2F8NH

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nH00
5BNXA 1N1JB 1P3IC 3AV2D 4R8PD 3C1BB 4J8VD 3MVDA 3REIC 2FJ7D 4J8UD 1P3MD 5B2IC 4YM6B 4J8XC 4NE6A 3AZLB 5DNNC 3AN2A 5B31G 5B0ZA 2F8NH 5BT1C 3W98D 5B32A 5AV6B 3UTAA 3AFAC 5B1LC 3RELB 3WKJC 3KUYC 3WAAA 1KX4A 3W99B 4YS3D 1BH8B 2L5AA 4QLCD 1TZYB 1P3FC 1M1AA 5G49B 2HIOB 5GXQA 3W96A 3WA9D 2PYOB 3KXBD 3REJD 2AROB 5AV9C 5GSUA 1JFIB 5AV8A 1B6WA 2YFWB 1ZLAD 3B6FD 4WU9D 1R4VA 4ZBJB 5GT3D 2BYMB 4KHAB 3LZ0C 2NQBB 3AZID 5BNVA 3KWQD 4J8WC 3NQJA 3AZJC 4WU8D 1P3PD 3R45A 3V9RA 4X23C 3LELC 3B0CT 3LZ1A 3AZED 2IO5B 5JRGC 5BNXB 4NFTA 2CV5A 1P3LD 1P3BD 3A6NA 1P34C 4J8VC 4ZUXC 3MGRA 3REKD 5B40D 3X1SD 5B1MA 3MGPA 5AVCD 4EO5B 3X1TD 4J8WB 5DNMA 3AZHD 3X1VD 4JJND 2F8ND 3AN2B 5B0ZB 3AZKA 3C1BD 3W97A 5B32B 2F8NK 3UTAB 5BO0A 3WAAB 1KX4B 3AZLD 4Z66D 1P3AD 3VH5W 5B2JA 1BH9A 3B0DB 1P3ID 5AV6D 5GXQB 4H9NB 3RELD 3REID 3REJC 3W99D 4G91C 1H3OA 5B2ID 1KX3A 4J8XD 1P3OC 1U35A 5GSUB 5AV8B 5FUGA 5DNND 5GT3C 5B0YC 3MNNA 2HIOD 3MGQA 5BT1D 2HUEC 3NQJB 3TU4A 4WU8C 3R45B 3V9RB 3UT9A 4E44A 3LZ1B 3WTPA 5B1LD 2AROD 3WKJD 1M18A 4LD9A 2CV5B 4E45A 3MGSA 1P3GA 1P3KC 1P3OB 3MGRB 5B40C 4XUJA 5CPJA 5B1MB 3MGPB 1P3FD 4KGCA 2NZDC 1M19A 5B31C 3AYWA 5CPIC 3LJAA 5AVBA 3AZKB 3C1BC 3W97B 4H9SA 5AV9D 3NQUA 5BO0B 2BYKB 4YM6C 4H9PA 3AZLC 1EQZA 3O62A 4J8WD 3AZJD 4X23D 2NZDB 3AN2D 3AZMA 1Q9CA 5CPIB 4XZQA 5B2JB 4KUDC 5B32D 1BH9B 4CSRA 5AV6C 3REHA 5GT0A 1S32A 3UTAD 1P34D 1F66A 4ZUXD 3RELC 5E5AA 3UTBA 1KX4D 3W99C 1H3OB 1KX3B 5F99A 1U35B 3AV1A 5BS7A 1TZYC 5AY8A 5FUGB 1KX5C 3AZFA 3MNNB 3AZGA 2HIOC 4Z5TA 3MGQB 3TU4B 2PYOC 4KUDB 3UT9B 5KDMA 3WTPB 1AOIC 2AROC 4LD9B 5AV5A 5B33A 5AV8D 1M18B 3MGSB 1P3GB 4ZBJC 1ID3C 2NQBC 4XUJB 5CPJB 5B24A 1KX5B 4KGCB 1M19B 3LZ1D 3AYWB 2IO5C 5CPKC 3LJAB 5CHLB 5AVBB 4AWLB 2CV5D 4UUZA 3MVDC 1AOIB 1P3OD 3AV2A 4R8PA 5B1MD 4EO5C 2YFVA 1HQ3A 5B0YD 1ID3B 4J8UA 1P3MA 1EQZB 2FJ7A 3O62B 3VH5T 3B0BA 3VH5A 3AN2C 3VH6W 5B0ZC 3AZKD 3AZMB 5CPKB 4XZQB 5B32C 3W97D 4CSRB 3REHB 5GT0B 3UTAC 1S32B 3AZNA 1P3KD 3MVDB 1F66B 3W98A 5E5AB 3WAAC 1KX4C 4M6BA 5F99B 2NZDD 5AY8B 2JSSA 5B31D 1M1AC 4YS3A 5CPID 5B2JD 3AZFB 3B0DC 5JA4A 3AZGB 5GXQC 3W96C 4QLCA 4Z5TB 5KDMB 3WA9A 1KX3D 4YM6D 1BFMA 5GSUC 5AV5B 5B33B 5AV8C 3B6GA 3KXBA 3MNND 1ZLAA 3B6FA 5B24B 3MGQD 1M1AB 4WU9A 4KUDD 3UT9D 4Z2MH 3LZ1C 3W96B 3AZIA 3WTPD 3KWQA 1P3PA 3C1CA 1M18D 2CV5C 3A6NC 3MGSD 1P3GD 4UUZB 3AZEA 3MGRC 5CP6A 1TZYD 1P3LA 1P3BA 3AV2B 4R8PB 5B1MC 5CPJD 3MGPC 1KX5D 4KGCD 2YFVB 1HQ3B 1M19D 4J8UB 1P3MB 2FJ7B 1HTAA 3REKA 3X1SA 3AYWD 5BNVB 5DNMC 3LJAD 2RVQC 2PYOD 5AVBD 5AVCA 3AZKC 4HGAB 3X1TA 1AOID 3W97C 3AZHA 3X1UA 3X1VA 4JJNA 2F8NA 3A6NB 3AZNB 3W98B 1ID3D 2NQBD 1EQZD 3WTPE 5CPKD 4YS3B 5B2JC 5DNMB 4WNNB 5JA4B 5GT0D 4Z66A 1P3AA 1A7WA 1F66D 3MVDD 1P3IA 1KX3C 3WA9B 1U35C 4H9OA 3B6GB 3REIA 3KXBB 5B2IA 4WV4B 3AZFD 4J8XA 3MNNC 5B0ZD 1ZLAB 3KSYA 3MGQC 3TU4C 3B6FB 4WU9B 5DNNA 3UT9C 4WZSB 3WTPC 3KWQB 1P3PB 4LD9C 3C1CB 5AV5D 5B33D 1M18C 3WAAD 3MGSC 1P3GC 1ULYA 3AZEB 3AFAA 5C3IC 4H9RA 5CP6B 5B1LA 3WKJA 3KUYA 1P3LB 4XUJC 5CPJC 4KGCC 1M1AD 1M19C 5GXQD 3REKB 3AYWC 3W96D 3LJAC 1P3FA 3VH6T 5AVBC 3VH6A 5AVCB 4DRBA 4AWLC 4H9QA 1WWIA 4H9SC 3AZHB 3X1UB 5GSUD 3X1VB 4JJNB 2F8NB 4G92B 5C3IB 1HQ3D 5AV9A 1EQZC 3O62C 3AZMC 3LZ0A 4XZQC 4J8WA 3REHC 3AZJA 5GT0C 1S32C 4Z66B 4X23A 3LELA 3A6ND 3AZND 1P3AB 1F66C 3UTBC 2CWEA 5E5AC 5JRGA 3MGRD 1P3IB 2F8NG 3NQUB 5F99C 1P34A 3MGPD 4J8VA 4H9PB 3AV1C 4H9OB 5BS7C 4ZUXA 5AY8C 3REIB 1TAFA 5B2IB 5DNMD 3AZFC 2RVQD 4J8XB 3AZGC 4Z5TC 1KU5A 5DNNB 4H9NA 3UTBB 5AV5C 5B33C 3B6GD 3AFAB 4CAYA 4H9RB 3AV1B 4NE5A 5B1LB 3WKJB 3KUYB 5B24C 1P3FB 3C1CD 4H9QB 1U35D 5CP6D 3REJA 3AV2C 4R8PC 4NE3A 1P3OA 1HQ3C 5AV9B 2FJ7C 4J8UC 1P3MC 3TU4D 5GT3A 5B0YA 4HGAC 3LZ0B 4WU8A 4LD9D 3X1UD 3AZJB 4X23B 3LELB 3AZNC 3W98C 5JRGB 4XUJD 1P34B 2BYKA 4J8VB 1P3KA 4ZUXB 1TAFB 5B40A 4YS3C 4DRAA 1B67A 1WWSA 4QLCC 2NZDA 5B31A 5CPIA 3B0CW 4WNNA 1N1JA 3WA9C 3C1BA 4Z2MG 5B32G 3B6GC 3KXBC 3O62D 4YM6A 4CAYB 3AZMD 1ZLAC 3AZLA 3B6FC 1F1EA 4XZQD 4WU9C 3REHD 1S32D 4QLCB 3AZIC 3KWQC 1P3PC 3UTBD 5E5AD 3C1CC 4KUDA 5AV6A 3AZEC 5F99D 3AFAD 5CP6C 3AV1D 3RELA 5AY8D 3KUYD 3REJB 1P3LC 1P3BC 3W99A 4G91B 1BH8A 3AZGD 3REKC 1TZYA 3X1SC 4Z5TD 1KX5A 2LY8A 5AVCC 5GT3B 5G49A 5B0YB 2HIOA 3X1TC 3AZIB 4WU8B 3X1UC 2HUEB 3X1VC 3AZHC 2PYOA 4JJNC 4G92C 1AOIA 2AROA 1JFIA 2YFWA 1P3BB 5B24D 1P3KB 2BYMA 1ID3A 5B40B 3X1SB 4KHAA 3LZ0D 2NQBA 4Z66C 1P3AC 3LELD 5B31B 3X1TB 5CPKA 5JRGD
