4J8WC

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wC00
3O62D 3AV1C 4H9RB 5GXQD 3X1VB 1TZYD 4XZQC 4AWLB 2NZDD 1P3OD 5B0YC 5AV6C 5AV8B 5DNNC 3VH6T 3MGPB 3AZNB 5AV5B 1BH9A 4UUZA 3AZGC 3X1TB 4X23D 5B1MA 4G91B 5E5AA 4Z5TD 3AV1A 3C1BD 4XZQA 3AZMC 1A7WA 5B0YA 2BYKA 5GSUA 5E5AD 5DNNA 5CP6C 4WZSB 3AZFB 2BYMA 3W96B 1HQ3B 3AZLC 3AZGA 4KGCC 1AOID 5B0YD 4YM6B 5GSUD 4XUJD 1H3OA 5DNND 1BH8B 5DNMD 3REJB 5JRGD 1ZLAD 5BO0A 5B1LC 4Z2MH 3AZED 2YFVA 1ID3D 3AZMA 3MGQB 3W97B 3AYWA 3X1VC 4AWLC 3AZKB 4KGCA 4JJNB 4E44A 5KDMB 3MGPC 3KUYB 3AZNC 5B2ID 4QLCC 3LJAD 3AYWD 5B1LA 3A6ND 4WNNB 3X1TC 1R4VA 4Z66B 4ZBJB 5JA4A 4KGCD 2JSSA 4G91C 3V9RA 4J8XB 3X1VA 1S32D 1P3MD 3B6FD 4CSRA 3MGPA 3W96C 3AZNA 5GT3D 4QLCA 3LZ0B 3MVDB 4H9NB 3X1TA 2F8ND 4YM6C 1P3AD 3REJC 4J8UC 5AY8C 5B2JC 2CV5D 3MGQC 2AROD 3W96A 5G49B 3VH6W 1M1AD 4X23B 1BH8A 4NE5A 3O62B 2YFWB 3KUYC 3REJA 3REHA 1EQZD 4J8UA 5AY8A 3WKJA 5GXQB 1TZYB 4ZBJC 5B2JA 2HUEC 1P3OB 4H9PB 3MGQA 3W99D 3WKJD 3REHD 4J8UD 5AY8D 1P3BD 3UTAD 1P3FD 5KDMA 3AFAD 3KUYA 5BNXB 3LZ0C 3MVDC 3C1BB 4EO5B 1BH9B 4UUZB 4WNNA 3NQUA 5E5AB 1M18C 1AOIB 5B0YB 4WU8D 5GSUB 2BYKB 4XUJB 5DNNB 2HIOD 5B0ZD 5DNMB 2BYMB 5BNVB 5JRGB 1ZLAB 3LZ0A 3B6GC 2IO5B 4H9NA 3AZEB 3AZGB 1ID3B 2F8NK 4X23C 3O62C 1P3GD 1M18A 5BO0B 5GXQC 1TZYC 2NZDC 3VH6A 2YFVB 3AZMB 5B2IB 3LJAB 3AYWB 3B6GA 4DRBA 3MNND 3A6NB 2PYOD 4KGCB 3C1CD 1P3KD 4ZUXD 4X23A 3O62A 2YFWA 4Z5TC 4LD9D 3C1BC 1TZYA 2NZDA 1S32B 1P3MB 1P34D 4H9PA 3B6FB 3AZHA 3V9RB 2LY8A 3NQJB 2F8NB 1AOIC 5GSUC 4CSRB 5DNMC 4XUJC 5GT0D 3AZHD 1P3AB 4Z5TA 5JRGC 1ZLAC 5BNXA 1WWSA 2IO5C 4QLCB 3C1BA 3AZEC 5CPJD 2CV5B 1ID3C 1P3ID 2AROB 3AV2A 1KX4D 1AOIA 4XUJA 5DNMA 3AV2D 5BNVA 5B2IC 5JRGA 3LJAC 3AYWC 1ZLAA 3A6NC 5AV9D 3AZEA 1ID3A 3W98C 5B40D 3WKJB 3REHB 4J8UB 5AY8B 4J8WD 1S32C 1P3BB 1P3MC 5B2JB 1P3FB 4KHAA 3B6FC 4R8PD 3AFAB 2FJ7D 5B2IA 5GT3C 3LJAA 3A6NA 5CPIA 1P3PD 3W98A 1P3AC 4WV4B 3RELD 1S32A 1P3MA 2CV5C 5CPID 2HUEB 1Q9CA 4WU8B 3B6FA 3NQUB 2AROC 3W98D 2HIOB 5GT3A 3AZID 1M1AC 3NQJA 2F8NA 3WTPD 1P3AA 1P3GB 1JFIB 1EQZC 2F8NH 5CHLB 2CV5A 1P3LD 1F1EA 2AROA 1F66D 3W99C 1M18B 3WKJC 3REHC 4H9SA 4H9OA 5B31C 3MNNB 3UTAC 1P3BC 1M1AA 1P3FC 2PYOB 3C1CB 1P3KB 3AFAC 4LD9B 5AVBD 1EQZA 3B6GB 1U35C 1KU5A 3W99A 3X1UC 4CAYA 2RVQD 5B31A 1P3BA 3UTAA 2NZDB 1P3FA 3UTBD 4WU8C 3WA9C 3UT9A 3AZHB 5GT0B 2HIOC 5AVCD 5AV8D 5B0ZC 3AFAA 5AV5D 5B31D 1U35A 3VH5T 3MGSD 5CPJB 3R45A 1P3IB 3UT9D 1P3GC 4Z5TB 3X1SA 3X1UA 5B32C 1KX4B 1U35D 5F99C 1M19D 2NQBA 1ULYA 4WU8A 3REKD 3WA9A 2HIOA 5B0ZA 3AV2B 3X1SD 3AZFD 3X1UD 4YS3C 3MNNC 2PYOC 3AN2D 5AV9B 3C1CC 1KX5B 4HGAB 1P3KC 2NQBD 4ZUXC 3WA9D 5B40B 1P3GA 1JFIA 5CPKD 4LD9C 2F8NG 5B33D 3B0BA 5B32A 5F99A 1P34C 4R8PB 1KX3C 2FJ7B 4YS3A 5B32D 3MNNA 4J8VC 2PYOA 5F99D 5B24C 3C1CA 1P3KA 4KHAB 3AZHC 4ZUXA 5GT0C 3RELB 4LD9A 4YS3D 3TU4D 5CPJC 4G92B 5CPIB 4Z66D 4WU9D 1P34A 1P3IC 3W98B 1KX3A 3MGRA 1KX4C 4J8XD 4J8VA 3KWQC 5B24A 3WTPB 3REIC 5GT0A 5B31G 3AV2C 1KX3D 3MGRD 5GT3B 4J8VD 1HTAA 5AV9C 5CPJA 1P3LB 4HGAC 5B24D 1P3IA 5B40C 1F66B 5BS7C 3AZJD 1KX4A 4J8WC 3KWQA 4R8PC 3REIA 2FJ7C 5AVBB 1N1JA 4H9OB 1M1AB 5AV9A 1P3PC 3KWQD 3REID 3VH5W 3RELC 5B40A 2CWEA 5BS7A 3B0CT 3LELA 1EQZB 4J8WA 4G92C 5CPIC 3UTBB 4R8PA 5B32G 5AVCB 3LELD 2FJ7A 3W99B 3KXBA 4CAYB 3AZIC 5B31B 3UTAB 3MGSB 3LZ1A 3WTPC 1P3PA 3UT9B 3RELA 3WAAA 3KXBD 1U35B 1M19B 3LZ1D 3R45B 1P3LC 3REKB 5B1MD 1F66C 5AV6A 3WAAD 3X1SB 3X1UB 3AV1D 3AZIA 3AN2B 4XZQD 2NQBB 3WTPA 3WA9B 1TAFB 5AV6D 5B0ZB 5CPKB 5AVBC 4NFTA 5B33B 4KUDC 4H9SC 3AZGD 1P3LA 1F66A 1KX5C 5CP6A 2RVQC 5B32B 3AZLA 5F99B 3UTBC 4H9QA 3AZMD 5AVCC 3VH5A 5AV8C 5AVBA 5CP6D 4KUDA 5AV5C 4YS3B 4DRAA 3TU4B 3MGSC 3AZLD 4WU9B 4E45A 3UT9C 4ZUXB 1B6WA 4NE3A 3KSYA 1KX5A 4KUDD 4H9RA 1M19C 5FUGB 5B1LD 3UTBA 1P34B 3REKC 5AVCA 1KX3B 5AV8A 3MGRB 1KX5D 3X1SC 3AZFC 5AV5A 3AN2C 1HQ3C 4J8VB 3MGSA 3X1VD 2NQBC 5B24B 4NE6A 5CPKC 3MGPD 5B33C 3AZND 3AZJB 4QLCD 1M19A 3B0CW 3X1TD 3REKA 1WWIA 3W97C 3AZFA 3AN2A 1HQ3A 1BFMA 3B0DB 3AZKC 3KWQB 4JJNC 3REIB 4YM6A 1TAFA 5CPKA 3W96D 1N1JB 5B33A 4Z2MG 3TU4C 1HQ3D 4Z66C 4WU9C 1B67A 4YM6D 3W97A 3LELB 3WTPE 3REJD 4J8XC 4J8WB 3AZKA 5B2JD 4JJNA 3MGQD 3MGRC 3W97D 3KXBB 4M6BA 3TU4A 3LZ1B 4Z66A 5C3IB 3AZKD 4WU9A 1P3PB 4JJND 5B1MB 2L5AA 3WAAB 3KUYD 3AZJC 3AV1B 4J8XA 5FUGA 4XZQB 5BT1C 5AV6B 3MVDA 3AZIB 3B0DC 1H3OB 3AZJA 3LZ0D 3MVDD 1P3OC 3LELC 1M18D 5CP6B 5G49A 3AZLB 4H9QB 5BT1D 3KXBC 4KUDB 3B6GD 4EO5C 5GXQA 5B1LB 3LZ1C 5C3IC 5JA4B 1P3OA 5B1MC 5E5AC 3WAAC
