4J8WC

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wC00
3MGRC 3WTPB 2AROC 5GT3A 1P3BA 3B0DB 1P3LA 5B2IB 1B67A 3C1BB 3W97A 4ZUXD 5F99B 5AVBC 1KX3C 4YS3C 1HQ3C 4XZQB 5DNNB 1ZLAD 3UT9B 1P34A 2NQBD 3WA9D 4X23D 3AZJD 4CSRB 1JFIB 5KDMB 5CPJB 4H9OA 4R8PD 2NZDA 3X1VB 1P3AC 4WU8D 5B24D 5CPKC 3AV1B 3KXBC 3RELC 5CHLB 3AZKC 1U35D 5B1MC 3V9RA 3AZMA 4G91C 4WU9A 5CPIA 3REKB 3AFAA 5FUGB 4Z66A 2HIOC 1ID3B 5BNVB 5DNMB 5GSUC 5AV8A 3KUYD 3MGPB 3A6NC 3AZHD 3B6FC 5B0YA 4J8WD 3AZIC 1P3GD 3TU4C 2YFWB 1P3FA 2F8NB 2PYOD 1BH9A 4DRBA 3R45A 3LJAD 3AYWD 3VH6T 5B33A 5B32G 5E5AA 5AV9A 1P3PD 5BT1D 4ZUXC 3AZED 3W98D 3X1SB 4CAYB 1ZLAC 3WA9C 1P3MD 2NQBC 4LD9B 3REJD 4X23C 5AV6B 3AZJC 1KX4D 4R8PC 3WAAD 5B31B 5JRGD 3AV2D 5B0ZA 4Z5TA 4WU8C 5B24C 1U35C 3LZ0D 4G92B 3B6GB 4ZBJC 5B2JA 3MGRA 2AROA 3WTPD 4E44A 1P3KB 5GXQD 3AZLB 5GT0D 5CP6B 5B2ID 1M18B 3KUYC 3C1BD 3AZHC 5F99D 2CV5B 1KX3A 3UTAB 1M1AD 4J8WC 4YS3A 1HQ3A 3LZ1B 3C1CB 3UT9D 1S32B 1P3GC 2PYOC 1H3OA 3LJAC 3AYWC 5CPJD 4XUJA 2IO5C 1P3PC 1P3OB 4J8XD 5BT1C 1P3AA 4KGCB 3AZEC 3W98C 3AV1D 2FJ7B 3RELA 3AZKA 3MGSD 5JA4A 1P3MC 5B1MA 3REJC 1P3LB 3W97B 3REKD 1KX4C 3WAAC 2HIOA 5JRGC 1ID3D 3AV2C 3MNNA 1P34B 1B6WA 1KU5A 2BYMA 3A6NA 3MGPD 3B6FA 3X1TC 2F8NG 4H9RB 3LZ0C 3AZIA 5BNXA 3KWQB 1TAFA 2F8ND 4H9NA 3WTPC 5C3IB 3B0DC 5GXQC 1F1EA 5GT0C 5B2IC 4Z2MH 4QLCB 5B40B 3C1BC 4ZUXA 4WU9B 2HUEB 5F99C 1P3IB 3B0BA 1M1AC 3B0CT 1EQZD 3X1SD 4AWLB 3AZFB 1ZLAA 1AOIB 3UT9C 2NQBA 4LD9D 5B31G 4X23A 3AZJA 4H9QB 5B1LB 5CPJC 1KX5D 4R8PA 1BFMA 1BH8A 3AZNB 4WV4B 4J8XC 4KHAB 4WU8A 5B24A 4UUZA 1BH9B 3AV1C 4NE6A 3MGSC 5B33B 1U35A 5E5AB 5AV9B 4J8VD 4YM6D 3REKC 5AVCB 1ID3C 1P3KD 1TZYB 3VH6A 3KUYA 1M18D 3MGPC 3AZHA 3W99B 2CV5D 4J8WA 1A7WA 4KUDD 3WKJB 3MVDD 5B0ZB 3C1CD 1P3GA 2PYOA 4Z5TB 3LJAA 3AYWA 4JJNB 1P3PA 1P3OD 4KGCD 3AZEA 1EQZC 2AROB 3KSYA 3W98A 2FJ7D 3X1SC 2YFVB 5G49B 1P3MA 4LD9C 3REJA 3B0CW 3NQUA 1KX4A 1KX5C 3WAAA 5JRGA 3AV2A 4WNNA 2LY8A 5B32D 2BYKA 4XUJB 3LZ0A 4J8UB 4G92C 3KWQD 4J8VC 4YM6C 5AV5B 3REHB 3WTPA 3AZKB 4WZSB 3MGQB 3O62D 5JA4B 1F66B 5GXQA 1P3KC 5GT0A 5B2IA 1M18C 4G91B 4QLCD 3C1BA 5B40D 1P3ID 5F99A 5BO0A 2CV5C 1M19B 1M1AA 3AZGD 3X1TD 3REIB 4KUDC 2HIOB 3AZFD 3MVDC 1AOID 3UT9A 3MNNB 3C1CC 1JFIA 4CSRA 5AY8B 5KDMA 3B6FB 5CPJA 5B1LD 4HGAB 3AZIB 3AZND 4J8XA 1P3OC 3NQJB 4KGCC 3LELB 3X1UB 4H9NB 3AV1A 5AVBA 2FJ7C 3MGSA 3UTBB 4XZQD 5DNND 4EO5C 3REKA 5FUGA 3W96B 5AVCD 4H9SC 5BS7C 1ID3A 5BNVA 2NQBB 3AN2B 1TZYD 4X23B 3AZJB 5B32C 3X1VD 3MGPA 1N1JA 5CPKA 3W99D 3KXBA 5GT3B 1P3BB 1BH8B 3WKJD 3KWQC 2YFWA 2F8NA 5B24B 4UUZB 5C3IC 4JJND 3O62C 5DNMD 5GSUA 4ZBJB 4QLCC 5B40C 1P3IC 1EQZA 3AZGC 4H9OB 3AZFC 1AOIC 2NZDB 4LD9A 3TU4A 5B1LC 1KX5A 3AZNC 3V9RB 3AZMB 2PYOB 4E45A 5CPIB 3AFAB 4Z66B 3LJAB 1Q9CA 4XUJD 4XZQC 5DNNC 4J8UD 3WA9A 5E5AC 4J8VA 4YM6A 5AV8B 5AV5D 2F8NK 5AV6D 3REHD 3W98B 5AVCC 5B0YB 3MGQD 5B31D 2L5AA 1P3KA 1F66D 1P3MB 1TZYC 3X1VC 1M18A 1P3FB 3W99C 2CV5A 1M19D 3R45B 4KUDA 3REID 3WKJC 3MVDA 3C1CA 3B6GD 3MNND 2BYKB 5AY8D 3VH5T 4JJNC 3LZ0B 5DNMC 1WWSA 3AZLD 1P3OA 4KGCA 5CP6D 3LELD 3X1UD 2FJ7A 3UTAD 3UTBD 5GXQB 5GT0B 3LZ1D 1S32D 1HTAA 5BO0B 1M1AB 3W96D 4H9SA 5BS7A 4H9PA 5B2JB 3AN2D 5B32A 3MGRB 1R4VA 5GT3D 4XUJC 1P3BD 4H9RA 4J8UC 3KWQA 4J8XB 1P3LD 5AV5C 5AV6C 3REHC 3W97D 5AVBB 1KX3B 3MGSB 3MGQC 1HQ3B 5B31C 3O62A 4YS3B 1F66C 1P34D 4M6BA 4QLCA 5B40A 1P3IA 1M19C 1H3OB 3AZGA 4Z2MG 3X1TA 3REIC 3AZFA 1AOIA 3B6GC 3MNNC 2NZDD 1P3AB 5AY8C 1N1JB 4H9QA 5CPKB 3KXBB 5B1LA 3RELB 4HGAC 3AZNA 5B1MB 3AZLC 4KHAA 3WTPE 3VH5W 5CP6C 3AZMD 3LELC 3X1UC 4WU9D 5CPID 3AFAD 4Z66D 3UTAC 2JSSA 4XZQA 5DNNA 3UTBC 4NE3A 3LZ1C 1S32C 5GSUB 5AV8D 2BYMB 2F8NH 3A6NB 1EQZB 5AVCA 3W96C 5B0YD 5BNXB 1TAFB 3TU4B 1TZYA 3AN2C 3X1VA 1P3FD 3W99A 1KX5B 5GT3C 1P3BC 5B33D 3WKJA 5E5AD 1P3LC 5AV9D 4NE5A 4ZUXB 3W97C 4DRAA 2RVQD 4JJNA 1ZLAB 5DNMA 3WA9B 1P34C 4J8VB 4YM6B 1ULYA 4R8PB 2YFVA 5G49A 2NZDC 5B0ZD 4Z5TD 4WU8B 1U35B 4KUDB 3MVDB 3AZMC 5B2JD 5CPIC 4WU9C 3MGRD 2HUEC 4Z66C 3AFAC 2AROD 3X1SA 4AWLC 2CWEA 4CAYA 1WWIA 4J8UA 5AV5A 5AV8C 5AV6A 3KUYB 3VH6W 3REHA 3AZHB 5AVBD 1KX3D 5B0YC 4J8WB 3MGQA 5B31A 4YS3D 1HQ3D 1F66A 4EO5B 1P3GB 3VH5A 1P3FC 1M19A 3AYWB 3REIA 5B33C 4H9PB 4NFTA 2IO5B 3B6GA 1P3PB 5AV9C 1P3AD 5B32B 5AY8A 3AZEB 5CPKD 3KXBD 2RVQC 3RELD 3AZKD 5B1MD 3AZLA 3NQJA 3REJB 5CP6A 3LELA 3X1UA 3NQUB 1KX4B 3UTAA 3WAAB 3UTBA 5JRGB 3O62B 2HIOD 3AV2B 4WNNB 3LZ1A 5B0ZC 1S32A 5GSUD 4Z5TC 3A6ND 3B6FD 3W96A 3AZGB 3X1TB 3AZID 3TU4D 3AN2A 5B2JC