chains in the Genus database with same CATH superfamily
5BNXA 1N1JB 1P3IC 3AV2D 4R8PD 3C1BB 4J8VD 3MVDA 3REIC 2FJ7D 4J8UD 1P3MD 5B2IC 4YM6B 4J8XC 2Y2GA 4NE6A 3AZLB 5DNNC 3AN2A 5B31G 5B0ZA 2F8NH 5BT1C 3W98D 5B32A 5AV6B 3UTAA 3AFAC 5B1LC 3RELB 3WKJC 3KUYC 3WAAA 1KX4A 3W99B 4YS3D 1BH8B 2L5AA 4QLCD 1TZYB 1P3FC 1M1AA 1Z2CB 2Y2LA 5G49B 2HIOB 5GXQA 3W96A 3WA9D 3EPKA 2PYOB 3KXBD 3REJD 2AROB 3F6TA 5AV9C 5GSUA 1JFIB 5AV8A 1B6WA 2YFWB 1ZLAD 3B6FD 4WU9D 1R4VA 4ZBJB 5GT3D 2BYMB 4KHAB 3LZ0C 2NQBB 3AZID 5BNVA 3KWQD 4J8WC 3NQJA 3AZJC 4WU8D 1P3PD 3R45A 3V9RA 4X23C 3LELC 3B0CT 3LZ1A 3AZED 2IO5B 5JRGC 5BNXB 4NFTA 2RIQA 2CV5A 1P3LD 1P3BD 3A6NA 1P34C 4J8VC 4ZUXC 2ZY2A 3MGRA 3A1IA 3REKD 5B40D 3X1SD 3H0MC 5B1MA 3MGPA 5AVCD 4EO5B 3X1TD 3EG5B 4J8WB 5DNMA 3AZHD 2Y2KA 3X1VD 4JJND 2F8ND 3AN2B 5B0ZB 3AZKA 3C1BD 3W97A 5B32B 2F8NK 3UTAB 5BO0A 3WAAB 1KX4B 3AZLD 4Z66D 1P3AD 3VH5W 5B2JA 1BH9A 3B0DB 1P3ID 5AV6D 5GXQB 4H9NB 3RELD 1W2EA 3REID 3REJC 2Y2NA 3W99D 4G91C 1H3OA 5B2ID 1KX3A 4J8XD 1P3OC 1U35A 5GSUB 5AV8B 5FUGA 5DNND 5GT3C 5B0YC 3MNNA 2HIOD 3MGQA 5BT1D 2HUEC 3NQJB 3TU4A 4WU8C 3R45B 3V9RB 3UT9A 4E44A 3LZ1B 3WTPA 5B1LD 2AROD 3WKJD 3EPJA 1M18A 4LD9A 2CV5B 4E45A 3MGSA 1P3GA 1P3KC 1P3OB 3MGRB 5B40C 4XUJA 5CPJA 5B1MB 3MGPB 1P3FD 4KGCA 2NZDC 1M19A 5B31C 3AYWA 5CPIC 3LJAA 5AVBA 3AZKB 3C1BC 3W97B 4H9SA 5AV9D 3NQUA 5BO0B 2BYKB 4YM6C 4H9PA 4UPKA 3AZLC 1EQZA 3O62A 4J8WD 3AZJD 4X23D 2NZDB 3AN2D 3AZMA 1Q9CA 5CPIB 4XZQA 5B2JB 4KUDC 5B32D 1BH9B 4CSRA 5AV6C 3REHA 5GT0A 1S32A 3UTAD 1P34D 1F66A 4ZUXD 3RELC 5E5AA 3UTBA 1KX4D 3W99C 1H3OB 1KX3B 1T3UA 5F99A 1U35B 3AV1A 5BS7A 1TZYC 5AY8A 2J8PA 5FUGB 1KX5C 3AZFA 3MNNB 3AZGA 2ZY3A 2HIOC 4Z5TA 3MGQB 3TU4B 2PYOC 4KUDB 3UT9B 5KDMA 3WTPB 1AOIC 2AROC 4LD9B 2VQRA 5AV5A 5AV8D 5B33A 1M18B 3MGSB 1P3GB 2G5HC 4ZBJC 1ID3C 2NQBC 4XUJB 5CPJB 5B24A 1KX5B 4KGCB 1M19B 3LZ1D 3AYWB 2IO5C 5CPKC 3LJAB 2XD1A 5CHLB 5AVBB 4AWLB 2CV5D 4UUZA 3MVDC 1AOIB 1P3OD 3AV2A 4R8PA 5B1MD 4EO5C 2YFVA 1HQ3A 5B0YD 1ID3B 4J8UA 1P3MA 1EQZB 2FJ7A 3O62B 3VH5T 3B0BA 3VH5A 3AN2C 2Y2MA 3VH6W 5B0ZC 3AZKD 3AZMB 5CPKB 4XZQB 5B32C 3W97D 2ZY5A 4CSRB 3REHB 5GT0B 3UTAC 1S32B 3AZNA 1P3KD 3MVDB 1F66B 3W98A 5E5AB 3WAAC 1KX4C 4M6BA 2XD5A 5F99B 2NZDD 5AY8B 2JSSA 5B31D 1M1AC 4YS3A 5CPID 5B2JD 3AZFB 3B0DC 5JA4A 3AZGB 5GXQC 3W96C 3FDDA 4QLCA 4Z5TB 5KDMB 3WA9A 1KX3D 4YM6D 1BFMA 5GSUC 5AV5B 5B33B 5AV8C 3B6GA 3KXBA 3MNND 2BG1A 2Y2OA 1ZLAA 3B6FA 5B24B 3MGQD 1M1AB 4WU9A 4KUDD 4WJ3C 3UT9D 4Z2MH 3LZ1C 3W96B 3AZIA 3WTPD 3KWQA 1P3PA 3C1CA 1M18D 2CV5C 3A6NC 3MGSD 1P3GD 2DQNC 4UUZB 3AZEA 4DQYB 3MGRC 5CP6A 1TZYD 1P3LA 1P3BA 3AV2B 4R8PB 5B1MC 5CPJD 3MGPC 1KX5D 4KGCD 2YFVB 1HQ3B 1M19D 4J8UB 1P3MB 2FJ7B 1HTAA 3REKA 3X1SA 3AYWD 5BNVB 5DNMC 3LJAD 2RVQC 2PYOD 5AVBD 5AVCA 3AZKC 4HGAB 3X1TA 1AOID 3W97C 3AZHA 3X1UA 3X1VA 4JJNA 2F8NA 3A6NB 3AZNB 3IP4C 3W98B 1ID3D 2NQBD 1EQZD 3WTPE 5CPKD 4YS3B 5B2JC 5DNMB 4WNNB 5JA4B 5GT0D 4Z66A 1P3AA 1A7WA 1F66D 3MVDD 1P3IA 2FFFB 2DF4C 1KX3C 3WA9B 1U35C 2F2AC 4H9OA 3B6GB 3REIA 2JE5A 3KXBB 5B2IA 4WV4B 3AZFD 4J8XA 3MNNC 5B0ZD 1ZLAB 3KSYA 3MGQC 3TU4C 3B6FB 4WU9B 5DNNA 3UT9C 2Y2PA 4WZSB 2G5IC 3WTPC 3KWQB 1P3PB 4LD9C 3C1CB 5AV5D 5B33D 1M18C 3WAAD 3MGSC 1P3GC 1ULYA 3AZEB 3AFAA 5C3IC 4H9RA 5CP6B 5B1LA 3WKJA 3KUYA 1P3LB 4XUJC 5CPJC 4KGCC 1M1AD 1M19C 5GXQD 3REKB 3AYWC 3W96D 3LJAC 1P3FA 3VH6T 5AVBC 3VH6A 5AVCB 4DRBA 4AWLC 4H9QA 1WWIA 4H9SC 3AZHB 3X1UB 5GSUD 3X1VB 4JJNB 2F8NB 4G92B 5C3IB 1HQ3D 5AV9A 1EQZC 3O62C 3H0RC 3AZMC 3LZ0A 4XZQC 4J8WA 3REHC 3AZJA 5GT0C 2UWXA 4Z66B 4X23A 3LELA 3A6ND 3AZND 1S32C 1P3AB 1F66C 3UTBC 2CWEA 5E5AC 5JRGA 3MGRD 2ZM5A 1P3IB 2F8NG 3NQUB 5F99C 1P34A 3MGPD 4J8VA 4H9PB 3AV1C 4H9OB 5BS7C 4ZUXA 5AY8C 3REIB 1TAFA 3H0LC 5B2IB 5DNMD 3AZFC 2RVQD 4J8XB 3AZGC 4Z5TC 1KU5A 5DNNB 2ZY4A 4H9NA 5AV5C 3UTBB 5B33C 3B6GD 3A1KA 3AFAB 4CAYA 4H9RB 3AV1B 4NE5A 5B1LB 3WKJB 3KUYB 5B24C 3AL0C 1P3FB 3C1CD 4H9QB 1U35D 5CP6D 3REJA 3AV2C 4R8PC 4NE3A 1P3OA 1HQ3C 5AV9B 2FJ7C 4J8UC 1P3MC 3TU4D 5GT3A 5B0YA 4HGAC 3LZ0B 4WU8A 4LD9D 3X1UD 3AZJB 4X23B 3LELB 3AZNC 2Y2JA 3W98C 5JRGB 4XUJD 1P34B 2BYKA 4J8VB 