3B0CT

Crystal structure of the chicken cenp-t histone fold/cenp-w complex, crystal form i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
SSLIKQIFSHYVKTPVTRDAYKIVEKCSERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Centromere protein T
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold.
pubmed doi rcsb
source organism Gallus gallus
total genus 29
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b0cT00
1A7WA 5DNNB 4Z5TD 3C1CC 5B0YB 1F66A 4J8WB 5B40D 3C1BC 3R45A 3REKA 4ZUXD 1WWSA 3UT9B 5B33B 5B31G 3UTBD 1P3AD 5GT3C 5B24A 3KWQB 3AZEC 3AZHA 5E5AC 4J8VB 3AV1D 1KX4A 4J8UB 1P3AB 4CAYA 1P34B 5B1LB 5AV8D 3W98C 3AZMD 2PYOB 1P3OC 5AY8C 3B0CW 5BO0A 3TU4B 3X1VA 1P3IB 4KGCA 5CPKC 2NQBD 4EO5C 1N1JB 4X23C 1S32C 1P3PC 2NQBB 1P3LD 5AV9D 1Q9CA 4UUZA 1KX3B 5FUGA 3LZ1C 1M1AD 1TAFB 1P3GA 5B2IA 3AZJD 5BNVA 4KHAB 3MVDB 1M1AB 5GT0B 4DRBA 4HGAC 4WU8A 3LJAD 5AVBD 4E45A 3MGSD 2AROD 3AZFA 5CPID 2BYKB 4JJNC 3W97A 3MGQB 5GSUD 1KX5C 5JA4A 1EQZD 4WU9A 1M18B 1ZLAB 1AOIA 1P3MA 2F8NG 3WTPD 5F99B 3NQJA 3AFAB 1EQZB 3O62D 1ULYA 1M19A 3A6NA 5B0ZD 3W99B 5CPJD 2HIOD 5BNXB 4DRAA 5DNNC 3AYWA 1U35A 3X1TD 3UTAD 5CPJB 5B0YA 2CV5C 5B0YC 4Z5TC 4J8WA 3KXBB 3C1BB 3AZKD 3UT9C 2L5AA 5B33A 5KDMB 5B33C 4R8PD 1TZYB 5GT3B 5B1MD 3KWQC 5BS7A 4J8VA 3B0CT 3AZEB 4J8VC 3REHB 1P3KD 4J8UC 4R8PB 1P3AC 1P34A 5B1LA 3AN2B 3AZND 5G49B 3B6FA 2PYOC 3MGPD 3TU4A 3TU4C 1P3IC 3MGRD 3AZIA 3REKD 1N1JA 3MGPB 4YS3A 1BFMA 1S32B 4YM6D 5B24D 3AZGA 3AZLA 2NQBC 4WV4B 5GXQB 2BYMB 1KX3C 3X1UD 4XUJA 3KUYB 3LZ0A 1P3LC 5B2JB 1TAFA 3X1VD 5B31A 3X1SD 3MVDA 3MVDC 1M1AC 5GT0A 3B6GB 4H9QB 3REJB 4KUDB 4WNNA 1ID3A 2FJ7D 3LJAC 2NZDA 2BYKA 3B0DB 3MGQC 5AVCD 3MGSC 1P3GD 5B2ID 1M18A 1ZLAA 5AV5D 5CPIC 1ZLAC 5AVCB 5F99A 3AFAA 3W96A 1EQZC 5JRGA 1P3BA 4LD9B 3W99C 4WU8D 4XZQA 1JFIA 3WTPC 3C1CA 3O62C 2RVQD 4J8XB 5B0ZC 2CV5B 5CPJC 3WAAD 3W97D 4Z5TB 3C1BA 2HUEC 3KXBC 1AOID 1P3MD 5GT3A 1TZYC 5B40B 3AZEA 5E5AA 3AZKC 4ZUXB 3A6ND 3REHC 3MNND 4ZBJB 1HQ3D 1BH9A 3UTBB 4R8PC 5B1MC 5CP6D 3AYWD 5G49A 3AN2C 1U35D 3W98A 1P3OA 5AY8A 3AV1B 3WA9D 2YFWA 3VH5A 3VH6W 5AV8B 3AZNC 2F8NA 5CPKA 3AZMB 3MGPC 4X23A 1S32A 1P3PA 4H9OB 2BYMA 5GXQC 4YM6C 3KUYA 2LY8A 3KUYC 3REID 3LZ1A 3AV2D 1P3LB 5B2JC 3B0BA 5AV9B 3AZID 4YS3D 3B6GC 4H9QA 5B32D 3REJC 3AZJB 4Z66D 4QLCD 5AV6D 4KUDC 3X1SC 3AZGD 3AZLD 5B32B 4Z2MH 3V9RB 4Z66B 4QLCB 1P3FD 3LJAB 4XUJD 5AVBB 4JJNA 5DNMD 3B0DC 3LZ0D 2YFVB 1KX5A 3MGSB 2AROB 5B31D 4AWLB 5CPIB 5GSUB 5AVCC 3LELD 4LD9C 5AV5C 3WKJD 5DNNA 3WTPB 3O62B 2CV5A 5B0ZB 4J8XC 2NZDD 2HIOB 3RELD 4Z5TA 1R4VA 2HUEB 3X1TB 3UTAB 3UT9A 4M6BA 3WAAC 4H9PB 3KWQA 5B40C 3W96D 3AZKB 4ZUXC 1P3BD 4WZSB 4J8UA 4ZBJC 3VH6T 4XZQD 1P3AA 5CHLB 3UTBC 5B1MB 2PYOA 1P3KB 3MNNC 3AV1C 1P3IA 1HQ3C 1F66D 5CP6C 5AV8C 3AZNB 3AZMC 3WA9C 1F66B 4H9OA 3MGRB 2NQBA 5E5AD 3REKB 3AZHD 1KX4D 1KX3A 4YM6B 5B24B 3W98D 1P3LA 3WTPE 3AZHB 1P3OD 5AY8D 2IO5B 5AV9C 3X1UB 4KHAA 4CAYB 2F8ND 4KGCD 5CPKD 3AV2C 1M1AA 5BO0B 3X1VB 3AZJC 1P3PD 3X1SB 5B32C 3LJAA 4Z66C 4QLCC 5AVBA 5AV6C 5AVBC 3MGQA 4H9RB 3LZ1D 3MGSA 2AROC 4H9SC 4UUZB 1P3FC 2FJ7B 4G92B 4AWLC 5CPIA 5DNMC 5GSUC 5FUGB 1EQZA 1P3GB 5B2IB 5BNVB 3W99A 5AV5B 5BNXA 3WTPA 2F8NH 3LELC 3O62A 4NFTA 5B0ZA 3AZFD 4WU8B 5CPJA 4G91C 2HIOC 4JJND 3WKJC 3KXBA 3NQUB 3X1TC 3UTAA 3UTAC 4WU9D 3RELC 3WAAB 5KDMA 3W97B 1H3OB 1TZYA 3AZKA 5JA4B 3REHA 1M19D 4WU9B 4R8PA 1P3MB 1AOIB 5B1MA 3AN2A 3NQJB 1M19B 1P3KA 3A6NB 5B32G 1P3KC 3MNNB 5B0YD 1F1EA 1HQ3B 3AZNA 5CP6B 4J8WD 5C3IB 3AYWB 1U35B 3MGPA 3UT9D 5B33D 3WA9B 4CSRB 3MGRA 1F66C 3MGRC 3KWQD 4J8VD 3REKC 4J8UD 5GXQA 4YM6A 1P34D 5B1LD 5B24C 3AZHC 2PYOD 5B2JA 3B6FD 3TU4D 1P3ID 1KX4C 3X1UA 2IO5C 3X1UC 3REIB 3AV2B 3B6FB 3B6GA 3REJA 3X1VC 4KUDA 4KGCC 3X1SA 3AZIB 4YS3B 1KX3D 5AV6B 3AZGB 4H9RA 3AZLB 2FJ7A 1P3FB 2FJ7C 4XUJB 4G92C 3LZ0B 5DNMB 5AVCA 3MVDD 5GT0D 1P3GC 5B2IC 4LD9A 5AV5A 5B31B 3LELB 4J8XA 1ID3D 4WU8C 4G91B 3WKJB 3MGQD 3NQUA 3AZFC 2RVQC 4WNNB 1ID3B 2NZDB 1M18D 1ZLAD 3WAAA 3RELB 1H3OA 5BT1D 3W97C 5F99D 5B40A 3AFAD 4H9NB 4ZUXA 1BH8B 5JRGD 3W99D 4WU9C 3UTBA 1AOIC 1P3MC 3W96B 3C1CD 5JRGB 1M19C 1P3BB 2CWEA 3MNNA 3A6NC 1HQ3A 3AV1A 4XZQB 1JFIB 5CP6A 5AV8A 3AYWC 3KXBD 3C1BD 4E44A 3VH5W 5C3IC 3C1CB 3AZMA 1U35C 1WWIA 3WA9A 4CSRA 1TZYD 5GT3D 4J8WC 3AZED 3R45B 3REHD 3KSYA 1B6WA 3AN2D 4NE3A 5E5AB 5BS7C 1KX4B 5AV9A 1BH9B 1P34C 5B1LC 3W98B 3REIA 3AV2A 3REIC 1P3OB 5AY8B 3B6FC 4X23D 3AZJA 3VH6A 1S32D 4KGCB 2YFWB 2F8NB 4NE6A 3AZIC 1HTAA 5CPKB 2JSSA 4EO5B 4NE5A 4YS3C 5B32A 4X23B 3V9RA 5GXQD 4Z66A 4QLCA 5AV6A 1P3PB 3KUYD 3AZGC 2YFVA 3AZLC 5B2JD 2AROA 4H9SA 1P3FA 4XUJC 5DNMA 3LZ0C 5GSUA 3LZ1B 1B67A 3B6GD 3REJD 1KU5A 4KUDD 5B31C 3LELA 5GT0C 4HGAB 4Z2MG 2HIOA 3WKJA 1KX5D 3X1TA 2F8NK 3AZFB 1ID3C 2NZDC 3RELA 4JJNB 4H9PA 1KX5B 4H9NA 1BH8A 4LD9D 1M18C 5BT1C 3VH5T 5DNND 5F99C 3AFAC 3W96C 5JRGC 4J8XD 1P3BC 2CV5D 4XZQC