chains in the Genus database with same CATH superfamily
3O62D 3AV1C 2W8SA 3F6TA 4H9RB 5GXQD 3X1VB 1TZYD 4XZQC 4AWLB 2NZDD 1P3OD 5B0YC 5AV6C 5AV8B 5DNNC 3VH6T 3MGPB 3AZNB 2Y2OA 5AV5B 1BH9A 4UUZA 3AZGC 3X1TB 4X23D 5B1MA 4G91B 5E5AA 4Z5TD 3AV1A 3C1BD 4XZQA 3AZMC 1A7WA 5B0YA 2BYKA 5GSUA 5E5AD 5DNNA 5CP6C 1W2EA 2UWXA 2BYMA 4WZSB 3AZFB 3W96B 1HQ3B 3AZLC 3AZGA 3IP4C 4KGCC 1AOID 5B0YD 4YM6B 5GSUD 4XUJD 1H3OA 5DNND 1BH8B 5DNMD 3REJB 5JRGD 1ZLAD 5BO0A 5B1LC 4Z2MH 3AZED 2YFVA 1ID3D 3AZMA 3MGQB 3W97B 3AYWA 3X1VC 4AWLC 2Y2LA 3AZKB 4KGCA 4JJNB 4E44A 5KDMB 3MGPC 3P5JB 3KUYB 3AZNC 5B2ID 4QLCC 3LJAD 3AYWD 5B1LA 3A6ND 2XD1A 4WNNB 1R4VA 4Z66B 4ZBJB 5JA4A 3X1TC 4KGCD 2JSSA 3AL0C 3EPHA 4G91C 3V9RA 4J8XB 3X1VA 1S32D 1P3MD 3EPJA 4CSRA 3B6FD 3MGPA 3W96C 3AZNA 5GT3D 4QLCA 3LZ0B 3MVDB 4H9NB 3X1TA 2F8ND 1Z2CB 4YM6C 2VQRA 1P3AD 3REJC 4J8UC 5AY8C 5B2JC 2CV5D 3MGQC 2AROD 3A1KA 3W96A 5G49B 3VH6W 1M1AD 2ZY5A 4X23B 1BH8A 4NE5A 3O62B 2YFWB 3KUYC 3REJA 3REHA 1EQZD 4J8UA 5AY8A 3WKJA 5GXQB 1TZYB 4ZBJC 5B2JA 2HUEC 1P3OB 4H9PB 3MGQA 3W99D 3WKJD 3REHD 4J8UD 5AY8D 1P3BD 3UTAD 1P3FD 3KFUG 5KDMA 3AFAD 3KUYA 5BNXB 3LZ0C 3MVDC 3C1BB 4EO5B 1BH9B 4UUZB 4WNNA 3NQUA 5E5AB 1M18C 1AOIB 5B0YB 4WU8D 5GSUB 2BYKB 2Y2PA 5DNNB 2HIOD 4XUJB 5B0ZD 5DNMB 2BYMB 5BNVB 5JRGB 1ZLAB 3LZ0A 3B6GC 2IO5B 4H9NA 3AZEB 3AZGB 1ID3B 2F8NK 4X23C 3O62C 1P3GD 1M18A 5BO0B 5GXQC 1TZYC 2NZDC 3VH6A 2YFVB 3AZMB 5B2IB 3LJAB 3AYWB 3B6GA 4DRBA 3MNND 3A6NB 2PYOD 4KGCB 3C1CD 1P3KD 4ZUXD 4X23A 3O62A 2YFWA 4Z5TC 4LD9D 3C1BC 1TZYA 2NZDA 1S32B 1P3MB 4DQYB 1P34D 4H9PA 3B6FB 3AZHA 3V9RB 2LY8A 3NQJB 2F8NB 1AOIC 3H0RC 5GSUC 4CSRB 5DNMC 4XUJC 5GT0D 3AZHD 1P3AB 4Z5TA 2Y2IA 5JRGC 1ZLAC 5BNXA 1WWSA 2IO5C 4QLCB 3C1BA 3AZEC 5CPJD 2CV5B 1ID3C 1P3ID 2AROB 3AV2A 1KX4D 1AOIA 2ZY2A 4XUJA 5DNMA 3AV2D 2Y2NA 5BNVA 5B2IC 5JRGA 3FDDA 3LJAC 3AYWC 1ZLAA 3A6NC 5AV9D 3AZEA 1ID3A 3W98C 5B40D 3WKJB 3REHB 4J8UB 5AY8B 4J8WD 1S32C 1P3BB 1P3MC 5B2JB 1P3FB 4KHAA 3B6FC 4R8PD 3AFAB 2FJ7D 5B2IA 5GT3C 3LJAA 2BG1A 3A6NA 5CPIA 1P3PD 3W98A 1T3UA 4WV4B 3RELD 1P3AC 1S32A 1P3MA 2CV5C 5CPID 2HUEB 1Q9CA 4WU8B 3B6FA 3NQUB 2AROC 3W98D 2HIOB 5GT3A 3AZID 1M1AC 2Y2GA 3NQJA 2F8NA 3WTPD 1P3AA 1P3GB 2ZY4A 1JFIB 1EQZC 2F8NH 5CHLB 2CV5A 1P3LD 1F1EA 2AROA 1F66D 3W99C 1M18B 3WKJC 3REHC 4H9SA 4H9OA 5B31C 3MNNB 3UTAC 1P3BC 1M1AA 1P3FC 2PYOB 3C1CB 1P3KB 3AFAC 4LD9B 5AVBD 1EQZA 3B6GB 1U35C 1KU5A 3W99A 2Y2KA 4CAYA 3X1UC 2RVQD 5B31A 1P3BA 3UTAA 2NZDB 1P3FA 3UTBD 4WU8C 2G5IC 3UT9A 3AZHB 5GT0B 2FFFB 2HIOC 5AV8D 2Y2JA 5AVCD 5B0ZC 3AFAA 5AV5D 2Y2MA 5B31D 1U35A 3VH5T 3MGSD 5CPJB 3R45A 1P3IB 3UT9D 1P3GC 2DQNC 4Z5TB 3X1SA 3X1UA 5B32C 1KX4B 1U35D 5F99C 1M19D 2NQBA 1ULYA 4WU8A 3REKD 3WA9A 2HIOA 5B0ZA 3AV2B 3X1SD 3AZFD 3X1UD 4YS3C 3H0MC 3MNNC 2PYOC 3AN2D 5AV9B 3C1CC 1KX5B 4HGAB 1P3KC 2NQBD 4ZUXC 3WA9D 5B40B 1P3GA 1JFIA 5CPKD 4LD9C 2F8NG 5B33D 3B0BA 5B32A 5F99A 1P34C 4R8PB 1KX3C 2FJ7B 2JCHA 4YS3A 5B32D 3MNNA 4J8VC 2PYOA 5F99D 5B24C 3C1CA 1P3KA 4KHAB 3AZHC 4ZUXA 5GT0C 3RELB 4LD9A 4UPKA 4YS3D 3TU4D 5CPJC 4G92B 5CPIB 4Z66D 4WU9D 1P34A 1P3IC 2G5HC 3W98B 1KX3A 3MGRA 1KX4C 4J8XD 4J8VA 3KWQC 5B24A 3WTPB 3REIC 5GT0A 5B31G 3AV2C 1KX3D 3MGRD 5GT3B 4J8VD 1HTAA 5AV9C 5CPJA 1P3LB 4HGAC 5B24D 3EPKA 1P3IA 5B40C 1F66B 5BS7C 3AZJD 1KX4A 4J8WC 3KWQA 4R8PC 3REIA 2FJ7C 5AVBB 1N1JA 4H9OB 1M1AB 5AV9A 1P3PC 3KWQD 3REID 3VH5W 3RELC 5B40A 2CWEA 5BS7A 3B0CT 3H0LC 3LELA 1EQZB 4J8WA 4G92C 5CPIC 1PZRA 3UTBB 4R8PA 5B32G 5AVCB 3LELD 2FJ7A 3W99B 3KXBA 4CAYB 3AZIC 5B31B 3UTAB 3MGSB 3LZ1A 3A1IA 3WTPC 1P3PA 3UT9B 3RELA 3WAAA 3KXBD 3EG5B 2DF4C 1U35B 1M19B 3LZ1D 3R45B 1P3LC 3REKB 5B1MD 1F66C 5AV6A 3WAAD 3X1SB 3X1UB 3AV1D 3AZIA 3AN2B 4XZQD 2NQBB 3WTPA 3EPLA 3WA9B 1TAFB 5AV6D 5B0ZB 5CPKB 5AVBC 4NFTA 5B33B 4KUDC 4H9SC 3AZGD 1P3LA 1F66A 1KX5C 5CP6A 2RVQC 5B32B 3AZLA 5F99B 3UTBC 4H9QA 3AZMD 5AVCC 3VH5A 5AV8C 5AVBA 5CP6D 4KUDA 5AV5C 4YS3B 4DRAA 3TU4B 3MGSC 3AZLD 4WU9B 4E45A 3UT9C 4ZUXB 1B6WA 4NE3A 3KSYA 1KX5A 4KUDD 2ZY3A 4H9RA 1M19C 5FUGB 5B1LD 3UTBA 1P34B 2XD5A 3REKC 5AVCA 1KX3B 5AV8A 3MGRB 1KX5D 3X1SC 3AZFC 5AV5A 2JE5A 3AN2C 1HQ3C 4J8VB 3MGSA 3X1VD 2NQBC 5B24B 4NE6A 5CPKC 3MGPD 5B33C 3AZND 3AZJB 4QLCD 1M19A 3B0CW 3X1TD 3REKA 1WWIA 3W97C 3AZFA 3AN2A 1HQ3A 1BFMA 3B0DB 3AZKC 3KWQB 4JJNC 3REIB 4YM6A 1TAFA 3WA9C 5CPKA 3W96D 1N1JB 5B33A 4Z2MG 3TU4C 2J8PA 1HQ3D 4Z66C 4WU9C 4WJ3C 1B67A 4YM6D 3W97A 3LELB 3WTPE 3REJD 2RIQA 4J8XC 4J8WB 3AZKA 5B2JD 2F2AC 4JJNA 3MGQD 3MGRC 3W97D 3KXBB 4M6BA 3TU4A 3LZ1B 4Z66A 5C3IB 3AZKD 4WU9A 1P3PB 4JJND 5B1MB 2L5AA 3WAAB 3KUYD 3AZJC 3AV1B 4J8XA 5FUGA 4XZQB 2Y2QA 5BT1C 5AV6B 3MVDA 3AZIB 3B0DC 1H3OB 3AZJA 3LZ0D 3MVDD 1P3OC 3LELC 1M18D 5CP6B 5G49A 3AZLB 4H9QB 5BT1D 3KXBC 4KUDB 3B6GD 4EO5C 5GXQA 5B1LB 3LZ1C 2ZM5A 5C3IC 5JA4B 1P3OA 5B1MC 2Y2HA 5E5AC 3WAAC