chains in the Genus database with same CATH superfamily
3MGRC 3WTPB 2AROC 5GT3A 1P3BA 3B0DB 1P3LA 5B2IB 1B67A 3C1BB 3W97A 4ZUXD 5F99B 5AVBC 1KX3C 4YS3C 1HQ3C 4XZQB 5DNNB 1ZLAD 3UT9B 1P34A 1PZRA 2NQBD 3WA9D 4X23D 3AZJD 4CSRB 1JFIB 5KDMB 3EPJA 5CPJB 4H9OA 4R8PD 2NZDA 3TU4D 3X1VB 1P3AC 4WU8D 5B24D 5CPKC 3AV1B 3KXBC 3RELC 5CHLB 3AZKC 1U35D 5B1MC 3V9RA 3AZMA 4G91C 4WU9A 5CPIA 3REKB 3AFAA 5FUGB 4Z66A 2HIOC 1ID3B 5BNVB 5DNMB 5GSUC 5AV8A 3KUYD 3MGPB 3A6NC 3AZHD 3B6FC 5B0YA 3EPLA 4J8WD 3AZIC 1P3GD 3TU4C 2YFWB 1P3FA 2F8NB 2PYOD 1BH9A 4DRBA 3R45A 3LJAD 3AYWD 3VH6T 5B33A 5B32G 2J8PA 2Y2OA 2Y2LA 5E5AA 5AV9A 1P3PD 5BT1D 4ZUXC 3AZED 3W98D 2G5HC 3X1SB 4CAYB 1ZLAC 3WA9C 1P3MD 2NQBC 4LD9B 3REJD 4X23C 5AV6B 3AZJC 3AL0C 1KX4D 4R8PC 3WAAD 5B31B 5JRGD 3AV2D 5B0ZA 4DQYB 4Z5TA 2BG1A 4WU8C 5B24C 1U35C 3LZ0D 4G92B 3B6GB 4ZBJC 5B2JA 3MGRA 2AROA 3WTPD 4E44A 1P3KB 3A1IA 5GXQD 3AZLB 5GT0D 5CP6B 5B2ID 1M18B 3KUYC 3C1BD 3AZHC 5F99D 2CV5B 1KX3A 3UTAB 1M1AD 4J8WC 4YS3A 1HQ3A 3LZ1B 3C1CB 3UT9D 1S32B 1P3GC 2PYOC 1H3OA 3LJAC 3AYWC 5CPJD 4XUJA 2IO5C 1P3PC 1P3OB 4J8XD 5BT1C 1P3AA 4KGCB 3H0MC 3AZEC 2ZY4A 3W98C 3AV1D 2FJ7B 3RELA 3AZKA 3MGSD 5JA4A 1P3MC 5B1MA 3REJC 1P3LB 3W97B 3REKD 1KX4C 3WAAC 2HIOA 5JRGC 1ID3D 3AV2C 3MNNA 4WJ3C 1P34B 1B6WA 3FDDA 1KU5A 2BYMA 3A6NA 3MGPD 3B6FA 3X1TC 2F8NG 4H9RB 3LZ0C 3AZIA 5BNXA 3KWQB 2Y2JA 1TAFA 2F8ND 4H9NA 3WTPC 5C3IB 3B0DC 5GXQC 1F1EA 5GT0C 2JE5A 5B2IC 4Z2MH 4QLCB 5B40B 3C1BC 4ZUXA 4WU9B 2HUEB 5F99C 1P3IB 3B0BA 1M1AC 3B0CT 1EQZD 3X1SD 4AWLB 3AZFB 1ZLAA 1AOIB 3UT9C 2NQBA 4LD9D 5B31G 4X23A 3AZJA 4H9QB 5B1LB 5CPJC 1KX5D 4R8PA 1BFMA 1BH8A 3AZNB 4WV4B 4J8XC 4KHAB 4WU8A 5B24A 4UUZA 1BH9B 3AV1C 4NE6A 3MGSC 5B33B 1U35A 5E5AB 5AV9B 4J8VD 4YM6D 3REKC 4UPKA 5AVCB 1Z2CB 1ID3C 1P3KD 2DF4C 1TZYB 2F2AC 3VH6A 3KUYA 3MGPC 1M18D 3AZHA 3W99B 2CV5D 4J8WA 1A7WA 4KUDD 3WKJB 3MVDD 5B0ZB 3C1CD 1P3GA 2PYOA 4Z5TB 3LJAA 3AYWA 4JJNB 1P3PA 3KFUG 1P3OD 4KGCD 3AZEA 1EQZC 2AROB 3KSYA 3W98A 2FJ7D 3X1SC 2YFVB 5G49B 1P3MA 4LD9C 3REJA 3B0CW 3NQUA 1KX4A 1KX5C 3WAAA 5JRGA 3AV2A 4WNNA 2LY8A 5B32D 2BYKA 3P5JB 4XUJB 3LZ0A 4J8UB 4G92C 3KWQD 4J8VC 4YM6C 5AV5B 3REHB 3WTPA 3AZKB 4WZSB 3MGQB 3O62D 5JA4B 1F66B 5GXQA 1P3KC 5GT0A 5B2IA 1M18C 4G91B 4QLCD 3C1BA 5B40D 1P3ID 5F99A 5BO0A 2CV5C 1M19B 1M1AA 3AZGD 3X1TD 3REIB 4KUDC 2HIOB 3AZFD 3MVDC 1AOID 3UT9A 3MNNB 3C1CC 1JFIA 2DQNC 4CSRA 2ZY3A 5KDMA 5AY8B 3B6FB 5CPJA 5B1LD 4HGAB 3AZIB 3AZND 4J8XA 2FFFB 3NQJB 1P3OC 4KGCC 3LELB 3X1UB 4H9NB 3AV1A 5AVBA 2FJ7C 3MGSA 3UTBB 4XZQD 5DNND 4EO5C 3REKA 5FUGA 3W96B 5AVCD 4H9SC 5BS7C 1ID3A 5BNVA 2NQBB 3AN2B 1TZYD 4X23B 3AZJB 5B32C 3X1VD 2Y2KA 3MGPA 1N1JA 5CPKA 3W99D 3KXBA 5GT3B 1P3BB 1BH8B 2ZM5A 3WKJD 3KWQC 2YFWA 2F8NA 5B24B 4UUZB 2JCHA 5C3IC 4JJND 3O62C 5DNMD 5GSUA 4ZBJB 4QLCC 5B40C 1P3IC 1EQZA 3AZGC 4H9OB 3AZFC 1AOIC 2NZDB 4LD9A 3TU4A 5B1LC 1KX5A 2Y2MA 3AZNC 3V9RB 3AZMB 2PYOB 4E45A 5CPIB 3AFAB 4Z66B 3LJAB 1Q9CA 4XUJD 4XZQC 5DNNC 2W8SA 4J8UD 3WA9A 5E5AC 4J8VA 4YM6A 5AV8B 5AV5D 2F8NK 5AV6D 3REHD 3W98B 5AVCC 5B0YB 3MGQD 5B31D 1T3UA 2L5AA 1P3KA 1F66D 1P3MB 1TZYC 3X1VC 1M18A 1P3FB 3W99C 2Y2PA 2CV5A 1M19D 3R45B 4KUDA 3REID 3WKJC 3MVDA 2UWXA 2RIQA 3C1CA 3MNND 3B6GD 2BYKB 5AY8D 3VH5T 4JJNC 3LZ0B 5DNMC 1WWSA 3AZLD 1P3OA 4KGCA 5CP6D 3LELD 3X1UD 2FJ7A 3UTAD 3UTBD 5GXQB 5GT0B 3LZ1D 1S32D 1HTAA 5BO0B 1M1AB 3W96D 4H9SA 5BS7A 4H9PA 3IP4C 5B2JB 3AN2D 5B32A 3MGRB 1R4VA 5GT3D 4XUJC 1P3BD 4H9RA 4J8UC 3KWQA 3F6TA 4J8XB 1P3LD 5AV5C 5AV6C 3REHC 3W97D 5AVBB 1KX3B 3MGSB 3MGQC 1HQ3B 5B31C 3O62A 4YS3B 1F66C 2Y2QA 1P34D 4M6BA 4QLCA 5B40A 1P3IA 1M19C 1H3OB 3AZGA 4Z2MG 3X1TA 3REIC 3AZFA 1AOIA 3B6GC 3MNNC 2NZDD 3EG5B 1P3AB 5AY8C 1N1JB 4H9QA 5CPKB 3KXBB 5B1LA 3RELB 3H0RC 4HGAC 3A1KA 3AZNA 5B1MB 3AZLC 4KHAA 3WTPE 3VH5W 5CP6C 3AZMD 2Y2GA 3LELC 3X1UC 4WU9D 5CPID 3AFAD 4Z66D 3UTAC 2JSSA 4XZQA 5DNNA 3UTBC 4NE3A 3LZ1C 1S32C 5GSUB 5AV8D 2BYMB 2F8NH 3A6NB 1EQZB 5AVCA 3W96C 5B0YD 5BNXB 1TAFB 3TU4B 1TZYA 3AN2C 3X1VA 1P3FD 3W99A 1KX5B 5GT3C 1P3BC 5B33D 3WKJA 3EPHA 5E5AD 1P3LC 5AV9D 4NE5A 4ZUXB 3W97C 2G5IC 2RVQD 2ZY5A 4DRAA 4JJNA 1ZLAB 5DNMA 3WA9B 1P34C 4J8VB 4YM6B 1ULYA 4R8PB 3EPKA 2YFVA 1W2EA 5G49A 5B0ZD 2NZDC 4Z5TD 4WU8B 1U35B 4KUDB 2Y2IA 3MVDB 2Y2HA 3AZMC 5B2JD 5CPIC 4WU9C 3MGRD 2HUEC 4Z66C 3AFAC 2AROD 3X1SA 4AWLC 2CWEA 4CAYA 1WWIA 4J8UA 5AV5A 5AV8C 5AV6A 3KUYB 3VH6W 3REHA 3AZHB 3H0LC 5AVBD 1KX3D 5B0YC 4J8WB 3MGQA 5B31A 4YS3D 1HQ3D 1F66A 4EO5B 1P3GB 3VH5A 1P3FC 1M19A 3AYWB 3REIA 5B33C 4H9PB 4NFTA 2IO5B 3B6GA 1P3PB 2VQRA 5AV9C 1P3AD 5B32B 5AY8A 3AZEB 5CPKD 3KXBD 2RVQC 3RELD 3AZKD 5B1MD 3AZLA 3NQJA 3REJB 5CP6A 3LELA 3X1UA 3NQUB 1KX4B 3UTAA 3WAAB 3UTBA 5JRGB 3O62B 2HIOD 3AV2B 4WNNB 3LZ1A 5B0ZC 1S32A 5GSUD 4Z5TC 2Y2NA 3A6ND 3B6FD 3W96A 3AZGB 2XD1A 3X1TB 3AZID 2ZY2A 2XD5A 3AN2A 5B2JC