1P3KA 4ZUXB 1TAFB 5B40A 4YS3C 4DRAA 1B67A 1WWSA 4QLCC 2NZDA 5B31A 5CPIA 3B0CW 4WNNA 1N1JA 3WA9C 3C1BA 4Z2MG 5B32G 3B6GC 3KXBC 3O62D 4YM6A 4CAYB 3EPHA 3AZMD 1ZLAC 3AZLA 3B6FC 1F1EA 4XZQD 4WU9C 3REHD 1S32D 4QLCB 3EPLA 3AZIC 3KWQC 1P3PC 3UTBD 5E5AD 3C1CC 4KUDA 5AV6A 3AZEC 5F99D 3AFAD 5CP6C 3AV1D 3RELA 5AY8D 3KUYD 3REJB 1P3LC 1P3BC 3W99A 4G91B 1BH8A 2Y2HA 3AZGD 3REKC 1TZYA 3X1SC 4Z5TD 3KFUG 1KX5A 2LY8A 5AVCC 5GT3B 5G49A 5B0YB 2HIOA 3X1TC 3AZIB 1PZRA 2Y2QA 4WU8B 2HUEB 3X1UC 3X1VC 3AZHC 4JJNC 2PYOA 4G92C 1AOIA 2AROA 1JFIA 2JCHA 2YFWA 3P5JB 1P3BB 5B24D 1P3KB 2Y2IA 2W8SA 2BYMA 1ID3A 5B40B 4KHAA 3X1SB 3LZ0D 2NQBA 4Z66C 1P3AC 3LELD 5B31B 3X1TB 5CPKA 5JRGD
chains in the Genus database with same CATH topology
5BNXA 1N1JB 1P3IC 3AV2D 4R8PD 3C1BB 4J8VD 3MVDA 3REIC 2FJ7D 4J8UD 1P3MD 5B2IC 4YM6B 4J8XC 2Y2GA 4NE6A 3AZLB 5DNNC 3AN2A 5B31G 5B0ZA 2F8NH 5BT1C 3W98D 5B32A 5AV6B 3UTAA 3AFAC 5B1LC 3RELB 3WKJC 3KUYC 3WAAA 1KX4A 3W99B 4YS3D 1BH8B 2L5AA 4QLCD 1TZYB 1P3FC 1M1AA 1Z2CB 2Y2LA 5G49B 2HIOB 5GXQA 3W96A 3WA9D 3EPKA 2PYOB 3KXBD 3REJD 2AROB 3F6TA 5AV9C 5GSUA 1JFIB 5AV8A 1B6WA 2YFWB 1ZLAD 3B6FD 4WU9D 1R4VA 4ZBJB 5GT3D 2BYMB 4KHAB 3LZ0C 2NQBB 3AZID 5BNVA 3KWQD 4J8WC 3NQJA 3AZJC 4WU8D 1P3PD 3R45A 3V9RA 4X23C 3LELC 3B0CT 3LZ1A 3AZED 2IO5B 5JRGC 5BNXB 4NFTA 2RIQA 2CV5A 1P3LD 1P3BD 3A6NA 1P34C 4J8VC 4ZUXC 2ZY2A 3MGRA 3A1IA 3REKD 5B40D 3X1SD 3H0MC 5B1MA 3MGPA 5AVCD 4EO5B 3X1TD 3EG5B 4J8WB 5DNMA 3AZHD 2Y2KA 3X1VD 4JJND 2F8ND 3AN2B 5B0ZB 3AZKA 3C1BD 3W97A 5B32B 2F8NK 3UTAB 5BO0A 3WAAB 1KX4B 3AZLD 4Z66D 1P3AD 3VH5W 5B2JA 1BH9A 3B0DB 1P3ID 5AV6D 5GXQB 4H9NB 3RELD 1W2EA 3REID 3REJC 2Y2NA 3W99D 4G91C 1H3OA 5B2ID 1KX3A 4J8XD 1P3OC 1U35A 5GSUB 5AV8B 5FUGA 5DNND 5GT3C 5B0YC 3MNNA 2HIOD 3MGQA 5BT1D 2HUEC 3NQJB 3TU4A 4WU8C 3R45B 3V9RB 3UT9A 4E44A 3LZ1B 3WTPA 5B1LD 2AROD 3WKJD 3EPJA 1M18A 4LD9A 2CV5B 4E45A 3MGSA 1P3GA 1P3KC 1P3OB 3MGRB 5B40C 4XUJA 5CPJA 5B1MB 3MGPB 1P3FD 4KGCA 2NZDC 1M19A 5B31C 3AYWA 5CPIC 3LJAA 5AVBA 3AZKB 3C1BC 3W97B 4H9SA 5AV9D 3NQUA 5BO0B 2BYKB 4YM6C 4H9PA 4UPKA 3AZLC 1EQZA 3O62A 4J8WD 3AZJD 4X23D 2NZDB 3AN2D 3AZMA 1Q9CA 5CPIB 4XZQA 5B2JB 4KUDC 5B32D 1BH9B 4CSRA 5AV6C 3REHA 5GT0A 1S32A 3UTAD 1P34D 1F66A 4ZUXD 3RELC 5E5AA 3UTBA 1KX4D 3W99C 1H3OB 1KX3B 1T3UA 5F99A 1U35B 3AV1A 5BS7A 1TZYC 5AY8A 2J8PA 5FUGB 1KX5C 3AZFA 3MNNB 3AZGA 2ZY3A 2HIOC 4Z5TA 3MGQB 3TU4B 2PYOC 4KUDB 3UT9B 5KDMA 3WTPB 1AOIC 2AROC 4LD9B 2VQRA 5AV5A 5AV8D 5B33A 1M18B 3MGSB 1P3GB 2G5HC 4ZBJC 1ID3C 2NQBC 4XUJB 5CPJB 5B24A 1KX5B 4KGCB 1M19B 3LZ1D 3AYWB 2IO5C 5CPKC 3LJAB 2XD1A 5CHLB 5AVBB 4AWLB 2CV5D 4UUZA 3MVDC 1AOIB 1P3OD 3AV2A 4R8PA 5B1MD 4EO5C 2YFVA 1HQ3A 5B0YD 1ID3B 4J8UA 1P3MA 1EQZB 2FJ7A 3O62B 3VH5T 3B0BA 3VH5A 3AN2C 2Y2MA 3VH6W 5B0ZC 3AZKD 3AZMB 5CPKB 4XZQB 5B32C 3W97D 2ZY5A 4CSRB 3REHB 5GT0B 3UTAC 1S32B 3AZNA 1P3KD 3MVDB 1F66B 3W98A 5E5AB 3WAAC 1KX4C 4M6BA 2XD5A 5F99B 2NZDD 5AY8B 2JSSA 5B31D 1M1AC 4YS3A 5CPID 5B2JD 3AZFB 3B0DC 5JA4A 3AZGB 5GXQC 3W96C 3FDDA 4QLCA 4Z5TB 5KDMB 3WA9A 1KX3D 4YM6D 1BFMA 5GSUC 5AV5B 5B33B 5AV8C 3B6GA 3KXBA 3MNND 2BG1A 2Y2OA 1ZLAA 3B6FA 5B24B 3MGQD 1M1AB 4WU9A 4KUDD 4WJ3C 3UT9D 4Z2MH 3LZ1C 3W96B 3AZIA 3WTPD 3KWQA 1P3PA 3C1CA 1M18D 2CV5C 3A6NC 3MGSD 1P3GD 2DQNC 4UUZB 3AZEA 4DQYB 3MGRC 5CP6A 1TZYD 1P3LA 1P3BA 3AV2B 4R8PB 5B1MC 5CPJD 3MGPC 1KX5D 4KGCD 2YFVB 1HQ3B 1M19D 4J8UB 1P3MB 2FJ7B 1HTAA 3REKA 3X1SA 3AYWD 5BNVB 5DNMC 3LJAD 2RVQC 2PYOD 5AVBD 5AVCA 3AZKC 4HGAB 3X1TA 1AOID 3W97C 3AZHA 3X1UA 3X1VA 4JJNA 2F8NA 3A6NB 3AZNB 3IP4C 3W98B 1ID3D 2NQBD 1EQZD 3WTPE 5CPKD 4YS3B 5B2JC 5DNMB 4WNNB 5JA4B 5GT0D 4Z66A 1P3AA 1A7WA 1F66D 3MVDD 1P3IA 2FFFB 2DF4C 1KX3C 3WA9B 1U35C 2F2AC 4H9OA 3B6GB 3REIA 2JE5A 3KXBB 5B2IA 4WV4B 3AZFD 4J8XA 3MNNC 5B0ZD 1ZLAB 3KSYA 3MGQC 3TU4C 3B6FB 4WU9B 5DNNA 3UT9C 2Y2PA 4WZSB 2G5IC 3WTPC 3KWQB 1P3PB 4LD9C 3C1CB 5AV5D 5B33D 1M18C 3WAAD 3MGSC 1P3GC 1ULYA 3AZEB 3AFAA 5C3IC 4H9RA 5CP6B 5B1LA 3WKJA 3KUYA 1P3LB 4XUJC 5CPJC 4KGCC 1M1AD 1M19C 5GXQD 3REKB 3AYWC 3W96D 3LJAC 1P3FA 3VH6T 5AVBC 3VH6A 5AVCB 4DRBA 4AWLC 4H9QA 1WWIA 4H9SC 3AZHB 3X1UB 5GSUD 3X1VB 4JJNB 2F8NB 4G92B 5C3IB 1HQ3D 5AV9A 1EQZC 3O62C 3H0RC 3AZMC 3LZ0A 4XZQC 4J8WA 3REHC 3AZJA 5GT0C 2UWXA 4Z66B 4X23A 3LELA 3A6ND 3AZND 1S32C 1P3AB 1F66C 3UTBC 2CWEA 