chains in the Genus database with same CATH topology
3O62D 3AV1C 2W8SA 3F6TA 4H9RB 5GXQD 3X1VB 1TZYD 4XZQC 4AWLB 2NZDD 1P3OD 5B0YC 5AV6C 5AV8B 5DNNC 3VH6T 3MGPB 3AZNB 2Y2OA 5AV5B 1BH9A 4UUZA 3AZGC 3X1TB 4X23D 5B1MA 4G91B 5E5AA 4Z5TD 3AV1A 3C1BD 4XZQA 3AZMC 1A7WA 5B0YA 2BYKA 5GSUA 5E5AD 5DNNA 5CP6C 1W2EA 2UWXA 2BYMA 4WZSB 3AZFB 3W96B 1HQ3B 3AZLC 3AZGA 3IP4C 4KGCC 1AOID 5B0YD 4YM6B 5GSUD 4XUJD 1H3OA 5DNND 1BH8B 5DNMD 3REJB 5JRGD 1ZLAD 5BO0A 5B1LC 4Z2MH 3AZED 2YFVA 1ID3D 3AZMA 3MGQB 3W97B 3AYWA 3X1VC 4AWLC 2Y2LA 3AZKB 4KGCA 4JJNB 4E44A 5KDMB 3MGPC 3P5JB 3KUYB 3AZNC 5B2ID 4QLCC 3LJAD 3AYWD 5B1LA 3A6ND 2XD1A 4WNNB 1R4VA 4Z66B 4ZBJB 5JA4A 3X1TC 4KGCD 2JSSA 3AL0C 3EPHA 4G91C 3V9RA 4J8XB 3X1VA 1S32D 1P3MD 3EPJA 4CSRA 3B6FD 3MGPA 3W96C 3AZNA 5GT3D 4QLCA 3LZ0B 3MVDB 4H9NB 3X1TA 2F8ND 1Z2CB 4YM6C 2VQRA 1P3AD 3REJC 4J8UC 5AY8C 5B2JC 2CV5D 3MGQC 2AROD 3A1KA 3W96A 5G49B 3VH6W 1M1AD 2ZY5A 4X23B 1BH8A 4NE5A 3O62B 2YFWB 3KUYC 3REJA 3REHA 1EQZD 4J8UA 5AY8A 3WKJA 5GXQB 1TZYB 4ZBJC 5B2JA 2HUEC 1P3OB 4H9PB 3MGQA 3W99D 3WKJD 3REHD 4J8UD 5AY8D 1P3BD 3UTAD 1P3FD 3KFUG 5KDMA 3AFAD 3KUYA 5BNXB 3LZ0C 3MVDC 3C1BB 4EO5B 1BH9B 4UUZB 4WNNA 3NQUA 5E5AB 1M18C 1AOIB 5B0YB 4WU8D 5GSUB 2BYKB 2Y2PA 5DNNB 2HIOD 4XUJB 5B0ZD 5DNMB 2BYMB 5BNVB 5JRGB 1ZLAB 3LZ0A 3B6GC 2IO5B 4H9NA 3AZEB 3AZGB 1ID3B 2F8NK 4X23C 3O62C 1P3GD 1M18A 5BO0B 5GXQC 1TZYC 2NZDC 3VH6A 2YFVB 3AZMB 5B2IB 3LJAB 3AYWB 3B6GA 4DRBA 3MNND 3A6NB 2PYOD 4KGCB 3C1CD 1P3KD 4ZUXD 4X23A 3O62A 2YFWA 4Z5TC 4LD9D 3C1BC 1TZYA 2NZDA 1S32B 1P3MB 4DQYB 1P34D 4H9PA 3B6FB 3AZHA 3V9RB 2LY8A 3NQJB 2F8NB 1AOIC 3H0RC 5GSUC 4CSRB 5DNMC 4XUJC 5GT0D 3AZHD 1P3AB 4Z5TA 2Y2IA 5JRGC 1ZLAC 5BNXA 1WWSA 2IO5C 4QLCB 3C1BA 3AZEC 5CPJD 2CV5B 1ID3C 1P3ID 2AROB 3AV2A 1KX4D 1AOIA 2ZY2A 4XUJA 5DNMA 3AV2D 2Y2NA 5BNVA 5B2IC 5JRGA 3FDDA 3LJAC 3AYWC 1ZLAA 3A6NC 5AV9D 3AZEA 1ID3A 3W98C 5B40D 3WKJB 3REHB 4J8UB 5AY8B 4J8WD 1S32C 1P3BB 1P3MC 5B2JB 1P3FB 4KHAA 3B6FC 4R8PD 3AFAB 2FJ7D 5B2IA 5GT3C 3LJAA 2BG1A 3A6NA 5CPIA 1P3PD 3W98A 1T3UA 4WV4B 3RELD 1P3AC 1S32A 1P3MA 2CV5C 5CPID 2HUEB 1Q9CA 4WU8B 3B6FA 3NQUB 2AROC 3W98D 2HIOB 5GT3A 3AZID 1M1AC 2Y2GA 3NQJA 2F8NA 3WTPD 1P3AA 1P3GB 2ZY4A 1JFIB 1EQZC 2F8NH 5CHLB 2CV5A 1P3LD 1F1EA 2AROA 1F66D 3W99C 1M18B 3WKJC 3REHC 4H9SA 4H9OA 5B31C 3MNNB 3UTAC 1P3BC 1M1AA 1P3FC 2PYOB 3C1CB 1P3KB 3AFAC 4LD9B 5AVBD 1EQZA 3B6GB 1U35C 1KU5A 3W99A 2Y2KA 4CAYA 3X1UC 2RVQD 5B31A 1P3BA 3UTAA 2NZDB 1P3FA 3UTBD 4WU8C 2G5IC 3UT9A 3AZHB 5GT0B 2FFFB 2HIOC 5AV8D 2Y2JA 5AVCD 5B0ZC 3AFAA 5AV5D 2Y2MA 5B31D 1U35A 3VH5T 3MGSD 5CPJB 3R45A 1P3IB 3UT9D 1P3GC 2DQNC 4Z5TB 3X1SA 3X1UA 5B32C 1KX4B 1U35D 5F99C 1M19D 2NQBA 1ULYA 4WU8A 3REKD 3WA9A 2HIOA 5B0ZA 3AV2B 3X1SD 3AZFD 3X1UD 4YS3C 3H0MC 3MNNC 2PYOC 3AN2D 5AV9B 3C1CC 1KX5B 4HGAB 1P3KC 2NQBD 4ZUXC 3WA9D 5B40B 1P3GA 1JFIA 5CPKD 4LD9C 2F8NG 5B33D 3B0BA 5B32A 5F99A 1P34C 4R8PB 1KX3C 2FJ7B 2JCHA 4YS3A 5B32D 3MNNA 4J8VC 2PYOA 5F99D 5B24C 3C1CA 1P3KA 4KHAB 3AZHC 4ZUXA 5GT0C 3RELB 4LD9A 4UPKA 4YS3D 3TU4D 5CPJC 4G92B 5CPIB 4Z66D 4WU9D 1P34A 1P3IC 2G5HC 3W98B 1KX3A 3MGRA 1KX4C 4J8XD 4J8VA 3KWQC 5B24A 3WTPB 3REIC 5GT0A 5B31G 3AV2C 1KX3D 3MGRD 5GT3B 4J8VD 1HTAA 5AV9C 5CPJA 1P3LB 4HGAC 5B24D 3EPKA 1P3IA 5B40C 1F66B 5BS7C 3AZJD 1KX4A 4J8WC 3KWQA 4R8PC 3REIA 2FJ7C 5AVBB 1N1JA 4H9OB 1M1AB 5AV9A 1P3PC 3KWQD 3REID 3VH5W 3RELC 5B40A 2CWEA 5BS7A 3B0CT 3H0LC 3LELA 1EQZB 4J8WA 4G92C 5CPIC 1PZRA 3UTBB 4R8PA 5B32G 5AVCB 3LELD 2FJ7A 3W99B 3KXBA 4CAYB 3AZIC 5B31B 3UTAB 3MGSB 3LZ1A 3A1IA 3WTPC 1P3PA 3UT9B 3RELA 3WAAA 3KXBD 3EG5B 2DF4C 1U35B 1M19B 3LZ1D 3R45B 1P3LC 3REKB 5B1MD 1F66C 5AV6A 3WAAD 3X1SB 3X1UB 3AV1D 3AZIA 3AN2B 4XZQD 2NQBB 3WTPA 3EPLA 3WA9B 1TAFB 5AV6D 5B0ZB 5CPKB 5AVBC 4NFTA 5B33B 4KUDC 4H9SC 3AZGD 1P3LA 1F66A 1KX5C 5CP6A 2RVQC 5B32B 3AZLA 5F99B 3UTBC 4H9QA 3AZMD 5AVCC 3VH5A 5AV8C 5AVBA 5CP6D 4KUDA 5AV5C 4YS3B 