chains in the Genus database with same CATH topology
3MGRC 3WTPB 2AROC 5GT3A 1P3BA 3B0DB 1P3LA 5B2IB 1B67A 3C1BB 3W97A 4ZUXD 5F99B 5AVBC 1KX3C 4YS3C 1HQ3C 4XZQB 5DNNB 1ZLAD 3UT9B 1P34A 1PZRA 2NQBD 3WA9D 4X23D 3AZJD 4CSRB 1JFIB 5KDMB 3EPJA 5CPJB 4H9OA 4R8PD 2NZDA 3TU4D 3X1VB 1P3AC 4WU8D 5B24D 5CPKC 3AV1B 3KXBC 3RELC 5CHLB 3AZKC 1U35D 5B1MC 3V9RA 3AZMA 4G91C 4WU9A 5CPIA 3REKB 3AFAA 5FUGB 4Z66A 2HIOC 1ID3B 5BNVB 5DNMB 5GSUC 5AV8A 3KUYD 3MGPB 3A6NC 3AZHD 3B6FC 5B0YA 3EPLA 4J8WD 3AZIC 1P3GD 3TU4C 2YFWB 1P3FA 2F8NB 2PYOD 1BH9A 4DRBA 3R45A 3LJAD 3AYWD 3VH6T 5B33A 5B32G 2J8PA 2Y2OA 2Y2LA 5E5AA 5AV9A 1P3PD 5BT1D 4ZUXC 3AZED 3W98D 2G5HC 3X1SB 4CAYB 1ZLAC 3WA9C 1P3MD 2NQBC 4LD9B 3REJD 4X23C 5AV6B 3AZJC 3AL0C 1KX4D 4R8PC 3WAAD 5B31B 5JRGD 3AV2D 5B0ZA 4DQYB 4Z5TA 2BG1A 4WU8C 5B24C 1U35C 3LZ0D 4G92B 3B6GB 4ZBJC 5B2JA 3MGRA 2AROA 3WTPD 4E44A 1P3KB 3A1IA 5GXQD 3AZLB 5GT0D 5CP6B 5B2ID 1M18B 3KUYC 3C1BD 3AZHC 5F99D 2CV5B 1KX3A 3UTAB 1M1AD 4J8WC 4YS3A 1HQ3A 3LZ1B 3C1CB 3UT9D 1S32B 1P3GC 2PYOC 1H3OA 3LJAC 3AYWC 5CPJD 4XUJA 2IO5C 1P3PC 1P3OB 4J8XD 5BT1C 1P3AA 4KGCB 3H0MC 3AZEC 2ZY4A 3W98C 3AV1D 2FJ7B 3RELA 3AZKA 3MGSD 5JA4A 1P3MC 5B1MA 3REJC 1P3LB 3W97B 3REKD 1KX4C 3WAAC 2HIOA 5JRGC 1ID3D 3AV2C 3MNNA 4WJ3C 1P34B 1B6WA 3FDDA 1KU5A 2BYMA 3A6NA 3MGPD 3B6FA 3X1TC 2F8NG 4H9RB 3LZ0C 3AZIA 5BNXA 3KWQB 2Y2JA 1TAFA 2F8ND 4H9NA 3WTPC 5C3IB 3B0DC 5GXQC 1F1EA 5GT0C 2JE5A 5B2IC 4Z2MH 4QLCB 5B40B 3C1BC 4ZUXA 4WU9B 2HUEB 5F99C 1P3IB 3B0BA 1M1AC 3B0CT 1EQZD 3X1SD 4AWLB 3AZFB 1ZLAA 1AOIB 3UT9C 2NQBA 4LD9D 5B31G 4X23A 3AZJA 4H9QB 5B1LB 5CPJC 1KX5D 4R8PA 1BFMA 1BH8A 3AZNB 4WV4B 4J8XC 4KHAB 4WU8A 5B24A 4UUZA 1BH9B 3AV1C 4NE6A 3MGSC 5B33B 1U35A 5E5AB 5AV9B 4J8VD 4YM6D 3REKC 4UPKA 5AVCB 1Z2CB 1ID3C 1P3KD 2DF4C 1TZYB 2F2AC 3VH6A 3KUYA 3MGPC 1M18D 3AZHA 3W99B 2CV5D 4J8WA 1A7WA 4KUDD 3WKJB 3MVDD 5B0ZB 3C1CD 1P3GA 2PYOA 4Z5TB 3LJAA 3AYWA 4JJNB 1P3PA 3KFUG 1P3OD 4KGCD 3AZEA 1EQZC 2AROB 3KSYA 3W98A 2FJ7D 3X1SC 2YFVB 5G49B 1P3MA 4LD9C 3REJA 3B0CW 3NQUA 1KX4A 1KX5C 3WAAA 5JRGA 3AV2A 4WNNA 2LY8A 5B32D 2BYKA 3P5JB 4XUJB 3LZ0A 4J8UB 4G92C 3KWQD 4J8VC 4YM6C 5AV5B 3REHB 3WTPA 3AZKB 4WZSB 3MGQB 3O62D 5JA4B 1F66B 5GXQA 1P3KC 5GT0A 5B2IA 1M18C 4G91B 4QLCD 3C1BA 5B40D 1P3ID 5F99A 5BO0A 2CV5C 1M19B 1M1AA 3AZGD 3X1TD 3REIB 4KUDC 2HIOB 3AZFD 3MVDC 1AOID 3UT9A 3MNNB 3C1CC 1JFIA 2DQNC 4CSRA 2ZY3A 5KDMA 5AY8B 3B6FB 5CPJA 5B1LD 4HGAB 3AZIB 3AZND 4J8XA 2FFFB 3NQJB 1P3OC 4KGCC 3LELB 3X1UB 4H9NB 3AV1A 5AVBA 2FJ7C 3MGSA 3UTBB 4XZQD 5DNND 4EO5C 3REKA 5FUGA 3W96B 5AVCD 4H9SC 5BS7C 1ID3A 5BNVA 2NQBB 3AN2B 1TZYD 4X23B 3AZJB 5B32C 3X1VD 2Y2KA 3MGPA 1N1JA 5CPKA 3W99D 3KXBA 5GT3B 1P3BB 1BH8B 2ZM5A 3WKJD 3KWQC 2YFWA 2F8NA 5B24B 4UUZB 2JCHA 5C3IC 4JJND 3O62C 5DNMD 5GSUA 4ZBJB 4QLCC 5B40C 1P3IC 1EQZA 3AZGC 4H9OB 3AZFC 1AOIC 2NZDB 4LD9A 3TU4A 5B1LC 1KX5A 2Y2MA 3AZNC 3V9RB 3AZMB 2PYOB 4E45A 5CPIB 3AFAB 4Z66B 3LJAB 1Q9CA 4XUJD 4XZQC 5DNNC 2W8SA 4J8UD 3WA9A 5E5AC 4J8VA 4YM6A 5AV8B 5AV5D 2F8NK 5AV6D 3REHD 3W98B 5AVCC 5B0YB 3MGQD 5B31D 1T3UA 2L5AA 1P3KA 1F66D 1P3MB 1TZYC 3X1VC 1M18A 1P3FB 3W99C 2Y2PA 2CV5A 1M19D 3R45B 4KUDA 3REID 3WKJC 3MVDA 2UWXA 2RIQA 3C1CA 3MNND 3B6GD 2BYKB 5AY8D 3VH5T 4JJNC 3LZ0B 5DNMC 1WWSA 3AZLD 1P3OA 4KGCA 5CP6D 3LELD 3X1UD 2FJ7A 3UTAD 3UTBD 5GXQB 5GT0B 3LZ1D 1S32D 1HTAA 5BO0B 1M1AB 3W96D 4H9SA 5BS7A 4H9PA 3IP4C 5B2JB 3AN2D 5B32A 3MGRB 1R4VA 5GT3D 4XUJC 1P3BD 4H9RA 4J8UC 3KWQA 3F6TA 4J8XB 1P3LD 5AV5C 5AV6C 3REHC 3W97D 5AVBB 1KX3B 3MGSB 3MGQC 1HQ3B 5B31C 3O62A 4YS3B 1F66C 2Y2QA 1P34D 4M6BA 4QLCA 5B40A 1P3IA 1M19C 1H3OB 3AZGA 4Z2MG 3X1TA 3REIC 3AZFA 1AOIA 3B6GC 3MNNC 2NZDD 3EG5B 1P3AB 5AY8C 1N1JB 4H9QA 5CPKB 3KXBB 5B1LA 3RELB 3H0RC 4HGAC 3A1KA 3AZNA 5B1MB 3AZLC 4KHAA 3WTPE 3VH5W 5CP6C 3AZMD 2Y2GA 3LELC 3X1UC 4WU9D 5CPID 3AFAD 4Z66D 3UTAC 2JSSA 4XZQA 5DNNA 3UTBC 4NE3A 3LZ1C 1S32C 5GSUB 5AV8D 2BYMB 