3B0CT

Crystal structure of the chicken cenp-t histone fold/cenp-w complex, crystal form i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
SSLIKQIFSHYVKTPVTRDAYKIVEKCSERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein T
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 29
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b0cT00
3B6GB 1KX5A 2AROB 4H9NB 5B2JA 3VH5T 5B24C 2NQBA 5DNNC 3WTPC 4J8VD 5B40D 4JJNC 5CPJA 3X1VB 3UTAD 3AZKC 4AWLC 5B32A 1P3GC 4G92B 3W97D 3LELC 4YS3C 1M1AD 3O62B 5C3IC 2PYOD 4NE5A 3AV2A 3C1BC 1WWSA 1F66D 5AY8D 5AV9A 2PYOB 1P3PB 4KHAB 3W99B 3AYWA 1TZYD 3AZLB 1KX3A 1H3OA 4NE3A 4J8VC 5JRGD 3UTBD 5B40C 4WU8A 4E44A 3RELD 3UTAC 5CHLB 3MVDD 5GSUD 3AZIA 3W97C 3AZED 3LZ1C 1U35C 5JRGB 1BH8B 1M1AC 3RELB 3MVDB 1F66C 2F8ND 5AY8C 5B31C 4ZUXA 4R8PC 5B0YA 4HGAB 4KGCC 5E5AD 5AV8C 1TZYC 2F8NB 1KX5B 5B2ID 4WU9C 5B2JB 3UTBC 2NQBB 3KUYA 5GSUC 4X23C 2JSSA 3REHD 5B2IB 3AZEC 3AV1D 5CPJB 2NZDC 1Q9CA 5AVCD 2YFVA 2YFWA 3AFAA 1P3LD 5CPKA 3REHB 3AV1B 5GXQD 3AV2B 4KUDD 4WZSB 3B0DC 5AV5D 5E5AC 5B1LD 3MGSA 1P3LB 5AV9B 4LD9A 2F8NG 3X1UC 5GXQB 2CV5A 4KUDB 5JA4A 3AN2C 3AZGC 3AYWB 4JJNA 3TU4A 3X1TC 2BYMB 1KX3B 1H3OB 1P3GA 5B0ZB 5CPIA 3LELA 5AVCC 3B6GA 3LJAC 1F1EA 2AROA 1P3OC 4H9NA 5BS7C 4ZBJB 1S32C 1P3BD 5BT1C 3KWQB 4DRAA 5AV5C 5B1LC 3WAAC 2FJ7C 2F8NH 3B0CT 3AZMD 3AZFD 5B40A 3R45B 3VH5W 3UTAA 3X1SD 4XZQD 1P3AD 3W96D 3W97A 3AZMB 3MGPC 3MGQD 3KXBB 3A6NC 2RVQD 1M1AA 2PYOA 1M19C 3X1SB 3UT9C 1P3BC 5AY8A 2BYKB 3MGQB 2YFVB 5B1MC 5B24D 5DNND 3WTPD 3REJC 1TZYA 3WA9D 5JRGA 3UTBA 3AZFC 3AZKD 5B24B 5DNNB 3NQUB 4NFTA 3RELA 3WTPB 3MVDA 4XZQC 3W96C 1P3AC 4YS3D 4JJNB 3AZEA 4Z66C 5KDMA 3AZKB 2RVQC 5DNMD 4J8WC 3C1BD 4AWLB 1P3GB 1ZLAC 5F99C 3AZHD 5BO0B 3LELB 2F8NK 4YS3B 5C3IB 2F8NA 3VH6T 1A7WA 3C1BB 5E5AA 2HIOC 2LY8A 3WA9C 1KU5A 5B2IA 3LZ1D 4J8VB 1U35D 1HQ3C 5B40B 3REHA 3AV1A 3UTAB 5DNMC 4XUJC 4H9SA 5AVCA 3W97B 3C1CC 3AZHC 1U35B 5B31D 1P3LA 1M1AB 3V9RA 5GXQA 5B33D 4R8PD 4KUDA 4KGCD 1F66B 5AV8D 5AV5A 5B31B 5B1LA 5AY8B 2BYMA 4WU9D 3AZJD 4R8PB 4J8XC 5B0ZA 4KGCB 5AV8B 4YM6C 1TZYB 5GT3C 1P3FC 4X23D 5G49B 4WU9B 2NZDD 3UTBB 5GT0D 4Z5TD 4UUZA 1EQZD 5GSUB 4WNNA 3KWQA 4X23B 3AZEB 5KDMB 3W98C 1P3BA 5B33C 5AV6C 2HUEC 3R45A 3X1UD 5B31G 3AN2D 3AZGD 3AZJC 3B0DB 3AZMA 3X1TD 5E5AB 3AZFA 5CP6D 3KXBA 3X1UB 3NQJA 3AN2B 3X1SA 3AZGB 1M18C 4XZQA 1P3AA 3B0CW 5GT0C 3B6FC 3WKJC 4Z5TC 3X1TB 1P3KC 2BYKA 3MGQA 3LJAD 4Z2MG 2L5AA 1EQZC 1P3OD 1S32D 1KX4D 5BT1D 5AVCB 1P3MC 3LJAB 1BFMA 1P3OB 5BNVA 3WAAD 1S32B 2FJ7D 5B24A 5DNNA 3NQUA 3V9RB 3WTPA 1ID3C 3WA9A 5AV5B 5B1LB 5CP6C 3MGRD 3AZKA 1AOIC 2FJ7B 3WAAB 1P3ID 4H9RB 3MGPD 5BO0A 3A6ND 4YS3A 1M19D 5DNMA 3MNND 3C1BA 3UT9D 3VH6A 1KX4C 3AZHA 3MGPB 4UUZB 3A6NB 3LZ0D 5B1MD 4WNNB 1M19B 3B0BA 3UT9B 4CAYA 3REJD 1P34D 1P3BB 5B1MB 3VH6W 4J8VA 5B32C 3MGRC 3REJB 5FUGA 1WWIA 1P3IC 4Z66D 3LZ1A 1U35A 3AZFB 1N1JA 3NQJB 4J8WD 1ZLAD 5F99D 3MNNC 4XZQB 1P3AB 3REID 1F66A 4J8UD 3W96B 4Z66B 5B31A 4H9PB 3LZ0C 4J8WB 1ZLAB 4R8PA 5F99B 4KGCA 3REKD 5AV8A 1P34C 2HIOD 4WU8C 5G49A 4WU9A 4QLCD 3AZJA 5BNVB 3AZND 1ULYA 3AZIC 4EO5C 2HIOB 5GSUA 3WA9B 1HQ3D 4X23A 2NZDA 5GT0A 4H9QA 4Z5TA 4XUJD 1EQZA 5AVBD 3C1CD 4ZUXC 3REIC 1B6WA 1HQ3B 4J8UC 5B0YC 1JFIA 5DNMB 4XUJB 3C1CB 3AZHB 3REKC 3X1UA 4J8XD 3AN2A 3AZGA 5BNXA 4QLCC 3KUYC 4CAYB 3AZNC 4YM6D 5GT3D 3X1TA 2CWEA 1P3FD 5CP6A 4M6BA 4J8XB 3B6GD 3AFAC 4YM6B 5FUGB 5GT3B 4DRBA 5CPKC 3LJAA 5AVBC 3LZ1B 1P3OA 5BS7A 1S32A 1KX4A 1N1JB 2IO5C 3W98D 3X1VD 3MGSC 4LD9C 5AV6D 2CV5C 4H9OB 3WAAA 2FJ7A 3W98B 4G91C 5B33B 4H9RA 3O62D 3TU4C 1BH9B 5AV6B 2HUEB 3MGRA 5CPIC 1M18D 1TAFB 3AZJB 1P3IA 3B6FD 3WKJD 3B6GC 1P3PD 3MGPA 1P3KD 3W99D 3A6NA 2AROC 1M19A 1M18B 3MNNA 2NZDB 3UT9A 5GT0B 1R4VA 3AZLD 3B6FB 4H9QB 4Z5TB 3WKJB 1P3KB 1P3MD 1EQZB 3LZ0A 3X1VC 5B1MA 4G92C 3REJA 1P34A 1ID3D 1JFIB 1P3MB 3O62C 1AOID 1P3FB 1ID3B 5BNXB 3W96A 2PYOC 1P3PC 4Z66A 3W99C 4H9PA 5CP6B 1AOIB 4J8WA 1ZLAA 4CSRB 5F99A 1KX5D 3REIA 4J8UA 3AZLC 5B2JD 2NQBD 1KX4B 3REKA 5CPJD 2HIOA 5JRGC 5B32D 4QLCA 3RELC 3MVDC 3AZNA 3AV2D 1HQ3A 5B32B 4HGAC 4E45A 3MGRB 4XUJA 1P3IB 4Z2MH 5AV9D 5AVBA 3C1CA 1KX5C 3AYWD 5B2JC 2NQBC 3MNNB 1KX3D 5B0ZD 5CPJC 5B2IC 3LZ0B 1HTAA 4WU8D 4J8XA 3AZID 1P34B 4NE6A 4YM6A 5GT3A 1P3FA 3REHC 4WU8B 3AV1C 3AV2C 4H9SC 5B32G 3AZIB 3KWQD 4EO5B 4ZUXD 1P3LC 5AV9C 5GXQC 4H9OA 5B0YD 4KUDC 3VH5A 3KSYA 3AYWC 3W98A 5B33A 4ZUXB 3X1VA 3REIB 1BH9A 4J8UB 5AV6A 1KX3C 5B0YB 1B67A 5B0ZC 1TAFA 3KUYD 3KXBD 3O62A 3REKB 4ZBJC 1M18A 3KUYB 4QLCB 3AFAD 3AZNB 3B6FA 3WKJA 1P3PA 3KWQC 5CPKD 1P3KA 4KHAA 3W99A 3AFAB 2YFWB 3AZLA 3MGSD 5CPKB 4LD9D 1P3MA 5AVBB 2CV5D 2IO5B 4JJND 3TU4D 3AZMC 1ID3A 3MGSB 4LD9B 3KXBC 1BH8A 2CV5B 1P3GD 5JA4B 3X1SC 1AOIA 5CPID 4G91B 3LELD 4CSRA 3WTPE 3TU4B 3MGQC 2AROD 4WV4B 5CPIB