4DRAA 3TU4B 3MGSC 3AZLD 4WU9B 4E45A 3UT9C 4ZUXB 1B6WA 4NE3A 3KSYA 1KX5A 4KUDD 2ZY3A 4H9RA 1M19C 5FUGB 5B1LD 3UTBA 1P34B 2XD5A 3REKC 5AVCA 1KX3B 5AV8A 3MGRB 1KX5D 3X1SC 3AZFC 5AV5A 2JE5A 3AN2C 1HQ3C 4J8VB 3MGSA 3X1VD 2NQBC 5B24B 4NE6A 5CPKC 3MGPD 5B33C 3AZND 3AZJB 4QLCD 1M19A 3B0CW 3X1TD 3REKA 1WWIA 3W97C 3AZFA 3AN2A 1HQ3A 1BFMA 3B0DB 3AZKC 3KWQB 4JJNC 3REIB 4YM6A 1TAFA 3WA9C 5CPKA 3W96D 1N1JB 5B33A 4Z2MG 3TU4C 2J8PA 1HQ3D 4Z66C 4WU9C 4WJ3C 1B67A 4YM6D 3W97A 3LELB 3WTPE 3REJD 2RIQA 4J8XC 4J8WB 3AZKA 5B2JD 2F2AC 4JJNA 3MGQD 3MGRC 3W97D 3KXBB 4M6BA 3TU4A 3LZ1B 4Z66A 5C3IB 3AZKD 4WU9A 1P3PB 4JJND 5B1MB 2L5AA 3WAAB 3KUYD 3AZJC 3AV1B 4J8XA 5FUGA 4XZQB 2Y2QA 5BT1C 5AV6B 3MVDA 3AZIB 3B0DC 1H3OB 3AZJA 3LZ0D 3MVDD 1P3OC 3LELC 1M18D 5CP6B 5G49A 3AZLB 4H9QB 5BT1D 3KXBC 4KUDB 3B6GD 4EO5C 5GXQA 5B1LB 3LZ1C 2ZM5A 5C3IC 5JA4B 1P3OA 5B1MC 2Y2HA 5E5AC 3WAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 D;  3AV1 C;  4H9R B;  5GXQ D;  3X1V B;  1TZY D;  4XZQ C;  4AWL B;  2NZD D;  1P3O D;  5B0Y C;  5AV6 C;  5AV8 B;  5DNN C;  3VH6 T;  3MGP B;  3AZN B;  5AV5 B;  1BH9 A;  4UUZ A;  3AZG C;  3X1T B;  4X23 D;  5B1M A;  4G91 B;  5E5A A;  4Z5T D;  3AV1 A;  3C1B D;  4XZQ A;  3AZM C;  1A7W A;  5B0Y A;  2BYK A;  5GSU A;  5E5A D;  5DNN A;  5CP6 C;  4WZS B;  3AZF B;  2BYM A;  3W96 B;  1HQ3 B;  3AZL C;  3AZG A;  4KGC C;  1AOI D;  5B0Y D;  4YM6 B;  5GSU D;  4XUJ D;  1H3O A;  5DNN D;  1BH8 B;  5DNM D;  3REJ B;  5JRG D;  1ZLA D;  5BO0 A;  5B1L C;  4Z2M H;  3AZE D;  2YFV A;  1ID3 D;  3AZM A;  3MGQ B;  3W97 B;  3AYW A;  3X1V C;  4AWL C;  3AZK B;  4KGC A;  4JJN B;  4E44 A;  5KDM B;  3MGP C;  3KUY B;  3AZN C;  5B2I D;  4QLC C;  3LJA D;  3AYW D;  5B1L A;  3A6N D;  4WNN B;  3X1T C;  1R4V A;  4Z66 B;  4ZBJ B;  5JA4 A;  4KGC D;  2JSS A;  4G91 C;  3V9R A;  4J8X B;  3X1V A;  1S32 D;  1P3M D;  3B6F D;  4CSR A;  3MGP A;  3W96 C;  3AZN A;  5GT3 D;  4QLC A;  3LZ0 B;  3MVD B;  4H9N B;  3X1T A;  2F8N D;  4YM6 C;  1P3A D;  3REJ C;  4J8U C;  5AY8 C;  5B2J C;  2CV5 D;  3MGQ C;  2ARO D;  3W96 A;  5G49 B;  3VH6 W;  1M1A D;  4X23 B;  1BH8 A;  4NE5 A;  3O62 B;  2YFW B;  3KUY C;  3REJ A;  3REH A;  1EQZ D;  4J8U A;  5AY8 A;  3WKJ A;  5GXQ B;  1TZY B;  4ZBJ C;  5B2J A;  2HUE C;  1P3O B;  4H9P B;  3MGQ A;  3W99 D;  3WKJ D;  3REH D;  4J8U D;  5AY8 D;  1P3B D;  3UTA D;  1P3F D;  5KDM A;  3AFA D;  3KUY A;  5BNX B;  3LZ0 C;  3MVD C;  3C1B B;  4EO5 B;  1BH9 B;  4UUZ B;  4WNN A;  3NQU A;  5E5A B;  1M18 C;  1AOI B;  5B0Y B;  4WU8 D;  5GSU B;  2BYK B;  4XUJ B;  5DNN B;  2HIO D;  5B0Z D;  5DNM B;  2BYM B;  5BNV B;  5JRG B;  1ZLA B;  3LZ0 A;  3B6G C;  2IO5 B;  4H9N A;  3AZE B;  3AZG B;  1ID3 B;  2F8N K;  4X23 C;  3O62 C;  1P3G D;  1M18 A;  5BO0 B;  5GXQ C;  1TZY C;  2NZD C;  3VH6 A;  2YFV B;  3AZM B;  5B2I B;  3LJA B;  3AYW B;  3B6G A;  4DRB A;  3MNN D;  3A6N B;  2PYO D;  4KGC B;  3C1C D;  1P3K D;  4ZUX D;  4X23 A;  3O62 A;  2YFW A;  4Z5T C;  4LD9 D;  3C1B C;  1TZY A;  2NZD A;  1S32 B;  1P3M B;  1P34 D;  4H9P A;  3B6F B;  3AZH A;  3V9R B;  2LY8 A;  3NQJ B;  2F8N B;  1AOI C;  5GSU C;  4CSR B;  5DNM C;  4XUJ C;  5GT0 D;  3AZH D;  1P3A B;  4Z5T A;  5JRG C;  1ZLA C;  5BNX A;  1WWS A;  2IO5 C;  4QLC B;  3C1B A;  3AZE C;  5CPJ D;  2CV5 B;  1ID3 C;  1P3I D;  2ARO B;  3AV2 A;  1KX4 D;  1AOI A;  4XUJ A;  5DNM A;  3AV2 D;  5BNV A;  5B2I C;  5JRG A;  3LJA C;  3AYW C;  1ZLA A;  3A6N C;  5AV9 D;  3AZE A;  1ID3 A;  3W98 C;  5B40 D;  3WKJ B;  3REH B;  4J8U B;  5AY8 B;  4J8W D;  1S32 C;  1P3B B;  1P3M C;  5B2J B;  1P3F B;  4KHA A;  3B6F C;  4R8P D;  3AFA B;  2FJ7 D;  5B2I A;  5GT3 C;  3LJA A;  3A6N A;  5CPI A;  1P3P D;  3W98 A;  1P3A C;  4WV4 B;  3REL D;  1S32 A;  1P3M A;  2CV5 C;  5CPI D;  2HUE B;  1Q9C A;  4WU8 B;  3B6F A;  3NQU B;  2ARO C;  3W98 D;  2HIO B;  5GT3 A;  3AZI D;  1M1A C;  3NQJ A;  2F8N A;  3WTP D;  1P3A A;  1P3G B;  1JFI B;  1EQZ C;  2F8N H;  5CHL B;  2CV5 A;  1P3L D;  1F1E A;  2ARO A;  1F66 D;  3W99 C;  1M18 B;  3WKJ C;  3REH C;  4H9S A;  4H9O A;  5B31 C;  3MNN B;  3UTA C;  1P3B C;  1M1A A;  1P3F C;  2PYO B;  3C1C B;  1P3K B;  3AFA C;  4LD9 B;  5AVB D;  1EQZ A;  3B6G B;  1U35 C;  1KU5 A;  3W99 A;  3X1U C;  4CAY A;  2RVQ D;  5B31 A;  1P3B A;  3UTA A;  2NZD B;  1P3F A;  3UTB D;  4WU8 C;  3WA9 C;  3UT9 A;  3AZH B;  5GT0 B;  2HIO C;  5AVC D;  5AV8 D;  5B0Z