2F8NH 3A6NB 1EQZB 5AVCA 3W96C 5B0YD 5BNXB 1TAFB 3TU4B 1TZYA 3AN2C 3X1VA 1P3FD 3W99A 1KX5B 5GT3C 1P3BC 5B33D 3WKJA 3EPHA 5E5AD 1P3LC 5AV9D 4NE5A 4ZUXB 3W97C 2G5IC 2RVQD 2ZY5A 4DRAA 4JJNA 1ZLAB 5DNMA 3WA9B 1P34C 4J8VB 4YM6B 1ULYA 4R8PB 3EPKA 2YFVA 1W2EA 5G49A 5B0ZD 2NZDC 4Z5TD 4WU8B 1U35B 4KUDB 2Y2IA 3MVDB 2Y2HA 3AZMC 5B2JD 5CPIC 4WU9C 3MGRD 2HUEC 4Z66C 3AFAC 2AROD 3X1SA 4AWLC 2CWEA 4CAYA 1WWIA 4J8UA 5AV5A 5AV8C 5AV6A 3KUYB 3VH6W 3REHA 3AZHB 3H0LC 5AVBD 1KX3D 5B0YC 4J8WB 3MGQA 5B31A 4YS3D 1HQ3D 1F66A 4EO5B 1P3GB 3VH5A 1P3FC 1M19A 3AYWB 3REIA 5B33C 4H9PB 4NFTA 2IO5B 3B6GA 1P3PB 2VQRA 5AV9C 1P3AD 5B32B 5AY8A 3AZEB 5CPKD 3KXBD 2RVQC 3RELD 3AZKD 5B1MD 3AZLA 3NQJA 3REJB 5CP6A 3LELA 3X1UA 3NQUB 1KX4B 3UTAA 3WAAB 3UTBA 5JRGB 3O62B 2HIOD 3AV2B 4WNNB 3LZ1A 5B0ZC 1S32A 5GSUD 4Z5TC 2Y2NA 3A6ND 3B6FD 3W96A 3AZGB 2XD1A 3X1TB 3AZID 2ZY2A 2XD5A 3AN2A 5B2JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR C;  3WTP B;  2ARO C;  5GT3 A;  1P3B A;  3B0D B;  1P3L A;  5B2I B;  1B67 A;  3C1B B;  3W97 A;  4ZUX D;  5F99 B;  5AVB C;  1KX3 C;  4YS3 C;  1HQ3 C;  4XZQ B;  5DNN B;  1ZLA D;  3UT9 B;  1P34 A;  2NQB D;  3WA9 D;  4X23 D;  3AZJ D;  4CSR B;  1JFI B;  5KDM B;  5CPJ B;  4H9O A;  4R8P D;  2NZD A;  3X1V B;  1P3A C;  4WU8 D;  5B24 D;  5CPK C;  3AV1 B;  3KXB C;  3REL C;  5CHL B;  3AZK C;  1U35 D;  5B1M C;  3V9R A;  3AZM A;  4G91 C;  4WU9 A;  5CPI A;  3REK B;  3AFA A;  5FUG B;  4Z66 A;  2HIO C;  1ID3 B;  5BNV B;  5DNM B;  5GSU C;  5AV8 A;  3KUY D;  3MGP B;  3A6N C;  3AZH D;  3B6F C;  5B0Y A;  4J8W D;  3AZI C;  1P3G D;  3TU4 C;  2YFW B;  1P3F A;  2F8N B;  2PYO D;  1BH9 A;  4DRB A;  3R45 A;  3LJA D;  3AYW D;  3VH6 T;  5B33 A;  5B32 G;  5E5A A;  5AV9 A;  1P3P D;  5BT1 D;  4ZUX C;  3AZE D;  3W98 D;  3X1S B;  4CAY B;  1ZLA C;  3WA9 C;  1P3M D;  2NQB C;  4LD9 B;  3REJ D;  4X23 C;  5AV6 B;  3AZJ C;  1KX4 D;  4R8P C;  3WAA D;  5B31 B;  5JRG D;  3AV2 D;  5B0Z A;  4Z5T A;  4WU8 C;  5B24 C;  1U35 C;  3LZ0 D;  4G92 B;  3B6G B;  4ZBJ C;  5B2J A;  3MGR A;  2ARO A;  3WTP D;  4E44 A;  1P3K B;  5GXQ D;  3AZL B;  5GT0 D;  5CP6 B;  5B2I D;  1M18 B;  3KUY C;  3C1B D;  3AZH C;  5F99 D;  2CV5 B;  1KX3 A;  3UTA B;  1M1A D;  4J8W C;  4YS3 A;  1HQ3 A;  3LZ1 B;  3C1C B;  3UT9 D;  1S32 B;  1P3G C;  2PYO C;  1H3O A;  3LJA C;  3AYW C;  5CPJ D;  4XUJ A;  2IO5 C;  1P3P C;  1P3O B;  4J8X D;  5BT1 C;  1P3A A;  4KGC B;  3AZE C;  3W98 C;  3AV1 D;  2FJ7 B;  3REL A;  3AZK A;  3MGS D;  5JA4 A;  1P3M C;  5B1M A;  3REJ C;  1P3L B;  3W97 B;  3REK D;  1KX4 C;  3WAA C;  2HIO A;  5JRG C;  1ID3 D;  3AV2 C;  3MNN A;  1P34 B;  1B6W A;  1KU5 A;  2BYM A;  3A6N A;  3MGP D;  3B6F A;  3X1T C;  2F8N G;  4H9R B;  3LZ0 C;  3AZI A;  5BNX A;  3KWQ B;  1TAF A;  2F8N D;  4H9N A;  3WTP C;  5C3I B;  3B0D C;  5GXQ C;  1F1E A;  5GT0 C;  5B2I C;  4Z2M H;  4QLC B;  5B40 B;  3C1B C;  4ZUX A;  4WU9 B;  2HUE B;  5F99 C;  1P3I B;  3B0B A;  1M1A C;  3B0C T;  1EQZ D;  3X1S D;  4AWL B;  3AZF B;  1ZLA A;  1AOI B;  3UT9 C;  2NQB A;  4LD9 D;  5B31 G;  4X23 A;  3AZJ A;  4H9Q B;  5B1L B;  5CPJ C;  1KX5 D;  4R8P A;  1BFM A;  1BH8 A;  3AZN B;  4WV4 B;  4J8X C;  4KHA B;  4WU8 A;  5B24 A;  4UUZ A;  1BH9 B;  3AV1 C;  4NE6 A;  3MGS C;  5B33 B;  1U35 A;  5E5A B;  5AV9 B;  4J8V D;  4YM6 D;  3REK C;  5AVC B;  1ID3 C;  1P3K D;  1TZY B;  3VH6 A;  3KUY A;  1M18 D;  3MGP C;  3AZH A;  3W99 B;  2CV5 D;  4J8W A;  1A7W A;  4KUD D;  3WKJ B;  3MVD D;  5B0Z B;  3C1C D;  1P3G A;  2PYO A;  4Z5T B;  3LJA A;  3AYW A;  4JJN B;  1P3P A;  1P3O D;  4KGC D;  3AZE A;  1EQZ C;  2ARO B;  3KSY A;  3W98 A;  2FJ7 D;  3X1S C;  2YFV B;  5G49 B;  1P3M A;  4LD9 C;  3REJ A;  3B0C W;  3NQU A;  1KX4 A;  1KX5 C;  3WAA A;  5JRG A;  3AV2 A;  4WNN A;  2LY8 A;  5B32 D;  2BYK A;  4XUJ B;  3LZ0 A;  4J8U B;  4G92 C;  3KWQ D;  4J8V C;  4YM6 C;  5AV5 B;  3REH B;  3WTP A;  3AZK B;  4WZS B;  3MGQ B;  3O62 D;  5JA4 B;  1F66 B;  5GXQ A;  1P3K C;  5GT0 A;  5B2I A;  1M18 C;  4G91 B;  4QLC D;  3C1B A;  5B40 D;  1P3I D;  5F99 A;  5BO0 A;  2CV5 C;  1M19 B;  1M1A A;  3AZG D;  3X1T D;  3REI B;  4KUD C;  2HIO B;  3AZF D;  3MVD C;  1AOI D;  3UT9 A;  3MNN B;  3C1C C;  1JFI A;  4CSR A;  5AY8 B;  5KDM A;  3B6F B;  5CPJ A;  5B1L D;  4HGA B;  3AZI B;  3AZN D;  4J8X A;  1P3O C;  3NQJ B;  4KGC C;  3LEL B;  3X1U B;  4H9N B;  3AV1 A;  5AVB A;  2FJ7 C;  3MGS