4J8WC

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wC00
4X23C 3KWQD 1H3OA 3KXBA 3X1SB 5BNXA 1ID3D 1F66C 1HQ3D 4H9PA 3WKJB 3AZND 3X1TB 5B40C 1P3FD 1P3LB 3KWQC 3B0CW 5JRGA 4WV4B 3AZIC 5B1MA 3REKC 3O62A 3LZ1A 3AZEB 1BH9A 4WU9C 5B32B 4KUDB 3WTPB 4XUJB 2CV5C 4YM6C 1S32C 1M1AA 2HIOD 4AWLB 3REIA 1ID3A 1HQ3A 3C1BA 1JFIA 5AY8B 1P3MB 3AZNA 3B0BA 3AV2B 4KHAA 3MGRB 5AV8A 2F8ND 1EQZD 4NFTA 5B24D 5AV6A 5AV9D 1H3OB 3KXBB 5BNXB 4R8PD 5CP6C 5BNVA 1P3KB 1EQZC 3MGQC 4J8VD 4Z66B 5B24C 2PYOD 5JRGB 1P34A 1ZLAD 5GSUB 4J8UD 4G92C 4KGCC 5BS7A 3O62B 3LZ1B 1BH9B 4R8PC 3MGPC 5B1LD 3MGSD 5AV9A 4H9RB 1P3OD 5BO0B 4J8VC 3AZJC 1TAFA 1M1AB 3REIB 1JFIB 1TZYB 3C1BB 5B1LC 3MGSC 3W96D 1P3PC 3AN2A 4KHAB 3AZLB 5CPKA 5AVCB 3MNNB 1P3OC 3B6GB 5AV8B 3AFAD 1P3BD 3AZFC 3RELD 3WAAA 5AV6B 3WA9B 3W99B 5CPJD 5B31G 3W96C 1M18C 5GT3B 2NZDA 5BNVB 3A6NC 4HGAC 3B0DC 3X1SD 5DNNA 4ZUXA 5GT0B 4ZBJB 5B2IC 1KX4B 4H9OA 1P34B 3WKJD 3X1TD 3AV1A 5B33C 1P3LD 3AFAA 1BFMA 4WU8A 3RELA 3X1SC 3AZED 5B32D 5CPJA 1P3IA 1TAFB 3KUYC 3TU4C 4KUDD 3WTPD 3AZMC 3LELA 3WKJC 4XUJD 3R45A 3AN2B 5E5AB 5AY8D 5CPKB 1P3MD 3AZEC 3AZKB 5F99B 3LZ0B 3W97C 3AV2D 3AZHC 1P3LA 3WAAB 1F1EA 3MGRD 4XUJC 3UTBC 2NZDB 5B31A 4KUDA 1M19C 3B6FA 3KXBD 5DNNB 4ZUXB 3REHA 1P3KD 4H9OB 2YFVA 4UUZA 5AY8A 1P3MA 3AV1B 4Z2MH 4Z66D 4QLCB 5JRGD 4WU8B 3AV2A 5GSUD 3KXBC 3MGRA 3O62D 3LZ1D 1P3IB 4J8WA 3LELB 2FJ7B 3R45B 1M1AD 2BYKA 5JRGC 3REID 2NQBB 1B67A 1TZYD 5B1MC 5AV5C 3C1BD 3O62C 1P3KA 1P3AB 4LD9B 4DRBA 4Z66A 3AZLD 3MNND 3UT9A 5B2JA 3B6GD 5GSUA 5AV8D 3REIC 5AV6D 1BH8A 3UTAB 1HQ3C 3C1BC 5B31B 1ID3C 3B6FB 3WA9D 3AZNC 4H9RA 5BO0A 5GT3D 1P3FC 3REHB 4M6BA 2YFVB 5AV8C 4UUZB 1TZYA 4DRAA 1KX4D 5AV6C 1P34D 4X23A 3AZLA 4E45A 2HUEC 5AVCA 3MNNA 3B6GA 1U35B 5B0YA 2HIOC 4J8WB 1F66A 3WA9A 3B0CT 3W99A 4E44A 2BYKB 5B0ZB 5GT3A 4H9SA 2IO5B 1AOIA 5BS7C 1KX5A 5GT0A 4WU9A 3AN2D 1KX4A 5CPKD 5AV9C 3UT9B 5B2JB 3AZKD 5KDMA 2F8NH 5F99D 3LZ0D 2CV5A 2AROA 1S32A 3WAAD 1BH8B 3W98A 2F8NK 2NZDD 3AN2C 1KX3A 1WWSA 2PYOC 5GXQA 1ZLAC 4J8UC 5DNND 4EO5B 4ZUXD 4XZQA 4J8XA 5JA4A 3WAAC 4JJNA 4X23B 5E5AA 5C3IB 3AZKA 3AV1D 5F99A 3LZ0A 2NZDC 1B6WA 1WWIA 5CP6A 3NQJA 4NE6A 5B0YB 4WU8D 1F66B 2L5AA 5DNNC 5B40B 1P3ID 4Z5TA 4G91C 3LELD 1P3GA 1AOIB 3AZIB 2FJ7D 3REKB 4KGCA 3AFAC 1KX5B 4WU9B 1P3BC 2NQBD 3C1CA 3RELC 5KDMB 1P3AD 2CV5B 2AROB 5CPJC 4YM6B 1S32B 4LD9D 3AZJA 3KSYA 4QLCA 3LELC 3W98B 1R4VA 3WTPE 1KX3B 5B31D 5GXQB 3B6FD 3X1TC 2FJ7A 4XZQB 4J8XB 3REHD 5JA4B 4JJNB 3AZFA 1P3LC 1N1JA 2NQBA 3X1UA 3AZGA 3LJAA 4YS3A 1P3AA 5B32C 4LD9A 3NQJB 5CP6B 5B31C 3A6NA 3B6FC 3WTPC 4KUDC 4Z2MG 1U35D 1EQZB 3VH6T 4Z5TB 3VH5W 3MGQB 3REHC 4J8WD 5B2IA 5FUGA 4AWLC 1P3GB 3UTAA 5AY8C 1P3MC 4G92B 4KGCB 3MGPB 5B0ZD 3AV2C 3C1CB 3MGRC 4NE3A 4J8WC 3AZJB 3KUYA 3TU4A 5BT1D 3UT9D 5B2JD 3AZMA 5CPIA 3VH6A 1U35A 1P3PB 1P3KC 3MVDA 3AYWA 3W97A 5AVBA 4Z66C 3AZFB 3AZHA 5BT1C 5B0ZA 3UT9C 1N1JB 5GSUC 3X1UB 3AZGB 3LJAB 3LZ1C 4YS3B 1M18B 4X23D 5CHLB 3A6NB 4HGAB 3REJA 5AVCD 3B0DB 1M1AC 5B0YD 5B2IB 5FUGB 1F66D 1TZYC 3W99D 5B33B 1Q9CA 3X1VA 3AZLC 5DNMA 5C3IC 5AVCC 3MNNC 3AZID 3REKD 1AOID 3B6GC 1KU5A 1KX5D 5GT0D 4WU9D 5B0YC 3KUYB 3TU4B 3WA9C 3AZMB 5CPIB 3W99C 2CV5D 2AROD 4YM6D 1S32D 5GT3C 4H9SC 3V9RA 3W98D 2F8NG 1AOIC 5AV5A 3MVDB 1HTAA 1KX5C 5GT0C 3AYWB 3W97B 4ZBJC 5B40A 5AVBB 1KX3D 3AZHB 1KX4C 5G49A 5GXQD 4CSRB 1P34C 3KWQA 2YFWA 2AROC 3AZIA 2BYMA 3REKA 3UTBB 4XZQD 4J8XD 4JJND 3W98C 2CWEA 5E5AD 3REJB 1M19B 2JSSA 5CP6D 4YM6A 1KX3C 1P3FA 5GXQC 4XZQC 4Z5TD 3MGQD 4J8XC 4JJNC 1ULYA 1P3GD 3X1VB 5E5AC 5DNMB 5CPKC 3AZKC 4H9QA 4KGCD 5F99C 3LZ0C 3MGPD 3C1CD 2HIOA 4H9PB 4Z5TC 4H9NA 3AZJD 4QLCD 1P3GC 3V9RB 5AV5B 5B1MB 4ZUXC 2F8NA 1EQZA 3MGQA 3C1CC 1P3PD 5G49B 5B24A 4WZSB 3KWQB 2YFWB 3NQUA 2BYMB 3AV1C 3AZFD 3MGPA 4QLCC 4R8PA 4WU8C 1ID3B 1HQ3B 1A7WA 3X1UD 3AZGD 3LJAD 4YS3D 3AZNB 1M18D 1P3IC 4J8VA 3A6ND 1P3FB 2PYOA 2RVQD 1ZLAA 4J8UA 2FJ7C 5B2ID 5B1LA 3MGSA 2NQBC 3UTAD 1P3PA 3X1UC 3AZGC 3LJAC 5B32G 4H9QB 2HUEB 4YS3C 1P3OA 5B33D 1P3AC 4LD9C 2HIOB 4NE5A 2RVQC 4CAYA 4H9NB 3W96A 3KUYD 3TU4D 1M18A 3AZMD 3UTAC 5CPID 3VH6W 2F8NB 1P3BA 5B24B 4WNNA 5AV9B 3MVDD 3NQUB 3AYWD 3W97D 5AVBD 3AZHD 5B33A 4R8PB 5CPIC 3UTBD 3X1SA 1U35C 4J8VB 3REJD 2PYOB 1M19D 3MVDC 3WKJA 1ZLAB 4J8UB 3AYWC 3X1TA 5AVBC 5B1LB 5B0ZC 3MGSB 2IO5C 3AZEA 1P3OB 5B32A 3X1VD 3VH5T 3REJC 5DNMD 4CSRA 3WTPA 5B2JC 4CAYB 4XUJA 3UTBA 3W96B 2LY8A 4G91B 1M19A 3AFAB 3X1VC 1P3BB 5DNMC 4WNNB 3RELB 5AV5D 5B1MD 4EO5C 5B40D 5CPJB 3VH5A