chains in the Genus database with same CATH superfamily
1A7WA 5DNNB 4Z5TD 2W8SA 3C1CC 5B0YB 1F66A 4J8WB 5B40D 3C1BC 3R45A 3REKA 4ZUXD 1WWSA 3UT9B 5B33B 5B31G 3UTBD 1P3AD 5GT3C 5B24A 3KWQB 3AZEC 3AZHA 5E5AC 4J8VB 2RIQA 3AV1D 1KX4A 4J8UB 1P3AB 4CAYA 1P34B 5B1LB 5AV8D 3W98C 3EPHA 3AZMD 2PYOB 1P3OC 5AY8C 3B0CW 5BO0A 3TU4B 3X1VA 1P3IB 4KGCA 5CPKC 2NQBD 4EO5C 1N1JB 4X23C 1S32C 1P3PC 4DQYB 2NQBB 1P3LD 5AV9D 1Q9CA 4UUZA 1KX3B 3EPKA 5FUGA 3LZ1C 1M1AD 1TAFB 1P3GA 5B2IA 3AZJD 5BNVA 4KHAB 3MVDB 1M1AB 5GT0B 2Y2KA 4DRBA 4HGAC 4WU8A 3LJAD 5AVBD 4E45A 3MGSD 2AROD 3AZFA 5CPID 2BYKB 4JJNC 3H0MC 3W97A 5GSUD 3MGQB 1KX5C 5JA4A 1EQZD 4WU9A 1M18B 1ZLAB 1AOIA 1P3MA 2F8NG 3WTPD 5F99B 3NQJA 3AFAB 1EQZB 3O62D 1ULYA 1M19A 3A6NA 5B0ZD 3W99B 5CPJD 2HIOD 5BNXB 4DRAA 5DNNC 3AYWA 1U35A 3X1TD 3UTAD 5CPJB 5B0YA 2Y2MA 2CV5C 5B0YC 4Z5TC 4J8WA 3KXBB 3C1BB 3AZKD 3UT9C 2L5AA 5B33A 5KDMB 5B33C 4R8PD 1TZYB 5GT3B 5B1MD 3KWQC 5BS7A 4J8VA 3B0CT 3AZEB 4J8VC 3REHB 1P3KD 4J8UC 4R8PB 1P3AC 1P34A 5B1LA 3AN2B 3AZND 5G49B 3B6FA 2PYOC 3MGPD 3TU4A 2Y2NA 3TU4C 1P3IC 2Y2HA 3MGRD 3AZIA 3REKD 1N1JA 3MGPB 4YS3A 1BFMA 1S32B 4YM6D 5B24D 3AZGA 3AZLA 2NQBC 4WV4B 5GXQB 2BYMB 1KX3C 3X1UD 4XUJA 3KUYB 3LZ0A 1P3LC 5B2JB 1TAFA 2F2AC 3X1VD 5B31A 3X1SD 3MVDA 3MVDC 1M1AC 3IP4C 5GT0A 3B6GB 4H9QB 3REJB 4KUDB 3EG5B 3A1IA 4WNNA 1ID3A 2FJ7D 3LJAC 2NZDA 2BYKA 3B0DB 3MGQC 5AVCD 3MGSC 1P3GD 5B2ID 1M18A 1ZLAA 5AV5D 5CPIC 1ZLAC 5AVCB 5F99A 3AFAA 3F6TA 3W96A 1EQZC 5JRGA 1P3BA 4LD9B 2Y2GA 3W99C 4WU8D 1Z2CB 4XZQA 1JFIA 3WTPC 3C1CA 3O62C 2RVQD 4J8XB 5B0ZC 2CV5B 5CPJC 3WAAD 3W97D 4Z5TB 3C1BA 2HUEC 3KXBC 1AOID 1P3MD 5GT3A 2XD1A 1TZYC 3FDDA 5B40B 3AZEA 5E5AA 3AZKC 4ZUXB 3A6ND 3REHC 3MNND 4ZBJB 1HQ3D 1W2EA 1BH9A 3UTBB 4R8PC 5B1MC 5CP6D 3AYWD 5G49A 3AN2C 1U35D 3W98A 1P3OA 5AY8A 3AV1B 3WA9D 2YFWA 3VH5A 3VH6W 5AV8B 3AZNC 2F8NA 2UWXA 5CPKA 3AZMB 3MGPC 4X23A 1S32A 1P3PA 4H9OB 2BYMA 5GXQC 4YM6C 3KUYA 2LY8A 3KUYC 3REID 3LZ1A 3AV2D 1P3LB 5B2JC 3B0BA 5AV9B 3AZID 4YS3D 1PZRA 3B6GC 4H9QA 5B32D 3REJC 3AZJB 2J8PA 4QLCD 5AV6D 4Z66D 3X1SC 4KUDC 3AZGD 3AZLD 5B32B 4Z2MH 3V9RB 4Z66B 4QLCB 1P3FD 3LJAB 4XUJD 2Y2JA 5AVBB 4JJNA 5DNMD 3B0DC 3LZ0D 2YFVB 1KX5A 3MGSB 2XD5A 2AROB 2JCHA 2ZM5A 5B31D 4AWLB 5CPIB 5GSUB 5AVCC 3LELD 4LD9C 5AV5C 3WKJD 5DNNA 3WTPB 3O62B 2CV5A 5B0ZB 4J8XC 2NZDD 2HIOB 3RELD 4Z5TA 1R4VA 2HUEB 3X1TB 3UTAB 3UT9A 3AL0C 4M6BA 3WAAC 4H9PB 3KWQA 5B40C 3W96D 3AZKB 4ZUXC 1P3BD 4WJ3C 4WZSB 4J8UA 4ZBJC 3VH6T 4XZQD 1P3AA 3EPJA 5CHLB 3UTBC 2Y2LA 5B1MB 2PYOA 1P3KB 3MNNC 3AV1C 1P3IA 1HQ3C 1F66D 5CP6C 5AV8C 3AZNB 3AZMC 3WA9C 1F66B 4H9OA 3MGRB 2NQBA 5E5AD 3REKB 3AZHD 2ZY4A 1KX4D 1KX3A 4YM6B 5B24B 3W98D 1P3LA 3WTPE 3AZHB 1P3OD 5AY8D 2IO5B 5AV9C 3X1UB 4KHAA 4CAYB 2F8ND 4KGCD 5CPKD 3AV2C 1M1AA 5BO0B 3X1VB 3AZJC 1P3PD 3X1SB 2ZY2A 5B32C 3LJAA 4Z66C 2FFFB 4QLCC 5AVBA 5AV6C 5AVBC 3MGQA 4H9RB 3LZ1D 3MGSA 2JE5A 2AROC 4H9SC 4UUZB 1P3FC 2FJ7B 4G92B 4AWLC 5CPIA 5DNMC 5GSUC 5FUGB 1EQZA 1P3GB 5B2IB 5BNVB 3W99A 5AV5B 2VQRA 5BNXA 3WTPA 3EPLA 2F8NH 3LELC 3O62A 4NFTA 5B0ZA 3AZFD 4WU8B 5CPJA 4G91C 2HIOC 2Y2IA 4JJND 3WKJC 3KXBA 3NQUB 3X1TC 3UTAA 2Y2QA 3UTAC 4WU9D 3RELC 3WAAB 5KDMA 3W97B 1H3OB 1TZYA 3AZKA 5JA4B 3REHA 1M19D 4WU9B 4R8PA 1P3MB 1AOIB 5B1MA 3AN2A 3NQJB 1M19B 1P3KA 3A6NB 5B32G 1P3KC 3MNNB 5B0YD 1F1EA 1HQ3B 3AZNA 5CP6B 4J8WD 5C3IB 3AYWB 1U35B 3MGPA 3UT9D 5B33D 3WA9B 4CSRB 3MGRA 1F66C 3MGRC 3KWQD 3KFUG 2BG1A 4J8VD 3REKC 4J8UD 5GXQA 4YM6A 1P34D 5B1LD 5B24C 3AZHC 2PYOD 3H0RC 5B2JA 3B6FD 3TU4D 1P3ID 1KX4C 3X1UA 2IO5C 3X1UC 3REIB 3AV2B 3B6FB 3B6GA 3REJA 3X1VC 4KUDA 4KGCC 3X1SA 3AZIB 4YS3B 3A1KA 1KX3D 2G5HC 2ZY5A 5AV6B 3AZGB 4H9RA 3AZLB 2FJ7A 1P3FB 2FJ7C 2G5IC 4XUJB 4G92C 3LZ0B 5DNMB 5AVCA 3MVDD 5GT0D 1P3GC 1T3UA 5B2IC 4LD9A 5AV5A 5B31B 3LELB 4J8XA 1ID3D 4WU8C 4G91B 3WKJB 3MGQD 2Y2OA 3NQUA 2Y2PA 3AZFC 2RVQC 4WNNB 1ID3B 2NZDB 1M18D 1ZLAD 3WAAA 3RELB 1H3OA 5BT1D 3W97C 5F99D 5B40A 3AFAD 4H9NB 4ZUXA 1BH8B 5JRGD 3H0LC 3W99D 4WU9C 3UTBA 1AOIC 1P3MC 2DQNC 3W96B 3C1CD 5JRGB 1M19C 