5E5AC 5JRGA 3MGRD 2ZM5A 1P3IB 2F8NG 3NQUB 5F99C 1P34A 3MGPD 4J8VA 4H9PB 3AV1C 4H9OB 5BS7C 4ZUXA 5AY8C 3REIB 1TAFA 3H0LC 5B2IB 5DNMD 3AZFC 2RVQD 4J8XB 3AZGC 4Z5TC 1KU5A 5DNNB 2ZY4A 4H9NA 5AV5C 3UTBB 5B33C 3B6GD 3A1KA 3AFAB 4CAYA 4H9RB 3AV1B 4NE5A 5B1LB 3WKJB 3KUYB 5B24C 3AL0C 1P3FB 3C1CD 4H9QB 1U35D 5CP6D 3REJA 3AV2C 4R8PC 4NE3A 1P3OA 1HQ3C 5AV9B 2FJ7C 4J8UC 1P3MC 3TU4D 5GT3A 5B0YA 4HGAC 3LZ0B 4WU8A 4LD9D 3X1UD 3AZJB 4X23B 3LELB 3AZNC 2Y2JA 3W98C 5JRGB 4XUJD 1P34B 2BYKA 4J8VB 1P3KA 4ZUXB 1TAFB 5B40A 4YS3C 4DRAA 1B67A 1WWSA 4QLCC 2NZDA 5B31A 5CPIA 3B0CW 4WNNA 1N1JA 3WA9C 3C1BA 4Z2MG 5B32G 3B6GC 3KXBC 3O62D 4YM6A 4CAYB 3EPHA 3AZMD 1ZLAC 3AZLA 3B6FC 1F1EA 4XZQD 4WU9C 3REHD 1S32D 4QLCB 3EPLA 3AZIC 3KWQC 1P3PC 3UTBD 5E5AD 3C1CC 4KUDA 5AV6A 3AZEC 5F99D 3AFAD 5CP6C 3AV1D 3RELA 5AY8D 3KUYD 3REJB 1P3LC 1P3BC 3W99A 4G91B 1BH8A 2Y2HA 3AZGD 3REKC 1TZYA 3X1SC 4Z5TD 3KFUG 1KX5A 2LY8A 5AVCC 5GT3B 5G49A 5B0YB 2HIOA 3X1TC 3AZIB 1PZRA 2Y2QA 4WU8B 2HUEB 3X1UC 3X1VC 3AZHC 4JJNC 2PYOA 4G92C 1AOIA 2AROA 1JFIA 2JCHA 2YFWA 3P5JB 1P3BB 5B24D 1P3KB 2Y2IA 2W8SA 2BYMA 1ID3A 5B40B 4KHAA 3X1SB 3LZ0D 2NQBA 4Z66C 1P3AC 3LELD 5B31B 3X1TB 5CPKA 5JRGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNX A;  1N1J B;  1P3I C;  3AV2 D;  4R8P D;  3C1B B;  4J8V D;  3MVD A;  3REI C;  2FJ7 D;  4J8U D;  1P3M D;  5B2I C;  4YM6 B;  4J8X C;  4NE6 A;  3AZL B;  5DNN C;  3AN2 A;  5B31 G;  5B0Z A;  2F8N H;  5BT1 C;  3W98 D;  5B32 A;  5AV6 B;  3UTA A;  3AFA C;  5B1L C;  3REL B;  3WKJ C;  3KUY C;  3WAA A;  1KX4 A;  3W99 B;  4YS3 D;  1BH8 B;  2L5A A;  4QLC D;  1TZY B;  1P3F C;  1M1A A;  5G49 B;  2HIO B;  5GXQ A;  3W96 A;  3WA9 D;  2PYO B;  3KXB D;  3REJ D;  2ARO B;  5AV9 C;  5GSU A;  1JFI B;  5AV8 A;  1B6W A;  2YFW B;  1ZLA D;  3B6F D;  4WU9 D;  1R4V A;  4ZBJ B;  5GT3 D;  2BYM B;  4KHA B;  3LZ0 C;  2NQB B;  3AZI D;  5BNV A;  3KWQ D;  4J8W C;  3NQJ A;  3AZJ C;  4WU8 D;  1P3P D;  3R45 A;  3V9R A;  4X23 C;  3LEL C;  3B0C T;  3LZ1 A;  3AZE D;  2IO5 B;  5JRG C;  5BNX B;  4NFT A;  2CV5 A;  1P3L D;  1P3B D;  3A6N A;  1P34 C;  4J8V C;  4ZUX C;  3MGR A;  3REK D;  5B40 D;  3X1S D;  5B1M A;  3MGP A;  5AVC D;  4EO5 B;  3X1T D;  4J8W B;  5DNM A;  3AZH D;  3X1V D;  4JJN D;  2F8N D;  3AN2 B;  5B0Z B;  3AZK A;  3C1B D;  3W97 A;  5B32 B;  2F8N K;  3UTA B;  5BO0 A;  3WAA B;  1KX4 B;  3AZL D;  4Z66 D;  1P3A D;  3VH5 W;  5B2J A;  1BH9 A;  3B0D B;  1P3I D;  5AV6 D;  5GXQ B;  4H9N B;  3REL D;  3REI D;  3REJ C;  3W99 D;  4G91 C;  1H3O A;  5B2I D;  1KX3 A;  4J8X D;  1P3O C;  1U35 A;  5GSU B;  5AV8 B;  5FUG A;  5DNN D;  5GT3 C;  5B0Y C;  3MNN A;  2HIO D;  3MGQ A;  5BT1 D;  2HUE C;  3NQJ B;  3TU4 A;  4WU8 C;  3R45 B;  3V9R B;  3UT9 A;  4E44 A;  3LZ1 B;  3WTP A;  5B1L D;  2ARO D;  3WKJ D;  1M18 A;  4LD9 A;  2CV5 B;  4E45 A;  3MGS A;  1P3G A;  1P3K C;  1P3O B;  3MGR B;  5B40 C;  4XUJ A;  5CPJ A;  5B1M B;  3MGP B;  1P3F D;  4KGC A;  2NZD C;  1M19 A;  5B31 C;  3AYW A;  5CPI C;  3LJA A;  5AVB A;  3AZK B;  3C1B C;  3W97 B;  4H9S A;  5AV9 D;  3NQU A;  5BO0 B;  2BYK B;  4YM6 C;  4H9P A;  3AZL C;  1EQZ A;  3O62 A;  4J8W D;  3AZJ D;  4X23 D;  2NZD B;  3AN2 D;  3AZM A;  1Q9C A;  5CPI B;  4XZQ A;  5B2J B;  4KUD C;  5B32 D;  1BH9 B;  4CSR A;  5AV6 C;  3REH A;  5GT0 A;  1S32 A;  3UTA D;  1P34 D;  1F66 A;  4ZUX D;  3REL C;  5E5A A;  3UTB A;  1KX4 D;  3W99 C;  1H3O B;  1KX3 B;  5F99 A;  1U35 B;  3AV1 A;  5BS7 A;  1TZY C;  5AY8 A;  5FUG B;  1KX5 C;  3AZF A;  3MNN B;  3AZG A;  2HIO C;  4Z5T A;  3MGQ B;  3TU4 B;  2PYO C;  4KUD B;  3UT9 B;  5KDM A;  3WTP B;  1AOI C;  2ARO C;  4LD9 B;  5AV5 A;  5B33 A;  5AV8 D;  1M18 B;  3MGS B;  1P3G B;  4ZBJ C;  1ID3 C;  2NQB C;  4XUJ B;  5CPJ B;  5B24 A;  1KX5 B;  4KGC B;  1M19 B;  3LZ1 D;  3AYW B;  2IO5 C;  5CPK C;  3LJA B;  5CHL B;  5AVB B;  4AWL B;  2CV5 D;  4UUZ A;  3MVD C;  1AOI B;  1P3O D;  3AV2 A;  4R8P A;  5B1M D;  4EO5 C;  2YFV A;  1HQ3 A;  5B0Y D;  1ID3 B;  4J8U A;  1P3M A;  1EQZ B;  2FJ7 A;  3O62 B;  3VH5 T;  3B0B A;  3VH5 A;  3AN2 C;  3VH6 W;  5B0Z C;  3AZK D;  3AZM B;  5CPK B;  4XZQ B;  5B32 C;  3W97 D;  4CSR B;  3REH B;  5GT0 B;  3UTA C;  1S32 B;  3AZN A;  1P3K D;  3MVD B;  1F66 B;  3W98 A;  5E5A B;  3WAA C;  1KX4 C;  4M6B A;  5F99 B;  2NZD