A;  3UTB B;  4XZQ D;  5DNN D;  4EO5 C;  3REK A;  5FUG A;  3W96 B;  5AVC D;  4H9S C;  5BS7 C;  1ID3 A;  5BNV A;  2NQB B;  3AN2 B;  1TZY D;  4X23 B;  3AZJ B;  5B32 C;  3X1V D;  3MGP A;  1N1J A;  5CPK A;  3W99 D;  3KXB A;  5GT3 B;  1P3B B;  1BH8 B;  3WKJ D;  3KWQ C;  2YFW A;  2F8N A;  5B24 B;  4UUZ B;  5C3I C;  4JJN D;  3O62 C;  5DNM D;  5GSU A;  4ZBJ B;  4QLC C;  5B40 C;  1P3I C;  1EQZ A;  3AZG C;  4H9O B;  3AZF C;  1AOI C;  2NZD B;  4LD9 A;  3TU4 A;  5B1L C;  1KX5 A;  3AZN C;  3V9R B;  3AZM B;  2PYO B;  4E45 A;  5CPI B;  3AFA B;  4Z66 B;  3LJA B;  1Q9C A;  4XUJ D;  4XZQ C;  5DNN C;  4J8U D;  3WA9 A;  5E5A C;  4J8V A;  4YM6 A;  5AV8 B;  5AV5 D;  2F8N K;  5AV6 D;  3REH D;  3W98 B;  5AVC C;  5B0Y B;  3MGQ D;  5B31 D;  2L5A A;  1P3K A;  1F66 D;  1P3M B;  1TZY C;  3X1V C;  1M18 A;  1P3F B;  3W99 C;  2CV5 A;  1M19 D;  3R45 B;  4KUD A;  3REI D;  3WKJ C;  3MVD A;  3C1C A;  3B6G D;  3MNN D;  2BYK B;  5AY8 D;  3VH5 T;  4JJN C;  3LZ0 B;  5DNM C;  1WWS A;  3AZL D;  1P3O A;  4KGC A;  5CP6 D;  3LEL D;  3X1U D;  2FJ7 A;  3UTA D;  3UTB D;  5GXQ B;  5GT0 B;  3LZ1 D;  1S32 D;  1HTA A;  5BO0 B;  1M1A B;  3W96 D;  4H9S A;  5BS7 A;  4H9P A;  5B2J B;  3AN2 D;  5B32 A;  3MGR B;  1R4V A;  5GT3 D;  4XUJ C;  1P3B D;  4H9R A;  4J8U C;  3KWQ A;  4J8X B;  1P3L D;  5AV5 C;  5AV6 C;  3REH C;  3W97 D;  5AVB B;  1KX3 B;  3MGS B;  3MGQ C;  1HQ3 B;  5B31 C;  3O62 A;  4YS3 B;  1F66 C;  1P34 D;  4M6B A;  4QLC A;  5B40 A;  1P3I A;  1M19 C;  1H3O B;  3AZG A;  4Z2M G;  3X1T A;  3REI C;  3AZF A;  1AOI A;  3B6G C;  3MNN C;  2NZD D;  1P3A B;  5AY8 C;  1N1J B;  4H9Q A;  5CPK B;  3KXB B;  5B1L A;  3REL B;  4HGA C;  3AZN A;  5B1M B;  3AZL C;  4KHA A;  3WTP E;  3VH5 W;  5CP6 C;  3AZM D;  3LEL C;  3X1U C;  4WU9 D;  5CPI D;  3AFA D;  4Z66 D;  3UTA C;  2JSS A;  4XZQ A;  5DNN A;  3UTB C;  4NE3 A;  3LZ1 C;  1S32 C;  5GSU B;  5AV8 D;  2BYM B;  2F8N H;  3A6N B;  1EQZ B;  5AVC A;  3W96 C;  5B0Y D;  5BNX B;  1TAF B;  3TU4 B;  1TZY A;  3AN2 C;  3X1V A;  1P3F D;  3W99 A;  1KX5 B;  5GT3 C;  1P3B C;  5B33 D;  3WKJ A;  5E5A D;  1P3L C;  5AV9 D;  4NE5 A;  4ZUX B;  3W97 C;  4DRA A;  2RVQ D;  4JJN A;  1ZLA B;  5DNM A;  3WA9 B;  1P34 C;  4J8V B;  4YM6 B;  1ULY A;  4R8P B;  2YFV A;  5G49 A;  2NZD C;  5B0Z D;  4Z5T D;  4WU8 B;  1U35 B;  4KUD B;  3MVD B;  3AZM C;  5B2J D;  5CPI C;  4WU9 C;  3MGR D;  2HUE C;  4Z66 C;  3AFA C;  2ARO D;  3X1S A;  4AWL C;  2CWE A;  4CAY A;  1WWI A;  4J8U A;  5AV5 A;  5AV8 C;  5AV6 A;  3KUY B;  3VH6 W;  3REH A;  3AZH B;  5AVB D;  1KX3 D;  5B0Y C;  4J8W B;  3MGQ A;  5B31 A;  4YS3 D;  1HQ3 D;  1F66 A;  4EO5 B;  1P3G B;  3VH5 A;  1P3F C;  1M19 A;  3AYW B;  3REI A;  5B33 C;  4H9P B;  4NFT A;  2IO5 B;  3B6G A;  1P3P B;  5AV9 C;  1P3A D;  5B32 B;  5AY8 A;  3AZE B;  5CPK D;  3KXB D;  2RVQ C;  3REL D;  3AZK D;  5B1M D;  3AZL A;  3NQJ A;  3REJ B;  5CP6 A;  3LEL A;  3X1U A;  3NQU B;  1KX4 B;  3UTA A;  3WAA B;  3UTB A;  5JRG B;  3O62 B;  2HIO D;  3AV2 B;  4WNN B;  3LZ1 A;  5B0Z C;  1S32 A;  5GSU D;  4Z5T C;  3A6N D;  3B6F D;  3W96 A;  3AZG B;  3X1T B;  3AZI D;  3TU4 D;  3AN2 A;  5B2J C; 
#chains in the Genus database with same CATH topology
 3MGR C;  3WTP B;  2ARO C;  5GT3 A;  1P3B A;  3B0D B;  1P3L A;  5B2I B;  1B67 A;  3C1B B;  3W97 A;  4ZUX D;  5F99 B;  5AVB C;  1KX3 C;  4YS3 C;  1HQ3 C;  4XZQ B;  5DNN B;  1ZLA D;  3UT9 B;  1P34 A;  1PZR A;  2NQB D;  3WA9 D;  4X23 D;  3AZJ D;  4CSR B;  1JFI B;  5KDM B;  3EPJ A;  5CPJ B;  4H9O A;  4R8P D;  2NZD A;  3TU4 D;  3X1V B;  1P3A C;  4WU8 D;  5B24 D;  5CPK C;  3AV1 B;  3KXB C;  3REL C;  5CHL B;  3AZK C;  1U35 D;  5B1M C;  3V9R A;  3AZM A;  4G91 C;  4WU9 A;  5CPI A;  3REK B;  3AFA A;  5FUG B;  4Z66 A;  2HIO C;  1ID3 B;  5BNV B;  5DNM B;  5GSU C;  5AV8 A;  3KUY D;  3MGP B;  3A6N C;  3AZH D;  3B6F C;  5B0Y A;  3EPL A;  4J8W D;  3AZI C;  1P3G D;  3TU4 C;  2YFW B;  1P3F A;  2F8N B;  2PYO D;  1BH9 A;  4DRB A;  3R45 A;  3LJA D;  3AYW D;  3VH6 T;  5B33 A;  5B32 G;  2J8P A;  2Y2O A;  2Y2L A;  5E5A A;  5AV9 A;  1P3P D;  5BT1 D;  4ZUX C;  3AZE D;  3W98 D;  2G5H C;  3X1S B;  4CAY B;  1ZLA C;  3WA9 C;  1P3M D;  2NQB C;  4LD9 B;  3REJ D;  4X23 C;  5AV6 B;  3AZJ C;  3AL0 C;  1KX4 D;  4R8P C;  3WAA D;  5B31 B;  5JRG D;  3AV2 D;  5B0Z A;  4DQY B;  4Z5T A;  2BG1 A;  4WU8 C;  5B24 C;  1U35 C;  3LZ0 D;  4G92 B;  