chains in the Genus database with same CATH superfamily
3B6GB 1KX5A 2AROB 4H9NB 5B2JA 3VH5T 5B24C 2NQBA 5DNNC 2UWXA 3WTPC 2Y2HA 4J8VD 5B40D 3H0LC 4JJNC 5CPJA 3X1VB 3UTAD 3AZKC 4AWLC 5B32A 1P3GC 4G92B 3W97D 2Y2JA 3LELC 4YS3C 1M1AD 3O62B 5C3IC 2PYOD 4NE5A 3AV2A 3C1BC 1WWSA 1F66D 5AY8D 5AV9A 2PYOB 1P3PB 1PZRA 3IP4C 4KHAB 3W99B 3AYWA 1TZYD 3AZLB 1KX3A 1H3OA 4NE3A 4J8VC 5JRGD 3UTBD 5B40C 4WU8A 4E44A 3RELD 3UTAC 5CHLB 3MVDD 5GSUD 3AZIA 3W97C 3AZED 3LZ1C 1U35C 5JRGB 3EPLA 1BH8B 1M1AC 1Z2CB 3RELB 3MVDB 1F66C 2F8ND 5AY8C 5B31C 4ZUXA 4R8PC 5B0YA 4HGAB 4WJ3C 4KGCC 5E5AD 5AV8C 2FFFB 1TZYC 2F8NB 1KX5B 5B2ID 4WU9C 5B2JB 3UTBC 2NQBB 3KUYA 3AL0C 5GSUC 2Y2GA 4X23C 2JSSA 3REHD 5B2IB 3AZEC 2Y2LA 3AV1D 5CPJB 1Q9CA 2NZDC 2J8PA 5AVCD 2YFVA 2YFWA 3AFAA 1P3LD 5CPKA 3REHB 3AV1B 5GXQD 3AV2B 4KUDD 4WZSB 3B0DC 5AV5D 5E5AC 2Y2NA 5B1LD 3MGSA 5AV9B 1P3LB 2F8NG 3X1UC 4LD9A 5GXQB 2CV5A 4KUDB 5JA4A 3AN2C 3AZGC 3AYWB 4JJNA 3TU4A 3X1TC 2BYMB 1KX3B 1H3OB 1P3GA 5B0ZB 5CPIA 3LELA 5AVCC 3B6GA 3LJAC 1F1EA 2AROA 1P3OC 4H9NA 5BS7C 4ZBJB 1S32C 1P3BD 5BT1C 3KWQB 4DRAA 5AV5C 5B1LC 3WAAC 2FJ7C 2F8NH 3P5JB 3B0CT 3AZMD 3AZFD 5B40A 3R45B 3VH5W 3UTAA 3X1SD 4XZQD 1P3AD 3W96D 3W97A 3AZMB 3MGPC 3MGQD 3KXBB 3A6NC 2RVQD 1M1AA 2PYOA 2RIQA 1M19C 3X1SB 3UT9C 1P3BC 5AY8A 2BYKB 3MGQB 2YFVB 5B1MC 5B24D 5DNND 3WTPD 3REJC 1TZYA 3WA9D 5JRGA 3UTBA 3AZFC 3AZKD 5B24B 5DNNB 3NQUB 4NFTA 3RELA 3WTPB 3MVDA 4XZQC 3W96C 1P3AC 4YS3D 4JJNB 3AZEA 4Z66C 5KDMA 3AZKB 2RVQC 5DNMD 4J8WC 3C1BD 4AWLB 1P3GB 1ZLAC 5F99C 3AZHD 5BO0B 3LELB 2F8NK 4YS3B 5C3IB 2F8NA 3VH6T 2DQNC 1A7WA 3C1BB 5E5AA 3H0RC 2HIOC 2LY8A 3WA9C 1KU5A 5B2IA 2ZY2A 3LZ1D 4J8VB 1U35D 1HQ3C 5B40B 3REHA 3AV1A 3UTAB 5DNMC 4XUJC 4H9SA 5AVCA 3W97B 3C1CC 3AZHC 1U35B 5B31D 1P3LA 2ZY5A 1M1AB 3V9RA 5GXQA 5B33D 4R8PD 4KUDA 4KGCD 2JE5A 1F66B 5AV8D 5AV5A 5B31B 5B1LA 5AY8B 2BYMA 4WU9D 3AZJD 4R8PB 4J8XC 5B0ZA 4KGCB 2F2AC 5AV8B 4YM6C 1TZYB 5GT3C 1P3FC 4X23D 5G49B 4WU9B 2NZDD 3UTBB 5GT0D 4Z5TD 4UUZA 1EQZD 5GSUB 4WNNA 3KWQA 4X23B 3AZEB 5KDMB 3W98C 1P3BA 5B33C 5AV6C 2HUEC 3R45A 3X1UD 5B31G 3AN2D 3AZGD 3AZJC 3B0DB 3AZMA 3X1TD 5E5AB 3AZFA 5CP6D 3KXBA 3X1UB 3NQJA 3AN2B 3X1SA 3AZGB 1M18C 4XZQA 1P3AA 2G5IC 3B0CW 5GT0C 3B6FC 2XD1A 3WKJC 4Z5TC 3X1TB 1P3KC 2BYKA 3MGQA 3LJAD 4Z2MG 2L5AA 1EQZC 1P3OD 1S32D 1KX4D 5BT1D 5AVCB 1P3MC 3LJAB 2ZY4A 1BFMA 1P3OB 5BNVA 3WAAD 1S32B 2FJ7D 5B24A 5DNNA 3NQUA 3V9RB 3WTPA 1ID3C 2Y2PA 3WA9A 3F6TA 5AV5B 5B1LB 5CP6C 3MGRD 4DQYB 3AZKA 1AOIC 2FJ7B 3WAAB 1P3ID 4H9RB 3MGPD 5BO0A 3A6ND 4YS3A 1M19D 5DNMA 3MNND 3C1BA 3UT9D 3VH6A 1KX4C 3AZHA 3MGPB 4UUZB 2ZY3A 3LZ0D 3A6NB 5B1MD 4WNNB 1M19B 3B0BA 3UT9B 4CAYA 3REJD 1P34D 1P3BB 2VQRA 5B1MB 3VH6W 4J8VA 5B32C 3MGRC 3REJB 5FUGA 1WWIA 1P3IC 4Z66D 3LZ1A 1U35A 3AZFB 1N1JA 3NQJB 4J8WD 1ZLAD 2ZM5A 5F99D 3MNNC 4XZQB 1P3AB 3REID 1F66A 4J8UD 3W96B 4Z66B 5B31A 4H9PB 3LZ0C 4J8WB 1ZLAB 4R8PA 5F99B 1T3UA 4KGCA 3REKD 5AV8A 1P34C 2HIOD 3EG5B 3EPHA 4WU8C 5G49A 4WU9A 4QLCD 3AZJA 5BNVB 3AZND 1ULYA 3AZIC 4EO5C 2HIOB 5GSUA 3EPKA 3WA9B 1HQ3D 4X23A 2BG1A 2NZDA 5GT0A 4H9QA 4Z5TA 4XUJD 4UPKA 1EQZA 5AVBD 3C1CD 4ZUXC 3REIC 1B6WA 1HQ3B 4J8UC 5B0YC 1JFIA 5DNMB 4XUJB 3C1CB 3AZHB 3REKC 3X1UA 4J8XD 3AN2A 3AZGA 5BNXA 4QLCC 3KUYC 4CAYB 3AZNC 4YM6D 5GT3D 3X1TA 2CWEA 1P3FD 5CP6A 4M6BA 4J8XB 3B6GD 3AFAC 3A1KA 4YM6B 5FUGB 2DF4C 5GT3B 4DRBA 5CPKC 3LJAA 5AVBC 3LZ1B 1P3OA 5BS7A 1S32A 1KX4A 1N1JB 2IO5C 3W98D 3X1VD 3MGSC 2W8SA 4LD9C 5AV6D 2CV5C 4H9OB 3WAAA 2FJ7A 3W98B 4G91C 3FDDA 5B33B 4H9RA 3O62D 3TU4C 1BH9B 5AV6B 2HUEB 3MGRA 5CPIC 1M18D 1TAFB 3AZJB 1P3IA 3B6FD 3WKJD 3B6GC 1P3PD 3MGPA 1P3KD 3W99D 3A6NA 2AROC 1M19A 1M18B 3MNNA 1W2EA 2NZDB 3UT9A 5GT0B 1R4VA 3AZLD 3B6FB 4H9QB 4Z5TB 3WKJB 1P3KB 1P3MD 1EQZB 3LZ0A 3X1VC 5B1MA 3EPJA 4G92C 2Y2IA 3REJA 1P34A 1ID3D 1JFIB 1P3MB 3O62C 1AOID 1P3FB 2XD5A 1ID3B 5BNXB 3W96A 2PYOC 1P3PC 4Z66A 3W99C 4H9PA 5CP6B 1AOIB 4J8WA 1ZLAA 4CSRB 5F99A 1KX5D 3REIA 4J8UA 3AZLC 5B2JD 3A1IA 2NQBD 1KX4B 3REKA 5CPJD 2HIOA 5JRGC 3KFUG 5B32D 4QLCA 3RELC 3MVDC 3AZNA 3AV2D 2Y2OA 1HQ3A 5B32B 4HGAC 4E45A 3MGRB 4XUJA 