1P3BB 2CWEA 3MNNA 3A6NC 1HQ3A 3AV1A 4XZQB 1JFIB 5CP6A 5AV8A 3AYWC 3KXBD 3C1BD 4E44A 3VH5W 5C3IC 3C1CB 3AZMA 1U35C 1WWIA 3WA9A 4CSRA 1TZYD 5GT3D 4J8WC 3AZED 3R45B 3REHD 3KSYA 1B6WA 3AN2D 4NE3A 5E5AB 5BS7C 1KX4B 5AV9A 1BH9B 1P34C 5B1LC 3W98B 3REIA 3AV2A 3REIC 1P3OB 5AY8B 3B6FC 4X23D 3AZJA 3VH6A 1S32D 4KGCB 2YFWB 2F8NB 4NE6A 3AZIC 1HTAA 5CPKB 2JSSA 4EO5B 4NE5A 4YS3C 5B32A 4X23B 3V9RA 5GXQD 4Z66A 4QLCA 5AV6A 3P5JB 1P3PB 3KUYD 3AZGC 2YFVA 3AZLC 5B2JD 2AROA 4H9SA 1P3FA 4XUJC 5DNMA 3LZ0C 5GSUA 3LZ1B 1B67A 3B6GD 3REJD 1KU5A 4KUDD 5B31C 2ZY3A 3LELA 5GT0C 4HGAB 4Z2MG 2HIOA 3WKJA 2DF4C 1KX5D 3X1TA 2F8NK 3AZFB 1ID3C 2NZDC 3RELA 4JJNB 4H9PA 1KX5B 4H9NA 1BH8A 4LD9D 1M18C 5BT1C 3VH5T 5DNND 5F99C 3AFAC 3W96C 5JRGC 4J8XD 1P3BC 2CV5D 4UPKA 4XZQC
chains in the Genus database with same CATH topology
1A7WA 5DNNB 4Z5TD 2W8SA 3C1CC 5B0YB 1F66A 4J8WB 5B40D 3C1BC 3R45A 3REKA 4ZUXD 1WWSA 3UT9B 5B33B 5B31G 3UTBD 1P3AD 5GT3C 5B24A 3KWQB 3AZEC 3AZHA 5E5AC 4J8VB 2RIQA 3AV1D 1KX4A 4J8UB 1P3AB 4CAYA 1P34B 5B1LB 5AV8D 3W98C 3EPHA 3AZMD 2PYOB 1P3OC 5AY8C 3B0CW 5BO0A 3TU4B 3X1VA 1P3IB 4KGCA 5CPKC 2NQBD 4EO5C 1N1JB 4X23C 1S32C 1P3PC 4DQYB 2NQBB 1P3LD 5AV9D 1Q9CA 4UUZA 1KX3B 3EPKA 5FUGA 3LZ1C 1M1AD 1TAFB 1P3GA 5B2IA 3AZJD 5BNVA 4KHAB 3MVDB 1M1AB 5GT0B 2Y2KA 4DRBA 4HGAC 4WU8A 3LJAD 5AVBD 4E45A 3MGSD 2AROD 3AZFA 5CPID 2BYKB 4JJNC 3H0MC 3W97A 5GSUD 3MGQB 1KX5C 5JA4A 1EQZD 4WU9A 1M18B 1ZLAB 1AOIA 1P3MA 2F8NG 3WTPD 5F99B 3NQJA 3AFAB 1EQZB 3O62D 1ULYA 1M19A 3A6NA 5B0ZD 3W99B 5CPJD 2HIOD 5BNXB 4DRAA 5DNNC 3AYWA 1U35A 3X1TD 3UTAD 5CPJB 5B0YA 2Y2MA 2CV5C 5B0YC 4Z5TC 4J8WA 3KXBB 3C1BB 3AZKD 3UT9C 2L5AA 5B33A 5KDMB 5B33C 4R8PD 1TZYB 5GT3B 5B1MD 3KWQC 5BS7A 4J8VA 3B0CT 3AZEB 4J8VC 3REHB 1P3KD 4J8UC 4R8PB 1P3AC 1P34A 5B1LA 3AN2B 3AZND 5G49B 3B6FA 2PYOC 3MGPD 3TU4A 2Y2NA 3TU4C 1P3IC 2Y2HA 3MGRD 3AZIA 3REKD 1N1JA 3MGPB 4YS3A 1BFMA 1S32B 4YM6D 5B24D 3AZGA 3AZLA 2NQBC 4WV4B 5GXQB 2BYMB 1KX3C 3X1UD 4XUJA 3KUYB 3LZ0A 1P3LC 5B2JB 1TAFA 2F2AC 3X1VD 5B31A 3X1SD 3MVDA 3MVDC 1M1AC 3IP4C 5GT0A 3B6GB 4H9QB 3REJB 4KUDB 3EG5B 3A1IA 4WNNA 1ID3A 2FJ7D 3LJAC 2NZDA 2BYKA 3B0DB 3MGQC 5AVCD 3MGSC 1P3GD 5B2ID 1M18A 1ZLAA 5AV5D 5CPIC 1ZLAC 5AVCB 5F99A 3AFAA 3F6TA 3W96A 1EQZC 5JRGA 1P3BA 4LD9B 2Y2GA 3W99C 4WU8D 1Z2CB 4XZQA 1JFIA 3WTPC 3C1CA 3O62C 2RVQD 4J8XB 5B0ZC 2CV5B 5CPJC 3WAAD 3W97D 4Z5TB 3C1BA 2HUEC 3KXBC 1AOID 1P3MD 5GT3A 2XD1A 1TZYC 3FDDA 5B40B 3AZEA 5E5AA 3AZKC 4ZUXB 3A6ND 3REHC 3MNND 4ZBJB 1HQ3D 1W2EA 1BH9A 3UTBB 4R8PC 5B1MC 5CP6D 3AYWD 5G49A 3AN2C 1U35D 3W98A 1P3OA 5AY8A 3AV1B 3WA9D 2YFWA 3VH5A 3VH6W 5AV8B 3AZNC 2F8NA 2UWXA 5CPKA 3AZMB 3MGPC 4X23A 1S32A 1P3PA 4H9OB 2BYMA 5GXQC 4YM6C 3KUYA 2LY8A 3KUYC 3REID 3LZ1A 3AV2D 1P3LB 5B2JC 3B0BA 5AV9B 3AZID 4YS3D 1PZRA 3B6GC 4H9QA 5B32D 3REJC 3AZJB 2J8PA 4QLCD 5AV6D 4Z66D 3X1SC 4KUDC 3AZGD 3AZLD 5B32B 4Z2MH 3V9RB 4Z66B 4QLCB 1P3FD 3LJAB 4XUJD 2Y2JA 5AVBB 4JJNA 5DNMD 3B0DC 3LZ0D 2YFVB 1KX5A 3MGSB 2XD5A 2AROB 2JCHA 2ZM5A 5B31D 4AWLB 5CPIB 5GSUB 5AVCC 3LELD 4LD9C 5AV5C 3WKJD 5DNNA 3WTPB 3O62B 2CV5A 5B0ZB 4J8XC 2NZDD 2HIOB 3RELD 4Z5TA 1R4VA 2HUEB 3X1TB 3UTAB 3UT9A 3AL0C 4M6BA 3WAAC 4H9PB 3KWQA 5B40C 3W96D 3AZKB 4ZUXC 1P3BD 4WJ3C 4WZSB 4J8UA 4ZBJC 3VH6T 4XZQD 1P3AA 3EPJA 5CHLB 3UTBC 2Y2LA 5B1MB 2PYOA 1P3KB 3MNNC 3AV1C 1P3IA 1HQ3C 1F66D 5CP6C 5AV8C 3AZNB 3AZMC 3WA9C 1F66B 4H9OA 3MGRB 2NQBA 5E5AD 3REKB 3AZHD 2ZY4A 1KX4D 1KX3A 4YM6B 5B24B 3W98D 1P3LA 3WTPE 3AZHB 1P3OD 5AY8D 2IO5B 5AV9C 3X1UB 4KHAA 4CAYB 2F8ND 4KGCD 5CPKD 3AV2C 1M1AA 5BO0B 3X1VB 3AZJC 1P3PD 3X1SB 2ZY2A 5B32C 3LJAA 4Z66C 2FFFB 4QLCC 5AVBA 5AV6C 5AVBC 3MGQA 4H9RB 3LZ1D 3MGSA 2JE5A 2AROC 4H9SC 4UUZB 1P3FC 2FJ7B 4G92B 4AWLC 5CPIA 5DNMC 5GSUC 5FUGB 1EQZA 1P3GB 5B2IB 5BNVB 3W99A 5AV5B 2VQRA 5BNXA 3WTPA 3EPLA 2F8NH 3LELC 3O62A 4NFTA 5B0ZA 3AZFD 4WU8B 5CPJA 4G91C 2HIOC 2Y2IA 4JJND 3WKJC 3KXBA 3NQUB 3X1TC 3UTAA 2Y2QA 3UTAC 4WU9D 3RELC 3WAAB 5KDMA 3W97B 1H3OB 1TZYA 3AZKA 5JA4B 3REHA 1M19D 4WU9B 4R8PA 1P3MB 1AOIB 5B1MA 3AN2A 3NQJB 1M19B 1P3KA 3A6NB 5B32G 1P3KC 3MNNB 5B0YD 1F1EA 1HQ3B 3AZNA 5CP6B 4J8WD 5C3IB 3AYWB 1U35B 3MGPA 3UT9D 5B33D 3WA9B 4CSRB 3MGRA 1F66C 3MGRC 3KWQD 3KFUG 2BG1A 4J8VD 3REKC 4J8UD 5GXQA 4YM6A 1P34D 5B1LD 5B24C 3AZHC 2PYOD 3H0RC 5B2JA 3B6FD 3TU4D 1P3ID 1KX4C 3X1UA 2IO5C 3X1UC 3REIB 3AV2B 3B6FB 3B6GA 3REJA 3X1VC 4KUDA 4KGCC 3X1SA 3AZIB 4YS3B 3A1KA 1KX3D 2G5HC 2ZY5A 5AV6B 3AZGB 4H9RA 3AZLB 