chains in the Genus database with same CATH superfamily
4X23C 3KWQD 1H3OA 3KXBA 3X1SB 5BNXA 1ID3D 1F66C 1HQ3D 4H9PA 3WKJB 3P5JB 3AZND 3X1TB 5B40C 1P3FD 1P3LB 4WJ3C 3KWQC 3B0CW 5JRGA 4WV4B 3AZIC 5B1MA 3REKC 3O62A 3LZ1A 3AZEB 1BH9A 4WU9C 5B32B 4KUDB 3WTPB 4XUJB 2CV5C 2Y2GA 4YM6C 1S32C 1M1AA 2HIOD 4AWLB 3REIA 1ID3A 1HQ3A 3C1BA 1JFIA 5AY8B 1W2EA 1P3MB 3AZNA 3B0BA 3AV2B 2Y2IA 4KHAA 3MGRB 5AV8A 2F8ND 1EQZD 4NFTA 5B24D 5AV6A 5AV9D 1H3OB 3KXBB 5BNXB 4R8PD 5CP6C 5BNVA 2Y2NA 1P3KB 1EQZC 3MGQC 2ZY3A 4J8VD 4Z66B 5B24C 2PYOD 5JRGB 1P34A 1ZLAD 5GSUB 4J8UD 4G92C 4KGCC 5BS7A 3O62B 3LZ1B 1BH9B 4R8PC 3MGPC 5B1LD 3MGSD 5AV9A 4H9RB 1P3OD 5BO0B 4J8VC 3AZJC 1TAFA 1M1AB 3REIB 2Y2QA 1JFIB 1TZYB 3C1BB 5B1LC 3MGSC 3W96D 1P3PC 3AN2A 4KHAB 3AZLB 5CPKA 2Y2PA 5AVCB 3MNNB 1P3OC 3B6GB 5AV8B 3AFAD 1P3BD 3AZFC 3RELD 3WAAA 5AV6B 3WA9B 3W99B 5CPJD 5B31G 3W96C 1M18C 5GT3B 2NZDA 2Y2OA 5BNVB 3A6NC 4HGAC 2G5IC 3B0DC 3X1SD 5DNNA 4ZUXA 5GT0B 1PZRA 4ZBJB 5B2IC 1KX4B 4H9OA 1P34B 3WKJD 3EPHA 3X1TD 3AV1A 5B33C 1P3LD 3AFAA 1BFMA 4WU8A 3RELA 3X1SC 3AZED 5B32D 5CPJA 1P3IA 1TAFB 3KUYC 3TU4C 4KUDD 3WTPD 3AZMC 3LELA 3WKJC 4XUJD 3R45A 3A1KA 3F6TA 3AN2B 5E5AB 5AY8D 5CPKB 1P3MD 3AZEC 3AZKB 5F99B 3LZ0B 3W97C 3EPJA 3AV2D 3AZHC 1P3LA 3WAAB 1F1EA 3MGRD 2FFFB 4XUJC 3UTBC 2DQNC 2NZDB 5B31A 4KUDA 1M19C 3B6FA 3KXBD 5DNNB 4ZUXB 3REHA 1P3KD 4H9OB 2YFVA 4UUZA 5AY8A 1P3MA 3AV1B 4Z2MH 3H0LC 4Z66D 4QLCB 5JRGD 4WU8B 3AV2A 5GSUD 3KXBC 3MGRA 3O62D 3LZ1D 1P3IB 4J8WA 3LELB 2FJ7B 3R45B 1M1AD 3KFUG 2BYKA 5JRGC 3REID 2NQBB 1B67A 1TZYD 5B1MC 5AV5C 3C1BD 3O62C 1P3KA 1P3AB 4LD9B 4DRBA 4Z66A 3AZLD 3MNND 3UT9A 5B2JA 3B6GD 5GSUA 5AV8D 3A1IA 3REIC 5AV6D 1BH8A 3UTAB 1HQ3C 3C1BC 5B31B 1ID3C 3B6FB 3WA9D 3AZNC 4H9RA 2Y2KA 5BO0A 5GT3D 1P3FC 3REHB 4M6BA 2YFVB 5AV8C 4UUZB 1TZYA 4DRAA 1KX4D 5AV6C 1P34D 4X23A 3AZLA 4E45A 2HUEC 5AVCA 3MNNA 3B6GA 1U35B 5B0YA 2HIOC 4J8WB 1F66A 3WA9A 3B0CT 3W99A 4E44A 2BYKB 4UPKA 5GT3A 3EG5B 5B0ZB 4H9SA 2IO5B 1AOIA 5BS7C 1KX5A 2F2AC 5GT0A 4WU9A 3AN2D 1KX4A 5CPKD 5AV9C 3UT9B 5B2JB 3AZKD 5KDMA 2F8NH 5F99D 3LZ0D 2CV5A 2AROA 1S32A 3WAAD 1BH8B 3W98A 2F8NK 2NZDD 3AN2C 1KX3A 1WWSA 2PYOC 5GXQA 1ZLAC 4J8UC 5DNND 4EO5B 4ZUXD 4XZQA 4J8XA 5JA4A 3WAAC 4JJNA 4X23B 5E5AA 5C3IB 3AZKA 3AV1D 5F99A 3LZ0A 2NZDC 1B6WA 1WWIA 5CP6A 2G5HC 3NQJA 4NE6A 5B0YB 4WU8D 1F66B 2Y2HA 2L5AA 5DNNC 1T3UA 5B40B 1P3ID 4Z5TA 4G91C 3LELD 1P3GA 1AOIB 3AZIB 2FJ7D 3REKB 4KGCA 3AFAC 1KX5B 4WU9B 1P3BC 2NQBD 3C1CA 3RELC 5KDMB 1P3AD 2CV5B 2AROB 5CPJC 4YM6B 1S32B 4LD9D 3AZJA 3KSYA 4QLCA 3LELC 3EPLA 3W98B 1R4VA 3WTPE 1KX3B 5B31D 5GXQB 3B6FD 3X1TC 2FJ7A 4XZQB 4J8XB 3REHD 5JA4B 4JJNB 3AZFA 1P3LC 1N1JA 2NQBA 2ZY5A 3X1UA 3AZGA 3LJAA 4YS3A 1P3AA 5B32C 4LD9A 3NQJB 5CP6B 5B31C 3A6NA 3B6FC 3WTPC 4KUDC 4Z2MG 1U35D 1EQZB 3VH6T 4Z5TB 3VH5W 3MGQB 3REHC 4J8WD 5B2IA 5FUGA 4AWLC 1P3GB 3UTAA 5AY8C 1P3MC 4G92B 4KGCB 3MGPB 5B0ZD 3AV2C 3C1CB 3MGRC 4NE3A 4J8WC 3AZJB 3KUYA 3TU4A 5BT1D 3UT9D 5B2JD 3AZMA 5CPIA 3VH6A 1U35A 1P3PB 1P3KC 3MVDA 3AYWA 3W97A 5AVBA 4Z66C 3AZFB 3AZHA 3H0RC 5BT1C 5B0ZA 1N1JB 3UT9C 2DF4C 5GSUC 3X1UB 3AZGB 3LJAB 3LZ1C 4YS3B 1M18B 4X23D 5CHLB 3A6NB 4HGAB 3REJA 5AVCD 3B0DB 1M1AC 5B0YD 5B2IB 5FUGB 1F66D 2JE5A 1TZYC 3W99D 1Z2CB 5B33B 2JCHA 1Q9CA 3X1VA 3AZLC 5DNMA 5C3IC 5AVCC 3MNNC 3AZID 3REKD 1AOID 3B6GC 3FDDA 1KU5A 1KX5D 5GT0D 4WU9D 5B0YC 3KUYB 4DQYB 3TU4B 3WA9C 3AZMB 5CPIB 3W99C 3EPKA 2CV5D 2AROD 4YM6D 1S32D 5GT3C 4H9SC 3V9RA 3W98D 2F8NG 1AOIC 5AV5A 3IP4C 3MVDB 1HTAA 1KX5C 5GT0C 2XD1A 3AYWB 4ZBJC 5B40A 3W97B 5AVBB 1KX3D 3AZHB 1KX4C 5G49A 5GXQD 4CSRB 1P34C 3KWQA 2YFWA 2AROC 3AZIA 2BYMA 3REKA 3UTBB 4XZQD 4J8XD 4JJND 3W98C 2CWEA 5E5AD 3REJB 1M19B 2JSSA 5CP6D 4YM6A 1KX3C 1P3FA 5GXQC 4XZQC 4Z5TD 3MGQD 4J8XC 4JJNC 1ULYA 1P3GD 3X1VB 5E5AC 5DNMB 5CPKC 3AZKC 4H9QA 4KGCD 5F99C 3LZ0C 3MGPD 2J8PA 3C1CD 2HIOA 2ZY4A 4H9PB 4Z5TC 4H9NA 3AZJD 4QLCD 1P3GC 3V9RB 5AV5B 5B1MB 2Y2JA 4ZUXC 2F8NA 1EQZA 3MGQA 3C1CC 1P3PD 5G49B 5B24A 4WZSB 3KWQB 2YFWB 2ZM5A 3NQUA 2BYMB 3AV1C 2VQRA 3AZFD 3MGPA 4QLCC 4R8PA 4WU8C 1ID3B 1HQ3B 1A7WA 3X1UD 3AZGD 3LJAD 4YS3D 3AZNB 1M18D 1P3IC 4J8VA 3A6ND 1P3FB 2PYOA 2RVQD 1ZLAA 4J8UA 2FJ7C 5B2ID 5B1LA 2Y2LA 3MGSA 2NQBC 3UTAD 1P3PA 3X1UC 3H0MC 3LJAC 5B32G 3AZGC 4H9QB 2HUEB 4YS3C 1P3OA 5B33D 1P3AC 4LD9C 2HIOB 4NE5A 2RVQC 4CAYA 4H9NB 3W96A 3KUYD 3TU4D 1M18A 3AZMD 3UTAC 5CPID 3VH6W 2F8NB 2ZY2A 1P3BA 5B24B 4WNNA 5AV9B 3MVDD 3NQUB 3AYWD 2RIQA 3W97D 3AL0C 5AVBD 3AZHD 5B33A 4R8PB 2W8SA 5CPIC 3UTBD 3X1SA 1U35C 2XD5A 4J8VB 3REJD 2PYOB 1M19D 3MVDC 3WKJA 1ZLAB 4J8UB 3AYWC 3X1TA 5AVBC 5B1LB 5B0ZC 3MGSB 2IO5C 3AZEA 1P3OB 5B32A 3X1VD 3VH5T 3REJC 5DNMD 4CSRA 3WTPA 5B2JC 4CAYB 4XUJA 3UTBA 3W96B 2BG1A 2LY8A 4G91B 1M19A 2UWXA 3AFAB 3X1VC 1P3BB 5DNMC 4WNNB 2Y2MA 5AV5D 5B1MD 3RELB 4EO5C 5B40D 5CPJB 3VH5A