1P3IB 4Z2MH 5AV9D 5AVBA 3C1CA 1KX5C 3AYWD 5B2JC 2NQBC 3MNNB 1KX3D 2Y2KA 5B0ZD 5CPJC 5B2IC 3LZ0B 1HTAA 4WU8D 4J8XA 3AZID 1P34B 4NE6A 4YM6A 5GT3A 1P3FA 3REHC 4WU8B 3AV1C 3AV2C 4H9SC 5B32G 3AZIB 2G5HC 3KWQD 4EO5B 4ZUXD 1P3LC 5AV9C 5GXQC 5B0YD 4H9OA 4KUDC 3VH5A 3KSYA 3AYWC 3W98A 2JCHA 5B33A 4ZUXB 3X1VA 3REIB 1BH9A 4J8UB 5AV6A 1KX3C 5B0YB 1B67A 5B0ZC 2Y2QA 1TAFA 3KUYD 2Y2MA 3KXBD 3O62A 3REKB 3H0MC 4ZBJC 1M18A 3KUYB 4QLCB 3AFAD 3AZNB 3B6FA 3WKJA 1P3PA 3KWQC 5CPKD 1P3KA 4KHAA 3W99A 3AFAB 2YFWB 3AZLA 3MGSD 5CPKB 4LD9D 1P3MA 5AVBB 2CV5D 2IO5B 4JJND 3TU4D 3AZMC 1ID3A 3MGSB 4LD9B 3KXBC 1BH8A 2CV5B 1P3GD 5JA4B 3X1SC 1AOIA 5CPID 4G91B 3LELD 4CSRA 3WTPE 3TU4B 3MGQC 2AROD 4WV4B 5CPIB
chains in the Genus database with same CATH topology
3B6GB 1KX5A 2AROB 4H9NB 5B2JA 3VH5T 5B24C 2NQBA 5DNNC 2UWXA 3WTPC 2Y2HA 4J8VD 5B40D 3H0LC 4JJNC 5CPJA 3X1VB 3UTAD 3AZKC 4AWLC 5B32A 1P3GC 4G92B 3W97D 2Y2JA 3LELC 4YS3C 1M1AD 3O62B 5C3IC 2PYOD 4NE5A 3AV2A 3C1BC 1WWSA 1F66D 5AY8D 5AV9A 2PYOB 1P3PB 1PZRA 3IP4C 4KHAB 3W99B 3AYWA 1TZYD 3AZLB 1KX3A 1H3OA 4NE3A 4J8VC 5JRGD 3UTBD 5B40C 4WU8A 4E44A 3RELD 3UTAC 5CHLB 3MVDD 5GSUD 3AZIA 3W97C 3AZED 3LZ1C 1U35C 5JRGB 3EPLA 1BH8B 1M1AC 1Z2CB 3RELB 3MVDB 1F66C 2F8ND 5AY8C 5B31C 4ZUXA 4R8PC 5B0YA 4HGAB 4WJ3C 4KGCC 5E5AD 5AV8C 2FFFB 1TZYC 2F8NB 1KX5B 5B2ID 4WU9C 5B2JB 3UTBC 2NQBB 3KUYA 3AL0C 5GSUC 2Y2GA 4X23C 2JSSA 3REHD 5B2IB 3AZEC 2Y2LA 3AV1D 5CPJB 1Q9CA 2NZDC 2J8PA 5AVCD 2YFVA 2YFWA 3AFAA 1P3LD 5CPKA 3REHB 3AV1B 5GXQD 3AV2B 4KUDD 4WZSB 3B0DC 5AV5D 5E5AC 2Y2NA 5B1LD 3MGSA 5AV9B 1P3LB 2F8NG 3X1UC 4LD9A 5GXQB 2CV5A 4KUDB 5JA4A 3AN2C 3AZGC 3AYWB 4JJNA 3TU4A 3X1TC 2BYMB 1KX3B 1H3OB 1P3GA 5B0ZB 5CPIA 3LELA 5AVCC 3B6GA 3LJAC 1F1EA 2AROA 1P3OC 4H9NA 5BS7C 4ZBJB 1S32C 1P3BD 5BT1C 3KWQB 4DRAA 5AV5C 5B1LC 3WAAC 2FJ7C 2F8NH 3P5JB 3B0CT 3AZMD 3AZFD 5B40A 3R45B 3VH5W 3UTAA 3X1SD 4XZQD 1P3AD 3W96D 3W97A 3AZMB 3MGPC 3MGQD 3KXBB 3A6NC 2RVQD 1M1AA 2PYOA 2RIQA 1M19C 3X1SB 3UT9C 1P3BC 5AY8A 2BYKB 3MGQB 2YFVB 5B1MC 5B24D 5DNND 3WTPD 3REJC 1TZYA 3WA9D 5JRGA 3UTBA 3AZFC 3AZKD 5B24B 5DNNB 3NQUB 4NFTA 3RELA 3WTPB 3MVDA 4XZQC 3W96C 1P3AC 4YS3D 4JJNB 3AZEA 4Z66C 5KDMA 3AZKB 2RVQC 5DNMD 4J8WC 3C1BD 4AWLB 1P3GB 1ZLAC 5F99C 3AZHD 5BO0B 3LELB 2F8NK 4YS3B 5C3IB 2F8NA 3VH6T 2DQNC 1A7WA 3C1BB 5E5AA 3H0RC 2HIOC 2LY8A 3WA9C 1KU5A 5B2IA 2ZY2A 3LZ1D 4J8VB 1U35D 1HQ3C 5B40B 3REHA 3AV1A 3UTAB 5DNMC 4XUJC 4H9SA 5AVCA 3W97B 3C1CC 3AZHC 1U35B 5B31D 1P3LA 2ZY5A 1M1AB 3V9RA 5GXQA 5B33D 4R8PD 4KUDA 4KGCD 2JE5A 1F66B 5AV8D 5AV5A 5B31B 5B1LA 5AY8B 2BYMA 4WU9D 3AZJD 4R8PB 4J8XC 5B0ZA 4KGCB 2F2AC 5AV8B 4YM6C 1TZYB 5GT3C 1P3FC 4X23D 5G49B 4WU9B 2NZDD 3UTBB 5GT0D 4Z5TD 4UUZA 1EQZD 5GSUB 4WNNA 3KWQA 4X23B 3AZEB 5KDMB 3W98C 1P3BA 5B33C 5AV6C 2HUEC 3R45A 3X1UD 5B31G 3AN2D 3AZGD 3AZJC 3B0DB 3AZMA 3X1TD 5E5AB 3AZFA 5CP6D 3KXBA 3X1UB 3NQJA 3AN2B 3X1SA 3AZGB 1M18C 4XZQA 1P3AA 2G5IC 3B0CW 5GT0C 3B6FC 2XD1A 3WKJC 4Z5TC 3X1TB 1P3KC 2BYKA 3MGQA 3LJAD 4Z2MG 2L5AA 1EQZC 1P3OD 1S32D 1KX4D 5BT1D 5AVCB 1P3MC 3LJAB 2ZY4A 1BFMA 1P3OB 5BNVA 3WAAD 1S32B 2FJ7D 5B24A 5DNNA 3NQUA 3V9RB 3WTPA 1ID3C 2Y2PA 3WA9A 3F6TA 5AV5B 5B1LB 5CP6C 3MGRD 4DQYB 3AZKA 1AOIC 2FJ7B 3WAAB 1P3ID 4H9RB 3MGPD 5BO0A 3A6ND 4YS3A 1M19D 5DNMA 3MNND 3C1BA 3UT9D 3VH6A 1KX4C 3AZHA 3MGPB 4UUZB 2ZY3A 3LZ0D 3A6NB 5B1MD 4WNNB 1M19B 3B0BA 3UT9B 4CAYA 3REJD 1P34D 1P3BB 2VQRA 5B1MB 3VH6W 4J8VA 5B32C 3MGRC 3REJB 5FUGA 1WWIA 1P3IC 4Z66D 3LZ1A 1U35A 3AZFB 1N1JA 3NQJB 4J8WD 1ZLAD 2ZM5A 5F99D 3MNNC 4XZQB 1P3AB 3REID 1F66A 4J8UD 3W96B 4Z66B 5B31A 4H9PB 3LZ0C 4J8WB 1ZLAB 4R8PA 5F99B 1T3UA 4KGCA 3REKD 5AV8A 1P34C 2HIOD 3EG5B 3EPHA 4WU8C 5G49A 4WU9A 4QLCD 3AZJA 5BNVB 3AZND 1ULYA 3AZIC 4EO5C 2HIOB 5GSUA 3EPKA 3WA9B 1HQ3D 4X23A 2BG1A 2NZDA 5GT0A 4H9QA 4Z5TA 4XUJD 4UPKA 1EQZA 5AVBD 3C1CD 4ZUXC 3REIC 1B6WA 1HQ3B 4J8UC 5B0YC 1JFIA 5DNMB 4XUJB 3C1CB 3AZHB 3REKC 3X1UA 4J8XD 3AN2A 3AZGA 5BNXA 4QLCC 3KUYC 4CAYB 3AZNC 4YM6D 5GT3D 3X1TA 2CWEA 1P3FD 5CP6A 4M6BA 4J8XB 3B6GD 3AFAC 3A1KA 4YM6B 5FUGB 2DF4C 5GT3B 4DRBA 5CPKC 3LJAA 5AVBC 3LZ1B 1P3OA 5BS7A 1S32A 1KX4A 1N1JB 2IO5C 3W98D 3X1VD 3MGSC 2W8SA 4LD9C 5AV6D 2CV5C 4H9OB 3WAAA 2FJ7A 3W98B 4G91C 3FDDA 5B33B 4H9RA 3O62D 3TU4C 1BH9B 5AV6B 2HUEB 3MGRA 5CPIC 1M18D 1TAFB 3AZJB 1P3IA 3B6FD 3WKJD 3B6GC 1P3PD 3MGPA 1P3KD 3W99D 3A6NA 2AROC 1M19A 1M18B 3MNNA 1W2EA 2NZDB 3UT9A 5GT0B 1R4VA 3AZLD 3B6FB 4H9QB 4Z5TB 