D;  5AY8 B;  2JSS A;  5B31 D;  1M1A C;  4YS3 A;  5CPI D;  5B2J D;  3AZF B;  3B0D C;  5JA4 A;  3AZG B;  5GXQ C;  3W96 C;  4QLC A;  4Z5T B;  5KDM B;  3WA9 A;  1KX3 D;  4YM6 D;  1BFM A;  5GSU C;  5AV5 B;  5B33 B;  5AV8 C;  3B6G A;  3KXB A;  3MNN D;  1ZLA A;  3B6F A;  5B24 B;  3MGQ D;  1M1A B;  4WU9 A;  4KUD D;  3UT9 D;  4Z2M H;  3LZ1 C;  3W96 B;  3AZI A;  3WTP D;  3KWQ A;  1P3P A;  3C1C A;  1M18 D;  2CV5 C;  3A6N C;  3MGS D;  1P3G D;  4UUZ B;  3AZE A;  3MGR C;  5CP6 A;  1TZY D;  1P3L A;  1P3B A;  3AV2 B;  4R8P B;  5B1M C;  5CPJ D;  3MGP C;  1KX5 D;  4KGC D;  2YFV B;  1HQ3 B;  1M19 D;  4J8U B;  1P3M B;  2FJ7 B;  1HTA A;  3REK A;  3X1S A;  3AYW D;  5BNV B;  5DNM C;  3LJA D;  2RVQ C;  2PYO D;  5AVB D;  5AVC A;  3AZK C;  4HGA B;  3X1T A;  1AOI D;  3W97 C;  3AZH A;  3X1U A;  3X1V A;  4JJN A;  2F8N A;  3A6N B;  3AZN B;  3W98 B;  1ID3 D;  2NQB D;  1EQZ D;  3WTP E;  5CPK D;  4YS3 B;  5B2J C;  5DNM B;  4WNN B;  5JA4 B;  5GT0 D;  4Z66 A;  1P3A A;  1A7W A;  1F66 D;  3MVD D;  1P3I A;  1KX3 C;  3WA9 B;  1U35 C;  4H9O A;  3B6G B;  3REI A;  3KXB B;  5B2I A;  4WV4 B;  3AZF D;  4J8X A;  3MNN C;  5B0Z D;  1ZLA B;  3KSY A;  3MGQ C;  3TU4 C;  3B6F B;  4WU9 B;  5DNN A;  3UT9 C;  4WZS B;  3WTP C;  3KWQ B;  1P3P B;  4LD9 C;  3C1C B;  5AV5 D;  5B33 D;  1M18 C;  3WAA D;  3MGS C;  1P3G C;  1ULY A;  3AZE B;  3AFA A;  5C3I C;  4H9R A;  5CP6 B;  5B1L A;  3WKJ A;  3KUY A;  1P3L B;  4XUJ C;  5CPJ C;  4KGC C;  1M1A D;  1M19 C;  5GXQ D;  3REK B;  3AYW C;  3W96 D;  3LJA C;  1P3F A;  3VH6 T;  5AVB C;  3VH6 A;  5AVC B;  4DRB A;  4AWL C;  4H9Q A;  1WWI A;  4H9S C;  3AZH B;  3X1U B;  5GSU D;  3X1V B;  4JJN B;  2F8N B;  4G92 B;  5C3I B;  1HQ3 D;  5AV9 A;  1EQZ C;  3O62 C;  3AZM C;  3LZ0 A;  4XZQ C;  4J8W A;  3REH C;  3AZJ A;  5GT0 C;  1S32 C;  4Z66 B;  4X23 A;  3LEL A;  3A6N D;  3AZN D;  1P3A B;  1F66 C;  3UTB C;  2CWE A;  5E5A C;  5JRG A;  3MGR D;  1P3I B;  2F8N G;  3NQU B;  5F99 C;  1P34 A;  3MGP D;  4J8V A;  4H9P B;  3AV1 C;  4H9O B;  5BS7 C;  4ZUX A;  5AY8 C;  3REI B;  1TAF A;  5B2I B;  5DNM D;  3AZF C;  2RVQ D;  4J8X B;  3AZG C;  4Z5T C;  1KU5 A;  5DNN B;  4H9N A;  3UTB B;  5AV5 C;  5B33 C;  3B6G D;  3AFA B;  4CAY A;  4H9R B;  3AV1 B;  4NE5 A;  5B1L B;  3WKJ B;  3KUY B;  5B24 C;  1P3F B;  3C1C D;  4H9Q B;  1U35 D;  5CP6 D;  3REJ A;  3AV2 C;  4R8P C;  4NE3 A;  1P3O A;  1HQ3 C;  5AV9 B;  2FJ7 C;  4J8U C;  1P3M C;  3TU4 D;  5GT3 A;  5B0Y A;  4HGA C;  3LZ0 B;  4WU8 A;  4LD9 D;  3X1U D;  3AZJ B;  4X23 B;  3LEL B;  3AZN C;  3W98 C;  5JRG B;  4XUJ D;  1P34 B;  2BYK A;  4J8V B;  1P3K A;  4ZUX B;  1TAF B;  5B40 A;  4YS3 C;  4DRA A;  1B67 A;  1WWS A;  4QLC C;  2NZD A;  5B31 A;  5CPI A;  3B0C W;  4WNN A;  1N1J A;  3WA9 C;  3C1B A;  4Z2M G;  5B32 G;  3B6G C;  3KXB C;  3O62 D;  4YM6 A;  4CAY B;  3AZM D;  1ZLA C;  3AZL A;  3B6F C;  1F1E A;  4XZQ D;  4WU9 C;  3REH D;  1S32 D;  4QLC B;  3AZI C;  3KWQ C;  1P3P C;  3UTB D;  5E5A D;  3C1C C;  4KUD A;  5AV6 A;  3AZE C;  5F99 D;  3AFA D;  5CP6 C;  3AV1 D;  3REL A;  5AY8 D;  3KUY D;  3REJ B;  1P3L C;  1P3B C;  3W99 A;  4G91 B;  1BH8 A;  3AZG D;  3REK C;  1TZY A;  3X1S C;  4Z5T D;  1KX5 A;  2LY8 A;  5AVC C;  5GT3 B;  5G49 A;  5B0Y B;  2HIO A;  3X1T C;  3AZI B;  4WU8 B;  3X1U C;  2HUE B;  3X1V C;  3AZH C;  2PYO A;  4JJN C;  4G92 C;  1AOI A;  2ARO A;  1JFI A;  2YFW A;  1P3B B;  5B24 D;  1P3K B;  2BYM A;  1ID3 A;  5B40 B;  3X1S B;  4KHA A;  3LZ0 D;  2NQB A;  4Z66 C;  1P3A C;  3LEL D;  5B31 B;  3X1T B;  5CPK A;  5JRG D; 
#chains in the Genus database with same CATH topology
 5BNX A;  1N1J B;  1P3I C;  3AV2 D;  4R8P D;  3C1B B;  4J8V D;  3MVD A;  3REI C;  2FJ7 D;  4J8U D;  1P3M D;  5B2I C;  4YM6 B;  4J8X C;  2Y2G A;  4NE6 A;  3AZL B;  5DNN C;  3AN2 A;  5B31 G;  5B0Z A;  2F8N H;  5BT1 C;  3W98 D;  5B32 A;  5AV6 B;  3UTA A;  3AFA C;  5B1L C;  3REL B;  3WKJ C;  3KUY C;  3WAA A;  1KX4 A;  3W99 B;  4YS3 D;  1BH8 B;  2L5A A;  4QLC D;  1TZY B;  1P3F C;  1M1A A;  1Z2C B;  2Y2L A;  5G49 B;  2HIO B;  5GXQ A;  3W96 A;  3WA9 D;  3EPK A;  2PYO B;  3KXB D;  3REJ D;  2ARO B;  3F6T A;  5AV9 C;  5GSU A;  1JFI B;  5AV8 A;  1B6W A;  2YFW B;  1ZLA D;  3B6F D;  4WU9 D;  1R4V A;  4ZBJ B;  5GT3 D;  2BYM B;  4KHA B;  3LZ0 C;  2NQB