chains in the Genus database with same CATH topology
4X23C 3KWQD 1H3OA 3KXBA 3X1SB 5BNXA 1ID3D 1F66C 1HQ3D 4H9PA 3WKJB 3P5JB 3AZND 3X1TB 5B40C 1P3FD 1P3LB 4WJ3C 3KWQC 3B0CW 5JRGA 4WV4B 3AZIC 5B1MA 3REKC 3O62A 3LZ1A 3AZEB 1BH9A 4WU9C 5B32B 4KUDB 3WTPB 4XUJB 2CV5C 2Y2GA 4YM6C 1S32C 1M1AA 2HIOD 4AWLB 3REIA 1ID3A 1HQ3A 3C1BA 1JFIA 5AY8B 1W2EA 1P3MB 3AZNA 3B0BA 3AV2B 2Y2IA 4KHAA 3MGRB 5AV8A 2F8ND 1EQZD 4NFTA 5B24D 5AV6A 5AV9D 1H3OB 3KXBB 5BNXB 4R8PD 5CP6C 5BNVA 2Y2NA 1P3KB 1EQZC 3MGQC 2ZY3A 4J8VD 4Z66B 5B24C 2PYOD 5JRGB 1P34A 1ZLAD 5GSUB 4J8UD 4G92C 4KGCC 5BS7A 3O62B 3LZ1B 1BH9B 4R8PC 3MGPC 5B1LD 3MGSD 5AV9A 4H9RB 1P3OD 5BO0B 4J8VC 3AZJC 1TAFA 1M1AB 3REIB 2Y2QA 1JFIB 1TZYB 3C1BB 5B1LC 3MGSC 3W96D 1P3PC 3AN2A 4KHAB 3AZLB 5CPKA 2Y2PA 5AVCB 3MNNB 1P3OC 3B6GB 5AV8B 3AFAD 1P3BD 3AZFC 3RELD 3WAAA 5AV6B 3WA9B 3W99B 5CPJD 5B31G 3W96C 1M18C 5GT3B 2NZDA 2Y2OA 5BNVB 3A6NC 4HGAC 2G5IC 3B0DC 3X1SD 5DNNA 4ZUXA 5GT0B 1PZRA 4ZBJB 5B2IC 1KX4B 4H9OA 1P34B 3WKJD 3EPHA 3X1TD 3AV1A 5B33C 1P3LD 3AFAA 1BFMA 4WU8A 3RELA 3X1SC 3AZED 5B32D 5CPJA 1P3IA 1TAFB 3KUYC 3TU4C 4KUDD 3WTPD 3AZMC 3LELA 3WKJC 4XUJD 3R45A 3A1KA 3F6TA 3AN2B 5E5AB 5AY8D 5CPKB 1P3MD 3AZEC 3AZKB 5F99B 3LZ0B 3W97C 3EPJA 3AV2D 3AZHC 1P3LA 3WAAB 1F1EA 3MGRD 2FFFB 4XUJC 3UTBC 2DQNC 2NZDB 5B31A 4KUDA 1M19C 3B6FA 3KXBD 5DNNB 4ZUXB 3REHA 1P3KD 4H9OB 2YFVA 4UUZA 5AY8A 1P3MA 3AV1B 4Z2MH 3H0LC 4Z66D 4QLCB 5JRGD 4WU8B 3AV2A 5GSUD 3KXBC 3MGRA 3O62D 3LZ1D 1P3IB 4J8WA 3LELB 2FJ7B 3R45B 1M1AD 3KFUG 2BYKA 5JRGC 3REID 2NQBB 1B67A 1TZYD 5B1MC 5AV5C 3C1BD 3O62C 1P3KA 1P3AB 4LD9B 4DRBA 4Z66A 3AZLD 3MNND 3UT9A 5B2JA 3B6GD 5GSUA 5AV8D 3A1IA 3REIC 5AV6D 1BH8A 3UTAB 1HQ3C 3C1BC 5B31B 1ID3C 3B6FB 3WA9D 3AZNC 4H9RA 2Y2KA 5BO0A 5GT3D 1P3FC 3REHB 4M6BA 2YFVB 5AV8C 4UUZB 1TZYA 4DRAA 1KX4D 5AV6C 1P34D 4X23A 3AZLA 4E45A 2HUEC 5AVCA 3MNNA 3B6GA 1U35B 5B0YA 2HIOC 4J8WB 1F66A 3WA9A 3B0CT 3W99A 4E44A 2BYKB 4UPKA 5GT3A 3EG5B 5B0ZB 4H9SA 2IO5B 1AOIA 5BS7C 1KX5A 2F2AC 5GT0A 4WU9A 3AN2D 1KX4A 5CPKD 5AV9C 3UT9B 5B2JB 3AZKD 5KDMA 2F8NH 5F99D 3LZ0D 2CV5A 2AROA 1S32A 3WAAD 1BH8B 3W98A 2F8NK 2NZDD 3AN2C 1KX3A 1WWSA 2PYOC 5GXQA 1ZLAC 4J8UC 5DNND 4EO5B 4ZUXD 4XZQA 4J8XA 5JA4A 3WAAC 4JJNA 4X23B 5E5AA 5C3IB 3AZKA 3AV1D 5F99A 3LZ0A 2NZDC 1B6WA 1WWIA 5CP6A 2G5HC 3NQJA 4NE6A 5B0YB 4WU8D 1F66B 2Y2HA 2L5AA 5DNNC 1T3UA 5B40B 1P3ID 4Z5TA 4G91C 3LELD 1P3GA 1AOIB 3AZIB 2FJ7D 3REKB 4KGCA 3AFAC 1KX5B 4WU9B 1P3BC 2NQBD 3C1CA 3RELC 5KDMB 1P3AD 2CV5B 2AROB 5CPJC 4YM6B 1S32B 4LD9D 3AZJA 3KSYA 4QLCA 3LELC 3EPLA 3W98B 1R4VA 3WTPE 1KX3B 5B31D 5GXQB 3B6FD 3X1TC 2FJ7A 4XZQB 4J8XB 3REHD 5JA4B 4JJNB 3AZFA 1P3LC 1N1JA 2NQBA 2ZY5A 3X1UA 3AZGA 3LJAA 4YS3A 1P3AA 5B32C 4LD9A 3NQJB 5CP6B 5B31C 3A6NA 3B6FC 3WTPC 4KUDC 4Z2MG 1U35D 1EQZB 3VH6T 4Z5TB 3VH5W 3MGQB 3REHC 4J8WD 5B2IA 5FUGA 4AWLC 1P3GB 3UTAA 5AY8C 1P3MC 4G92B 4KGCB 3MGPB 5B0ZD 3AV2C 3C1CB 3MGRC 4NE3A 4J8WC 3AZJB 3KUYA 3TU4A 5BT1D 3UT9D 5B2JD 3AZMA 5CPIA 3VH6A 1U35A 1P3PB 1P3KC 3MVDA 3AYWA 3W97A 5AVBA 4Z66C 3AZFB 3AZHA 3H0RC 5BT1C 5B0ZA 1N1JB 3UT9C 2DF4C 5GSUC 3X1UB 3AZGB 3LJAB 3LZ1C 4YS3B 1M18B 4X23D 5CHLB 3A6NB 4HGAB 3REJA 5AVCD 3B0DB 1M1AC 5B0YD 5B2IB 5FUGB 1F66D 2JE5A 1TZYC 3W99D 1Z2CB 5B33B 2JCHA 1Q9CA 3X1VA 3AZLC 5DNMA 5C3IC 5AVCC 3MNNC 3AZID 3REKD 1AOID 3B6GC 3FDDA 1KU5A 1KX5D 5GT0D 4WU9D 5B0YC 3KUYB 4DQYB 3TU4B 3WA9C 3AZMB 5CPIB 3W99C 3EPKA 2CV5D 2AROD 4YM6D 1S32D 5GT3C 4H9SC 3V9RA 3W98D 2F8NG 1AOIC 5AV5A 3IP4C 3MVDB 1HTAA 1KX5C 5GT0C 2XD1A 3AYWB 4ZBJC 5B40A 3W97B 5AVBB 1KX3D 3AZHB 1KX4C 5G49A 5GXQD 4CSRB 1P34C 3KWQA 2YFWA 2AROC 3AZIA 2BYMA 3REKA 3UTBB 4XZQD 4J8XD 4JJND 3W98C 2CWEA 5E5AD 3REJB 1M19B 2JSSA 5CP6D 4YM6A 1KX3C 1P3FA 5GXQC 4XZQC 4Z5TD 3MGQD 4J8XC 4JJNC 1ULYA 1P3GD 3X1VB 5E5AC 5DNMB 5CPKC 3AZKC 4H9QA 4KGCD 5F99C 3LZ0C 3MGPD 2J8PA 3C1CD 2HIOA 2ZY4A 4H9PB 4Z5TC 4H9NA 3AZJD 4QLCD 1P3GC 3V9RB 5AV5B 