3B6G B;  4ZBJ C;  5B2J A;  3MGR A;  2ARO A;  3WTP D;  4E44 A;  1P3K B;  3A1I A;  5GXQ D;  3AZL B;  5GT0 D;  5CP6 B;  5B2I D;  1M18 B;  3KUY C;  3C1B D;  3AZH C;  5F99 D;  2CV5 B;  1KX3 A;  3UTA B;  1M1A D;  4J8W C;  4YS3 A;  1HQ3 A;  3LZ1 B;  3C1C B;  3UT9 D;  1S32 B;  1P3G C;  2PYO C;  1H3O A;  3LJA C;  3AYW C;  5CPJ D;  4XUJ A;  2IO5 C;  1P3P C;  1P3O B;  4J8X D;  5BT1 C;  1P3A A;  4KGC B;  3H0M C;  3AZE C;  2ZY4 A;  3W98 C;  3AV1 D;  2FJ7 B;  3REL A;  3AZK A;  3MGS D;  5JA4 A;  1P3M C;  5B1M A;  3REJ C;  1P3L B;  3W97 B;  3REK D;  1KX4 C;  3WAA C;  2HIO A;  5JRG C;  1ID3 D;  3AV2 C;  3MNN A;  4WJ3 C;  1P34 B;  1B6W A;  3FDD A;  1KU5 A;  2BYM A;  3A6N A;  3MGP D;  3B6F A;  3X1T C;  2F8N G;  4H9R B;  3LZ0 C;  3AZI A;  5BNX A;  3KWQ B;  2Y2J A;  1TAF A;  2F8N D;  4H9N A;  3WTP C;  5C3I B;  3B0D C;  5GXQ C;  1F1E A;  5GT0 C;  2JE5 A;  5B2I C;  4Z2M H;  4QLC B;  5B40 B;  3C1B C;  4ZUX A;  4WU9 B;  2HUE B;  5F99 C;  1P3I B;  3B0B A;  1M1A C;  3B0C T;  1EQZ D;  3X1S D;  4AWL B;  3AZF B;  1ZLA A;  1AOI B;  3UT9 C;  2NQB A;  4LD9 D;  5B31 G;  4X23 A;  3AZJ A;  4H9Q B;  5B1L B;  5CPJ C;  1KX5 D;  4R8P A;  1BFM A;  1BH8 A;  3AZN B;  4WV4 B;  4J8X C;  4KHA B;  4WU8 A;  5B24 A;  4UUZ A;  1BH9 B;  3AV1 C;  4NE6 A;  3MGS C;  5B33 B;  1U35 A;  5E5A B;  5AV9 B;  4J8V D;  4YM6 D;  3REK C;  4UPK A;  5AVC B;  1Z2C B;  1ID3 C;  1P3K D;  2DF4 C;  1TZY B;  2F2A C;  3VH6 A;  3KUY A;  3MGP C;  1M18 D;  3AZH A;  3W99 B;  2CV5 D;  4J8W A;  1A7W A;  4KUD D;  3WKJ B;  3MVD D;  5B0Z B;  3C1C D;  1P3G A;  2PYO A;  4Z5T B;  3LJA A;  3AYW A;  4JJN B;  1P3P A;  3KFU G;  1P3O D;  4KGC D;  3AZE A;  1EQZ C;  2ARO B;  3KSY A;  3W98 A;  2FJ7 D;  3X1S C;  2YFV B;  5G49 B;  1P3M A;  4LD9 C;  3REJ A;  3B0C W;  3NQU A;  1KX4 A;  1KX5 C;  3WAA A;  5JRG A;  3AV2 A;  4WNN A;  2LY8 A;  5B32 D;  2BYK A;  3P5J B;  4XUJ B;  3LZ0 A;  4J8U B;  4G92 C;  3KWQ D;  4J8V C;  4YM6 C;  5AV5 B;  3REH B;  3WTP A;  3AZK B;  4WZS B;  3MGQ B;  3O62 D;  5JA4 B;  1F66 B;  5GXQ A;  1P3K C;  5GT0 A;  5B2I A;  1M18 C;  4G91 B;  4QLC D;  3C1B A;  5B40 D;  1P3I D;  5F99 A;  5BO0 A;  2CV5 C;  1M19 B;  1M1A A;  3AZG D;  3X1T D;  3REI B;  4KUD C;  2HIO B;  3AZF D;  3MVD C;  1AOI D;  3UT9 A;  3MNN B;  3C1C C;  1JFI A;  2DQN C;  4CSR A;  2ZY3 A;  5KDM A;  5AY8 B;  3B6F B;  5CPJ A;  5B1L D;  4HGA B;  3AZI B;  3AZN D;  4J8X A;  2FFF B;  3NQJ B;  1P3O C;  4KGC C;  3LEL B;  3X1U B;  4H9N B;  3AV1 A;  5AVB A;  2FJ7 C;  3MGS A;  3UTB B;  4XZQ D;  5DNN D;  4EO5 C;  3REK A;  5FUG A;  3W96 B;  5AVC D;  4H9S C;  5BS7 C;  1ID3 A;  5BNV A;  2NQB B;  3AN2 B;  1TZY D;  4X23 B;  3AZJ B;  5B32 C;  3X1V D;  2Y2K A;  3MGP A;  1N1J A;  5CPK A;  3W99 D;  3KXB A;  5GT3 B;  1P3B B;  1BH8 B;  2ZM5 A;  3WKJ D;  3KWQ C;  2YFW A;  2F8N A;  5B24 B;  4UUZ B;  2JCH A;  5C3I C;  4JJN D;  3O62 C;  5DNM D;  5GSU A;  4ZBJ B;  4QLC C;  5B40 C;  1P3I C;  1EQZ A;  3AZG C;  4H9O B;  3AZF C;  1AOI C;  2NZD B;  4LD9 A;  3TU4 A;  5B1L C;  1KX5 A;  2Y2M A;  3AZN C;  3V9R B;  3AZM B;  2PYO B;  4E45 A;  5CPI B;  3AFA B;  4Z66 B;  3LJA B;  1Q9C A;  4XUJ D;  4XZQ C;  5DNN C;  2W8S A;  4J8U D;  3WA9 A;  5E5A C;  4J8V A;  4YM6 A;  5AV8 B;  5AV5 D;  2F8N K;  5AV6 D;  3REH D;  3W98 B;  5AVC C;  5B0Y B;  3MGQ D;  5B31 D;  1T3U A;  2L5A A;  1P3K A;  1F66 D;  1P3M B;  1TZY C;  3X1V C;  1M18 A;  1P3F B;  3W99 C;  2Y2P A;  2CV5 A;  1M19 D;  3R45 B;  4KUD A;  3REI D;  3WKJ C;  3MVD A;  2UWX A;  2RIQ A;  3C1C A;  3MNN D;  3B6G D;  2BYK B;  5AY8 D;  3VH5 T;  4JJN C;  3LZ0 B;  5DNM C;  1WWS A;  3AZL D;  1P3O A;  4KGC A;  5CP6 D;  3LEL D;  3X1U D;  2FJ7 A;  3UTA D;  3UTB D;  5GXQ B;  5GT0 B;  3LZ1 D;  1S32 D;  1HTA A;  5BO0 B;  1M1A B;  3W96 D;  4H9S A;  5BS7 A;  4H9P A;  3IP4 C;  5B2J B;  3AN2 D;  5B32 A;  3MGR B;  1R4V A;  5GT3 D;  4XUJ C;  1P3B D;  4H9R A;  4J8U C;  3KWQ A;  3F6T A;  4J8X B;  1P3L D;  5AV5 C;  5AV6 C;  3REH C;  3W97 D;  5AVB B;  1KX3 B;  3MGS B;  3MGQ C;  1HQ3 B;  5B31 C;  3O62 A;  4YS3 B;  1F66 C;  2Y2Q A;  1P34 D;  4M6B A;  4QLC A;  5B40 A;  1P3I A;  1M19 C;  1H3O B;  3AZG A;  4Z2M G;  3X1T A;  3REI C;  3AZF A;  1AOI A;  3B6G C;  3MNN C;  2NZD D;  3EG5 B;  1P3A B;  5AY8 C;  1N1J B;  4H9Q A;  5CPK B;  3KXB B;  5B1L A;  3REL B;  3H0R C;  4HGA C;  3A1K A;  3AZN A;  5B1M B;  3AZL C;  4KHA A;  3WTP