3WKJB 1P3KB 1P3MD 1EQZB 3LZ0A 3X1VC 5B1MA 3EPJA 4G92C 2Y2IA 3REJA 1P34A 1ID3D 1JFIB 1P3MB 3O62C 1AOID 1P3FB 2XD5A 1ID3B 5BNXB 3W96A 2PYOC 1P3PC 4Z66A 3W99C 4H9PA 5CP6B 1AOIB 4J8WA 1ZLAA 4CSRB 5F99A 1KX5D 3REIA 4J8UA 3AZLC 5B2JD 3A1IA 2NQBD 1KX4B 3REKA 5CPJD 2HIOA 5JRGC 3KFUG 5B32D 4QLCA 3RELC 3MVDC 3AZNA 3AV2D 2Y2OA 1HQ3A 5B32B 4HGAC 4E45A 3MGRB 4XUJA 1P3IB 4Z2MH 5AV9D 5AVBA 3C1CA 1KX5C 3AYWD 5B2JC 2NQBC 3MNNB 1KX3D 2Y2KA 5B0ZD 5CPJC 5B2IC 3LZ0B 1HTAA 4WU8D 4J8XA 3AZID 1P34B 4NE6A 4YM6A 5GT3A 1P3FA 3REHC 4WU8B 3AV1C 3AV2C 4H9SC 5B32G 3AZIB 2G5HC 3KWQD 4EO5B 4ZUXD 1P3LC 5AV9C 5GXQC 5B0YD 4H9OA 4KUDC 3VH5A 3KSYA 3AYWC 3W98A 2JCHA 5B33A 4ZUXB 3X1VA 3REIB 1BH9A 4J8UB 5AV6A 1KX3C 5B0YB 1B67A 5B0ZC 2Y2QA 1TAFA 3KUYD 2Y2MA 3KXBD 3O62A 3REKB 3H0MC 4ZBJC 1M18A 3KUYB 4QLCB 3AFAD 3AZNB 3B6FA 3WKJA 1P3PA 3KWQC 5CPKD 1P3KA 4KHAA 3W99A 3AFAB 2YFWB 3AZLA 3MGSD 5CPKB 4LD9D 1P3MA 5AVBB 2CV5D 2IO5B 4JJND 3TU4D 3AZMC 1ID3A 3MGSB 4LD9B 3KXBC 1BH8A 2CV5B 1P3GD 5JA4B 3X1SC 1AOIA 5CPID 4G91B 3LELD 4CSRA 3WTPE 3TU4B 3MGQC 2AROD 4WV4B 5CPIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G B;  1KX5 A;  2ARO B;  4H9N B;  5B2J A;  3VH5 T;  5B24 C;  2NQB A;  5DNN C;  3WTP C;  4J8V D;  5B40 D;  4JJN C;  5CPJ A;  3X1V B;  3UTA D;  3AZK C;  4AWL C;  5B32 A;  1P3G C;  4G92 B;  3W97 D;  3LEL C;  4YS3 C;  1M1A D;  3O62 B;  5C3I C;  2PYO D;  4NE5 A;  3AV2 A;  3C1B C;  1WWS A;  1F66 D;  5AY8 D;  5AV9 A;  2PYO B;  1P3P B;  4KHA B;  3W99 B;  3AYW A;  1TZY D;  3AZL B;  1KX3 A;  1H3O A;  4NE3 A;  4J8V C;  5JRG D;  3UTB D;  5B40 C;  4WU8 A;  4E44 A;  3REL D;  3UTA C;  5CHL B;  3MVD D;  5GSU D;  3AZI A;  3W97 C;  3AZE D;  3LZ1 C;  1U35 C;  5JRG B;  1BH8 B;  1M1A C;  3REL B;  3MVD B;  1F66 C;  2F8N D;  5AY8 C;  5B31 C;  4ZUX A;  4R8P C;  5B0Y A;  4HGA B;  4KGC C;  5E5A D;  5AV8 C;  1TZY C;  2F8N B;  1KX5 B;  5B2I D;  4WU9 C;  5B2J B;  3UTB C;  2NQB B;  3KUY A;  5GSU C;  4X23 C;  2JSS A;  3REH D;  5B2I B;  3AZE C;  3AV1 D;  5CPJ B;  2NZD C;  1Q9C A;  5AVC D;  2YFV A;  2YFW A;  3AFA A;  1P3L D;  5CPK A;  3REH B;  3AV1 B;  5GXQ D;  3AV2 B;  4KUD D;  4WZS B;  3B0D C;  5AV5 D;  5E5A C;  5B1L D;  3MGS A;  1P3L B;  5AV9 B;  4LD9 A;  2F8N G;  3X1U C;  5GXQ B;  2CV5 A;  4KUD B;  5JA4 A;  3AN2 C;  3AZG C;  3AYW B;  4JJN A;  3TU4 A;  3X1T C;  2BYM B;  1KX3 B;  1H3O B;  1P3G A;  5B0Z B;  5CPI A;  3LEL A;  5AVC C;  3B6G A;  3LJA C;  1F1E A;  2ARO A;  1P3O C;  4H9N A;  5BS7 C;  4ZBJ B;  1S32 C;  1P3B D;  5BT1 C;  3KWQ B;  4DRA A;  5AV5 C;  5B1L C;  3WAA C;  2FJ7 C;  2F8N H;  3B0C T;  3AZM D;  3AZF D;  5B40 A;  3R45 B;  3VH5 W;  3UTA A;  3X1S D;  4XZQ D;  1P3A D;  3W96 D;  3W97 A;  3AZM B;  3MGP C;  3MGQ D;  3KXB B;  3A6N C;  2RVQ D;  1M1A A;  2PYO A;  1M19 C;  3X1S B;  3UT9 C;  1P3B C;  5AY8 A;  2BYK B;  3MGQ B;  2YFV B;  5B1M C;  5B24 D;  5DNN D;  3WTP D;  3REJ C;  1TZY A;  3WA9 D;  5JRG A;  3UTB A;  3AZF C;  3AZK D;  5B24 B;  5DNN B;  3NQU B;  4NFT A;  3REL A;  3WTP B;  3MVD A;  4XZQ C;  3W96 C;  1P3A C;  4YS3 D;  4JJN B;  3AZE A;  4Z66 C;  5KDM A;  3AZK B;  2RVQ C;  5DNM D;  4J8W C;  3C1B D;  4AWL B;  1P3G B;  1ZLA C;  5F99 C;  3AZH D;  5BO0 B;  3LEL B;  2F8N K;  4YS3 B;  5C3I B;  2F8N A;  3VH6 T;  1A7W A;  3C1B B;  5E5A A;  2HIO C;  2LY8 A;  3WA9 C;  1KU5 A;  5B2I A;  3LZ1 D;  4J8V B;  1U35 D;  1HQ3 C;  5B40 B;  3REH A;  3AV1 A;  3UTA B;  5DNM C;  4XUJ C;  4H9S A;  5AVC A;  3W97 B;  3C1C C;  3AZH C;  1U35 B;  5B31 D;  1P3L A;  1M1A B;  3V9R A;  5GXQ A;  5B33 D;  4R8P D;  4KUD A;  4KGC D;  1F66 B;  5AV8 D;  5AV5 A;  5B31 B;  5B1L A;  5AY8 B;  2BYM A;  4WU9 D;  3AZJ D;  4R8P B;  4J8X C;  5B0Z A;  4KGC B;  5AV8 B;  4YM6 C;  1TZY B;  5GT3 C;  1P3F C;  4X23 D;  5G49 B;  4WU9 B;  2NZD D;  3UTB B;  5GT0 D;  4Z5T D;  4UUZ A;  1EQZ D;  5GSU B;  4WNN A;  3KWQ A;  4X23 B;  3AZE B;  5KDM B;  3W98 C;  1P3B A;  5B33 C;  5AV6 C;  2HUE C;  3R45 A;  3X1U D;  5B31 G;  3AN2 D;  3AZG D;  3AZJ C;  3B0D B;  3AZM A;  3X1T D;  5E5A B;  3AZF A;  5CP6 D;  3KXB A;  3X1U B;  3NQJ A;  3AN2 B;  3X1S A;  3AZG B;  1M18 C;  4XZQ A;  1P3A A;  3B0C W;  5GT0 C;  3B6F C;  3WKJ C;  4Z5T C;  3X1T B;  1P3K C;  2BYK A;  3MGQ A;  3LJA D;  4Z2M G;  2L5A A;  1EQZ C;  1P3O D;  1S32 D;  1KX4 D;  5BT1 D;  5AVC B;  1P3M C;  3LJA B;  1BFM A;  1P3O B;  5BNV A;  3WAA D;  1S32 B;  2FJ7 D;  5B24 A;  5DNN A;  3NQU A;  3V9R