B;  3AZI D;  5BNV A;  3KWQ D;  4J8W C;  3NQJ A;  3AZJ C;  4WU8 D;  1P3P D;  3R45 A;  3V9R A;  4X23 C;  3LEL C;  3B0C T;  3LZ1 A;  3AZE D;  2IO5 B;  5JRG C;  5BNX B;  4NFT A;  2RIQ A;  2CV5 A;  1P3L D;  1P3B D;  3A6N A;  1P34 C;  4J8V C;  4ZUX C;  2ZY2 A;  3MGR A;  3A1I A;  3REK D;  5B40 D;  3X1S D;  3H0M C;  5B1M A;  3MGP A;  5AVC D;  4EO5 B;  3X1T D;  3EG5 B;  4J8W B;  5DNM A;  3AZH D;  2Y2K A;  3X1V D;  4JJN D;  2F8N D;  3AN2 B;  5B0Z B;  3AZK A;  3C1B D;  3W97 A;  5B32 B;  2F8N K;  3UTA B;  5BO0 A;  3WAA B;  1KX4 B;  3AZL D;  4Z66 D;  1P3A D;  3VH5 W;  5B2J A;  1BH9 A;  3B0D B;  1P3I D;  5AV6 D;  5GXQ B;  4H9N B;  3REL D;  1W2E A;  3REI D;  3REJ C;  2Y2N A;  3W99 D;  4G91 C;  1H3O A;  5B2I D;  1KX3 A;  4J8X D;  1P3O C;  1U35 A;  5GSU B;  5AV8 B;  5FUG A;  5DNN D;  5GT3 C;  5B0Y C;  3MNN A;  2HIO D;  3MGQ A;  5BT1 D;  2HUE C;  3NQJ B;  3TU4 A;  4WU8 C;  3R45 B;  3V9R B;  3UT9 A;  4E44 A;  3LZ1 B;  3WTP A;  5B1L D;  2ARO D;  3WKJ D;  3EPJ A;  1M18 A;  4LD9 A;  2CV5 B;  4E45 A;  3MGS A;  1P3G A;  1P3K C;  1P3O B;  3MGR B;  5B40 C;  4XUJ A;  5CPJ A;  5B1M B;  3MGP B;  1P3F D;  4KGC A;  2NZD C;  1M19 A;  5B31 C;  3AYW A;  5CPI C;  3LJA A;  5AVB A;  3AZK B;  3C1B C;  3W97 B;  4H9S A;  5AV9 D;  3NQU A;  5BO0 B;  2BYK B;  4YM6 C;  4H9P A;  4UPK A;  3AZL C;  1EQZ A;  3O62 A;  4J8W D;  3AZJ D;  4X23 D;  2NZD B;  3AN2 D;  3AZM A;  1Q9C A;  5CPI B;  4XZQ A;  5B2J B;  4KUD C;  5B32 D;  1BH9 B;  4CSR A;  5AV6 C;  3REH A;  5GT0 A;  1S32 A;  3UTA D;  1P34 D;  1F66 A;  4ZUX D;  3REL C;  5E5A A;  3UTB A;  1KX4 D;  3W99 C;  1H3O B;  1KX3 B;  1T3U A;  5F99 A;  1U35 B;  3AV1 A;  5BS7 A;  1TZY C;  5AY8 A;  2J8P A;  5FUG B;  1KX5 C;  3AZF A;  3MNN B;  3AZG A;  2ZY3 A;  2HIO C;  4Z5T A;  3MGQ B;  3TU4 B;  2PYO C;  4KUD B;  3UT9 B;  5KDM A;  3WTP B;  1AOI C;  2ARO C;  4LD9 B;  2VQR A;  5AV5 A;  5AV8 D;  5B33 A;  1M18 B;  3MGS B;  1P3G B;  2G5H C;  4ZBJ C;  1ID3 C;  2NQB C;  4XUJ B;  5CPJ B;  5B24 A;  1KX5 B;  4KGC B;  1M19 B;  3LZ1 D;  3AYW B;  2IO5 C;  5CPK C;  3LJA B;  2XD1 A;  5CHL B;  5AVB B;  4AWL B;  2CV5 D;  4UUZ A;  3MVD C;  1AOI B;  1P3O D;  3AV2 A;  4R8P A;  5B1M D;  4EO5 C;  2YFV A;  1HQ3 A;  5B0Y D;  1ID3 B;  4J8U A;  1P3M A;  1EQZ B;  2FJ7 A;  3O62 B;  3VH5 T;  3B0B A;  3VH5 A;  3AN2 C;  2Y2M A;  3VH6 W;  5B0Z C;  3AZK D;  3AZM B;  5CPK B;  4XZQ B;  5B32 C;  3W97 D;  2ZY5 A;  4CSR B;  3REH B;  5GT0 B;  3UTA C;  1S32 B;  3AZN A;  1P3K D;  3MVD B;  1F66 B;  3W98 A;  5E5A B;  3WAA C;  1KX4 C;  4M6B A;  2XD5 A;  5F99 B;  2NZD D;  5AY8 B;  2JSS A;  5B31 D;  1M1A C;  4YS3 A;  5CPI D;  5B2J D;  3AZF B;  3B0D C;  5JA4 A;  3AZG B;  5GXQ C;  3W96 C;  3FDD A;  4QLC A;  4Z5T B;  5KDM B;  3WA9 A;  1KX3 D;  4YM6 D;  1BFM A;  5GSU C;  5AV5 B;  5B33 B;  5AV8 C;  3B6G A;  3KXB A;  3MNN D;  2BG1 A;  2Y2O A;  1ZLA A;  3B6F A;  5B24 B;  3MGQ D;  1M1A B;  4WU9 A;  4KUD D;  4WJ3 C;  3UT9 D;  4Z2M H;  3LZ1 C;  3W96 B;  3AZI A;  3WTP D;  3KWQ A;  1P3P A;  3C1C A;  1M18 D;  2CV5 C;  3A6N C;  3MGS D;  1P3G D;  2DQN C;  4UUZ B;  3AZE A;  4DQY B;  3MGR C;  5CP6 A;  1TZY D;  1P3L A;  1P3B A;  3AV2 B;  4R8P B;  5B1M C;  5CPJ D;  3MGP C;  1KX5 D;  4KGC D;  2YFV B;  1HQ3 B;  1M19 D;  4J8U B;  1P3M B;  2FJ7 B;  1HTA A;  3REK A;  3X1S A;  3AYW D;  5BNV B;  5DNM C;  3LJA D;  2RVQ C;  2PYO D;  5AVB D;  5AVC A;  3AZK C;  4HGA B;  3X1T A;  1AOI D;  3W97 C;  3AZH A;  3X1U A;  3X1V A;  4JJN A;  2F8N A;  3A6N B;  3AZN B;  3IP4 C;  3W98 B;  1ID3 D;  2NQB D;  1EQZ D;  3WTP E;  5CPK D;  4YS3 B;  5B2J C;  5DNM B;  4WNN B;  5JA4 B;  5GT0 D;  4Z66 A;  1P3A A;  1A7W A;  1F66 D;  3MVD D;  1P3I A;  2FFF B;  2DF4 C;  1KX3 C;  3WA9 B;  1U35 C;  2F2A C;  4H9O A;  3B6G B;  3REI A;  2JE5 A;  3KXB B;  5B2I A;  4WV4 B;  3AZF D;  4J8X A;  3MNN C;  5B0Z D;  1ZLA B;  3KSY A;  3MGQ C;  3TU4 C;  3B6F B;  4WU9 B;  5DNN A;  3UT9 C;  2Y2P A;  4WZS B;  2G5I C;  3WTP C;  3KWQ B;  1P3P B;  4LD9 C;  3C1C B;  5AV5 D;  5B33 D;  1M18 C;  3WAA D;  3MGS C;  1P3G C;  1ULY A;  3AZE B;  3AFA A;  5C3I C;  4H9R A;  5CP6 B;  5B1L A;  3WKJ A;  3KUY A;  1P3L B;  4XUJ C;  5CPJ C;  4KGC C;  1M1A D;  1M19 C;  5GXQ D;  3REK B;  3AYW C;  3W96 D;  3LJA C;  1P3F A;  3VH6 T;  5AVB C;  3VH6 