C;  3AFA A;  5AV5 D;  5B31 D;  1U35 A;  3VH5 T;  3MGS D;  5CPJ B;  3R45 A;  1P3I B;  3UT9 D;  1P3G C;  4Z5T B;  3X1S A;  3X1U A;  5B32 C;  1KX4 B;  1U35 D;  5F99 C;  1M19 D;  2NQB A;  1ULY A;  4WU8 A;  3REK D;  3WA9 A;  2HIO A;  5B0Z A;  3AV2 B;  3X1S D;  3AZF D;  3X1U D;  4YS3 C;  3MNN C;  2PYO C;  3AN2 D;  5AV9 B;  3C1C C;  1KX5 B;  4HGA B;  1P3K C;  2NQB D;  4ZUX C;  3WA9 D;  5B40 B;  1P3G A;  1JFI A;  5CPK D;  4LD9 C;  2F8N G;  5B33 D;  3B0B A;  5B32 A;  5F99 A;  1P34 C;  4R8P B;  1KX3 C;  2FJ7 B;  4YS3 A;  5B32 D;  3MNN A;  4J8V C;  2PYO A;  5F99 D;  5B24 C;  3C1C A;  1P3K A;  4KHA B;  3AZH C;  4ZUX A;  5GT0 C;  3REL B;  4LD9 A;  4YS3 D;  3TU4 D;  5CPJ C;  4G92 B;  5CPI B;  4Z66 D;  4WU9 D;  1P34 A;  1P3I C;  3W98 B;  1KX3 A;  3MGR A;  1KX4 C;  4J8X D;  4J8V A;  3KWQ C;  5B24 A;  3WTP B;  3REI C;  5GT0 A;  5B31 G;  3AV2 C;  1KX3 D;  3MGR D;  5GT3 B;  4J8V D;  1HTA A;  5AV9 C;  5CPJ A;  1P3L B;  4HGA C;  5B24 D;  1P3I A;  5B40 C;  1F66 B;  5BS7 C;  3AZJ D;  1KX4 A;  4J8W C;  3KWQ A;  4R8P C;  3REI A;  2FJ7 C;  5AVB B;  1N1J A;  4H9O B;  1M1A B;  5AV9 A;  1P3P C;  3KWQ D;  3REI D;  3VH5 W;  3REL C;  5B40 A;  2CWE A;  5BS7 A;  3B0C T;  3LEL A;  1EQZ B;  4J8W A;  4G92 C;  5CPI C;  3UTB B;  4R8P A;  5B32 G;  5AVC B;  3LEL D;  2FJ7 A;  3W99 B;  3KXB A;  4CAY B;  3AZI C;  5B31 B;  3UTA B;  3MGS B;  3LZ1 A;  3WTP C;  1P3P A;  3UT9 B;  3REL A;  3WAA A;  3KXB D;  1U35 B;  1M19 B;  3LZ1 D;  3R45 B;  1P3L C;  3REK B;  5B1M D;  1F66 C;  5AV6 A;  3WAA D;  3X1S B;  3X1U B;  3AV1 D;  3AZI A;  3AN2 B;  4XZQ D;  2NQB B;  3WTP A;  3WA9 B;  1TAF B;  5AV6 D;  5B0Z B;  5CPK B;  5AVB C;  4NFT A;  5B33 B;  4KUD C;  4H9S C;  3AZG D;  1P3L A;  1F66 A;  1KX5 C;  5CP6 A;  2RVQ C;  5B32 B;  3AZL A;  5F99 B;  3UTB C;  4H9Q A;  3AZM D;  5AVC C;  3VH5 A;  5AV8 C;  5AVB A;  5CP6 D;  4KUD A;  5AV5 C;  4YS3 B;  4DRA A;  3TU4 B;  3MGS C;  3AZL D;  4WU9 B;  4E45 A;  3UT9 C;  4ZUX B;  1B6W A;  4NE3 A;  3KSY A;  1KX5 A;  4KUD D;  4H9R A;  1M19 C;  5FUG B;  5B1L D;  3UTB A;  1P34 B;  3REK C;  5AVC A;  1KX3 B;  5AV8 A;  3MGR B;  1KX5 D;  3X1S C;  3AZF C;  5AV5 A;  3AN2 C;  1HQ3 C;  4J8V B;  3MGS A;  3X1V D;  2NQB C;  5B24 B;  4NE6 A;  5CPK C;  3MGP D;  5B33 C;  3AZN D;  3AZJ B;  4QLC D;  1M19 A;  3B0C W;  3X1T D;  3REK A;  1WWI A;  3W97 C;  3AZF A;  3AN2 A;  1HQ3 A;  1BFM A;  3B0D B;  3AZK C;  3KWQ B;  4JJN C;  3REI B;  4YM6 A;  1TAF A;  5CPK A;  3W96 D;  1N1J B;  5B33 A;  4Z2M G;  3TU4 C;  1HQ3 D;  4Z66 C;  4WU9 C;  1B67 A;  4YM6 D;  3W97 A;  3LEL B;  3WTP E;  3REJ D;  4J8X C;  4J8W B;  3AZK A;  5B2J D;  4JJN A;  3MGQ D;  3MGR C;  3W97 D;  3KXB B;  4M6B A;  3TU4 A;  3LZ1 B;  4Z66 A;  5C3I B;  3AZK D;  4WU9 A;  1P3P B;  4JJN D;  5B1M B;  2L5A A;  3WAA B;  3KUY D;  3AZJ C;  3AV1 B;  4J8X A;  5FUG A;  4XZQ B;  5BT1 C;  5AV6 B;  3MVD A;  3AZI B;  3B0D C;  1H3O B;  3AZJ A;  3LZ0 D;  3MVD D;  1P3O C;  3LEL C;  1M18 D;  5CP6 B;  5G49 A;  3AZL B;  4H9Q B;  5BT1 D;  3KXB C;  4KUD B;  3B6G D;  4EO5 C;  5GXQ A;  5B1L B;  3LZ1 C;  5C3I C;  5JA4 B;  1P3O A;  5B1M C;  5E5A C;  3WAA C; 
#chains in the Genus database with same CATH topology
 3O62 D;  3AV1 C;  2W8S A;  3F6T A;  4H9R B;  5GXQ D;  3X1V B;  1TZY D;  4XZQ C;  4AWL B;  2NZD D;  1P3O D;  5B0Y C;  5AV6 C;  5AV8 B;  5DNN C;  3VH6 T;  3MGP B;  3AZN B;  2Y2O A;  5AV5 B;  1BH9 A;  4UUZ A;  3AZG C;  3X1T B;  4X23 D;  5B1M A;  4G91 B;  5E5A A;  4Z5T D;  3AV1 A;  3C1B D;  4XZQ A;  3AZM C;  1A7W A;  5B0Y A;  2BYK A;  5GSU A;  5E5A D;  5DNN A;  5CP6 C;  1W2E A;  2UWX A;  2BYM A;  4WZS B;  3AZF B;  3W96 B;  1HQ3 B;  3AZL C;  3AZG A;  3IP4 C;  4KGC C;  1AOI D;  5B0Y D;  4YM6 B;  5GSU D;  4XUJ D;  1H3O A;  5DNN D;  1BH8 B;  5DNM D;  3REJ B;  5JRG D;  1ZLA D;  5BO0 A;  5B1L C;  4Z2M H;  3AZE D;  2YFV A;  1ID3 D;  3AZM A;  3MGQ B;  3W97 B;  3AYW A;  3X1V C;  4AWL C;  2Y2L A;  3AZK B;  4KGC A;  4JJN B;  4E44 A;  5KDM B;  3MGP C;  3P5J B;  3KUY B;  3AZN C;  5B2I D;  4QLC C;  3LJA D;  3AYW D;  5B1L A;  3A6N D;  2XD1 A;  4WNN B;  1R4V A;  4Z66 B;  4ZBJ B;  5JA4 A;  3X1T C;  4KGC D;  2JSS A;  3AL0 C;  3EPH A;  4G91 C;  3V9R A;  4J8X B;  3X1V A;  1S32 D;  1P3M D;  3EPJ A;  4CSR A;  3B6F D;  3MGP A;  3W96 C;  3AZN A;  5GT3 D;  4QLC A;  3LZ0 B;  3MVD B;  4H9N B;  3X1T A;  2F8N D;  1Z2C B;  4YM6 C;  