2FJ7A 1P3FB 2FJ7C 2G5IC 4XUJB 4G92C 3LZ0B 5DNMB 5AVCA 3MVDD 5GT0D 1P3GC 1T3UA 5B2IC 4LD9A 5AV5A 5B31B 3LELB 4J8XA 1ID3D 4WU8C 4G91B 3WKJB 3MGQD 2Y2OA 3NQUA 2Y2PA 3AZFC 2RVQC 4WNNB 1ID3B 2NZDB 1M18D 1ZLAD 3WAAA 3RELB 1H3OA 5BT1D 3W97C 5F99D 5B40A 3AFAD 4H9NB 4ZUXA 1BH8B 5JRGD 3H0LC 3W99D 4WU9C 3UTBA 1AOIC 1P3MC 2DQNC 3W96B 3C1CD 5JRGB 1M19C 1P3BB 2CWEA 3MNNA 3A6NC 1HQ3A 3AV1A 4XZQB 1JFIB 5CP6A 5AV8A 3AYWC 3KXBD 3C1BD 4E44A 3VH5W 5C3IC 3C1CB 3AZMA 1U35C 1WWIA 3WA9A 4CSRA 1TZYD 5GT3D 4J8WC 3AZED 3R45B 3REHD 3KSYA 1B6WA 3AN2D 4NE3A 5E5AB 5BS7C 1KX4B 5AV9A 1BH9B 1P34C 5B1LC 3W98B 3REIA 3AV2A 3REIC 1P3OB 5AY8B 3B6FC 4X23D 3AZJA 3VH6A 1S32D 4KGCB 2YFWB 2F8NB 4NE6A 3AZIC 1HTAA 5CPKB 2JSSA 4EO5B 4NE5A 4YS3C 5B32A 4X23B 3V9RA 5GXQD 4Z66A 4QLCA 5AV6A 3P5JB 1P3PB 3KUYD 3AZGC 2YFVA 3AZLC 5B2JD 2AROA 4H9SA 1P3FA 4XUJC 5DNMA 3LZ0C 5GSUA 3LZ1B 1B67A 3B6GD 3REJD 1KU5A 4KUDD 5B31C 2ZY3A 3LELA 5GT0C 4HGAB 4Z2MG 2HIOA 3WKJA 2DF4C 1KX5D 3X1TA 2F8NK 3AZFB 1ID3C 2NZDC 3RELA 4JJNB 4H9PA 1KX5B 4H9NA 1BH8A 4LD9D 1M18C 5BT1C 3VH5T 5DNND 5F99C 3AFAC 3W96C 5JRGC 4J8XD 1P3BC 2CV5D 4UPKA 4XZQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7W A;  5DNN B;  4Z5T D;  3C1C C;  5B0Y B;  1F66 A;  4J8W B;  5B40 D;  3C1B C;  3R45 A;  3REK A;  4ZUX D;  1WWS A;  3UT9 B;  5B33 B;  5B31 G;  3UTB D;  1P3A D;  5GT3 C;  5B24 A;  3KWQ B;  3AZE C;  3AZH A;  5E5A C;  4J8V B;  3AV1 D;  1KX4 A;  4J8U B;  1P3A B;  4CAY A;  1P34 B;  5B1L B;  5AV8 D;  3W98 C;  3AZM D;  2PYO B;  1P3O C;  5AY8 C;  3B0C W;  5BO0 A;  3TU4 B;  3X1V A;  1P3I B;  4KGC A;  5CPK C;  2NQB D;  4EO5 C;  1N1J B;  4X23 C;  1S32 C;  1P3P C;  2NQB B;  1P3L D;  5AV9 D;  1Q9C A;  4UUZ A;  1KX3 B;  5FUG A;  3LZ1 C;  1M1A D;  1TAF B;  1P3G A;  5B2I A;  3AZJ D;  5BNV A;  4KHA B;  3MVD B;  1M1A B;  5GT0 B;  4DRB A;  4HGA C;  4WU8 A;  3LJA D;  5AVB D;  4E45 A;  3MGS D;  2ARO D;  3AZF A;  5CPI D;  2BYK B;  4JJN C;  3W97 A;  3MGQ B;  5GSU D;  1KX5 C;  5JA4 A;  1EQZ D;  4WU9 A;  1M18 B;  1ZLA B;  1AOI A;  1P3M A;  2F8N G;  3WTP D;  5F99 B;  3NQJ A;  3AFA B;  1EQZ B;  3O62 D;  1ULY A;  1M19 A;  3A6N A;  5B0Z D;  3W99 B;  5CPJ D;  2HIO D;  5BNX B;  4DRA A;  5DNN C;  3AYW A;  1U35 A;  3X1T D;  3UTA D;  5CPJ B;  5B0Y A;  2CV5 C;  5B0Y C;  4Z5T C;  4J8W A;  3KXB B;  3C1B B;  3AZK D;  3UT9 C;  2L5A A;  5B33 A;  5KDM B;  5B33 C;  4R8P D;  1TZY B;  5GT3 B;  5B1M D;  3KWQ C;  5BS7 A;  4J8V A;  3B0C T;  3AZE B;  4J8V C;  3REH B;  1P3K D;  4J8U C;  4R8P B;  1P3A C;  1P34 A;  5B1L A;  3AN2 B;  3AZN D;  5G49 B;  3B6F A;  2PYO C;  3MGP D;  3TU4 A;  3TU4 C;  1P3I C;  3MGR D;  3AZI A;  3REK D;  1N1J A;  3MGP B;  4YS3 A;  1BFM A;  1S32 B;  4YM6 D;  5B24 D;  3AZG A;  3AZL A;  2NQB C;  4WV4 B;  5GXQ B;  2BYM B;  1KX3 C;  3X1U D;  4XUJ A;  3KUY B;  3LZ0 A;  1P3L C;  5B2J B;  1TAF A;  3X1V D;  5B31 A;  3X1S D;  3MVD A;  3MVD C;  1M1A C;  5GT0 A;  3B6G B;  4H9Q B;  3REJ B;  4KUD B;  4WNN A;  1ID3 A;  2FJ7 D;  3LJA C;  2NZD A;  2BYK A;  3B0D B;  3MGQ C;  5AVC D;  3MGS C;  1P3G D;  5B2I D;  1M18 A;  1ZLA A;  5AV5 D;  5CPI C;  1ZLA C;  5AVC B;  5F99 A;  3AFA A;  3W96 A;  1EQZ C;  5JRG A;  1P3B A;  4LD9 B;  3W99 C;  4WU8 D;  4XZQ A;  1JFI A;  3WTP C;  3C1C A;  3O62 C;  2RVQ D;  4J8X B;  5B0Z C;  2CV5 B;  5CPJ C;  3WAA D;  3W97 D;  4Z5T B;  3C1B A;  2HUE C;  3KXB C;  1AOI D;  1P3M D;  5GT3 A;  1TZY C;  5B40 B;  3AZE A;  5E5A A;  3AZK C;  4ZUX B;  3A6N D;  3REH C;  3MNN D;  4ZBJ B;  1HQ3 D;  1BH9 A;  3UTB B;  4R8P C;  5B1M C;  5CP6 D;  3AYW D;  5G49 A;  3AN2 C;  1U35 D;  3W98 A;  1P3O A;  5AY8 A;  3AV1 B;  3WA9 D;  2YFW A;  3VH5 A;  3VH6 W;  5AV8 B;  3AZN C;  2F8N A;  5CPK A;  3AZM B;  3MGP C;  4X23 A;  1S32 A;  1P3P A;  4H9O B;  2BYM A;  5GXQ C;  4YM6 C;  3KUY A;  2LY8 A;  3KUY C;  3REI D;  3LZ1 A;  3AV2 D;  1P3L B;  5B2J C;  3B0B A;  5AV9 B;  3AZI D;  4YS3 D;  3B6G C;  4H9Q A;  5B32 D;  3REJ C;  3AZJ B;  4Z66 D;  4QLC D;  5AV6 D;  4KUD C;  3X1S C;  3AZG D;  3AZL D;  5B32 B;  4Z2M H;  3V9R B;  4Z66 B;  4QLC B;  1P3F D;  3LJA B;  4XUJ D;  5AVB B;  4JJN A;  5DNM D;  3B0D C;  3LZ0 D;  2YFV B;  1KX5 A;  3MGS B;  2ARO B;  5B31 D;  4AWL B;  5CPI B;  5GSU B;  5AVC C;  3LEL D;  4LD9 C;  5AV5 C;  3WKJ D;  5DNN A;  3WTP B;  3O62 B;  2CV5 A;  5B0Z B;  4J8X C;  2NZD D;  2HIO B;  3REL D;  4Z5T A;  1R4V A;  2HUE B;  3X1T B;  3UTA B;  3UT9 A;  4M6B A;  3WAA C;  