A;  5AVC B;  4DRB A;  4AWL C;  4H9Q A;  1WWI A;  4H9S C;  3AZH B;  3X1U B;  5GSU D;  3X1V B;  4JJN B;  2F8N B;  4G92 B;  5C3I B;  1HQ3 D;  5AV9 A;  1EQZ C;  3O62 C;  3H0R C;  3AZM C;  3LZ0 A;  4XZQ C;  4J8W A;  3REH C;  3AZJ A;  5GT0 C;  2UWX A;  4Z66 B;  4X23 A;  3LEL A;  3A6N D;  3AZN D;  1S32 C;  1P3A B;  1F66 C;  3UTB C;  2CWE A;  5E5A C;  5JRG A;  3MGR D;  2ZM5 A;  1P3I B;  2F8N G;  3NQU B;  5F99 C;  1P34 A;  3MGP D;  4J8V A;  4H9P B;  3AV1 C;  4H9O B;  5BS7 C;  4ZUX A;  5AY8 C;  3REI B;  1TAF A;  3H0L C;  5B2I B;  5DNM D;  3AZF C;  2RVQ D;  4J8X B;  3AZG C;  4Z5T C;  1KU5 A;  5DNN B;  2ZY4 A;  4H9N A;  5AV5 C;  3UTB B;  5B33 C;  3B6G D;  3A1K A;  3AFA B;  4CAY A;  4H9R B;  3AV1 B;  4NE5 A;  5B1L B;  3WKJ B;  3KUY B;  5B24 C;  3AL0 C;  1P3F B;  3C1C D;  4H9Q B;  1U35 D;  5CP6 D;  3REJ A;  3AV2 C;  4R8P C;  4NE3 A;  1P3O A;  1HQ3 C;  5AV9 B;  2FJ7 C;  4J8U C;  1P3M C;  3TU4 D;  5GT3 A;  5B0Y A;  4HGA C;  3LZ0 B;  4WU8 A;  4LD9 D;  3X1U D;  3AZJ B;  4X23 B;  3LEL B;  3AZN C;  2Y2J A;  3W98 C;  5JRG B;  4XUJ D;  1P34 B;  2BYK A;  4J8V B;  1P3K A;  4ZUX B;  1TAF B;  5B40 A;  4YS3 C;  4DRA A;  1B67 A;  1WWS A;  4QLC C;  2NZD A;  5B31 A;  5CPI A;  3B0C W;  4WNN A;  1N1J A;  3WA9 C;  3C1B A;  4Z2M G;  5B32 G;  3B6G C;  3KXB C;  3O62 D;  4YM6 A;  4CAY B;  3EPH A;  3AZM D;  1ZLA C;  3AZL A;  3B6F C;  1F1E A;  4XZQ D;  4WU9 C;  3REH D;  1S32 D;  4QLC B;  3EPL A;  3AZI C;  3KWQ C;  1P3P C;  3UTB D;  5E5A D;  3C1C C;  4KUD A;  5AV6 A;  3AZE C;  5F99 D;  3AFA D;  5CP6 C;  3AV1 D;  3REL A;  5AY8 D;  3KUY D;  3REJ B;  1P3L C;  1P3B C;  3W99 A;  4G91 B;  1BH8 A;  2Y2H A;  3AZG D;  3REK C;  1TZY A;  3X1S C;  4Z5T D;  3KFU G;  1KX5 A;  2LY8 A;  5AVC C;  5GT3 B;  5G49 A;  5B0Y B;  2HIO A;  3X1T C;  3AZI B;  1PZR A;  2Y2Q A;  4WU8 B;  2HUE B;  3X1U C;  3X1V C;  3AZH C;  4JJN C;  2PYO A;  4G92 C;  1AOI A;  2ARO A;  1JFI A;  2JCH A;  2YFW A;  3P5J B;  1P3B B;  5B24 D;  1P3K B;  2Y2I A;  2W8S A;  2BYM A;  1ID3 A;  5B40 B;  4KHA A;  3X1S B;  3LZ0 D;  2NQB A;  4Z66 C;  1P3A C;  3LEL D;  5B31 B;  3X1T B;  5CPK A;  5JRG D; 
#chains in the Genus database with same CATH homology
 5BNX A;  1N1J B;  1P3I C;  3AV2 D;  4R8P D;  3C1B B;  4J8V D;  3MVD A;  3REI C;  2FJ7 D;  4J8U D;  1P3M D;  5B2I C;  4YM6 B;  4J8X C;  2Y2G A;  4NE6 A;  3AZL B;  5DNN C;  3AN2 A;  5B31 G;  5B0Z A;  2F8N H;  5BT1 C;  3W98 D;  5B32 A;  5AV6 B;  3UTA A;  3AFA C;  5B1L C;  3REL B;  3WKJ C;  3KUY C;  3WAA A;  1KX4 A;  3W99 B;  4YS3 D;  1BH8 B;  2L5A A;  4QLC D;  1TZY B;  1P3F C;  1M1A A;  1Z2C B;  2Y2L A;  5G49 B;  2HIO B;  5GXQ A;  3W96 A;  3WA9 D;  3EPK A;  2PYO B;  3KXB D;  3REJ D;  2ARO B;  3F6T A;  5AV9 C;  5GSU A;  1JFI B;  5AV8 A;  1B6W A;  2YFW B;  1ZLA D;  3B6F D;  4WU9 D;  1R4V A;  4ZBJ B;  5GT3 D;  2BYM B;  4KHA B;  3LZ0 C;  2NQB B;  3AZI D;  5BNV A;  3KWQ D;  4J8W C;  3NQJ A;  3AZJ C;  4WU8 D;  1P3P D;  3R45 A;  3V9R A;  4X23 C;  3LEL C;  3B0C T;  3LZ1 A;  3AZE D;  2IO5 B;  5JRG C;  5BNX B;  4NFT A;  2RIQ A;  2CV5 A;  1P3L D;  1P3B D;  3A6N A;  1P34 C;  4J8V C;  4ZUX C;  2ZY2 A;  3MGR A;  3A1I A;  3REK D;  5B40 D;  3X1S D;  3H0M C;  5B1M A;  3MGP A;  5AVC D;  4EO5 B;  3X1T D;  3EG5 B;  4J8W B;  5DNM A;  3AZH D;  2Y2K A;  3X1V D;  4JJN D;  2F8N D;  3AN2 B;  5B0Z B;  3AZK A;  3C1B D;  3W97 A;  5B32 B;  2F8N K;  3UTA B;  5BO0 A;  3WAA B;  1KX4 B;  3AZL D;  4Z66 D;  1P3A D;  3VH5 W;  5B2J A;  1BH9 A;  3B0D B;  1P3I D;  5AV6 D;  5GXQ B;  4H9N B;  3REL D;  1W2E A;  3REI D;  3REJ C;  2Y2N A;  3W99 D;  4G91 C;  1H3O A;  5B2I D;  1KX3 A;  4J8X D;  1P3O C;  1U35 A;  5GSU B;  5AV8 B;  5FUG A;  5DNN D;  5GT3 C;  5B0Y C;  3MNN A;  2HIO D;  3MGQ A;  5BT1 D;  2HUE C;  3NQJ B;  3TU4 A;  4WU8 C;  3R45 B;  3V9R B;  3UT9 A;  4E44 A;  3LZ1 B;  3WTP A;  5B1L D;  2ARO D;  3WKJ D;  3EPJ A;  1M18 A;  4LD9 A;  2CV5 B;  4E45 A;  3MGS A;  1P3G A;  1P3K C;  1P3O B;  3MGR B;  5B40 C;  4XUJ A;  5CPJ A;  5B1M B;  3MGP B;  1P3F D;  4KGC A;  2NZD C;  1M19 A;  5B31 C;  3AYW A;  5CPI C;  3LJA A;  5AVB A;  3AZK B;  3C1B C;  3W97 B;  4H9S A;  5AV9 D;  3NQU A;  5BO0 B;  2BYK B;  4YM6 C;  4H9P A;  4UPK A;  3AZL C;  1EQZ A;  3O62 A;  4J8W D;  3AZJ D;  4X23 D;  2NZD B;  3AN2 