2VQR A;  1P3A D;  3REJ C;  4J8U C;  5AY8 C;  5B2J C;  2CV5 D;  3MGQ C;  2ARO D;  3A1K A;  3W96 A;  5G49 B;  3VH6 W;  1M1A D;  2ZY5 A;  4X23 B;  1BH8 A;  4NE5 A;  3O62 B;  2YFW B;  3KUY C;  3REJ A;  3REH A;  1EQZ D;  4J8U A;  5AY8 A;  3WKJ A;  5GXQ B;  1TZY B;  4ZBJ C;  5B2J A;  2HUE C;  1P3O B;  4H9P B;  3MGQ A;  3W99 D;  3WKJ D;  3REH D;  4J8U D;  5AY8 D;  1P3B D;  3UTA D;  1P3F D;  3KFU G;  5KDM A;  3AFA D;  3KUY A;  5BNX B;  3LZ0 C;  3MVD C;  3C1B B;  4EO5 B;  1BH9 B;  4UUZ B;  4WNN A;  3NQU A;  5E5A B;  1M18 C;  1AOI B;  5B0Y B;  4WU8 D;  5GSU B;  2BYK B;  2Y2P A;  5DNN B;  2HIO D;  4XUJ B;  5B0Z D;  5DNM B;  2BYM B;  5BNV B;  5JRG B;  1ZLA B;  3LZ0 A;  3B6G C;  2IO5 B;  4H9N A;  3AZE B;  3AZG B;  1ID3 B;  2F8N K;  4X23 C;  3O62 C;  1P3G D;  1M18 A;  5BO0 B;  5GXQ C;  1TZY C;  2NZD C;  3VH6 A;  2YFV B;  3AZM B;  5B2I B;  3LJA B;  3AYW B;  3B6G A;  4DRB A;  3MNN D;  3A6N B;  2PYO D;  4KGC B;  3C1C D;  1P3K D;  4ZUX D;  4X23 A;  3O62 A;  2YFW A;  4Z5T C;  4LD9 D;  3C1B C;  1TZY A;  2NZD A;  1S32 B;  1P3M B;  4DQY B;  1P34 D;  4H9P A;  3B6F B;  3AZH A;  3V9R B;  2LY8 A;  3NQJ B;  2F8N B;  1AOI C;  3H0R C;  5GSU C;  4CSR B;  5DNM C;  4XUJ C;  5GT0 D;  3AZH D;  1P3A B;  4Z5T A;  2Y2I A;  5JRG C;  1ZLA C;  5BNX A;  1WWS A;  2IO5 C;  4QLC B;  3C1B A;  3AZE C;  5CPJ D;  2CV5 B;  1ID3 C;  1P3I D;  2ARO B;  3AV2 A;  1KX4 D;  1AOI A;  2ZY2 A;  4XUJ A;  5DNM A;  3AV2 D;  2Y2N A;  5BNV A;  5B2I C;  5JRG A;  3FDD A;  3LJA C;  3AYW C;  1ZLA A;  3A6N C;  5AV9 D;  3AZE A;  1ID3 A;  3W98 C;  5B40 D;  3WKJ B;  3REH B;  4J8U B;  5AY8 B;  4J8W D;  1S32 C;  1P3B B;  1P3M C;  5B2J B;  1P3F B;  4KHA A;  3B6F C;  4R8P D;  3AFA B;  2FJ7 D;  5B2I A;  5GT3 C;  3LJA A;  2BG1 A;  3A6N A;  5CPI A;  1P3P D;  3W98 A;  1T3U A;  4WV4 B;  3REL D;  1P3A C;  1S32 A;  1P3M A;  2CV5 C;  5CPI D;  2HUE B;  1Q9C A;  4WU8 B;  3B6F A;  3NQU B;  2ARO C;  3W98 D;  2HIO B;  5GT3 A;  3AZI D;  1M1A C;  2Y2G A;  3NQJ A;  2F8N A;  3WTP D;  1P3A A;  1P3G B;  2ZY4 A;  1JFI B;  1EQZ C;  2F8N H;  5CHL B;  2CV5 A;  1P3L D;  1F1E A;  2ARO A;  1F66 D;  3W99 C;  1M18 B;  3WKJ C;  3REH C;  4H9S A;  4H9O A;  5B31 C;  3MNN B;  3UTA C;  1P3B C;  1M1A A;  1P3F C;  2PYO B;  3C1C B;  1P3K B;  3AFA C;  4LD9 B;  5AVB D;  1EQZ A;  3B6G B;  1U35 C;  1KU5 A;  3W99 A;  2Y2K A;  4CAY A;  3X1U C;  2RVQ D;  5B31 A;  1P3B A;  3UTA A;  2NZD B;  1P3F A;  3UTB D;  4WU8 C;  2G5I C;  3UT9 A;  3AZH B;  5GT0 B;  2FFF B;  2HIO C;  5AV8 D;  2Y2J A;  5AVC D;  5B0Z C;  3AFA A;  5AV5 D;  2Y2M A;  5B31 D;  1U35 A;  3VH5 T;  3MGS D;  5CPJ B;  3R45 A;  1P3I B;  3UT9 D;  1P3G C;  2DQN C;  4Z5T B;  3X1S A;  3X1U A;  5B32 C;  1KX4 B;  1U35 D;  5F99 C;  1M19 D;  2NQB A;  1ULY A;  4WU8 A;  3REK D;  3WA9 A;  2HIO A;  5B0Z A;  3AV2 B;  3X1S D;  3AZF D;  3X1U D;  4YS3 C;  3H0M C;  3MNN C;  2PYO C;  3AN2 D;  5AV9 B;  3C1C C;  1KX5 B;  4HGA B;  1P3K C;  2NQB D;  4ZUX C;  3WA9 D;  5B40 B;  1P3G A;  1JFI A;  5CPK D;  4LD9 C;  2F8N G;  5B33 D;  3B0B A;  5B32 A;  5F99 A;  1P34 C;  4R8P B;  1KX3 C;  2FJ7 B;  2JCH A;  4YS3 A;  5B32 D;  3MNN A;  4J8V C;  2PYO A;  5F99 D;  5B24 C;  3C1C A;  1P3K A;  4KHA B;  3AZH C;  4ZUX A;  5GT0 C;  3REL B;  4LD9 A;  4UPK A;  4YS3 D;  3TU4 D;  5CPJ C;  4G92 B;  5CPI B;  4Z66 D;  4WU9 D;  1P34 A;  1P3I C;  2G5H C;  3W98 B;  1KX3 A;  3MGR A;  1KX4 C;  4J8X D;  4J8V A;  3KWQ C;  5B24 A;  3WTP B;  3REI C;  5GT0 A;  5B31 G;  3AV2 C;  1KX3 D;  3MGR D;  5GT3 B;  4J8V D;  1HTA A;  5AV9 C;  5CPJ A;  1P3L B;  4HGA C;  5B24 D;  3EPK A;  1P3I A;  5B40 C;  1F66 B;  5BS7 C;  3AZJ D;  1KX4 A;  4J8W C;  3KWQ A;  4R8P C;  3REI A;  2FJ7 C;  5AVB B;  1N1J A;  4H9O B;  1M1A B;  5AV9 A;  1P3P C;  3KWQ D;  3REI D;  3VH5 W;  3REL C;  5B40 A;  2CWE A;  5BS7 A;  3B0C T;  3H0L C;  3LEL A;  1EQZ B;  4J8W A;  4G92 C;  5CPI C;  1PZR A;  3UTB B;  4R8P A;  5B32 G;  5AVC B;  3LEL D;  2FJ7 A;  3W99 B;  3KXB A;  4CAY B;  3AZI C;  5B31 B;  3UTA B;  3MGS B;  3LZ1 A;  3A1I A;  3WTP C;  1P3P A;  3UT9 B;  3REL A;  3WAA A;  3KXB D;  3EG5 B;  2DF4 C;  1U35 B;  1M19 B;  3LZ1 D;  3R45 B;  1P3L C;  3REK B;  5B1M D;  1F66 C;  5AV6 A;  3WAA D;  3X1S B;  3X1U B;  3AV1 D;  3AZI A;  3AN2 B;  4XZQ D;  2NQB B;  3WTP A;  3EPL A;  3WA9 B;  1TAF B;  5AV6 D;  5B0Z B;  5CPK B;  5AVB C;  4NFT A;  5B33 B;  4KUD