5B1MB 2Y2JA 4ZUXC 2F8NA 1EQZA 3MGQA 3C1CC 1P3PD 5G49B 5B24A 4WZSB 3KWQB 2YFWB 2ZM5A 3NQUA 2BYMB 3AV1C 2VQRA 3AZFD 3MGPA 4QLCC 4R8PA 4WU8C 1ID3B 1HQ3B 1A7WA 3X1UD 3AZGD 3LJAD 4YS3D 3AZNB 1M18D 1P3IC 4J8VA 3A6ND 1P3FB 2PYOA 2RVQD 1ZLAA 4J8UA 2FJ7C 5B2ID 5B1LA 2Y2LA 3MGSA 2NQBC 3UTAD 1P3PA 3X1UC 3H0MC 3LJAC 5B32G 3AZGC 4H9QB 2HUEB 4YS3C 1P3OA 5B33D 1P3AC 4LD9C 2HIOB 4NE5A 2RVQC 4CAYA 4H9NB 3W96A 3KUYD 3TU4D 1M18A 3AZMD 3UTAC 5CPID 3VH6W 2F8NB 2ZY2A 1P3BA 5B24B 4WNNA 5AV9B 3MVDD 3NQUB 3AYWD 2RIQA 3W97D 3AL0C 5AVBD 3AZHD 5B33A 4R8PB 2W8SA 5CPIC 3UTBD 3X1SA 1U35C 2XD5A 4J8VB 3REJD 2PYOB 1M19D 3MVDC 3WKJA 1ZLAB 4J8UB 3AYWC 3X1TA 5AVBC 5B1LB 5B0ZC 3MGSB 2IO5C 3AZEA 1P3OB 5B32A 3X1VD 3VH5T 3REJC 5DNMD 4CSRA 3WTPA 5B2JC 4CAYB 4XUJA 3UTBA 3W96B 2BG1A 2LY8A 4G91B 1M19A 2UWXA 3AFAB 3X1VC 1P3BB 5DNMC 4WNNB 2Y2MA 5AV5D 5B1MD 3RELB 4EO5C 5B40D 5CPJB 3VH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 C;  3KWQ D;  1H3O A;  3KXB A;  3X1S B;  5BNX A;  1ID3 D;  1F66 C;  1HQ3 D;  4H9P A;  3WKJ B;  3AZN D;  3X1T B;  5B40 C;  1P3F D;  1P3L B;  3KWQ C;  3B0C W;  5JRG A;  4WV4 B;  3AZI C;  5B1M A;  3REK C;  3O62 A;  3LZ1 A;  3AZE B;  1BH9 A;  4WU9 C;  5B32 B;  4KUD B;  3WTP B;  4XUJ B;  2CV5 C;  4YM6 C;  1S32 C;  1M1A A;  2HIO D;  4AWL B;  3REI A;  1ID3 A;  1HQ3 A;  3C1B A;  1JFI A;  5AY8 B;  1P3M B;  3AZN A;  3B0B A;  3AV2 B;  4KHA A;  3MGR B;  5AV8 A;  2F8N D;  1EQZ D;  4NFT A;  5B24 D;  5AV6 A;  5AV9 D;  1H3O B;  3KXB B;  5BNX B;  4R8P D;  5CP6 C;  5BNV A;  1P3K B;  1EQZ C;  3MGQ C;  4J8V D;  4Z66 B;  5B24 C;  2PYO D;  5JRG B;  1P34 A;  1ZLA D;  5GSU B;  4J8U D;  4G92 C;  4KGC C;  5BS7 A;  3O62 B;  3LZ1 B;  1BH9 B;  4R8P C;  3MGP C;  5B1L D;  3MGS D;  5AV9 A;  4H9R B;  1P3O D;  5BO0 B;  4J8V C;  3AZJ C;  1TAF A;  1M1A B;  3REI B;  1JFI B;  1TZY B;  3C1B B;  5B1L C;  3MGS C;  3W96 D;  1P3P C;  3AN2 A;  4KHA B;  3AZL B;  5CPK A;  5AVC B;  3MNN B;  1P3O C;  3B6G B;  5AV8 B;  3AFA D;  1P3B D;  3AZF C;  3REL D;  3WAA A;  5AV6 B;  3WA9 B;  3W99 B;  5CPJ D;  5B31 G;  3W96 C;  1M18 C;  5GT3 B;  2NZD A;  5BNV B;  3A6N C;  4HGA C;  3B0D C;  3X1S D;  5DNN A;  4ZUX A;  5GT0 B;  4ZBJ B;  5B2I C;  1KX4 B;  4H9O A;  1P34 B;  3WKJ D;  3X1T D;  3AV1 A;  5B33 C;  1P3L D;  3AFA A;  1BFM A;  4WU8 A;  3REL A;  3X1S C;  3AZE D;  5B32 D;  5CPJ A;  1P3I A;  1TAF B;  3KUY C;  3TU4 C;  4KUD D;  3WTP D;  3AZM C;  3LEL A;  3WKJ C;  4XUJ D;  3R45 A;  3AN2 B;  5E5A B;  5AY8 D;  5CPK B;  1P3M D;  3AZE C;  3AZK B;  5F99 B;  3LZ0 B;  3W97 C;  3AV2 D;  3AZH C;  1P3L A;  3WAA B;  1F1E A;  3MGR D;  4XUJ C;  3UTB C;  2NZD B;  5B31 A;  4KUD A;  1M19 C;  3B6F A;  3KXB D;  5DNN B;  4ZUX B;  3REH A;  1P3K D;  4H9O B;  2YFV A;  4UUZ A;  5AY8 A;  1P3M A;  3AV1 B;  4Z2M H;  4Z66 D;  4QLC B;  5JRG D;  4WU8 B;  3AV2 A;  5GSU D;  3KXB C;  3MGR A;  3O62 D;  3LZ1 D;  1P3I B;  4J8W A;  3LEL B;  2FJ7 B;  3R45 B;  1M1A D;  2BYK A;  5JRG C;  3REI D;  2NQB B;  1B67 A;  1TZY D;  5B1M C;  5AV5 C;  3C1B D;  3O62 C;  1P3K A;  1P3A B;  4LD9 B;  4DRB A;  4Z66 A;  3AZL D;  3MNN D;  3UT9 A;  5B2J A;  3B6G D;  5GSU A;  5AV8 D;  3REI C;  5AV6 D;  1BH8 A;  3UTA B;  1HQ3 C;  3C1B C;  5B31 B;  1ID3 C;  3B6F B;  3WA9 D;  3AZN C;  4H9R A;  5BO0 A;  5GT3 D;  1P3F C;  3REH B;  4M6B A;  2YFV B;  5AV8 C;  4UUZ B;  1TZY A;  4DRA A;  1KX4 D;  5AV6 C;  1P34 D;  4X23 A;  3AZL A;  4E45 A;  2HUE C;  5AVC A;  3MNN A;  3B6G A;  1U35 B;  5B0Y A;  2HIO C;  4J8W B;  1F66 A;  3WA9 A;  3B0C T;  3W99 A;  4E44 A;  2BYK B;  5B0Z B;  5GT3 A;  4H9S A;  2IO5 B;  1AOI A;  5BS7 C;  1KX5 A;  5GT0 A;  4WU9 A;  3AN2 D;  1KX4 A;  5CPK D;  5AV9 C;  3UT9 B;  5B2J B;  3AZK D;  5KDM A;  2F8N H;  5F99 D;  3LZ0 D;  2CV5 A;  2ARO A;  1S32 A;  3WAA D;  1BH8 B;  3W98 A;  2F8N K;  2NZD D;  3AN2 C;  1KX3 A;  1WWS A;  2PYO C;  5GXQ A;  1ZLA C;  4J8U C;  5DNN D;  4EO5 B;  4ZUX D;  4XZQ A;  4J8X A;  5JA4 A;  3WAA C;  4JJN A;  4X23 B;  5E5A A;  5C3I B;  3AZK A;  3AV1 D;  5F99 A;  3LZ0 A;  2NZD C;  1B6W A;  1WWI A;  5CP6 A;  3NQJ A;  4NE6 A;  5B0Y B;  4WU8 D;  1F66 B;  2L5A A;  5DNN C;  5B40 B;  1P3I D;  4Z5T A;  4G91 C;  3LEL D;  1P3G A;  1AOI B;  3AZI B;  2FJ7 D;  3REK B;  4KGC A;  3AFA C;  1KX5 B;  4WU9 B;  1P3B C;  2NQB D;  3C1C A;  3REL C;  5KDM B;  1P3A D;  2CV5 B;  2ARO B;  5CPJ C;  4YM6 B;  1S32 B;  4LD9 