4H9P B;  3KWQ A;  5B40 C;  3W96 D;  3AZK B;  4ZUX C;  1P3B D;  4WZS B;  4J8U A;  4ZBJ C;  3VH6 T;  4XZQ D;  1P3A A;  5CHL B;  3UTB C;  5B1M B;  2PYO A;  1P3K B;  3MNN C;  3AV1 C;  1P3I A;  1HQ3 C;  1F66 D;  5CP6 C;  5AV8 C;  3AZN B;  3AZM C;  3WA9 C;  1F66 B;  4H9O A;  3MGR B;  2NQB A;  5E5A D;  3REK B;  3AZH D;  1KX4 D;  1KX3 A;  4YM6 B;  5B24 B;  3W98 D;  1P3L A;  3WTP E;  3AZH B;  1P3O D;  5AY8 D;  2IO5 B;  5AV9 C;  3X1U B;  4KHA A;  4CAY B;  2F8N D;  4KGC D;  5CPK D;  3AV2 C;  1M1A A;  5BO0 B;  3X1V B;  3AZJ C;  1P3P D;  3X1S B;  5B32 C;  3LJA A;  4Z66 C;  4QLC C;  5AVB A;  5AV6 C;  5AVB C;  3MGQ A;  4H9R B;  3LZ1 D;  3MGS A;  2ARO C;  4H9S C;  4UUZ B;  1P3F C;  2FJ7 B;  4G92 B;  4AWL C;  5CPI A;  5DNM C;  5GSU C;  5FUG B;  1EQZ A;  1P3G B;  5B2I B;  5BNV B;  3W99 A;  5AV5 B;  5BNX A;  3WTP A;  2F8N H;  3LEL C;  3O62 A;  4NFT A;  5B0Z A;  3AZF D;  4WU8 B;  5CPJ A;  4G91 C;  2HIO C;  4JJN D;  3WKJ C;  3KXB A;  3NQU B;  3X1T C;  3UTA A;  3UTA C;  4WU9 D;  3REL C;  3WAA B;  5KDM A;  3W97 B;  1H3O B;  1TZY A;  3AZK A;  5JA4 B;  3REH A;  1M19 D;  4WU9 B;  4R8P A;  1P3M B;  1AOI B;  5B1M A;  3AN2 A;  3NQJ B;  1M19 B;  1P3K A;  3A6N B;  5B32 G;  1P3K C;  3MNN B;  5B0Y D;  1F1E A;  1HQ3 B;  3AZN A;  5CP6 B;  4J8W D;  5C3I B;  3AYW B;  1U35 B;  3MGP A;  3UT9 D;  5B33 D;  3WA9 B;  4CSR B;  3MGR A;  1F66 C;  3MGR C;  3KWQ D;  4J8V D;  3REK C;  4J8U D;  5GXQ A;  4YM6 A;  1P34 D;  5B1L D;  5B24 C;  3AZH C;  2PYO D;  5B2J A;  3B6F D;  3TU4 D;  1P3I D;  1KX4 C;  3X1U A;  2IO5 C;  3X1U C;  3REI B;  3AV2 B;  3B6F B;  3B6G A;  3REJ A;  3X1V C;  4KUD A;  4KGC C;  3X1S A;  3AZI B;  4YS3 B;  1KX3 D;  5AV6 B;  3AZG B;  4H9R A;  3AZL B;  2FJ7 A;  1P3F B;  2FJ7 C;  4XUJ B;  4G92 C;  3LZ0 B;  5DNM B;  5AVC A;  3MVD D;  5GT0 D;  1P3G C;  5B2I C;  4LD9 A;  5AV5 A;  5B31 B;  3LEL B;  4J8X A;  1ID3 D;  4WU8 C;  4G91 B;  3WKJ B;  3MGQ D;  3NQU A;  3AZF C;  2RVQ C;  4WNN B;  1ID3 B;  2NZD B;  1M18 D;  1ZLA D;  3WAA A;  3REL B;  1H3O A;  5BT1 D;  3W97 C;  5F99 D;  5B40 A;  3AFA D;  4H9N B;  4ZUX A;  1BH8 B;  5JRG D;  3W99 D;  4WU9 C;  3UTB A;  1AOI C;  1P3M C;  3W96 B;  3C1C D;  5JRG B;  1M19 C;  1P3B B;  2CWE A;  3MNN A;  3A6N C;  1HQ3 A;  3AV1 A;  4XZQ B;  1JFI B;  5CP6 A;  5AV8 A;  3AYW C;  3KXB D;  3C1B D;  4E44 A;  3VH5 W;  5C3I C;  3C1C B;  3AZM A;  1U35 C;  1WWI A;  3WA9 A;  4CSR A;  1TZY D;  5GT3 D;  4J8W C;  3AZE D;  3R45 B;  3REH D;  3KSY A;  1B6W A;  3AN2 D;  4NE3 A;  5E5A B;  5BS7 C;  1KX4 B;  5AV9 A;  1BH9 B;  1P34 C;  5B1L C;  3W98 B;  3REI A;  3AV2 A;  3REI C;  1P3O B;  5AY8 B;  3B6F C;  4X23 D;  3AZJ A;  3VH6 A;  1S32 D;  4KGC B;  2YFW B;  2F8N B;  4NE6 A;  3AZI C;  1HTA A;  5CPK B;  2JSS A;  4EO5 B;  4NE5 A;  4YS3 C;  5B32 A;  4X23 B;  3V9R A;  5GXQ D;  4Z66 A;  4QLC A;  5AV6 A;  1P3P B;  3KUY D;  3AZG C;  2YFV A;  3AZL C;  5B2J D;  2ARO A;  4H9S A;  1P3F A;  4XUJ C;  5DNM A;  3LZ0 C;  5GSU A;  3LZ1 B;  1B67 A;  3B6G D;  3REJ D;  1KU5 A;  4KUD D;  5B31 C;  3LEL A;  5GT0 C;  4HGA B;  4Z2M G;  2HIO A;  3WKJ A;  1KX5 D;  3X1T A;  2F8N K;  3AZF B;  1ID3 C;  2NZD C;  3REL A;  4JJN B;  4H9P A;  1KX5 B;  4H9N A;  1BH8 A;  4LD9 D;  1M18 C;  5BT1 C;  3VH5 T;  5DNN D;  5F99 C;  3AFA C;  3W96 C;  5JRG C;  4J8X D;  1P3B C;  2CV5 D;  4XZQ C; 
#chains in the Genus database with same CATH topology
 1A7W A;  5DNN B;  4Z5T D;  2W8S A;  3C1C C;  5B0Y B;  1F66 A;  4J8W B;  5B40 D;  3C1B C;  3R45 A;  3REK A;  4ZUX D;  1WWS A;  3UT9 B;  5B33 B;  5B31 G;  3UTB D;  1P3A D;  5GT3 C;  5B24 A;  3KWQ B;  3AZE C;  3AZH A;  5E5A C;  4J8V B;  2RIQ A;  3AV1 D;  1KX4 A;  4J8U B;  1P3A B;  4CAY A;  1P34 B;  5B1L B;  5AV8 D;  3W98 C;  3EPH A;  3AZM D;  2PYO B;  1P3O C;  5AY8 C;  3B0C W;  5BO0 A;  3TU4 B;  3X1V A;  1P3I B;  4KGC A;  5CPK C;  2NQB D;  4EO5 C;  1N1J B;  4X23 C;  1S32 C;  1P3P C;  4DQY B;  2NQB B;  1P3L D;  5AV9 D;  1Q9C A;  4UUZ A;  1KX3 B;  3EPK A;  5FUG A;  3LZ1 C;  1M1A D;  1TAF B;  1P3G A;  5B2I A;  3AZJ D;  5BNV A;  4KHA B;  3MVD B;  1M1A B;  5GT0 B;  2Y2K A;  4DRB A;  4HGA C;  4WU8 A;  3LJA D;  5AVB D;  4E45 A;  3MGS D;  2ARO D;  3AZF A;  5CPI D;  2BYK B;  4JJN C;  3H0M C;  3W97 A;  5GSU D;  3MGQ B;  1KX5 C;  5JA4 A;  1EQZ D;  4WU9 A;  1M18 B;  1ZLA B;  1AOI A;  1P3M A;  2F8N G;  3WTP D;  5F99 B;  3NQJ A;  3AFA B;  1EQZ B;  3O62 D;  1ULY A;  1M19 A;  3A6N A;  