B;  3WTP A;  1ID3 C;  3WA9 A;  5AV5 B;  5B1L B;  5CP6 C;  3MGR D;  3AZK A;  1AOI C;  2FJ7 B;  3WAA B;  1P3I D;  4H9R B;  3MGP D;  5BO0 A;  3A6N D;  4YS3 A;  1M19 D;  5DNM A;  3MNN D;  3C1B A;  3UT9 D;  3VH6 A;  1KX4 C;  3AZH A;  3MGP B;  4UUZ B;  3A6N B;  3LZ0 D;  5B1M D;  4WNN B;  1M19 B;  3B0B A;  3UT9 B;  4CAY A;  3REJ D;  1P34 D;  1P3B B;  5B1M B;  3VH6 W;  4J8V A;  5B32 C;  3MGR C;  3REJ B;  5FUG A;  1WWI A;  1P3I C;  4Z66 D;  3LZ1 A;  1U35 A;  3AZF B;  1N1J A;  3NQJ B;  4J8W D;  1ZLA D;  5F99 D;  3MNN C;  4XZQ B;  1P3A B;  3REI D;  1F66 A;  4J8U D;  3W96 B;  4Z66 B;  5B31 A;  4H9P B;  3LZ0 C;  4J8W B;  1ZLA B;  4R8P A;  5F99 B;  4KGC A;  3REK D;  5AV8 A;  1P34 C;  2HIO D;  4WU8 C;  5G49 A;  4WU9 A;  4QLC D;  3AZJ A;  5BNV B;  3AZN D;  1ULY A;  3AZI C;  4EO5 C;  2HIO B;  5GSU A;  3WA9 B;  1HQ3 D;  4X23 A;  2NZD A;  5GT0 A;  4H9Q A;  4Z5T A;  4XUJ D;  1EQZ A;  5AVB D;  3C1C D;  4ZUX C;  3REI C;  1B6W A;  1HQ3 B;  4J8U C;  5B0Y C;  1JFI A;  5DNM B;  4XUJ B;  3C1C B;  3AZH B;  3REK C;  3X1U A;  4J8X D;  3AN2 A;  3AZG A;  5BNX A;  4QLC C;  3KUY C;  4CAY B;  3AZN C;  4YM6 D;  5GT3 D;  3X1T A;  2CWE A;  1P3F D;  5CP6 A;  4M6B A;  4J8X B;  3B6G D;  3AFA C;  4YM6 B;  5FUG B;  5GT3 B;  4DRB A;  5CPK C;  3LJA A;  5AVB C;  3LZ1 B;  1P3O A;  5BS7 A;  1S32 A;  1KX4 A;  1N1J B;  2IO5 C;  3W98 D;  3X1V D;  3MGS C;  4LD9 C;  5AV6 D;  2CV5 C;  4H9O B;  3WAA A;  2FJ7 A;  3W98 B;  4G91 C;  5B33 B;  4H9R A;  3O62 D;  3TU4 C;  1BH9 B;  5AV6 B;  2HUE B;  3MGR A;  5CPI C;  1M18 D;  1TAF B;  3AZJ B;  1P3I A;  3B6F D;  3WKJ D;  3B6G C;  1P3P D;  3MGP A;  1P3K D;  3W99 D;  3A6N A;  2ARO C;  1M19 A;  1M18 B;  3MNN A;  2NZD B;  3UT9 A;  5GT0 B;  1R4V A;  3AZL D;  3B6F B;  4H9Q B;  4Z5T B;  3WKJ B;  1P3K B;  1P3M D;  1EQZ B;  3LZ0 A;  3X1V C;  5B1M A;  4G92 C;  3REJ A;  1P34 A;  1ID3 D;  1JFI B;  1P3M B;  3O62 C;  1AOI D;  1P3F B;  1ID3 B;  5BNX B;  3W96 A;  2PYO C;  1P3P C;  4Z66 A;  3W99 C;  4H9P A;  5CP6 B;  1AOI B;  4J8W A;  1ZLA A;  4CSR B;  5F99 A;  1KX5 D;  3REI A;  4J8U A;  3AZL C;  5B2J D;  2NQB D;  1KX4 B;  3REK A;  5CPJ D;  2HIO A;  5JRG C;  5B32 D;  4QLC A;  3REL C;  3MVD C;  3AZN A;  3AV2 D;  1HQ3 A;  5B32 B;  4HGA C;  4E45 A;  3MGR B;  4XUJ A;  1P3I B;  4Z2M H;  5AV9 D;  5AVB A;  3C1C A;  1KX5 C;  3AYW D;  5B2J C;  2NQB C;  3MNN B;  1KX3 D;  5B0Z D;  5CPJ C;  5B2I C;  3LZ0 B;  1HTA A;  4WU8 D;  4J8X A;  3AZI D;  1P34 B;  4NE6 A;  4YM6 A;  5GT3 A;  1P3F A;  3REH C;  4WU8 B;  3AV1 C;  3AV2 C;  4H9S C;  5B32 G;  3AZI B;  3KWQ D;  4EO5 B;  4ZUX D;  1P3L C;  5AV9 C;  5GXQ C;  4H9O A;  5B0Y D;  4KUD C;  3VH5 A;  3KSY A;  3AYW C;  3W98 A;  5B33 A;  4ZUX B;  3X1V A;  3REI B;  1BH9 A;  4J8U B;  5AV6 A;  1KX3 C;  5B0Y B;  1B67 A;  5B0Z C;  1TAF A;  3KUY D;  3KXB D;  3O62 A;  3REK B;  4ZBJ C;  1M18 A;  3KUY B;  4QLC B;  3AFA D;  3AZN B;  3B6F A;  3WKJ A;  1P3P A;  3KWQ C;  5CPK D;  1P3K A;  4KHA A;  3W99 A;  3AFA B;  2YFW B;  3AZL A;  3MGS D;  5CPK B;  4LD9 D;  1P3M A;  5AVB B;  2CV5 D;  2IO5 B;  4JJN D;  3TU4 D;  3AZM C;  1ID3 A;  3MGS B;  4LD9 B;  3KXB C;  1BH8 A;  2CV5 B;  1P3G D;  5JA4 B;  3X1S C;  1AOI A;  5CPI D;  4G91 B;  3LEL D;  4CSR A;  3WTP E;  3TU4 B;  3MGQ C;  2ARO D;  4WV4 B;  5CPI B; 
#chains in the Genus database with same CATH topology
 3B6G B;  1KX5 A;  2ARO B;  4H9N B;  5B2J A;  3VH5 T;  5B24 C;  2NQB A;  5DNN C;  2UWX A;  3WTP C;  2Y2H A;  4J8V D;  5B40 D;  3H0L C;  4JJN C;  5CPJ A;  3X1V B;  3UTA D;  3AZK C;  4AWL C;  5B32 A;  1P3G C;  4G92 B;  3W97 D;  2Y2J A;  3LEL C;  4YS3 C;  1M1A D;  3O62 B;  5C3I C;  2PYO D;  4NE5 A;  3AV2 A;  3C1B C;  1WWS A;  1F66 D;  5AY8 D;  5AV9 A;  2PYO B;  1P3P B;  1PZR A;  3IP4 C;  4KHA B;  3W99 B;  3AYW A;  1TZY D;  3AZL B;  1KX3 A;  1H3O A;  4NE3 A;  4J8V C;  5JRG D;  3UTB D;  5B40 C;  4WU8 A;  4E44 A;  3REL D;  3UTA C;  5CHL B;  3MVD D;  5GSU D;  3AZI A;  3W97 C;  3AZE D;  3LZ1 C;  1U35 C;  5JRG B;  3EPL A;  1BH8 B;  1M1A C;  1Z2C B;  3REL B;  3MVD B;  1F66 C;  2F8N D;  5AY8 C;  5B31 C;  4ZUX A;  4R8P C;  5B0Y A;  4HGA B;  4WJ3 C;  4KGC C;  5E5A D;  5AV8 C;  2FFF B;  1TZY C;  2F8N B;  1KX5 B;  5B2I D;  4WU9 C;  5B2J B;  3UTB C;  2NQB B;  3KUY A;  3AL0 C;  5GSU C;  2Y2G A;  4X23 C;  2JSS A;  3REH D;  5B2I B;  3AZE C;  2Y2L A;  3AV1 D;  5CPJ B;  1Q9C A;  2NZD C;  2J8P A;  5AVC D;  2YFV A;  