D;  3AZJ A;  3KSY A;  4QLC A;  3LEL C;  3W98 B;  1R4V A;  3WTP E;  1KX3 B;  5B31 D;  5GXQ B;  3B6F D;  3X1T C;  2FJ7 A;  4XZQ B;  4J8X B;  3REH D;  5JA4 B;  4JJN B;  3AZF A;  1P3L C;  1N1J A;  2NQB A;  3X1U A;  3AZG A;  3LJA A;  4YS3 A;  1P3A A;  5B32 C;  4LD9 A;  3NQJ B;  5CP6 B;  5B31 C;  3A6N A;  3B6F C;  3WTP C;  4KUD C;  4Z2M G;  1U35 D;  1EQZ B;  3VH6 T;  4Z5T B;  3VH5 W;  3MGQ B;  3REH C;  4J8W D;  5B2I A;  5FUG A;  4AWL C;  1P3G B;  3UTA A;  5AY8 C;  1P3M C;  4G92 B;  4KGC B;  3MGP B;  5B0Z D;  3AV2 C;  3C1C B;  3MGR C;  4NE3 A;  4J8W C;  3AZJ B;  3KUY A;  3TU4 A;  5BT1 D;  3UT9 D;  5B2J D;  3AZM A;  5CPI A;  3VH6 A;  1U35 A;  1P3P B;  1P3K C;  3MVD A;  3AYW A;  3W97 A;  5AVB A;  4Z66 C;  3AZF B;  3AZH A;  5BT1 C;  5B0Z A;  3UT9 C;  1N1J B;  5GSU C;  3X1U B;  3AZG B;  3LJA B;  3LZ1 C;  4YS3 B;  1M18 B;  4X23 D;  5CHL B;  3A6N B;  4HGA B;  3REJ A;  5AVC D;  3B0D B;  1M1A C;  5B0Y D;  5B2I B;  5FUG B;  1F66 D;  1TZY C;  3W99 D;  5B33 B;  1Q9C A;  3X1V A;  3AZL C;  5DNM A;  5C3I C;  5AVC C;  3MNN C;  3AZI D;  3REK D;  1AOI D;  3B6G C;  1KU5 A;  1KX5 D;  5GT0 D;  4WU9 D;  5B0Y C;  3KUY B;  3TU4 B;  3WA9 C;  3AZM B;  5CPI B;  3W99 C;  2CV5 D;  2ARO D;  4YM6 D;  1S32 D;  5GT3 C;  4H9S C;  3V9R A;  3W98 D;  2F8N G;  1AOI C;  5AV5 A;  3MVD B;  1HTA A;  1KX5 C;  5GT0 C;  3AYW B;  3W97 B;  4ZBJ C;  5B40 A;  5AVB B;  1KX3 D;  3AZH B;  1KX4 C;  5G49 A;  5GXQ D;  4CSR B;  1P34 C;  3KWQ A;  2YFW A;  2ARO C;  3AZI A;  2BYM A;  3REK A;  3UTB B;  4XZQ D;  4J8X D;  4JJN D;  3W98 C;  2CWE A;  5E5A D;  3REJ B;  1M19 B;  2JSS A;  5CP6 D;  4YM6 A;  1KX3 C;  1P3F A;  5GXQ C;  4XZQ C;  4Z5T D;  3MGQ D;  4J8X C;  4JJN C;  1ULY A;  1P3G D;  3X1V B;  5E5A C;  5DNM B;  5CPK C;  3AZK C;  4H9Q A;  4KGC D;  5F99 C;  3LZ0 C;  3MGP D;  3C1C D;  2HIO A;  4H9P B;  4Z5T C;  4H9N A;  3AZJ D;  4QLC D;  1P3G C;  3V9R B;  5AV5 B;  5B1M B;  4ZUX C;  2F8N A;  1EQZ A;  3MGQ A;  3C1C C;  1P3P D;  5G49 B;  5B24 A;  4WZS B;  3KWQ B;  2YFW B;  3NQU A;  2BYM B;  3AV1 C;  3AZF D;  3MGP A;  4QLC C;  4R8P A;  4WU8 C;  1ID3 B;  1HQ3 B;  1A7W A;  3X1U D;  3AZG D;  3LJA D;  4YS3 D;  3AZN B;  1M18 D;  1P3I C;  4J8V A;  3A6N D;  1P3F B;  2PYO A;  2RVQ D;  1ZLA A;  4J8U A;  2FJ7 C;  5B2I D;  5B1L A;  3MGS A;  2NQB C;  3UTA D;  1P3P A;  3X1U C;  3AZG C;  3LJA C;  5B32 G;  4H9Q B;  2HUE B;  4YS3 C;  1P3O A;  5B33 D;  1P3A C;  4LD9 C;  2HIO B;  4NE5 A;  2RVQ C;  4CAY A;  4H9N B;  3W96 A;  3KUY D;  3TU4 D;  1M18 A;  3AZM D;  3UTA C;  5CPI D;  3VH6 W;  2F8N B;  1P3B A;  5B24 B;  4WNN A;  5AV9 B;  3MVD D;  3NQU B;  3AYW D;  3W97 D;  5AVB D;  3AZH D;  5B33 A;  4R8P B;  5CPI C;  3UTB D;  3X1S A;  1U35 C;  4J8V B;  3REJ D;  2PYO B;  1M19 D;  3MVD C;  3WKJ A;  1ZLA B;  4J8U B;  3AYW C;  3X1T A;  5AVB C;  5B1L B;  5B0Z C;  3MGS B;  2IO5 C;  3AZE A;  1P3O B;  5B32 A;  3X1V D;  3VH5 T;  3REJ C;  5DNM D;  4CSR A;  3WTP A;  5B2J C;  4CAY B;  4XUJ A;  3UTB A;  3W96 B;  2LY8 A;  4G91 B;  1M19 A;  3AFA B;  3X1V C;  1P3B B;  5DNM C;  4WNN B;  3REL B;  5AV5 D;  5B1M D;  4EO5 C;  5B40 D;  5CPJ B;  3VH5 A; 
#chains in the Genus database with same CATH topology
 4X23 C;  3KWQ D;  1H3O A;  3KXB A;  3X1S B;  5BNX A;  1ID3 D;  1F66 C;  1HQ3 D;  4H9P A;  3WKJ B;  3P5J B;  3AZN D;  3X1T B;  5B40 C;  1P3F D;  1P3L B;  4WJ3 C;  3KWQ C;  3B0C W;  5JRG A;  4WV4 B;  3AZI C;  5B1M A;  3REK C;  3O62 A;  3LZ1 A;  3AZE B;  1BH9 A;  4WU9 C;  5B32 B;  4KUD B;  3WTP B;  4XUJ B;  2CV5 C;  2Y2G A;  4YM6 C;  1S32 C;  1M1A A;  2HIO D;  4AWL B;  3REI A;  1ID3 A;  1HQ3 A;  3C1B A;  1JFI A;  5AY8 B;  1W2E A;  1P3M B;  3AZN A;  3B0B A;  3AV2 B;  2Y2I A;  4KHA A;  3MGR B;  5AV8 A;  2F8N D;  1EQZ D;  4NFT A;  5B24 D;  5AV6 A;  5AV9 D;  1H3O B;  3KXB B;  5BNX B;  4R8P D;  5CP6 C;  5BNV A;  2Y2N A;  1P3K B;  1EQZ C;  3MGQ C;  2ZY3 A;  4J8V D;  4Z66 B;  5B24 C;  2PYO D;  5JRG B;  1P34 A;  1ZLA D;  5GSU B;  4J8U D;  4G92 C;  4KGC C;  5BS7 A;  3O62 B;  3LZ1 B;  1BH9 B;  4R8P C;  3MGP C;  5B1L D;  3MGS D;  5AV9 A;  4H9R B;  1P3O D;  5BO0 B;  4J8V C;  3AZJ C;  1TAF A;  1M1A B;  3REI B;  2Y2Q A;  1JFI B;  1TZY B;  3C1B B;  5B1L C;  3MGS C;  3W96 D;  1P3P C;  3AN2 A;  4KHA B;  3AZL B;  5CPK A;  2Y2P A;  5AVC B;  3MNN B;  1P3O C;  3B6G B;  5AV8 B;  3AFA D;  1P3B D;  3AZF C;  3REL D;  3WAA A;  