5B0Z D;  3W99 B;  5CPJ D;  2HIO D;  5BNX B;  4DRA A;  5DNN C;  3AYW A;  1U35 A;  3X1T D;  3UTA D;  5CPJ B;  5B0Y A;  2Y2M A;  2CV5 C;  5B0Y C;  4Z5T C;  4J8W A;  3KXB B;  3C1B B;  3AZK D;  3UT9 C;  2L5A A;  5B33 A;  5KDM B;  5B33 C;  4R8P D;  1TZY B;  5GT3 B;  5B1M D;  3KWQ C;  5BS7 A;  4J8V A;  3B0C T;  3AZE B;  4J8V C;  3REH B;  1P3K D;  4J8U C;  4R8P B;  1P3A C;  1P34 A;  5B1L A;  3AN2 B;  3AZN D;  5G49 B;  3B6F A;  2PYO C;  3MGP D;  3TU4 A;  2Y2N A;  3TU4 C;  1P3I C;  2Y2H A;  3MGR D;  3AZI A;  3REK D;  1N1J A;  3MGP B;  4YS3 A;  1BFM A;  1S32 B;  4YM6 D;  5B24 D;  3AZG A;  3AZL A;  2NQB C;  4WV4 B;  5GXQ B;  2BYM B;  1KX3 C;  3X1U D;  4XUJ A;  3KUY B;  3LZ0 A;  1P3L C;  5B2J B;  1TAF A;  2F2A C;  3X1V D;  5B31 A;  3X1S D;  3MVD A;  3MVD C;  1M1A C;  3IP4 C;  5GT0 A;  3B6G B;  4H9Q B;  3REJ B;  4KUD B;  3EG5 B;  3A1I A;  4WNN A;  1ID3 A;  2FJ7 D;  3LJA C;  2NZD A;  2BYK A;  3B0D B;  3MGQ C;  5AVC D;  3MGS C;  1P3G D;  5B2I D;  1M18 A;  1ZLA A;  5AV5 D;  5CPI C;  1ZLA C;  5AVC B;  5F99 A;  3AFA A;  3F6T A;  3W96 A;  1EQZ C;  5JRG A;  1P3B A;  4LD9 B;  2Y2G A;  3W99 C;  4WU8 D;  1Z2C B;  4XZQ A;  1JFI A;  3WTP C;  3C1C A;  3O62 C;  2RVQ D;  4J8X B;  5B0Z C;  2CV5 B;  5CPJ C;  3WAA D;  3W97 D;  4Z5T B;  3C1B A;  2HUE C;  3KXB C;  1AOI D;  1P3M D;  5GT3 A;  2XD1 A;  1TZY C;  3FDD A;  5B40 B;  3AZE A;  5E5A A;  3AZK C;  4ZUX B;  3A6N D;  3REH C;  3MNN D;  4ZBJ B;  1HQ3 D;  1W2E A;  1BH9 A;  3UTB B;  4R8P C;  5B1M C;  5CP6 D;  3AYW D;  5G49 A;  3AN2 C;  1U35 D;  3W98 A;  1P3O A;  5AY8 A;  3AV1 B;  3WA9 D;  2YFW A;  3VH5 A;  3VH6 W;  5AV8 B;  3AZN C;  2F8N A;  2UWX A;  5CPK A;  3AZM B;  3MGP C;  4X23 A;  1S32 A;  1P3P A;  4H9O B;  2BYM A;  5GXQ C;  4YM6 C;  3KUY A;  2LY8 A;  3KUY C;  3REI D;  3LZ1 A;  3AV2 D;  1P3L B;  5B2J C;  3B0B A;  5AV9 B;  3AZI D;  4YS3 D;  1PZR A;  3B6G C;  4H9Q A;  5B32 D;  3REJ C;  3AZJ B;  2J8P A;  4QLC D;  5AV6 D;  4Z66 D;  3X1S C;  4KUD C;  3AZG D;  3AZL D;  5B32 B;  4Z2M H;  3V9R B;  4Z66 B;  4QLC B;  1P3F D;  3LJA B;  4XUJ D;  2Y2J A;  5AVB B;  4JJN A;  5DNM D;  3B0D C;  3LZ0 D;  2YFV B;  1KX5 A;  3MGS B;  2XD5 A;  2ARO B;  2JCH A;  2ZM5 A;  5B31 D;  4AWL B;  5CPI B;  5GSU B;  5AVC C;  3LEL D;  4LD9 C;  5AV5 C;  3WKJ D;  5DNN A;  3WTP B;  3O62 B;  2CV5 A;  5B0Z B;  4J8X C;  2NZD D;  2HIO B;  3REL D;  4Z5T A;  1R4V A;  2HUE B;  3X1T B;  3UTA B;  3UT9 A;  3AL0 C;  4M6B A;  3WAA C;  4H9P B;  3KWQ A;  5B40 C;  3W96 D;  3AZK B;  4ZUX C;  1P3B D;  4WJ3 C;  4WZS B;  4J8U A;  4ZBJ C;  3VH6 T;  4XZQ D;  1P3A A;  3EPJ A;  5CHL B;  3UTB C;  2Y2L A;  5B1M B;  2PYO A;  1P3K B;  3MNN C;  3AV1 C;  1P3I A;  1HQ3 C;  1F66 D;  5CP6 C;  5AV8 C;  3AZN B;  3AZM C;  3WA9 C;  1F66 B;  4H9O A;  3MGR B;  2NQB A;  5E5A D;  3REK B;  3AZH D;  2ZY4 A;  1KX4 D;  1KX3 A;  4YM6 B;  5B24 B;  3W98 D;  1P3L A;  3WTP E;  3AZH B;  1P3O D;  5AY8 D;  2IO5 B;  5AV9 C;  3X1U B;  4KHA A;  4CAY B;  2F8N D;  4KGC D;  5CPK D;  3AV2 C;  1M1A A;  5BO0 B;  3X1V B;  3AZJ C;  1P3P D;  3X1S B;  2ZY2 A;  5B32 C;  3LJA A;  4Z66 C;  2FFF B;  4QLC C;  5AVB A;  5AV6 C;  5AVB C;  3MGQ A;  4H9R B;  3LZ1 D;  3MGS A;  2JE5 A;  2ARO C;  4H9S C;  4UUZ B;  1P3F C;  2FJ7 B;  4G92 B;  4AWL C;  5CPI A;  5DNM C;  5GSU C;  5FUG B;  1EQZ A;  1P3G B;  5B2I B;  5BNV B;  3W99 A;  5AV5 B;  2VQR A;  5BNX A;  3WTP A;  3EPL A;  2F8N H;  3LEL C;  3O62 A;  4NFT A;  5B0Z A;  3AZF D;  4WU8 B;  5CPJ A;  4G91 C;  2HIO C;  2Y2I A;  4JJN D;  3WKJ C;  3KXB A;  3NQU B;  3X1T C;  3UTA A;  2Y2Q A;  3UTA C;  4WU9 D;  3REL C;  3WAA B;  5KDM A;  3W97 B;  1H3O B;  1TZY A;  3AZK A;  5JA4 B;  3REH A;  1M19 D;  4WU9 B;  4R8P A;  1P3M B;  1AOI B;  5B1M A;  3AN2 A;  3NQJ B;  1M19 B;  1P3K A;  3A6N B;  5B32 G;  1P3K C;  3MNN B;  5B0Y D;  1F1E A;  1HQ3 B;  3AZN A;  5CP6 B;  4J8W D;  5C3I B;  3AYW B;  1U35 B;  3MGP A;  3UT9 D;  5B33 D;  3WA9 B;  4CSR B;  3MGR A;  1F66 C;  3MGR C;  3KWQ D;  3KFU G;  2BG1 A;  4J8V D;  3REK C;  4J8U D;  5GXQ A;  4YM6 A;  1P34 D;  5B1L D;  5B24 C;  3AZH C;  2PYO D;  3H0R C;  5B2J A;  3B6F D;  3TU4 D;  1P3I D;  1KX4 C;  3X1U A;  2IO5 C;  3X1U C;  3REI B;  3AV2 B;  3B6F B;  3B6G A;  3REJ A;  3X1V C;  4KUD A;  4KGC C;  3X1S A;  3AZI B;  4YS3 B;  3A1K A;  1KX3 D;  2G5H C;  2ZY5 A;  5AV6 B;  3AZG B;  4H9R A;  3AZL B;  2FJ7 A;  1P3F B;  2FJ7 C;  2G5I C;  4XUJ B;  4G92 C;  3LZ0 