E;  3VH5 W;  5CP6 C;  3AZM D;  2Y2G A;  3LEL C;  3X1U C;  4WU9 D;  5CPI D;  3AFA D;  4Z66 D;  3UTA C;  2JSS A;  4XZQ A;  5DNN A;  3UTB C;  4NE3 A;  3LZ1 C;  1S32 C;  5GSU B;  5AV8 D;  2BYM B;  2F8N H;  3A6N B;  1EQZ B;  5AVC A;  3W96 C;  5B0Y D;  5BNX B;  1TAF B;  3TU4 B;  1TZY A;  3AN2 C;  3X1V A;  1P3F D;  3W99 A;  1KX5 B;  5GT3 C;  1P3B C;  5B33 D;  3WKJ A;  3EPH A;  5E5A D;  1P3L C;  5AV9 D;  4NE5 A;  4ZUX B;  3W97 C;  2G5I C;  2RVQ D;  2ZY5 A;  4DRA A;  4JJN A;  1ZLA B;  5DNM A;  3WA9 B;  1P34 C;  4J8V B;  4YM6 B;  1ULY A;  4R8P B;  3EPK A;  2YFV A;  1W2E A;  5G49 A;  5B0Z D;  2NZD C;  4Z5T D;  4WU8 B;  1U35 B;  4KUD B;  2Y2I A;  3MVD B;  2Y2H A;  3AZM C;  5B2J D;  5CPI C;  4WU9 C;  3MGR D;  2HUE C;  4Z66 C;  3AFA C;  2ARO D;  3X1S A;  4AWL C;  2CWE A;  4CAY A;  1WWI A;  4J8U A;  5AV5 A;  5AV8 C;  5AV6 A;  3KUY B;  3VH6 W;  3REH A;  3AZH B;  3H0L C;  5AVB D;  1KX3 D;  5B0Y C;  4J8W B;  3MGQ A;  5B31 A;  4YS3 D;  1HQ3 D;  1F66 A;  4EO5 B;  1P3G B;  3VH5 A;  1P3F C;  1M19 A;  3AYW B;  3REI A;  5B33 C;  4H9P B;  4NFT A;  2IO5 B;  3B6G A;  1P3P B;  2VQR A;  5AV9 C;  1P3A D;  5B32 B;  5AY8 A;  3AZE B;  5CPK D;  3KXB D;  2RVQ C;  3REL D;  3AZK D;  5B1M D;  3AZL A;  3NQJ A;  3REJ B;  5CP6 A;  3LEL A;  3X1U A;  3NQU B;  1KX4 B;  3UTA A;  3WAA B;  3UTB A;  5JRG B;  3O62 B;  2HIO D;  3AV2 B;  4WNN B;  3LZ1 A;  5B0Z C;  1S32 A;  5GSU D;  4Z5T C;  2Y2N A;  3A6N D;  3B6F D;  3W96 A;  3AZG B;  2XD1 A;  3X1T B;  3AZI D;  2ZY2 A;  2XD5 A;  3AN2 A;  5B2J C; 
#chains in the Genus database with same CATH homology
 3MGR C;  3WTP B;  2ARO C;  5GT3 A;  1P3B A;  3B0D B;  1P3L A;  5B2I B;  1B67 A;  3C1B B;  3W97 A;  4ZUX D;  5F99 B;  5AVB C;  1KX3 C;  4YS3 C;  1HQ3 C;  4XZQ B;  5DNN B;  1ZLA D;  3UT9 B;  1P34 A;  1PZR A;  2NQB D;  3WA9 D;  4X23 D;  3AZJ D;  4CSR B;  1JFI B;  5KDM B;  3EPJ A;  5CPJ B;  4H9O A;  4R8P D;  2NZD A;  3TU4 D;  3X1V B;  1P3A C;  4WU8 D;  5B24 D;  5CPK C;  3AV1 B;  3KXB C;  3REL C;  5CHL B;  3AZK C;  1U35 D;  5B1M C;  3V9R A;  3AZM A;  4G91 C;  4WU9 A;  5CPI A;  3REK B;  3AFA A;  5FUG B;  4Z66 A;  2HIO C;  1ID3 B;  5BNV B;  5DNM B;  5GSU C;  5AV8 A;  3KUY D;  3MGP B;  3A6N C;  3AZH D;  3B6F C;  5B0Y A;  3EPL A;  4J8W D;  3AZI C;  1P3G D;  3TU4 C;  2YFW B;  1P3F A;  2F8N B;  2PYO D;  1BH9 A;  4DRB A;  3R45 A;  3LJA D;  3AYW D;  3VH6 T;  5B33 A;  5B32 G;  2J8P A;  2Y2O A;  2Y2L A;  5E5A A;  5AV9 A;  1P3P D;  5BT1 D;  4ZUX C;  3AZE D;  3W98 D;  2G5H C;  3X1S B;  4CAY B;  1ZLA C;  3WA9 C;  1P3M D;  2NQB C;  4LD9 B;  3REJ D;  4X23 C;  5AV6 B;  3AZJ C;  3AL0 C;  1KX4 D;  4R8P C;  3WAA D;  5B31 B;  5JRG D;  3AV2 D;  5B0Z A;  4DQY B;  4Z5T A;  2BG1 A;  4WU8 C;  5B24 C;  1U35 C;  3LZ0 D;  4G92 B;  3B6G B;  4ZBJ C;  5B2J A;  3MGR A;  2ARO A;  3WTP D;  4E44 A;  1P3K B;  3A1I A;  5GXQ D;  3AZL B;  5GT0 D;  5CP6 B;  5B2I D;  1M18 B;  3KUY C;  3C1B D;  3AZH C;  5F99 D;  2CV5 B;  1KX3 A;  3UTA B;  1M1A D;  4J8W C;  4YS3 A;  1HQ3 A;  3LZ1 B;  3C1C B;  3UT9 D;  1S32 B;  1P3G C;  2PYO C;  1H3O A;  3LJA C;  3AYW C;  5CPJ D;  4XUJ A;  2IO5 C;  1P3P C;  1P3O B;  4J8X D;  5BT1 C;  1P3A A;  4KGC B;  3H0M C;  3AZE C;  2ZY4 A;  3W98 C;  3AV1 D;  2FJ7 B;  3REL A;  3AZK A;  3MGS D;  5JA4 A;  1P3M C;  5B1M A;  3REJ C;  1P3L B;  3W97 B;  3REK D;  1KX4 C;  3WAA C;  2HIO A;  5JRG C;  1ID3 D;  3AV2 C;  3MNN A;  4WJ3 C;  1P34 B;  1B6W A;  3FDD A;  1KU5 A;  2BYM A;  3A6N A;  3MGP D;  3B6F A;  3X1T C;  2F8N G;  4H9R B;  3LZ0 C;  3AZI A;  5BNX A;  3KWQ B;  2Y2J A;  1TAF A;  2F8N D;  4H9N A;  3WTP C;  5C3I B;  3B0D C;  5GXQ C;  1F1E A;  5GT0 C;  2JE5 A;  5B2I C;  4Z2M H;  4QLC B;  5B40 B;  3C1B C;  4ZUX A;  4WU9 B;  2HUE B;  5F99 C;  1P3I B;  3B0B A;  1M1A C;  3B0C T;  1EQZ D;  3X1S D;  4AWL B;  3AZF B;  1ZLA A;  1AOI B;  3UT9 C;  2NQB A;  4LD9 D;  5B31 G;  4X23 A;  3AZJ A;  4H9Q B;  5B1L B;  5CPJ C;  1KX5 D;  4R8P A;  1BFM A;  1BH8 A;  3AZN B;  4WV4 B;  4J8X C;  4KHA B;  4WU8 A;  5B24 A;  4UUZ A;  1BH9 B;  3AV1 C;  4NE6 A;  3MGS C;  5B33 B;  1U35 A;  5E5A B;  5AV9 B;  4J8V D;  4YM6 D;  3REK C;  4UPK A;  5AVC B;  1Z2C B;  1ID3 C;  1P3K D;  2DF4 C;  1TZY B;  2F2A C;  3VH6 A;  3KUY A;  3MGP C;  1M18 D;  3AZH A;  3W99 B;  2CV5 D;  4J8W A;  1A7W A;  4KUD D;  3WKJ B;  3MVD D;  5B0Z B;  3C1C D;  1P3G A;  2PYO A;  4Z5T B;  