5AV6 B;  3WA9 B;  3W99 B;  5CPJ D;  5B31 G;  3W96 C;  1M18 C;  5GT3 B;  2NZD A;  2Y2O A;  5BNV B;  3A6N C;  4HGA C;  2G5I C;  3B0D C;  3X1S D;  5DNN A;  4ZUX A;  5GT0 B;  1PZR A;  4ZBJ B;  5B2I C;  1KX4 B;  4H9O A;  1P34 B;  3WKJ D;  3EPH A;  3X1T D;  3AV1 A;  5B33 C;  1P3L D;  3AFA A;  1BFM A;  4WU8 A;  3REL A;  3X1S C;  3AZE D;  5B32 D;  5CPJ A;  1P3I A;  1TAF B;  3KUY C;  3TU4 C;  4KUD D;  3WTP D;  3AZM C;  3LEL A;  3WKJ C;  4XUJ D;  3R45 A;  3A1K A;  3F6T A;  3AN2 B;  5E5A B;  5AY8 D;  5CPK B;  1P3M D;  3AZE C;  3AZK B;  5F99 B;  3LZ0 B;  3W97 C;  3EPJ A;  3AV2 D;  3AZH C;  1P3L A;  3WAA B;  1F1E A;  3MGR D;  2FFF B;  4XUJ C;  3UTB C;  2DQN C;  2NZD B;  5B31 A;  4KUD A;  1M19 C;  3B6F A;  3KXB D;  5DNN B;  4ZUX B;  3REH A;  1P3K D;  4H9O B;  2YFV A;  4UUZ A;  5AY8 A;  1P3M A;  3AV1 B;  4Z2M H;  3H0L C;  4Z66 D;  4QLC B;  5JRG D;  4WU8 B;  3AV2 A;  5GSU D;  3KXB C;  3MGR A;  3O62 D;  3LZ1 D;  1P3I B;  4J8W A;  3LEL B;  2FJ7 B;  3R45 B;  1M1A D;  3KFU G;  2BYK A;  5JRG C;  3REI D;  2NQB B;  1B67 A;  1TZY D;  5B1M C;  5AV5 C;  3C1B D;  3O62 C;  1P3K A;  1P3A B;  4LD9 B;  4DRB A;  4Z66 A;  3AZL D;  3MNN D;  3UT9 A;  5B2J A;  3B6G D;  5GSU A;  5AV8 D;  3A1I A;  3REI C;  5AV6 D;  1BH8 A;  3UTA B;  1HQ3 C;  3C1B C;  5B31 B;  1ID3 C;  3B6F B;  3WA9 D;  3AZN C;  4H9R A;  2Y2K A;  5BO0 A;  5GT3 D;  1P3F C;  3REH B;  4M6B A;  2YFV B;  5AV8 C;  4UUZ B;  1TZY A;  4DRA A;  1KX4 D;  5AV6 C;  1P34 D;  4X23 A;  3AZL A;  4E45 A;  2HUE C;  5AVC A;  3MNN A;  3B6G A;  1U35 B;  5B0Y A;  2HIO C;  4J8W B;  1F66 A;  3WA9 A;  3B0C T;  3W99 A;  4E44 A;  2BYK B;  4UPK A;  5GT3 A;  3EG5 B;  5B0Z B;  4H9S A;  2IO5 B;  1AOI A;  5BS7 C;  1KX5 A;  2F2A C;  5GT0 A;  4WU9 A;  3AN2 D;  1KX4 A;  5CPK D;  5AV9 C;  3UT9 B;  5B2J B;  3AZK D;  5KDM A;  2F8N H;  5F99 D;  3LZ0 D;  2CV5 A;  2ARO A;  1S32 A;  3WAA D;  1BH8 B;  3W98 A;  2F8N K;  2NZD D;  3AN2 C;  1KX3 A;  1WWS A;  2PYO C;  5GXQ A;  1ZLA C;  4J8U C;  5DNN D;  4EO5 B;  4ZUX D;  4XZQ A;  4J8X A;  5JA4 A;  3WAA C;  4JJN A;  4X23 B;  5E5A A;  5C3I B;  3AZK A;  3AV1 D;  5F99 A;  3LZ0 A;  2NZD C;  1B6W A;  1WWI A;  5CP6 A;  2G5H C;  3NQJ A;  4NE6 A;  5B0Y B;  4WU8 D;  1F66 B;  2Y2H A;  2L5A A;  5DNN C;  1T3U A;  5B40 B;  1P3I D;  4Z5T A;  4G91 C;  3LEL D;  1P3G A;  1AOI B;  3AZI B;  2FJ7 D;  3REK B;  4KGC A;  3AFA C;  1KX5 B;  4WU9 B;  1P3B C;  2NQB D;  3C1C A;  3REL C;  5KDM B;  1P3A D;  2CV5 B;  2ARO B;  5CPJ C;  4YM6 B;  1S32 B;  4LD9 D;  3AZJ A;  3KSY A;  4QLC A;  3LEL C;  3EPL A;  3W98 B;  1R4V A;  3WTP E;  1KX3 B;  5B31 D;  5GXQ B;  3B6F D;  3X1T C;  2FJ7 A;  4XZQ B;  4J8X B;  3REH D;  5JA4 B;  4JJN B;  3AZF A;  1P3L C;  1N1J A;  2NQB A;  2ZY5 A;  3X1U A;  3AZG A;  3LJA A;  4YS3 A;  1P3A A;  5B32 C;  4LD9 A;  3NQJ B;  5CP6 B;  5B31 C;  3A6N A;  3B6F C;  3WTP C;  4KUD C;  4Z2M G;  1U35 D;  1EQZ B;  3VH6 T;  4Z5T B;  3VH5 W;  3MGQ B;  3REH C;  4J8W D;  5B2I A;  5FUG A;  4AWL C;  1P3G B;  3UTA A;  5AY8 C;  1P3M C;  4G92 B;  4KGC B;  3MGP B;  5B0Z D;  3AV2 C;  3C1C B;  3MGR C;  4NE3 A;  4J8W C;  3AZJ B;  3KUY A;  3TU4 A;  5BT1 D;  3UT9 D;  5B2J D;  3AZM A;  5CPI A;  3VH6 A;  1U35 A;  1P3P B;  1P3K C;  3MVD A;  3AYW A;  3W97 A;  5AVB A;  4Z66 C;  3AZF B;  3AZH A;  3H0R C;  5BT1 C;  5B0Z A;  1N1J B;  3UT9 C;  2DF4 C;  5GSU C;  3X1U B;  3AZG B;  3LJA B;  3LZ1 C;  4YS3 B;  1M18 B;  4X23 D;  5CHL B;  3A6N B;  4HGA B;  3REJ A;  5AVC D;  3B0D B;  1M1A C;  5B0Y D;  5B2I B;  5FUG B;  1F66 D;  2JE5 A;  1TZY C;  3W99 D;  1Z2C B;  5B33 B;  2JCH A;  1Q9C A;  3X1V A;  3AZL C;  5DNM A;  5C3I C;  5AVC C;  3MNN C;  3AZI D;  3REK D;  1AOI D;  3B6G C;  3FDD A;  1KU5 A;  1KX5 D;  5GT0 D;  4WU9 D;  5B0Y C;  3KUY B;  4DQY B;  3TU4 B;  3WA9 C;  3AZM B;  5CPI B;  3W99 C;  3EPK A;  2CV5 D;  2ARO D;  4YM6 D;  1S32 D;  5GT3 C;  4H9S C;  3V9R A;  3W98 D;  2F8N G;  1AOI C;  5AV5 A;  3IP4 C;  3MVD B;  1HTA A;  1KX5 C;  5GT0 C;  2XD1 A;  3AYW B;  4ZBJ C;  5B40 A;  3W97 B;  5AVB B;  1KX3 D;  3AZH B;  1KX4 C;  5G49 A;  5GXQ D;  4CSR B;  1P34 C;  3KWQ A;  2YFW A;  2ARO C;  3AZI A;  2BYM A;  3REK A;  3UTB B;  4XZQ D;  4J8X D;  4JJN D;  3W98 C;  2CWE A;  5E5A D;  3REJ B;  1M19 B;  2JSS A;  5CP6 D;  4YM6 A;  1KX3 C;  1P3F A;  5GXQ C;  4XZQ C;  4Z5T D;  3MGQ D;  4J8X C;  4JJN C;  1ULY A;  1P3G D;  3X1V