B;  5DNM B;  5AVC A;  3MVD D;  5GT0 D;  1P3G C;  1T3U A;  5B2I C;  4LD9 A;  5AV5 A;  5B31 B;  3LEL B;  4J8X A;  1ID3 D;  4WU8 C;  4G91 B;  3WKJ B;  3MGQ D;  2Y2O A;  3NQU A;  2Y2P A;  3AZF C;  2RVQ C;  4WNN B;  1ID3 B;  2NZD B;  1M18 D;  1ZLA D;  3WAA A;  3REL B;  1H3O A;  5BT1 D;  3W97 C;  5F99 D;  5B40 A;  3AFA D;  4H9N B;  4ZUX A;  1BH8 B;  5JRG D;  3H0L C;  3W99 D;  4WU9 C;  3UTB A;  1AOI C;  1P3M C;  2DQN C;  3W96 B;  3C1C D;  5JRG B;  1M19 C;  1P3B B;  2CWE A;  3MNN A;  3A6N C;  1HQ3 A;  3AV1 A;  4XZQ B;  1JFI B;  5CP6 A;  5AV8 A;  3AYW C;  3KXB D;  3C1B D;  4E44 A;  3VH5 W;  5C3I C;  3C1C B;  3AZM A;  1U35 C;  1WWI A;  3WA9 A;  4CSR A;  1TZY D;  5GT3 D;  4J8W C;  3AZE D;  3R45 B;  3REH D;  3KSY A;  1B6W A;  3AN2 D;  4NE3 A;  5E5A B;  5BS7 C;  1KX4 B;  5AV9 A;  1BH9 B;  1P34 C;  5B1L C;  3W98 B;  3REI A;  3AV2 A;  3REI C;  1P3O B;  5AY8 B;  3B6F C;  4X23 D;  3AZJ A;  3VH6 A;  1S32 D;  4KGC B;  2YFW B;  2F8N B;  4NE6 A;  3AZI C;  1HTA A;  5CPK B;  2JSS A;  4EO5 B;  4NE5 A;  4YS3 C;  5B32 A;  4X23 B;  3V9R A;  5GXQ D;  4Z66 A;  4QLC A;  5AV6 A;  3P5J B;  1P3P B;  3KUY D;  3AZG C;  2YFV A;  3AZL C;  5B2J D;  2ARO A;  4H9S A;  1P3F A;  4XUJ C;  5DNM A;  3LZ0 C;  5GSU A;  3LZ1 B;  1B67 A;  3B6G D;  3REJ D;  1KU5 A;  4KUD D;  5B31 C;  2ZY3 A;  3LEL A;  5GT0 C;  4HGA B;  4Z2M G;  2HIO A;  3WKJ A;  2DF4 C;  1KX5 D;  3X1T A;  2F8N K;  3AZF B;  1ID3 C;  2NZD C;  3REL A;  4JJN B;  4H9P A;  1KX5 B;  4H9N A;  1BH8 A;  4LD9 D;  1M18 C;  5BT1 C;  3VH5 T;  5DNN D;  5F99 C;  3AFA C;  3W96 C;  5JRG C;  4J8X D;  1P3B C;  2CV5 D;  4UPK A;  4XZQ C; 
#chains in the Genus database with same CATH homology
 1A7W A;  5DNN B;  4Z5T D;  2W8S A;  3C1C C;  5B0Y B;  1F66 A;  4J8W B;  5B40 D;  3C1B C;  3R45 A;  3REK A;  4ZUX D;  1WWS A;  3UT9 B;  5B33 B;  5B31 G;  3UTB D;  1P3A D;  5GT3 C;  5B24 A;  3KWQ B;  3AZE C;  3AZH A;  5E5A C;  4J8V B;  2RIQ A;  3AV1 D;  1KX4 A;  4J8U B;  1P3A B;  4CAY A;  1P34 B;  5B1L B;  5AV8 D;  3W98 C;  3EPH A;  3AZM D;  2PYO B;  1P3O C;  5AY8 C;  3B0C W;  5BO0 A;  3TU4 B;  3X1V A;  1P3I B;  4KGC A;  5CPK C;  2NQB D;  4EO5 C;  1N1J B;  4X23 C;  1S32 C;  1P3P C;  4DQY B;  2NQB B;  1P3L D;  5AV9 D;  1Q9C A;  4UUZ A;  1KX3 B;  3EPK A;  5FUG A;  3LZ1 C;  1M1A D;  1TAF B;  1P3G A;  5B2I A;  3AZJ D;  5BNV A;  4KHA B;  3MVD B;  1M1A B;  5GT0 B;  2Y2K A;  4DRB A;  4HGA C;  4WU8 A;  3LJA D;  5AVB D;  4E45 A;  3MGS D;  2ARO D;  3AZF A;  5CPI D;  2BYK B;  4JJN C;  3H0M C;  3W97 A;  5GSU D;  3MGQ B;  1KX5 C;  5JA4 A;  1EQZ D;  4WU9 A;  1M18 B;  1ZLA B;  1AOI A;  1P3M A;  2F8N G;  3WTP D;  5F99 B;  3NQJ A;  3AFA B;  1EQZ B;  3O62 D;  1ULY A;  1M19 A;  3A6N A;  5B0Z D;  3W99 B;  5CPJ D;  2HIO D;  5BNX B;  4DRA A;  5DNN C;  3AYW A;  1U35 A;  3X1T D;  3UTA D;  5CPJ B;  5B0Y A;  2Y2M A;  2CV5 C;  5B0Y C;  4Z5T C;  4J8W A;  3KXB B;  3C1B B;  3AZK D;  3UT9 C;  2L5A A;  5B33 A;  5KDM B;  5B33 C;  4R8P D;  1TZY B;  5GT3 B;  5B1M D;  3KWQ C;  5BS7 A;  4J8V A;  3B0C T;  3AZE B;  4J8V C;  3REH B;  1P3K D;  4J8U C;  4R8P B;  1P3A C;  1P34 A;  5B1L A;  3AN2 B;  3AZN D;  5G49 B;  3B6F A;  2PYO C;  3MGP D;  3TU4 A;  2Y2N A;  3TU4 C;  1P3I C;  2Y2H A;  3MGR D;  3AZI A;  3REK D;  1N1J A;  3MGP B;  4YS3 A;  1BFM A;  1S32 B;  4YM6 D;  5B24 D;  3AZG A;  3AZL A;  2NQB C;  4WV4 B;  5GXQ B;  2BYM B;  1KX3 C;  3X1U D;  4XUJ A;  3KUY B;  3LZ0 A;  1P3L C;  5B2J B;  1TAF A;  2F2A C;  3X1V D;  5B31 A;  3X1S D;  3MVD A;  3MVD C;  1M1A C;  3IP4 C;  5GT0 A;  3B6G B;  4H9Q B;  3REJ B;  4KUD B;  3EG5 B;  3A1I A;  4WNN A;  1ID3 A;  2FJ7 D;  3LJA C;  2NZD A;  2BYK A;  3B0D B;  3MGQ C;  5AVC D;  3MGS C;  1P3G D;  5B2I D;  1M18 A;  1ZLA A;  5AV5 D;  5CPI C;  1ZLA C;  5AVC B;  5F99 A;  3AFA A;  3F6T A;  3W96 A;  1EQZ C;  5JRG A;  1P3B A;  4LD9 B;  2Y2G A;  3W99 C;  4WU8 D;  1Z2C B;  4XZQ A;  1JFI A;  3WTP C;  3C1C A;  3O62 C;  2RVQ D;  4J8X B;  5B0Z C;  2CV5 B;  5CPJ C;  3WAA D;  3W97 D;  4Z5T B;  3C1B A;  2HUE C;  3KXB C;  1AOI D;  1P3M D;  5GT3 A;  2XD1 A;  1TZY C;  3FDD A;  5B40 B;  3AZE A;  5E5A A;  3AZK C;  4ZUX B;  3A6N D;  3REH C;  3MNN D;  4ZBJ B;  1HQ3 D;  1W2E A;  1BH9 A;  3UTB B;  4R8P C;  5B1M C;  5CP6 D;  3AYW D;  5G49 A;  3AN2 C;  1U35 D;  3W98 A;  1P3O A;  5AY8 A;  3AV1 B;  3WA9 D;  2YFW A;  3VH5 A;  3VH6 W;  5AV8 B;  3AZN C;  2F8N A;  2UWX A;  5CPK A;  3AZM B;  3MGP C;  4X23 A;  1S32 A;  1P3P A;  4H9O B;  2BYM A;  5GXQ C;  4YM6 C;  3KUY A;  2LY8 A;  3KUY C;  3REI D;  3LZ1 A;  3AV2 D;  1P3L B;  5B2J C;  3B0B A;  5AV9 B;  3AZI D;  4YS3 D;  1PZR A;  3B6G C;  4H9Q A;  5B32 D;  3REJ C;  3AZJ B;  2J8P A;  4QLC D;  5AV6 D;  4Z66 D;  3X1S C;  4KUD C;  3AZG D;  3AZL D;  5B32 B;  4Z2M H;  3V9R B;  4Z66 B;  4QLC B;  1P3F D;  3LJA B;  4XUJ D;  2Y2J A;  5AVB B;  4JJN A;  5DNM D;  3B0D C;  3LZ0 D;  2YFV B;  1KX5 A;  3MGS B;  2XD5 A;  2ARO B;  2JCH A;  2ZM5 A;  5B31 D;  4AWL B;  5CPI B;  5GSU B;  5AVC C;  3LEL D;  4LD9 C;  5AV5 C;  3WKJ D;  5DNN A;  3WTP B;  3O62 B;  2CV5 A;  5B0Z B;  4J8X C;  2NZD D;  2HIO B;  3REL D;  4Z5T A;  1R4V A;  2HUE B;  3X1T B;  3UTA B;  3UT9 A;  3AL0 C;  4M6B A;  3WAA C;  4H9P B;  3KWQ A;  5B40 C;  3W96 D;  3AZK B;  4ZUX C;  1P3B D;  4WJ3 C;  4WZS B;  4J8U A;  4ZBJ C;  3VH6 T;  4XZQ D;  1P3A A;  3EPJ A;  5CHL B;  3UTB C;  2Y2L A;  5B1M B;  2PYO A;  1P3K B;  3MNN C;  3AV1 C;  1P3I A;  1HQ3 C;  1F66 D;  5CP6 C;  5AV8 C;  3AZN B;  3AZM C;  3WA9 C;  1F66 B;  4H9O A;  3MGR B;  2NQB A;  5E5A D;  3REK B;  3AZH D;  2ZY4 A;  1KX4 D;  1KX3 A;  4YM6 B;  5B24 B;  3W98 D;  1P3L A;  3WTP E;  3AZH B;  1P3O D;  5AY8 D;  2IO5 B;  5AV9 C;  3X1U B;  4KHA A;  4CAY B;  2F8N D;  4KGC D;  5CPK D;  3AV2 C;  1M1A A;  5BO0 B;  3X1V B;  3AZJ C;  1P3P D;  3X1S B;  2ZY2 A;  5B32 C;  3LJA A;  4Z66 C;  2FFF B;  4QLC C;  5AVB A;  5AV6 C;  5AVB C;  3MGQ A;  4H9R B;  3LZ1 D;  3MGS A;  2JE5 A;  2ARO C;  4H9S C;  4UUZ B;  1P3F C;  2FJ7 B;  4G92 B;  4AWL C;  5CPI A;  5DNM C;  5GSU C;  5FUG B;  1EQZ A;  1P3G B;  5B2I B;  5BNV B;  3W99 A;  5AV5 B;  2VQR A;  5BNX A;  3WTP A;  3EPL A;  2F8N H;  3LEL C;  3O62 A;  4NFT A;  5B0Z A;  3AZF D;  4WU8 B;  5CPJ A;  4G91 C;  2HIO C;  2Y2I A;  4JJN D;  3WKJ C;  3KXB A;  3NQU B;  3X1T C;  3UTA A;  2Y2Q A;  3UTA C;  4WU9 D;  3REL C;  3WAA B;  5KDM A;  3W97 B;  1H3O B;  1TZY A;  3AZK A;  5JA4 B;  3REH A;  1M19 D;  4WU9 B;  4R8P A;  1P3M B;  1AOI B;  5B1M A;  3AN2 A;  3NQJ B;  1M19 B;  1P3K A;  3A6N B;  5B32 G;  1P3K C;  3MNN B;  5B0Y D;  1F1E A;  1HQ3 B;  3AZN A;  5CP6 B;  4J8W D;  5C3I B;  3AYW B;  1U35 B;  3MGP A;  3UT9 D;  5B33 D;  3WA9 B;  4CSR B;  3MGR A;  1F66 C;  3MGR C;  3KWQ D;  3KFU G;  2BG1 A;  4J8V D;  3REK C;  4J8U D;  5GXQ A;  4YM6 A;  1P34 D;  5B1L D;  5B24 C;  3AZH C;  2PYO D;  3H0R C;  5B2J A;  3B6F D;  3TU4 D;  1P3I D;  1KX4 C;  3X1U A;  2IO5 C;  3X1U C;  3REI B;  3AV2 B;  3B6F B;  3B6G A;  3REJ A;  3X1V C;  4KUD A;  4KGC C;  3X1S A;  3AZI B;  4YS3 B;  3A1K A;  1KX3 D;  2G5H C;  2ZY5 A;  5AV6 B;  3AZG B;  4H9R A;  3AZL B;  2FJ7 A;  1P3F B;  2FJ7 C;  2G5I C;  4XUJ B;  4G92 C;  3LZ0 B;  5DNM B;  5AVC A;  3MVD D;  5GT0 D;  1P3G C;  1T3U A;  5B2I C;  4LD9 A;  5AV5 A;  5B31 B;  3LEL B;  4J8X A;  1ID3 D;  4WU8 C;  4G91 B;  3WKJ B;  3MGQ D;  2Y2O A;  3NQU A;  2Y2P A;  3AZF C;  2RVQ C;  4WNN B;  1ID3 B;  2NZD B;  1M18 D;  1ZLA D;  3WAA A;  3REL B;  1H3O A;  5BT1 D;  3W97 C;  5F99 D;  5B40 A;  3AFA D;  4H9N B;  4ZUX A;  1BH8 B;  5JRG D;  3H0L C;  3W99 D;  4WU9 C;  3UTB A;  1AOI C;  1P3M C;  2DQN C;  3W96 B;  3C1C D;  5JRG B;  1M19 C;  1P3B B;  2CWE A;  3MNN A;  3A6N C;  1HQ3 A;  3AV1 A;  4XZQ B;  1JFI B;  5CP6 A;  5AV8 A;  3AYW C;  3KXB D;  3C1B D;  4E44 A;  3VH5 W;  5C3I C;  3C1C B;  3AZM A;  1U35 C;  1WWI A;  3WA9 A;  4CSR A;  1TZY D;  5GT3 D;  4J8W C;  3AZE D;  3R45 B;  3REH D;  3KSY A;  1B6W A;  3AN2 D;  4NE3 A;  5E5A B;  5BS7 C;  1KX4 B;  5AV9 A;  1BH9 B;  1P34 C;  5B1L C;  3W98 B;  3REI A;  3AV2 A;  3REI C;  1P3O B;  5AY8 B;  3B6F C;  4X23 D;  3AZJ A;  3VH6 A;  1S32 D;  4KGC B;  2YFW B;  2F8N B;  4NE6 A;  3AZI C;  1HTA A;  5CPK B;  2JSS A;  4EO5 B;  4NE5 A;  4YS3 C;  5B32 A;  4X23 B;  3V9R A;  5GXQ D;  4Z66 A;  4QLC A;  5AV6 A;  3P5J B;  1P3P B;  3KUY D;  3AZG C;  2YFV A;  3AZL C;  5B2J D;  2ARO A;  4H9S A;  1P3F A;  4XUJ C;  5DNM A;  3LZ0 C;  5GSU A;  3LZ1 B;  1B67 A;  3B6G D;  3REJ D;  1KU5 A;  4KUD D;  5B31 C;  2ZY3 A;  3LEL A;  5GT0 C;  4HGA B;  4Z2M G;  2HIO A;  3WKJ A;  2DF4 C;  1KX5 D;  3X1T A;  2F8N K;  3AZF B;  1ID3 C;  2NZD C;  3REL A;  4JJN B;  4H9P A;  1KX5 B;  4H9N A;  1BH8 A;  4LD9 D;  1M18 C;  5BT1 C;  3VH5 T;  5DNN D;  5F99 C;  3AFA C;  3W96 C;  5JRG C;  4J8X D;  1P3B C;  2CV5 D;  4UPK A;  4XZQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...