2YFW A;  3AFA A;  1P3L D;  5CPK A;  3REH B;  3AV1 B;  5GXQ D;  3AV2 B;  4KUD D;  4WZS B;  3B0D C;  5AV5 D;  5E5A C;  2Y2N A;  5B1L D;  3MGS A;  5AV9 B;  1P3L B;  2F8N G;  3X1U C;  4LD9 A;  5GXQ B;  2CV5 A;  4KUD B;  5JA4 A;  3AN2 C;  3AZG C;  3AYW B;  4JJN A;  3TU4 A;  3X1T C;  2BYM B;  1KX3 B;  1H3O B;  1P3G A;  5B0Z B;  5CPI A;  3LEL A;  5AVC C;  3B6G A;  3LJA C;  1F1E A;  2ARO A;  1P3O C;  4H9N A;  5BS7 C;  4ZBJ B;  1S32 C;  1P3B D;  5BT1 C;  3KWQ B;  4DRA A;  5AV5 C;  5B1L C;  3WAA C;  2FJ7 C;  2F8N H;  3P5J B;  3B0C T;  3AZM D;  3AZF D;  5B40 A;  3R45 B;  3VH5 W;  3UTA A;  3X1S D;  4XZQ D;  1P3A D;  3W96 D;  3W97 A;  3AZM B;  3MGP C;  3MGQ D;  3KXB B;  3A6N C;  2RVQ D;  1M1A A;  2PYO A;  2RIQ A;  1M19 C;  3X1S B;  3UT9 C;  1P3B C;  5AY8 A;  2BYK B;  3MGQ B;  2YFV B;  5B1M C;  5B24 D;  5DNN D;  3WTP D;  3REJ C;  1TZY A;  3WA9 D;  5JRG A;  3UTB A;  3AZF C;  3AZK D;  5B24 B;  5DNN B;  3NQU B;  4NFT A;  3REL A;  3WTP B;  3MVD A;  4XZQ C;  3W96 C;  1P3A C;  4YS3 D;  4JJN B;  3AZE A;  4Z66 C;  5KDM A;  3AZK B;  2RVQ C;  5DNM D;  4J8W C;  3C1B D;  4AWL B;  1P3G B;  1ZLA C;  5F99 C;  3AZH D;  5BO0 B;  3LEL B;  2F8N K;  4YS3 B;  5C3I B;  2F8N A;  3VH6 T;  2DQN C;  1A7W A;  3C1B B;  5E5A A;  3H0R C;  2HIO C;  2LY8 A;  3WA9 C;  1KU5 A;  5B2I A;  2ZY2 A;  3LZ1 D;  4J8V B;  1U35 D;  1HQ3 C;  5B40 B;  3REH A;  3AV1 A;  3UTA B;  5DNM C;  4XUJ C;  4H9S A;  5AVC A;  3W97 B;  3C1C C;  3AZH C;  1U35 B;  5B31 D;  1P3L A;  2ZY5 A;  1M1A B;  3V9R A;  5GXQ A;  5B33 D;  4R8P D;  4KUD A;  4KGC D;  2JE5 A;  1F66 B;  5AV8 D;  5AV5 A;  5B31 B;  5B1L A;  5AY8 B;  2BYM A;  4WU9 D;  3AZJ D;  4R8P B;  4J8X C;  5B0Z A;  4KGC B;  2F2A C;  5AV8 B;  4YM6 C;  1TZY B;  5GT3 C;  1P3F C;  4X23 D;  5G49 B;  4WU9 B;  2NZD D;  3UTB B;  5GT0 D;  4Z5T D;  4UUZ A;  1EQZ D;  5GSU B;  4WNN A;  3KWQ A;  4X23 B;  3AZE B;  5KDM B;  3W98 C;  1P3B A;  5B33 C;  5AV6 C;  2HUE C;  3R45 A;  3X1U D;  5B31 G;  3AN2 D;  3AZG D;  3AZJ C;  3B0D B;  3AZM A;  3X1T D;  5E5A B;  3AZF A;  5CP6 D;  3KXB A;  3X1U B;  3NQJ A;  3AN2 B;  3X1S A;  3AZG B;  1M18 C;  4XZQ A;  1P3A A;  2G5I C;  3B0C W;  5GT0 C;  3B6F C;  2XD1 A;  3WKJ C;  4Z5T C;  3X1T B;  1P3K C;  2BYK A;  3MGQ A;  3LJA D;  4Z2M G;  2L5A A;  1EQZ C;  1P3O D;  1S32 D;  1KX4 D;  5BT1 D;  5AVC B;  1P3M C;  3LJA B;  2ZY4 A;  1BFM A;  1P3O B;  5BNV A;  3WAA D;  1S32 B;  2FJ7 D;  5B24 A;  5DNN A;  3NQU A;  3V9R B;  3WTP A;  1ID3 C;  2Y2P A;  3WA9 A;  3F6T A;  5AV5 B;  5B1L B;  5CP6 C;  3MGR D;  4DQY B;  3AZK A;  1AOI C;  2FJ7 B;  3WAA B;  1P3I D;  4H9R B;  3MGP D;  5BO0 A;  3A6N D;  4YS3 A;  1M19 D;  5DNM A;  3MNN D;  3C1B A;  3UT9 D;  3VH6 A;  1KX4 C;  3AZH A;  3MGP B;  4UUZ B;  2ZY3 A;  3LZ0 D;  3A6N B;  5B1M D;  4WNN B;  1M19 B;  3B0B A;  3UT9 B;  4CAY A;  3REJ D;  1P34 D;  1P3B B;  2VQR A;  5B1M B;  3VH6 W;  4J8V A;  5B32 C;  3MGR C;  3REJ B;  5FUG A;  1WWI A;  1P3I C;  4Z66 D;  3LZ1 A;  1U35 A;  3AZF B;  1N1J A;  3NQJ B;  4J8W D;  1ZLA D;  2ZM5 A;  5F99 D;  3MNN C;  4XZQ B;  1P3A B;  3REI D;  1F66 A;  4J8U D;  3W96 B;  4Z66 B;  5B31 A;  4H9P B;  3LZ0 C;  4J8W B;  1ZLA B;  4R8P A;  5F99 B;  1T3U A;  4KGC A;  3REK D;  5AV8 A;  1P34 C;  2HIO D;  3EG5 B;  3EPH A;  4WU8 C;  5G49 A;  4WU9 A;  4QLC D;  3AZJ A;  5BNV B;  3AZN D;  1ULY A;  3AZI C;  4EO5 C;  2HIO B;  5GSU A;  3EPK A;  3WA9 B;  1HQ3 D;  4X23 A;  2BG1 A;  2NZD A;  5GT0 A;  4H9Q A;  4Z5T A;  4XUJ D;  4UPK A;  1EQZ A;  5AVB D;  3C1C D;  4ZUX C;  3REI C;  1B6W A;  1HQ3 B;  4J8U C;  5B0Y C;  1JFI A;  5DNM B;  4XUJ B;  3C1C B;  3AZH B;  3REK C;  3X1U A;  4J8X D;  3AN2 A;  3AZG A;  5BNX A;  4QLC C;  3KUY C;  4CAY B;  3AZN C;  4YM6 D;  5GT3 D;  3X1T A;  2CWE A;  1P3F D;  5CP6 A;  4M6B A;  4J8X B;  3B6G D;  3AFA C;  3A1K A;  4YM6 B;  5FUG B;  2DF4 C;  5GT3 B;  4DRB A;  5CPK C;  3LJA A;  5AVB C;  3LZ1 B;  1P3O A;  5BS7 A;  1S32 A;  1KX4 A;  1N1J B;  2IO5 C;  3W98 D;  3X1V D;  3MGS C;  2W8S A;  4LD9 C;  5AV6 D;  2CV5 C;  4H9O B;  3WAA A;  2FJ7 A;  3W98 B;  4G91 C;  3FDD A;  5B33 B;  4H9R A;  3O62 D;  3TU4 C;  1BH9 B;  5AV6 B;  2HUE B;  3MGR A;  5CPI C;  1M18 D;  1TAF B;  3AZJ B;  1P3I A;  3B6F D;  3WKJ D;  3B6G C;  1P3P D;  3MGP A;  1P3K D;  3W99 D;  3A6N A;  2ARO C;  1M19 A;  1M18 B;  3MNN A;  1W2E A;  2NZD B;  3UT9 A;  5GT0 B;  1R4V A;  3AZL D;  3B6F B;  4H9Q B;  4Z5T B;  3WKJ B;  1P3K B;  1P3M D;  1EQZ B;  3LZ0 A;  3X1V C;  5B1M A;  3EPJ A;  4G92 C;  2Y2I A;  3REJ A;  1P34 A;  1ID3 D;  1JFI B;  1P3M B;  3O62 C;  1AOI D;  1P3F B;  2XD5 A;  1ID3 B;  5BNX B;  3W96 A;  2PYO C;  1P3P C;  4Z66 A;  3W99 C;  4H9P A;  5CP6 B;  1AOI B;  4J8W A;  1ZLA A;  4CSR B;  5F99 A;  1KX5 D;  3REI A;  4J8U A;  3AZL C;  5B2J D;  3A1I A;  2NQB D;  1KX4 B;  3REK A;  5CPJ D;  2HIO A;  5JRG C;  3KFU G;  5B32 D;  4QLC A;  3REL C;  3MVD C;  3AZN A;  3AV2 D;  2Y2O A;  1HQ3 A;  5B32 B;  4HGA C;  4E45 A;  3MGR B;  4XUJ A;  1P3I B;  4Z2M H;  5AV9 D;  5AVB A;  3C1C A;  1KX5 C;  3AYW D;  5B2J C;  2NQB C;  3MNN B;  1KX3 D;  2Y2K A;  5B0Z D;  5CPJ C;  5B2I C;  3LZ0 B;  1HTA A;  4WU8 D;  4J8X A;  3AZI D;  1P34 B;  4NE6 A;  4YM6 A;  5GT3 A;  1P3F A;  3REH C;  4WU8 B;  3AV1 C;  3AV2 C;  4H9S C;  5B32 G;  3AZI B;  2G5H C;  3KWQ D;  4EO5 B;  4ZUX D;  1P3L C;  5AV9 C;  5GXQ C;  5B0Y D;  4H9O A;  4KUD C;  3VH5 A;  3KSY A;  3AYW C;  3W98 A;  2JCH A;  5B33 A;  4ZUX B;  3X1V A;  3REI B;  1BH9 A;  4J8U B;  5AV6 A;  1KX3 C;  5B0Y B;  1B67 A;  5B0Z C;  2Y2Q A;  1TAF A;  3KUY D;  2Y2M A;  3KXB D;  3O62 A;  3REK B;  3H0M C;  4ZBJ C;  1M18 A;  3KUY B;  4QLC B;  3AFA D;  3AZN B;  3B6F A;  3WKJ A;  1P3P A;  3KWQ C;  5CPK D;  1P3K A;  4KHA A;  3W99 A;  3AFA B;  2YFW B;  3AZL A;  3MGS D;  5CPK B;  4LD9 D;  1P3M A;  5AVB B;  2CV5 D;  2IO5 B;  4JJN D;  3TU4 D;  3AZM C;  1ID3 A;  3MGS B;  4LD9 B;  3KXB C;  1BH8 A;  2CV5 B;  1P3G D;  5JA4 B;  3X1S C;  1AOI A;  5CPI D;  4G91 B;  3LEL D;  4CSR A;  3WTP E;  3TU4 B;  3MGQ C;  2ARO D;  4WV4 B;  5CPI B; 
#chains in the Genus database with same CATH homology
 3B6G B;  1KX5 A;  2ARO B;  4H9N B;  5B2J A;  3VH5 T;  5B24 C;  2NQB A;  5DNN C;  2UWX A;  3WTP C;  2Y2H A;  4J8V D;  5B40 D;  3H0L C;  4JJN C;  5CPJ A;  3X1V B;  3UTA D;  3AZK C;  4AWL C;  5B32 A;  1P3G C;  4G92 B;  3W97 D;  2Y2J A;  3LEL C;  4YS3 C;  1M1A D;  3O62 B;  5C3I C;  2PYO D;  4NE5 A;  3AV2 A;  3C1B C;  1WWS A;  1F66 D;  5AY8 D;  5AV9 A;  2PYO B;  1P3P B;  1PZR A;  3IP4 C;  4KHA B;  3W99 B;  3AYW A;  1TZY D;  3AZL B;  1KX3 A;  1H3O A;  4NE3 A;  4J8V C;  5JRG D;  3UTB D;  5B40 C;  4WU8 A;  4E44 A;  3REL D;  3UTA C;  5CHL B;  3MVD D;  5GSU D;  3AZI A;  3W97 C;  3AZE D;  3LZ1 C;  1U35 C;  5JRG B;  3EPL A;  1BH8 B;  1M1A C;  1Z2C B;  3REL B;  3MVD B;  1F66 C;  2F8N D;  5AY8 C;  5B31 C;  4ZUX A;  4R8P C;  5B0Y A;  4HGA B;  4WJ3 C;  4KGC C;  5E5A D;  5AV8 C;  2FFF B;  1TZY C;  2F8N B;  1KX5 B;  5B2I D;  4WU9 C;  5B2J B;  3UTB C;  2NQB B;  3KUY A;  3AL0 C;  5GSU C;  2Y2G A;  4X23 C;  2JSS A;  3REH D;  5B2I B;  3AZE C;  2Y2L A;  3AV1 D;  5CPJ B;  1Q9C A;  2NZD C;  2J8P A;  5AVC D;  2YFV A;  2YFW A;  3AFA A;  1P3L D;  5CPK A;  3REH B;  3AV1 B;  5GXQ D;  3AV2 B;  4KUD D;  4WZS B;  3B0D C;  5AV5 D;  5E5A C;  2Y2N A;  5B1L D;  3MGS A;  5AV9 B;  1P3L B;  2F8N G;  3X1U C;  4LD9 A;  5GXQ B;  2CV5 A;  4KUD B;  5JA4 A;  3AN2 C;  3AZG C;  3AYW B;  4JJN A;  3TU4 A;  3X1T C;  2BYM B;  1KX3 B;  1H3O B;  1P3G A;  5B0Z B;  5CPI A;  3LEL A;  5AVC C;  3B6G A;  3LJA C;  1F1E A;  2ARO A;  1P3O C;  4H9N A;  5BS7 C;  4ZBJ B;  1S32 C;  1P3B D;  5BT1 C;  3KWQ B;  4DRA A;  5AV5 C;  5B1L C;  3WAA C;  2FJ7 C;  2F8N H;  3P5J B;  3B0C T;  3AZM D;  3AZF D;  5B40 A;  3R45 B;  3VH5 W;  3UTA A;  3X1S D;  4XZQ D;  1P3A D;  3W96 D;  3W97 A;  3AZM B;  3MGP C;  3MGQ D;  3KXB B;  3A6N C;  2RVQ D;  1M1A A;  2PYO A;  2RIQ A;  1M19 C;  3X1S B;  3UT9 C;  1P3B C;  5AY8 A;  2BYK B;  3MGQ B;  2YFV B;  5B1M C;  5B24 D;  5DNN D;  3WTP D;  3REJ C;  1TZY A;  3WA9 D;  5JRG A;  3UTB A;  3AZF C;  3AZK D;  5B24 B;  5DNN B;  3NQU B;  4NFT A;  3REL A;  3WTP B;  3MVD A;  4XZQ C;  3W96 C;  1P3A C;  4YS3 D;  4JJN B;  3AZE A;  4Z66 C;  5KDM A;  3AZK B;  2RVQ C;  5DNM D;  4J8W C;  3C1B D;  4AWL B;  1P3G B;  1ZLA C;  5F99 C;  3AZH D;  5BO0 B;  3LEL B;  2F8N K;  4YS3 B;  5C3I B;  2F8N A;  3VH6 T;  2DQN C;  1A7W A;  3C1B B;  5E5A A;  3H0R C;  2HIO C;  2LY8 A;  3WA9 C;  1KU5 A;  5B2I A;  2ZY2 A;  3LZ1 D;  4J8V B;  1U35 D;  1HQ3 C;  5B40 B;  3REH A;  3AV1 A;  3UTA B;  5DNM C;  4XUJ C;  4H9S A;  5AVC A;  3W97 B;  3C1C C;  3AZH C;  1U35 B;  5B31 D;  1P3L A;  2ZY5 A;  1M1A B;  3V9R A;  5GXQ A;  5B33 D;  4R8P D;  4KUD A;  4KGC D;  2JE5 A;  1F66 B;  5AV8 D;  5AV5 A;  5B31 B;  5B1L A;  5AY8 B;  2BYM A;  4WU9 D;  3AZJ D;  