B;  5E5A C;  5DNM B;  5CPK C;  3AZK C;  4H9Q A;  4KGC D;  5F99 C;  3LZ0 C;  3MGP D;  2J8P A;  3C1C D;  2HIO A;  2ZY4 A;  4H9P B;  4Z5T C;  4H9N A;  3AZJ D;  4QLC D;  1P3G C;  3V9R B;  5AV5 B;  5B1M B;  2Y2J A;  4ZUX C;  2F8N A;  1EQZ A;  3MGQ A;  3C1C C;  1P3P D;  5G49 B;  5B24 A;  4WZS B;  3KWQ B;  2YFW B;  2ZM5 A;  3NQU A;  2BYM B;  3AV1 C;  2VQR A;  3AZF D;  3MGP A;  4QLC C;  4R8P A;  4WU8 C;  1ID3 B;  1HQ3 B;  1A7W A;  3X1U D;  3AZG D;  3LJA D;  4YS3 D;  3AZN B;  1M18 D;  1P3I C;  4J8V A;  3A6N D;  1P3F B;  2PYO A;  2RVQ D;  1ZLA A;  4J8U A;  2FJ7 C;  5B2I D;  5B1L A;  2Y2L A;  3MGS A;  2NQB C;  3UTA D;  1P3P A;  3X1U C;  3H0M C;  3LJA C;  5B32 G;  3AZG C;  4H9Q B;  2HUE B;  4YS3 C;  1P3O A;  5B33 D;  1P3A C;  4LD9 C;  2HIO B;  4NE5 A;  2RVQ C;  4CAY A;  4H9N B;  3W96 A;  3KUY D;  3TU4 D;  1M18 A;  3AZM D;  3UTA C;  5CPI D;  3VH6 W;  2F8N B;  2ZY2 A;  1P3B A;  5B24 B;  4WNN A;  5AV9 B;  3MVD D;  3NQU B;  3AYW D;  2RIQ A;  3W97 D;  3AL0 C;  5AVB D;  3AZH D;  5B33 A;  4R8P B;  2W8S A;  5CPI C;  3UTB D;  3X1S A;  1U35 C;  2XD5 A;  4J8V B;  3REJ D;  2PYO B;  1M19 D;  3MVD C;  3WKJ A;  1ZLA B;  4J8U B;  3AYW C;  3X1T A;  5AVB C;  5B1L B;  5B0Z C;  3MGS B;  2IO5 C;  3AZE A;  1P3O B;  5B32 A;  3X1V D;  3VH5 T;  3REJ C;  5DNM D;  4CSR A;  3WTP A;  5B2J C;  4CAY B;  4XUJ A;  3UTB A;  3W96 B;  2BG1 A;  2LY8 A;  4G91 B;  1M19 A;  2UWX A;  3AFA B;  3X1V C;  1P3B B;  5DNM C;  4WNN B;  2Y2M A;  5AV5 D;  5B1M D;  3REL B;  4EO5 C;  5B40 D;  5CPJ B;  3VH5 A; 
#chains in the Genus database with same CATH homology
 4X23 C;  3KWQ D;  1H3O A;  3KXB A;  3X1S B;  5BNX A;  1ID3 D;  1F66 C;  1HQ3 D;  4H9P A;  3WKJ B;  3P5J B;  3AZN D;  3X1T B;  5B40 C;  1P3F D;  1P3L B;  4WJ3 C;  3KWQ C;  3B0C W;  5JRG A;  4WV4 B;  3AZI C;  5B1M A;  3REK C;  3O62 A;  3LZ1 A;  3AZE B;  1BH9 A;  4WU9 C;  5B32 B;  4KUD B;  3WTP B;  4XUJ B;  2CV5 C;  2Y2G A;  4YM6 C;  1S32 C;  1M1A A;  2HIO D;  4AWL B;  3REI A;  1ID3 A;  1HQ3 A;  3C1B A;  1JFI A;  5AY8 B;  1W2E A;  1P3M B;  3AZN A;  3B0B A;  3AV2 B;  2Y2I A;  4KHA A;  3MGR B;  5AV8 A;  2F8N D;  1EQZ D;  4NFT A;  5B24 D;  5AV6 A;  5AV9 D;  1H3O B;  3KXB B;  5BNX B;  4R8P D;  5CP6 C;  5BNV A;  2Y2N A;  1P3K B;  1EQZ C;  3MGQ C;  2ZY3 A;  4J8V D;  4Z66 B;  5B24 C;  2PYO D;  5JRG B;  1P34 A;  1ZLA D;  5GSU B;  4J8U D;  4G92 C;  4KGC C;  5BS7 A;  3O62 B;  3LZ1 B;  1BH9 B;  4R8P C;  3MGP C;  5B1L D;  3MGS D;  5AV9 A;  4H9R B;  1P3O D;  5BO0 B;  4J8V C;  3AZJ C;  1TAF A;  1M1A B;  3REI B;  2Y2Q A;  1JFI B;  1TZY B;  3C1B B;  5B1L C;  3MGS C;  3W96 D;  1P3P C;  3AN2 A;  4KHA B;  3AZL B;  5CPK A;  2Y2P A;  5AVC B;  3MNN B;  1P3O C;  3B6G B;  5AV8 B;  3AFA D;  1P3B D;  3AZF C;  3REL D;  3WAA A;  5AV6 B;  3WA9 B;  3W99 B;  5CPJ D;  5B31 G;  3W96 C;  1M18 C;  5GT3 B;  2NZD A;  2Y2O A;  5BNV B;  3A6N C;  4HGA C;  2G5I C;  3B0D C;  3X1S D;  5DNN A;  4ZUX A;  5GT0 B;  1PZR A;  4ZBJ B;  5B2I C;  1KX4 B;  4H9O A;  1P34 B;  3WKJ D;  3EPH A;  3X1T D;  3AV1 A;  5B33 C;  1P3L D;  3AFA A;  1BFM A;  4WU8 A;  3REL A;  3X1S C;  3AZE D;  5B32 D;  5CPJ A;  1P3I A;  1TAF B;  3KUY C;  3TU4 C;  4KUD D;  3WTP D;  3AZM C;  3LEL A;  3WKJ C;  4XUJ D;  3R45 A;  3A1K A;  3F6T A;  3AN2 B;  5E5A B;  5AY8 D;  5CPK B;  1P3M D;  3AZE C;  3AZK B;  5F99 B;  3LZ0 B;  3W97 C;  3EPJ A;  3AV2 D;  3AZH C;  1P3L A;  3WAA B;  1F1E A;  3MGR D;  2FFF B;  4XUJ C;  3UTB C;  2DQN C;  2NZD B;  5B31 A;  4KUD A;  1M19 C;  3B6F A;  3KXB D;  5DNN B;  4ZUX B;  3REH A;  1P3K D;  4H9O B;  2YFV A;  4UUZ A;  5AY8 A;  1P3M A;  3AV1 B;  4Z2M H;  3H0L C;  4Z66 D;  4QLC B;  5JRG D;  4WU8 B;  3AV2 A;  5GSU D;  3KXB C;  3MGR A;  3O62 D;  3LZ1 D;  1P3I B;  4J8W A;  3LEL B;  2FJ7 B;  3R45 B;  1M1A D;  3KFU G;  2BYK A;  5JRG C;  3REI D;  2NQB B;  1B67 A;  1TZY D;  5B1M C;  5AV5 C;  3C1B D;  3O62 C;  1P3K A;  1P3A B;  4LD9 B;  4DRB A;  4Z66 A;  3AZL D;  3MNN D;  3UT9 A;  5B2J A;  3B6G D;  5GSU A;  5AV8 D;  3A1I A;  3REI C;  5AV6 D;  1BH8 A;  3UTA B;  1HQ3 C;  3C1B C;  5B31 B;  1ID3 C;  3B6F B;  3WA9 D;  3AZN C;  4H9R A;  2Y2K A;  5BO0 A;  5GT3 D;  1P3F C;  3REH B;  4M6B A;  2YFV B;  5AV8 C;  4UUZ B;  1TZY A;  4DRA A;  1KX4 D;  5AV6 C;  1P34 D;  4X23 A;  3AZL A;  4E45 A;  2HUE C;  5AVC A;  3MNN A;  3B6G A;  1U35 B;  5B0Y A;  2HIO C;  4J8W B;  1F66 A;  