Z66 A;  2Y2P A;  2JSS A;  3TU4 D;  3KFU G;  4WU8 A;  5JRG D;  5B1L B;  5B2I D;  1WWS A;  5B32 B;  3AYW A;  1TAF A;  3WAA C;  4WZS B;  4J8U D;  1U35 A;  3UTA D;  3LEL B;  5BNX B;  2ZM5 A;  4AWL C;  4WU9 B;  4WNN A;  1P3I B;  1P3O A;  3MVD D;  5B24 A;  4G91 B;  3X1V C;  5DNN A;  2YFW A;  2Y2O A;  3C1C A;  1A7W A;  3AZI B;  3X1U C;  3AZM D;  1EQZ B;  1PZR A;  5B1L D;  1P34 B;  5B32 D;  5AY8 A;  1TZY A;  4H9N B;  2BYK B;  3H0L C;  5BS7 A;  3A6N B;  4Z2M H;  3LEL D;  3REH A;  2FJ7 C;  3AZL B;  1P3F C;  4WU9 D;  1P3I D;  5AV5 A;  2Y2I A;  4ZUX C;  1R4V A;  1ULY A;  1P3P A;  4H9S A;  2XD5 A;  5KDM A;  3REI B;  3WAA A;  3UT9 B;  3AV2 C;  5AV8 C;  3LJA C;  1H3O A;  3W99 D;  5B1M B;  2Y2L A;  1P34 D;  5B40 B;  1P3M B;  3X1V A;  5FUG A;  1N1J B;  3REK B;  1KX3 C;  3AZL D;  3X1U A;  1M18 B;  3AZF B;  4LD9 A;  2RIQ A;  3MGQ C;  3NQJ B;  4YS3 B;  3AZH B;  3REI D;  4J8V B;  3AZE B;  1ID3 C;  3MNN B;  3UT9 D;  5B1M D;  2FJ7 A;  1Z2C B;  5B40 D;  5B2J C;  3W96 C;  3KWQ A;  3REK D;  4XZQ B;  3B6G D;  1M18 D;  3AZF D;  3LJA A;  5AVC D;  5JA4 B;  4YS3 D;  3AZH D;  2NZD A;  5B33 B;  4J8V D;  1S32 B;  5AV6 D;  3AZE D;  3MNN D;  1KX3 A;  4CSR B;  3MGS A;  1HTA A;  4Z5T B;  2W8S A;  5GT0 C;  4J8W A;  5G49 A;  4XZQ D;  2HIO A;  3V9R A;  5F99 B;  3KXB B;  3WTP B;  2CV5 B;  3R45 A;  5GXQ B;  4Z66 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...