C;  4H9S C;  3AZG D;  1P3L A;  1F66 A;  1KX5 C;  5CP6 A;  2RVQ C;  5B32 B;  3AZL A;  5F99 B;  3UTB C;  4H9Q A;  3AZM D;  5AVC C;  3VH5 A;  5AV8 C;  5AVB A;  5CP6 D;  4KUD A;  5AV5 C;  4YS3 B;  4DRA A;  3TU4 B;  3MGS C;  3AZL D;  4WU9 B;  4E45 A;  3UT9 C;  4ZUX B;  1B6W A;  4NE3 A;  3KSY A;  1KX5 A;  4KUD D;  2ZY3 A;  4H9R A;  1M19 C;  5FUG B;  5B1L D;  3UTB A;  1P34 B;  2XD5 A;  3REK C;  5AVC A;  1KX3 B;  5AV8 A;  3MGR B;  1KX5 D;  3X1S C;  3AZF C;  5AV5 A;  2JE5 A;  3AN2 C;  1HQ3 C;  4J8V B;  3MGS A;  3X1V D;  2NQB C;  5B24 B;  4NE6 A;  5CPK C;  3MGP D;  5B33 C;  3AZN D;  3AZJ B;  4QLC D;  1M19 A;  3B0C W;  3X1T D;  3REK A;  1WWI A;  3W97 C;  3AZF A;  3AN2 A;  1HQ3 A;  1BFM A;  3B0D B;  3AZK C;  3KWQ B;  4JJN C;  3REI B;  4YM6 A;  1TAF A;  3WA9 C;  5CPK A;  3W96 D;  1N1J B;  5B33 A;  4Z2M G;  3TU4 C;  2J8P A;  1HQ3 D;  4Z66 C;  4WU9 C;  4WJ3 C;  1B67 A;  4YM6 D;  3W97 A;  3LEL B;  3WTP E;  3REJ D;  2RIQ A;  4J8X C;  4J8W B;  3AZK A;  5B2J D;  2F2A C;  4JJN A;  3MGQ D;  3MGR C;  3W97 D;  3KXB B;  4M6B A;  3TU4 A;  3LZ1 B;  4Z66 A;  5C3I B;  3AZK D;  4WU9 A;  1P3P B;  4JJN D;  5B1M B;  2L5A A;  3WAA B;  3KUY D;  3AZJ C;  3AV1 B;  4J8X A;  5FUG A;  4XZQ B;  2Y2Q A;  5BT1 C;  5AV6 B;  3MVD A;  3AZI B;  3B0D C;  1H3O B;  3AZJ A;  3LZ0 D;  3MVD D;  1P3O C;  3LEL C;  1M18 D;  5CP6 B;  5G49 A;  3AZL B;  4H9Q B;  5BT1 D;  3KXB C;  4KUD B;  3B6G D;  4EO5 C;  5GXQ A;  5B1L B;  3LZ1 C;  2ZM5 A;  5C3I C;  5JA4 B;  1P3O A;  5B1M C;  2Y2H A;  5E5A C;  3WAA C; 
#chains in the Genus database with same CATH homology
 3O62 D;  3AV1 C;  2W8S A;  3F6T A;  4H9R B;  5GXQ D;  3X1V B;  1TZY D;  4XZQ C;  4AWL B;  2NZD D;  1P3O D;  5B0Y C;  5AV6 C;  5AV8 B;  5DNN C;  3VH6 T;  3MGP B;  3AZN B;  2Y2O A;  5AV5 B;  1BH9 A;  4UUZ A;  3AZG C;  3X1T B;  4X23 D;  5B1M A;  4G91 B;  5E5A A;  4Z5T D;  3AV1 A;  3C1B D;  4XZQ A;  3AZM C;  1A7W A;  5B0Y A;  2BYK A;  5GSU A;  5E5A D;  5DNN A;  5CP6 C;  1W2E A;  2UWX A;  2BYM A;  4WZS B;  3AZF B;  3W96 B;  1HQ3 B;  3AZL C;  3AZG A;  3IP4 C;  4KGC C;  1AOI D;  5B0Y D;  4YM6 B;  5GSU D;  4XUJ D;  1H3O A;  5DNN D;  1BH8 B;  5DNM D;  3REJ B;  5JRG D;  1ZLA D;  5BO0 A;  5B1L C;  4Z2M H;  3AZE D;  2YFV A;  1ID3 D;  3AZM A;  3MGQ B;  3W97 B;  3AYW A;  3X1V C;  4AWL C;  2Y2L A;  3AZK B;  4KGC A;  4JJN B;  4E44 A;  5KDM B;  3MGP C;  3P5J B;  3KUY B;  3AZN C;  5B2I D;  4QLC C;  3LJA D;  3AYW D;  5B1L A;  3A6N D;  2XD1 A;  4WNN B;  1R4V A;  4Z66 B;  4ZBJ B;  5JA4 A;  3X1T C;  4KGC D;  2JSS A;  3AL0 C;  3EPH A;  4G91 C;  3V9R A;  4J8X B;  3X1V A;  1S32 D;  1P3M D;  3EPJ A;  4CSR A;  3B6F D;  3MGP A;  3W96 C;  3AZN A;  5GT3 D;  4QLC A;  3LZ0 B;  3MVD B;  4H9N B;  3X1T A;  2F8N D;  1Z2C B;  4YM6 C;  2VQR A;  1P3A D;  3REJ C;  4J8U C;  5AY8 C;  5B2J C;  2CV5 D;  3MGQ C;  2ARO D;  3A1K A;  3W96 A;  5G49 B;  3VH6 W;  1M1A D;  2ZY5 A;  4X23 B;  1BH8 A;  4NE5 A;  3O62 B;  2YFW B;  3KUY C;  3REJ A;  3REH A;  1EQZ D;  4J8U A;  5AY8 A;  3WKJ A;  5GXQ B;  1TZY B;  4ZBJ C;  5B2J A;  2HUE C;  1P3O B;  4H9P B;  3MGQ A;  3W99 D;  3WKJ D;  3REH D;  4J8U D;  5AY8 D;  1P3B D;  3UTA D;  1P3F D;  3KFU G;  5KDM A;  3AFA D;  3KUY A;  5BNX B;  3LZ0 C;  3MVD C;  3C1B B;  4EO5 B;  1BH9 B;  4UUZ B;  4WNN A;  3NQU A;  5E5A B;  1M18 C;  1AOI B;  5B0Y B;  4WU8 D;  5GSU B;  2BYK B;  2Y2P A;  5DNN B;  2HIO D;  4XUJ B;  5B0Z D;  5DNM B;  2BYM B;  5BNV B;  5JRG B;  1ZLA B;  3LZ0 A;  3B6G C;  2IO5 B;  4H9N A;  3AZE B;  3AZG B;  1ID3 B;  2F8N K;  4X23 C;  3O62 C;  1P3G D;  1M18 A;  5BO0 B;  5GXQ C;  1TZY C;  2NZD C;  3VH6 A;  2YFV B;  3AZM B;  5B2I B;  3LJA B;  3AYW B;  3B6G A;  4DRB A;  3MNN D;  3A6N B;  2PYO D;  4KGC B;  3C1C D;  1P3K D;  4ZUX D;  4X23 A;  3O62 A;  2YFW A;  4Z5T C;  4LD9 D;  3C1B C;  1TZY A;  2NZD A;  1S32 B;  1P3M B;  4DQY B;  1P34 D;  4H9P A;  3B6F B;  3AZH A;  3V9R B;  2LY8 A;  3NQJ B;  2F8N B;  1AOI C;  3H0R C;  5GSU C;  4CSR B;  5DNM C;  4XUJ C;  5GT0 D;  3AZH D;  1P3A B;  4Z5T A;  2Y2I A;  5JRG C;  1ZLA C;  5BNX A;  1WWS A;  2IO5 C;  4QLC B;  3C1B A;  3AZE C;  5CPJ D;  2CV5 B;  1ID3 C;  1P3I D;  2ARO B;  3AV2 A;  1KX4 D;  1AOI A;  2ZY2 A;  4XUJ A;  5DNM A;  3AV2 D;  2Y2N A;  5BNV A;  5B2I C;  5JRG A;  3FDD A;  3LJA C;  3AYW C;  1ZLA A;  3A6N C;  5AV9 D;  3AZE A;  1ID3 A;  3W98 C;  5B40 D;  3WKJ B;  