4R8P B;  4J8X C;  5B0Z A;  4KGC B;  2F2A C;  5AV8 B;  4YM6 C;  1TZY B;  5GT3 C;  1P3F C;  4X23 D;  5G49 B;  4WU9 B;  2NZD D;  3UTB B;  5GT0 D;  4Z5T D;  4UUZ A;  1EQZ D;  5GSU B;  4WNN A;  3KWQ A;  4X23 B;  3AZE B;  5KDM B;  3W98 C;  1P3B A;  5B33 C;  5AV6 C;  2HUE C;  3R45 A;  3X1U D;  5B31 G;  3AN2 D;  3AZG D;  3AZJ C;  3B0D B;  3AZM A;  3X1T D;  5E5A B;  3AZF A;  5CP6 D;  3KXB A;  3X1U B;  3NQJ A;  3AN2 B;  3X1S A;  3AZG B;  1M18 C;  4XZQ A;  1P3A A;  2G5I C;  3B0C W;  5GT0 C;  3B6F C;  2XD1 A;  3WKJ C;  4Z5T C;  3X1T B;  1P3K C;  2BYK A;  3MGQ A;  3LJA D;  4Z2M G;  2L5A A;  1EQZ C;  1P3O D;  1S32 D;  1KX4 D;  5BT1 D;  5AVC B;  1P3M C;  3LJA B;  2ZY4 A;  1BFM A;  1P3O B;  5BNV A;  3WAA D;  1S32 B;  2FJ7 D;  5B24 A;  5DNN A;  3NQU A;  3V9R B;  3WTP A;  1ID3 C;  2Y2P A;  3WA9 A;  3F6T A;  5AV5 B;  5B1L B;  5CP6 C;  3MGR D;  4DQY B;  3AZK A;  1AOI C;  2FJ7 B;  3WAA B;  1P3I D;  4H9R B;  3MGP D;  5BO0 A;  3A6N D;  4YS3 A;  1M19 D;  5DNM A;  3MNN D;  3C1B A;  3UT9 D;  3VH6 A;  1KX4 C;  3AZH A;  3MGP B;  4UUZ B;  2ZY3 A;  3LZ0 D;  3A6N B;  5B1M D;  4WNN B;  1M19 B;  3B0B A;  3UT9 B;  4CAY A;  3REJ D;  1P34 D;  1P3B B;  2VQR A;  5B1M B;  3VH6 W;  4J8V A;  5B32 C;  3MGR C;  3REJ B;  5FUG A;  1WWI A;  1P3I C;  4Z66 D;  3LZ1 A;  1U35 A;  3AZF B;  1N1J A;  3NQJ B;  4J8W D;  1ZLA D;  2ZM5 A;  5F99 D;  3MNN C;  4XZQ B;  1P3A B;  3REI D;  1F66 A;  4J8U D;  3W96 B;  4Z66 B;  5B31 A;  4H9P B;  3LZ0 C;  4J8W B;  1ZLA B;  4R8P A;  5F99 B;  1T3U A;  4KGC A;  3REK D;  5AV8 A;  1P34 C;  2HIO D;  3EG5 B;  3EPH A;  4WU8 C;  5G49 A;  4WU9 A;  4QLC D;  3AZJ A;  5BNV B;  3AZN D;  1ULY A;  3AZI C;  4EO5 C;  2HIO B;  5GSU A;  3EPK A;  3WA9 B;  1HQ3 D;  4X23 A;  2BG1 A;  2NZD A;  5GT0 A;  4H9Q A;  4Z5T A;  4XUJ D;  4UPK A;  1EQZ A;  5AVB D;  3C1C D;  4ZUX C;  3REI C;  1B6W A;  1HQ3 B;  4J8U C;  5B0Y C;  1JFI A;  5DNM B;  4XUJ B;  3C1C B;  3AZH B;  3REK C;  3X1U A;  4J8X D;  3AN2 A;  3AZG A;  5BNX A;  4QLC C;  3KUY C;  4CAY B;  3AZN C;  4YM6 D;  5GT3 D;  3X1T A;  2CWE A;  1P3F D;  5CP6 A;  4M6B A;  4J8X B;  3B6G D;  3AFA C;  3A1K A;  4YM6 B;  5FUG B;  2DF4 C;  5GT3 B;  4DRB A;  5CPK C;  3LJA A;  5AVB C;  3LZ1 B;  1P3O A;  5BS7 A;  1S32 A;  1KX4 A;  1N1J B;  2IO5 C;  3W98 D;  3X1V D;  3MGS C;  2W8S A;  4LD9 C;  5AV6 D;  2CV5 C;  4H9O B;  3WAA A;  2FJ7 A;  3W98 B;  4G91 C;  3FDD A;  5B33 B;  4H9R A;  3O62 D;  3TU4 C;  1BH9 B;  5AV6 B;  2HUE B;  3MGR A;  5CPI C;  1M18 D;  1TAF B;  3AZJ B;  1P3I A;  3B6F D;  3WKJ D;  3B6G C;  1P3P D;  3MGP A;  1P3K D;  3W99 D;  3A6N A;  2ARO C;  1M19 A;  1M18 B;  3MNN A;  1W2E A;  2NZD B;  3UT9 A;  5GT0 B;  1R4V A;  3AZL D;  3B6F B;  4H9Q B;  4Z5T B;  3WKJ B;  1P3K B;  1P3M D;  1EQZ B;  3LZ0 A;  3X1V C;  5B1M A;  3EPJ A;  4G92 C;  2Y2I A;  3REJ A;  1P34 A;  1ID3 D;  1JFI B;  1P3M B;  3O62 C;  1AOI D;  1P3F B;  2XD5 A;  1ID3 B;  5BNX B;  3W96 A;  2PYO C;  1P3P C;  4Z66 A;  3W99 C;  4H9P A;  5CP6 B;  1AOI B;  4J8W A;  1ZLA A;  4CSR B;  5F99 A;  1KX5 D;  3REI A;  4J8U A;  3AZL C;  5B2J D;  3A1I A;  2NQB D;  1KX4 B;  3REK A;  5CPJ D;  2HIO A;  5JRG C;  3KFU G;  5B32 D;  4QLC A;  3REL C;  3MVD C;  3AZN A;  3AV2 D;  2Y2O A;  1HQ3 A;  5B32 B;  4HGA C;  4E45 A;  3MGR B;  4XUJ A;  1P3I B;  4Z2M H;  5AV9 D;  5AVB A;  3C1C A;  1KX5 C;  3AYW D;  5B2J C;  2NQB C;  3MNN B;  1KX3 D;  2Y2K A;  5B0Z D;  5CPJ C;  5B2I C;  3LZ0 B;  1HTA A;  4WU8 D;  4J8X A;  3AZI D;  1P34 B;  4NE6 A;  4YM6 A;  5GT3 A;  1P3F A;  3REH C;  4WU8 B;  3AV1 C;  3AV2 C;  4H9S C;  5B32 G;  3AZI B;  2G5H C;  3KWQ D;  4EO5 B;  4ZUX D;  1P3L C;  5AV9 C;  5GXQ C;  5B0Y D;  4H9O A;  4KUD C;  3VH5 A;  3KSY A;  3AYW C;  3W98 A;  2JCH A;  5B33 A;  4ZUX B;  3X1V A;  3REI B;  1BH9 A;  4J8U B;  5AV6 A;  1KX3 C;  5B0Y B;  1B67 A;  5B0Z C;  2Y2Q A;  1TAF A;  3KUY D;  2Y2M A;  3KXB D;  3O62 A;  3REK B;  3H0M C;  4ZBJ C;  1M18 A;  3KUY B;  4QLC B;  3AFA D;  3AZN B;  3B6F A;  3WKJ A;  1P3P A;  3KWQ C;  5CPK D;  1P3K A;  4KHA A;  3W99 A;  3AFA B;  2YFW B;  3AZL A;  3MGS D;  5CPK B;  4LD9 D;  1P3M A;  5AVB B;  2CV5 D;  2IO5 B;  4JJN D;  3TU4 D;  3AZM C;  1ID3 A;  3MGS B;  4LD9 B;  3KXB C;  1BH8 A;  2CV5 B;  1P3G D;  5JA4 B;  3X1S C;  1AOI A;  5CPI D;  4G91 B;  3LEL D;  4CSR A;  3WTP E;  3TU4 B;  3MGQ C;  2ARO D;  4WV4 B;  5CPI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...