3LJA A;  3AYW A;  4JJN B;  1P3P A;  3KFU G;  1P3O D;  4KGC D;  3AZE A;  1EQZ C;  2ARO B;  3KSY A;  3W98 A;  2FJ7 D;  3X1S C;  2YFV B;  5G49 B;  1P3M A;  4LD9 C;  3REJ A;  3B0C W;  3NQU A;  1KX4 A;  1KX5 C;  3WAA A;  5JRG A;  3AV2 A;  4WNN A;  2LY8 A;  5B32 D;  2BYK A;  3P5J B;  4XUJ B;  3LZ0 A;  4J8U B;  4G92 C;  3KWQ D;  4J8V C;  4YM6 C;  5AV5 B;  3REH B;  3WTP A;  3AZK B;  4WZS B;  3MGQ B;  3O62 D;  5JA4 B;  1F66 B;  5GXQ A;  1P3K C;  5GT0 A;  5B2I A;  1M18 C;  4G91 B;  4QLC D;  3C1B A;  5B40 D;  1P3I D;  5F99 A;  5BO0 A;  2CV5 C;  1M19 B;  1M1A A;  3AZG D;  3X1T D;  3REI B;  4KUD C;  2HIO B;  3AZF D;  3MVD C;  1AOI D;  3UT9 A;  3MNN B;  3C1C C;  1JFI A;  2DQN C;  4CSR A;  2ZY3 A;  5KDM A;  5AY8 B;  3B6F B;  5CPJ A;  5B1L D;  4HGA B;  3AZI B;  3AZN D;  4J8X A;  2FFF B;  3NQJ B;  1P3O C;  4KGC C;  3LEL B;  3X1U B;  4H9N B;  3AV1 A;  5AVB A;  2FJ7 C;  3MGS A;  3UTB B;  4XZQ D;  5DNN D;  4EO5 C;  3REK A;  5FUG A;  3W96 B;  5AVC D;  4H9S C;  5BS7 C;  1ID3 A;  5BNV A;  2NQB B;  3AN2 B;  1TZY D;  4X23 B;  3AZJ B;  5B32 C;  3X1V D;  2Y2K A;  3MGP A;  1N1J A;  5CPK A;  3W99 D;  3KXB A;  5GT3 B;  1P3B B;  1BH8 B;  2ZM5 A;  3WKJ D;  3KWQ C;  2YFW A;  2F8N A;  5B24 B;  4UUZ B;  2JCH A;  5C3I C;  4JJN D;  3O62 C;  5DNM D;  5GSU A;  4ZBJ B;  4QLC C;  5B40 C;  1P3I C;  1EQZ A;  3AZG C;  4H9O B;  3AZF C;  1AOI C;  2NZD B;  4LD9 A;  3TU4 A;  5B1L C;  1KX5 A;  2Y2M A;  3AZN C;  3V9R B;  3AZM B;  2PYO B;  4E45 A;  5CPI B;  3AFA B;  4Z66 B;  3LJA B;  1Q9C A;  4XUJ D;  4XZQ C;  5DNN C;  2W8S A;  4J8U D;  3WA9 A;  5E5A C;  4J8V A;  4YM6 A;  5AV8 B;  5AV5 D;  2F8N K;  5AV6 D;  3REH D;  3W98 B;  5AVC C;  5B0Y B;  3MGQ D;  5B31 D;  1T3U A;  2L5A A;  1P3K A;  1F66 D;  1P3M B;  1TZY C;  3X1V C;  1M18 A;  1P3F B;  3W99 C;  2Y2P A;  2CV5 A;  1M19 D;  3R45 B;  4KUD A;  3REI D;  3WKJ C;  3MVD A;  2UWX A;  2RIQ A;  3C1C A;  3MNN D;  3B6G D;  2BYK B;  5AY8 D;  3VH5 T;  4JJN C;  3LZ0 B;  5DNM C;  1WWS A;  3AZL D;  1P3O A;  4KGC A;  5CP6 D;  3LEL D;  3X1U D;  2FJ7 A;  3UTA D;  3UTB D;  5GXQ B;  5GT0 B;  3LZ1 D;  1S32 D;  1HTA A;  5BO0 B;  1M1A B;  3W96 D;  4H9S A;  5BS7 A;  4H9P A;  3IP4 C;  5B2J B;  3AN2 D;  5B32 A;  3MGR B;  1R4V A;  5GT3 D;  4XUJ C;  1P3B D;  4H9R A;  4J8U C;  3KWQ A;  3F6T A;  4J8X B;  1P3L D;  5AV5 C;  5AV6 C;  3REH C;  3W97 D;  5AVB B;  1KX3 B;  3MGS B;  3MGQ C;  1HQ3 B;  5B31 C;  3O62 A;  4YS3 B;  1F66 C;  2Y2Q A;  1P34 D;  4M6B A;  4QLC A;  5B40 A;  1P3I A;  1M19 C;  1H3O B;  3AZG A;  4Z2M G;  3X1T A;  3REI C;  3AZF A;  1AOI A;  3B6G C;  3MNN C;  2NZD D;  3EG5 B;  1P3A B;  5AY8 C;  1N1J B;  4H9Q A;  5CPK B;  3KXB B;  5B1L A;  3REL B;  3H0R C;  4HGA C;  3A1K A;  3AZN A;  5B1M B;  3AZL C;  4KHA A;  3WTP E;  3VH5 W;  5CP6 C;  3AZM D;  2Y2G A;  3LEL C;  3X1U C;  4WU9 D;  5CPI D;  3AFA D;  4Z66 D;  3UTA C;  2JSS A;  4XZQ A;  5DNN A;  3UTB C;  4NE3 A;  3LZ1 C;  1S32 C;  5GSU B;  5AV8 D;  2BYM B;  2F8N H;  3A6N B;  1EQZ B;  5AVC A;  3W96 C;  5B0Y D;  5BNX B;  1TAF B;  3TU4 B;  1TZY A;  3AN2 C;  3X1V A;  1P3F D;  3W99 A;  1KX5 B;  5GT3 C;  1P3B C;  5B33 D;  3WKJ A;  3EPH A;  5E5A D;  1P3L C;  5AV9 D;  4NE5 A;  4ZUX B;  3W97 C;  2G5I C;  2RVQ D;  2ZY5 A;  4DRA A;  4JJN A;  1ZLA B;  5DNM A;  3WA9 B;  1P34 C;  4J8V B;  4YM6 B;  1ULY A;  4R8P B;  3EPK A;  2YFV A;  1W2E A;  5G49 A;  5B0Z D;  2NZD C;  4Z5T D;  4WU8 B;  1U35 B;  4KUD B;  2Y2I A;  3MVD B;  2Y2H A;  3AZM C;  5B2J D;  5CPI C;  4WU9 C;  3MGR D;  2HUE C;  4Z66 C;  3AFA C;  2ARO D;  3X1S A;  4AWL C;  2CWE A;  4CAY A;  1WWI A;  4J8U A;  5AV5 A;  5AV8 C;  5AV6 A;  3KUY B;  3VH6 W;  3REH A;  3AZH B;  3H0L C;  5AVB D;  1KX3 D;  5B0Y C;  4J8W B;  3MGQ A;  5B31 A;  4YS3 D;  1HQ3 D;  1F66 A;  4EO5 B;  1P3G B;  3VH5 A;  1P3F C;  1M19 A;  3AYW B;  3REI A;  5B33 C;  4H9P B;  4NFT A;  2IO5 B;  3B6G A;  1P3P B;  2VQR A;  5AV9 C;  1P3A D;  5B32 B;  5AY8 A;  3AZE B;  5CPK D;  3KXB D;  2RVQ C;  3REL D;  3AZK D;  5B1M D;  3AZL A;  3NQJ A;  3REJ B;  5CP6 A;  3LEL A;  3X1U A;  3NQU B;  1KX4 B;  3UTA A;  3WAA B;  3UTB A;  5JRG B;  3O62 B;  2HIO D;  3AV2 B;  4WNN B;  3LZ1 A;  5B0Z C;  1S32 A;  5GSU D;  4Z5T C;  2Y2N A;  3A6N D;  3B6F D;  3W96 A;  3AZG B;  2XD1 A;  3X1T B;  3AZI D;  2ZY2 A;  2XD5 A;  3AN2 A;  5B2J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...