3REH B;  4J8U B;  5AY8 B;  4J8W D;  1S32 C;  1P3B B;  1P3M C;  5B2J B;  1P3F B;  4KHA A;  3B6F C;  4R8P D;  3AFA B;  2FJ7 D;  5B2I A;  5GT3 C;  3LJA A;  2BG1 A;  3A6N A;  5CPI A;  1P3P D;  3W98 A;  1T3U A;  4WV4 B;  3REL D;  1P3A C;  1S32 A;  1P3M A;  2CV5 C;  5CPI D;  2HUE B;  1Q9C A;  4WU8 B;  3B6F A;  3NQU B;  2ARO C;  3W98 D;  2HIO B;  5GT3 A;  3AZI D;  1M1A C;  2Y2G A;  3NQJ A;  2F8N A;  3WTP D;  1P3A A;  1P3G B;  2ZY4 A;  1JFI B;  1EQZ C;  2F8N H;  5CHL B;  2CV5 A;  1P3L D;  1F1E A;  2ARO A;  1F66 D;  3W99 C;  1M18 B;  3WKJ C;  3REH C;  4H9S A;  4H9O A;  5B31 C;  3MNN B;  3UTA C;  1P3B C;  1M1A A;  1P3F C;  2PYO B;  3C1C B;  1P3K B;  3AFA C;  4LD9 B;  5AVB D;  1EQZ A;  3B6G B;  1U35 C;  1KU5 A;  3W99 A;  2Y2K A;  4CAY A;  3X1U C;  2RVQ D;  5B31 A;  1P3B A;  3UTA A;  2NZD B;  1P3F A;  3UTB D;  4WU8 C;  2G5I C;  3UT9 A;  3AZH B;  5GT0 B;  2FFF B;  2HIO C;  5AV8 D;  2Y2J A;  5AVC D;  5B0Z C;  3AFA A;  5AV5 D;  2Y2M A;  5B31 D;  1U35 A;  3VH5 T;  3MGS D;  5CPJ B;  3R45 A;  1P3I B;  3UT9 D;  1P3G C;  2DQN C;  4Z5T B;  3X1S A;  3X1U A;  5B32 C;  1KX4 B;  1U35 D;  5F99 C;  1M19 D;  2NQB A;  1ULY A;  4WU8 A;  3REK D;  3WA9 A;  2HIO A;  5B0Z A;  3AV2 B;  3X1S D;  3AZF D;  3X1U D;  4YS3 C;  3H0M C;  3MNN C;  2PYO C;  3AN2 D;  5AV9 B;  3C1C C;  1KX5 B;  4HGA B;  1P3K C;  2NQB D;  4ZUX C;  3WA9 D;  5B40 B;  1P3G A;  1JFI A;  5CPK D;  4LD9 C;  2F8N G;  5B33 D;  3B0B A;  5B32 A;  5F99 A;  1P34 C;  4R8P B;  1KX3 C;  2FJ7 B;  2JCH A;  4YS3 A;  5B32 D;  3MNN A;  4J8V C;  2PYO A;  5F99 D;  5B24 C;  3C1C A;  1P3K A;  4KHA B;  3AZH C;  4ZUX A;  5GT0 C;  3REL B;  4LD9 A;  4UPK A;  4YS3 D;  3TU4 D;  5CPJ C;  4G92 B;  5CPI B;  4Z66 D;  4WU9 D;  1P34 A;  1P3I C;  2G5H C;  3W98 B;  1KX3 A;  3MGR A;  1KX4 C;  4J8X D;  4J8V A;  3KWQ C;  5B24 A;  3WTP B;  3REI C;  5GT0 A;  5B31 G;  3AV2 C;  1KX3 D;  3MGR D;  5GT3 B;  4J8V D;  1HTA A;  5AV9 C;  5CPJ A;  1P3L B;  4HGA C;  5B24 D;  3EPK A;  1P3I A;  5B40 C;  1F66 B;  5BS7 C;  3AZJ D;  1KX4 A;  4J8W C;  3KWQ A;  4R8P C;  3REI A;  2FJ7 C;  5AVB B;  1N1J A;  4H9O B;  1M1A B;  5AV9 A;  1P3P C;  3KWQ D;  3REI D;  3VH5 W;  3REL C;  5B40 A;  2CWE A;  5BS7 A;  3B0C T;  3H0L C;  3LEL A;  1EQZ B;  4J8W A;  4G92 C;  5CPI C;  1PZR A;  3UTB B;  4R8P A;  5B32 G;  5AVC B;  3LEL D;  2FJ7 A;  3W99 B;  3KXB A;  4CAY B;  3AZI C;  5B31 B;  3UTA B;  3MGS B;  3LZ1 A;  3A1I A;  3WTP C;  1P3P A;  3UT9 B;  3REL A;  3WAA A;  3KXB D;  3EG5 B;  2DF4 C;  1U35 B;  1M19 B;  3LZ1 D;  3R45 B;  1P3L C;  3REK B;  5B1M D;  1F66 C;  5AV6 A;  3WAA D;  3X1S B;  3X1U B;  3AV1 D;  3AZI A;  3AN2 B;  4XZQ D;  2NQB B;  3WTP A;  3EPL A;  3WA9 B;  1TAF B;  5AV6 D;  5B0Z B;  5CPK B;  5AVB C;  4NFT A;  5B33 B;  4KUD C;  4H9S C;  3AZG D;  1P3L A;  1F66 A;  1KX5 C;  5CP6 A;  2RVQ C;  5B32 B;  3AZL A;  5F99 B;  3UTB C;  4H9Q A;  3AZM D;  5AVC C;  3VH5 A;  5AV8 C;  5AVB A;  5CP6 D;  4KUD A;  5AV5 C;  4YS3 B;  4DRA A;  3TU4 B;  3MGS C;  3AZL D;  4WU9 B;  4E45 A;  3UT9 C;  4ZUX B;  1B6W A;  4NE3 A;  3KSY A;  1KX5 A;  4KUD D;  2ZY3 A;  4H9R A;  1M19 C;  5FUG B;  5B1L D;  3UTB A;  1P34 B;  2XD5 A;  3REK C;  5AVC A;  1KX3 B;  5AV8 A;  3MGR B;  1KX5 D;  3X1S C;  3AZF C;  5AV5 A;  2JE5 A;  3AN2 C;  1HQ3 C;  4J8V B;  3MGS A;  3X1V D;  2NQB C;  5B24 B;  4NE6 A;  5CPK C;  3MGP D;  5B33 C;  3AZN D;  3AZJ B;  4QLC D;  1M19 A;  3B0C W;  3X1T D;  3REK A;  1WWI A;  3W97 C;  3AZF A;  3AN2 A;  1HQ3 A;  1BFM A;  3B0D B;  3AZK C;  3KWQ B;  4JJN C;  3REI B;  4YM6 A;  1TAF A;  3WA9 C;  5CPK A;  3W96 D;  1N1J B;  5B33 A;  4Z2M G;  3TU4 C;  2J8P A;  1HQ3 D;  4Z66 C;  4WU9 C;  4WJ3 C;  1B67 A;  4YM6 D;  3W97 A;  3LEL B;  3WTP E;  3REJ D;  2RIQ A;  4J8X C;  4J8W B;  3AZK A;  5B2J D;  2F2A C;  4JJN A;  3MGQ D;  3MGR C;  3W97 D;  3KXB B;  4M6B A;  3TU4 A;  3LZ1 B;  4Z66 A;  5C3I B;  3AZK D;  4WU9 A;  1P3P B;  4JJN D;  5B1M B;  2L5A A;  3WAA B;  3KUY D;  3AZJ C;  3AV1 B;  4J8X A;  5FUG A;  4XZQ B;  2Y2Q A;  5BT1 C;  5AV6 B;  3MVD A;  3AZI B;  3B0D C;  1H3O B;  3AZJ A;  3LZ0 D;  3MVD D;  1P3O C;  3LEL C;  1M18 D;  5CP6 B;  5G49 A;  3AZL B;  4H9Q B;  5BT1 D;  3KXB C;  4KUD B;  3B6G D;  4EO5 C;  5GXQ A;  5B1L B;  3LZ1 C;  2ZM5 A;  5C3I C;  5JA4 B;  1P3O A;  5B1M C;  2Y2H A;  5E5A C;  3WAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...