3WA9 A;  3B0C T;  3W99 A;  4E44 A;  2BYK B;  4UPK A;  5GT3 A;  3EG5 B;  5B0Z B;  4H9S A;  2IO5 B;  1AOI A;  5BS7 C;  1KX5 A;  2F2A C;  5GT0 A;  4WU9 A;  3AN2 D;  1KX4 A;  5CPK D;  5AV9 C;  3UT9 B;  5B2J B;  3AZK D;  5KDM A;  2F8N H;  5F99 D;  3LZ0 D;  2CV5 A;  2ARO A;  1S32 A;  3WAA D;  1BH8 B;  3W98 A;  2F8N K;  2NZD D;  3AN2 C;  1KX3 A;  1WWS A;  2PYO C;  5GXQ A;  1ZLA C;  4J8U C;  5DNN D;  4EO5 B;  4ZUX D;  4XZQ A;  4J8X A;  5JA4 A;  3WAA C;  4JJN A;  4X23 B;  5E5A A;  5C3I B;  3AZK A;  3AV1 D;  5F99 A;  3LZ0 A;  2NZD C;  1B6W A;  1WWI A;  5CP6 A;  2G5H C;  3NQJ A;  4NE6 A;  5B0Y B;  4WU8 D;  1F66 B;  2Y2H A;  2L5A A;  5DNN C;  1T3U A;  5B40 B;  1P3I D;  4Z5T A;  4G91 C;  3LEL D;  1P3G A;  1AOI B;  3AZI B;  2FJ7 D;  3REK B;  4KGC A;  3AFA C;  1KX5 B;  4WU9 B;  1P3B C;  2NQB D;  3C1C A;  3REL C;  5KDM B;  1P3A D;  2CV5 B;  2ARO B;  5CPJ C;  4YM6 B;  1S32 B;  4LD9 D;  3AZJ A;  3KSY A;  4QLC A;  3LEL C;  3EPL A;  3W98 B;  1R4V A;  3WTP E;  1KX3 B;  5B31 D;  5GXQ B;  3B6F D;  3X1T C;  2FJ7 A;  4XZQ B;  4J8X B;  3REH D;  5JA4 B;  4JJN B;  3AZF A;  1P3L C;  1N1J A;  2NQB A;  2ZY5 A;  3X1U A;  3AZG A;  3LJA A;  4YS3 A;  1P3A A;  5B32 C;  4LD9 A;  3NQJ B;  5CP6 B;  5B31 C;  3A6N A;  3B6F C;  3WTP C;  4KUD C;  4Z2M G;  1U35 D;  1EQZ B;  3VH6 T;  4Z5T B;  3VH5 W;  3MGQ B;  3REH C;  4J8W D;  5B2I A;  5FUG A;  4AWL C;  1P3G B;  3UTA A;  5AY8 C;  1P3M C;  4G92 B;  4KGC B;  3MGP B;  5B0Z D;  3AV2 C;  3C1C B;  3MGR C;  4NE3 A;  4J8W C;  3AZJ B;  3KUY A;  3TU4 A;  5BT1 D;  3UT9 D;  5B2J D;  3AZM A;  5CPI A;  3VH6 A;  1U35 A;  1P3P B;  1P3K C;  3MVD A;  3AYW A;  3W97 A;  5AVB A;  4Z66 C;  3AZF B;  3AZH A;  3H0R C;  5BT1 C;  5B0Z A;  1N1J B;  3UT9 C;  2DF4 C;  5GSU C;  3X1U B;  3AZG B;  3LJA B;  3LZ1 C;  4YS3 B;  1M18 B;  4X23 D;  5CHL B;  3A6N B;  4HGA B;  3REJ A;  5AVC D;  3B0D B;  1M1A C;  5B0Y D;  5B2I B;  5FUG B;  1F66 D;  2JE5 A;  1TZY C;  3W99 D;  1Z2C B;  5B33 B;  2JCH A;  1Q9C A;  3X1V A;  3AZL C;  5DNM A;  5C3I C;  5AVC C;  3MNN C;  3AZI D;  3REK D;  1AOI D;  3B6G C;  3FDD A;  1KU5 A;  1KX5 D;  5GT0 D;  4WU9 D;  5B0Y C;  3KUY B;  4DQY B;  3TU4 B;  3WA9 C;  3AZM B;  5CPI B;  3W99 C;  3EPK A;  2CV5 D;  2ARO D;  4YM6 D;  1S32 D;  5GT3 C;  4H9S C;  3V9R A;  3W98 D;  2F8N G;  1AOI C;  5AV5 A;  3IP4 C;  3MVD B;  1HTA A;  1KX5 C;  5GT0 C;  2XD1 A;  3AYW B;  4ZBJ C;  5B40 A;  3W97 B;  5AVB B;  1KX3 D;  3AZH B;  1KX4 C;  5G49 A;  5GXQ D;  4CSR B;  1P34 C;  3KWQ A;  2YFW A;  2ARO C;  3AZI A;  2BYM A;  3REK A;  3UTB B;  4XZQ D;  4J8X D;  4JJN D;  3W98 C;  2CWE A;  5E5A D;  3REJ B;  1M19 B;  2JSS A;  5CP6 D;  4YM6 A;  1KX3 C;  1P3F A;  5GXQ C;  4XZQ C;  4Z5T D;  3MGQ D;  4J8X C;  4JJN C;  1ULY A;  1P3G D;  3X1V B;  5E5A C;  5DNM B;  5CPK C;  3AZK C;  4H9Q A;  4KGC D;  5F99 C;  3LZ0 C;  3MGP D;  2J8P A;  3C1C D;  2HIO A;  2ZY4 A;  4H9P B;  4Z5T C;  4H9N A;  3AZJ D;  4QLC D;  1P3G C;  3V9R B;  5AV5 B;  5B1M B;  2Y2J A;  4ZUX C;  2F8N A;  1EQZ A;  3MGQ A;  3C1C C;  1P3P D;  5G49 B;  5B24 A;  4WZS B;  3KWQ B;  2YFW B;  2ZM5 A;  3NQU A;  2BYM B;  3AV1 C;  2VQR A;  3AZF D;  3MGP A;  4QLC C;  4R8P A;  4WU8 C;  1ID3 B;  1HQ3 B;  1A7W A;  3X1U D;  3AZG D;  3LJA D;  4YS3 D;  3AZN B;  1M18 D;  1P3I C;  4J8V A;  3A6N D;  1P3F B;  2PYO A;  2RVQ D;  1ZLA A;  4J8U A;  2FJ7 C;  5B2I D;  5B1L A;  2Y2L A;  3MGS A;  2NQB C;  3UTA D;  1P3P A;  3X1U C;  3H0M C;  3LJA C;  5B32 G;  3AZG C;  4H9Q B;  2HUE B;  4YS3 C;  1P3O A;  5B33 D;  1P3A C;  4LD9 C;  2HIO B;  4NE5 A;  2RVQ C;  4CAY A;  4H9N B;  3W96 A;  3KUY D;  3TU4 D;  1M18 A;  3AZM D;  3UTA C;  5CPI D;  3VH6 W;  2F8N B;  2ZY2 A;  1P3B A;  5B24 B;  4WNN A;  5AV9 B;  3MVD D;  3NQU B;  3AYW D;  2RIQ A;  3W97 D;  3AL0 C;  5AVB D;  3AZH D;  5B33 A;  4R8P B;  2W8S A;  5CPI C;  3UTB D;  3X1S A;  1U35 C;  2XD5 A;  4J8V B;  3REJ D;  2PYO B;  1M19 D;  3MVD C;  3WKJ A;  1ZLA B;  4J8U B;  3AYW C;  3X1T A;  5AVB C;  5B1L B;  5B0Z C;  3MGS B;  2IO5 C;  3AZE A;  1P3O B;  5B32 A;  3X1V D;  3VH5 T;  3REJ C;  5DNM D;  4CSR A;  3WTP A;  5B2J C;  4CAY B;  4XUJ A;  3UTB A;  3W96 B;  2BG1 A;  2LY8 A;  4G91 B;  1M19 A;  2UWX A;  3AFA B;  3X1V C;  1P3B B;  5DNM C;  4WNN B;  2Y2M A;  5AV5 D;  5B1M D;  3REL B;  4EO5 C;  5B40 D;  5CPJ B;  3VH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...