D;  3AZM A;  1Q9C A;  5CPI B;  4XZQ A;  5B2J B;  4KUD C;  5B32 D;  1BH9 B;  4CSR A;  5AV6 C;  3REH A;  5GT0 A;  1S32 A;  3UTA D;  1P34 D;  1F66 A;  4ZUX D;  3REL C;  5E5A A;  3UTB A;  1KX4 D;  3W99 C;  1H3O B;  1KX3 B;  1T3U A;  5F99 A;  1U35 B;  3AV1 A;  5BS7 A;  1TZY C;  5AY8 A;  2J8P A;  5FUG B;  1KX5 C;  3AZF A;  3MNN B;  3AZG A;  2ZY3 A;  2HIO C;  4Z5T A;  3MGQ B;  3TU4 B;  2PYO C;  4KUD B;  3UT9 B;  5KDM A;  3WTP B;  1AOI C;  2ARO C;  4LD9 B;  2VQR A;  5AV5 A;  5AV8 D;  5B33 A;  1M18 B;  3MGS B;  1P3G B;  2G5H C;  4ZBJ C;  1ID3 C;  2NQB C;  4XUJ B;  5CPJ B;  5B24 A;  1KX5 B;  4KGC B;  1M19 B;  3LZ1 D;  3AYW B;  2IO5 C;  5CPK C;  3LJA B;  2XD1 A;  5CHL B;  5AVB B;  4AWL B;  2CV5 D;  4UUZ A;  3MVD C;  1AOI B;  1P3O D;  3AV2 A;  4R8P A;  5B1M D;  4EO5 C;  2YFV A;  1HQ3 A;  5B0Y D;  1ID3 B;  4J8U A;  1P3M A;  1EQZ B;  2FJ7 A;  3O62 B;  3VH5 T;  3B0B A;  3VH5 A;  3AN2 C;  2Y2M A;  3VH6 W;  5B0Z C;  3AZK D;  3AZM B;  5CPK B;  4XZQ B;  5B32 C;  3W97 D;  2ZY5 A;  4CSR B;  3REH B;  5GT0 B;  3UTA C;  1S32 B;  3AZN A;  1P3K D;  3MVD B;  1F66 B;  3W98 A;  5E5A B;  3WAA C;  1KX4 C;  4M6B A;  2XD5 A;  5F99 B;  2NZD D;  5AY8 B;  2JSS A;  5B31 D;  1M1A C;  4YS3 A;  5CPI D;  5B2J D;  3AZF B;  3B0D C;  5JA4 A;  3AZG B;  5GXQ C;  3W96 C;  3FDD A;  4QLC A;  4Z5T B;  5KDM B;  3WA9 A;  1KX3 D;  4YM6 D;  1BFM A;  5GSU C;  5AV5 B;  5B33 B;  5AV8 C;  3B6G A;  3KXB A;  3MNN D;  2BG1 A;  2Y2O A;  1ZLA A;  3B6F A;  5B24 B;  3MGQ D;  1M1A B;  4WU9 A;  4KUD D;  4WJ3 C;  3UT9 D;  4Z2M H;  3LZ1 C;  3W96 B;  3AZI A;  3WTP D;  3KWQ A;  1P3P A;  3C1C A;  1M18 D;  2CV5 C;  3A6N C;  3MGS D;  1P3G D;  2DQN C;  4UUZ B;  3AZE A;  4DQY B;  3MGR C;  5CP6 A;  1TZY D;  1P3L A;  1P3B A;  3AV2 B;  4R8P B;  5B1M C;  5CPJ D;  3MGP C;  1KX5 D;  4KGC D;  2YFV B;  1HQ3 B;  1M19 D;  4J8U B;  1P3M B;  2FJ7 B;  1HTA A;  3REK A;  3X1S A;  3AYW D;  5BNV B;  5DNM C;  3LJA D;  2RVQ C;  2PYO D;  5AVB D;  5AVC A;  3AZK C;  4HGA B;  3X1T A;  1AOI D;  3W97 C;  3AZH A;  3X1U A;  3X1V A;  4JJN A;  2F8N A;  3A6N B;  3AZN B;  3IP4 C;  3W98 B;  1ID3 D;  2NQB D;  1EQZ D;  3WTP E;  5CPK D;  4YS3 B;  5B2J C;  5DNM B;  4WNN B;  5JA4 B;  5GT0 D;  4Z66 A;  1P3A A;  1A7W A;  1F66 D;  3MVD D;  1P3I A;  2FFF B;  2DF4 C;  1KX3 C;  3WA9 B;  1U35 C;  2F2A C;  4H9O A;  3B6G B;  3REI A;  2JE5 A;  3KXB B;  5B2I A;  4WV4 B;  3AZF D;  4J8X A;  3MNN C;  5B0Z D;  1ZLA B;  3KSY A;  3MGQ C;  3TU4 C;  3B6F B;  4WU9 B;  5DNN A;  3UT9 C;  2Y2P A;  4WZS B;  2G5I C;  3WTP C;  3KWQ B;  1P3P B;  4LD9 C;  3C1C B;  5AV5 D;  5B33 D;  1M18 C;  3WAA D;  3MGS C;  1P3G C;  1ULY A;  3AZE B;  3AFA A;  5C3I C;  4H9R A;  5CP6 B;  5B1L A;  3WKJ A;  3KUY A;  1P3L B;  4XUJ C;  5CPJ C;  4KGC C;  1M1A D;  1M19 C;  5GXQ D;  3REK B;  3AYW C;  3W96 D;  3LJA C;  1P3F A;  3VH6 T;  5AVB C;  3VH6 A;  5AVC B;  4DRB A;  4AWL C;  4H9Q A;  1WWI A;  4H9S C;  3AZH B;  3X1U B;  5GSU D;  3X1V B;  4JJN B;  2F8N B;  4G92 B;  5C3I B;  1HQ3 D;  5AV9 A;  1EQZ C;  3O62 C;  3H0R C;  3AZM C;  3LZ0 A;  4XZQ C;  4J8W A;  3REH C;  3AZJ A;  5GT0 C;  2UWX A;  4Z66 B;  4X23 A;  3LEL A;  3A6N D;  3AZN D;  1S32 C;  1P3A B;  1F66 C;  3UTB C;  2CWE A;  5E5A C;  5JRG A;  3MGR D;  2ZM5 A;  1P3I B;  2F8N G;  3NQU B;  5F99 C;  1P34 A;  3MGP D;  4J8V A;  4H9P B;  3AV1 C;  4H9O B;  5BS7 C;  4ZUX A;  5AY8 C;  3REI B;  1TAF A;  3H0L C;  5B2I B;  5DNM D;  3AZF C;  2RVQ D;  4J8X B;  3AZG C;  4Z5T C;  1KU5 A;  5DNN B;  2ZY4 A;  4H9N A;  5AV5 C;  3UTB B;  5B33 C;  3B6G D;  3A1K A;  3AFA B;  4CAY A;  4H9R B;  3AV1 B;  4NE5 A;  5B1L B;  3WKJ B;  3KUY B;  5B24 C;  3AL0 C;  1P3F B;  3C1C D;  4H9Q B;  1U35 D;  5CP6 D;  3REJ A;  3AV2 C;  4R8P C;  4NE3 A;  1P3O A;  1HQ3 C;  5AV9 B;  2FJ7 C;  4J8U C;  1P3M C;  3TU4 D;  5GT3 A;  5B0Y A;  4HGA C;  3LZ0 B;  4WU8 A;  4LD9 D;  3X1U D;  3AZJ B;  4X23 B;  3LEL B;  3AZN C;  2Y2J A;  3W98 C;  5JRG B;  4XUJ D;  1P34 B;  2BYK A;  4J8V B;  1P3K A;  4ZUX B;  1TAF B;  5B40 A;  4YS3 C;  4DRA A;  1B67 A;  1WWS A;  4QLC C;  2NZD A;  5B31 A;  5CPI A;  3B0C W;  4WNN A;  1N1J A;  3WA9 C;  3C1B A;  4Z2M G;  5B32 G;  3B6G C;  3KXB C;  3O62 D;  4YM6 A;  4CAY B;  3EPH A;  3AZM D;  1ZLA C;  3AZL A;  3B6F C;  1F1E A;  4XZQ D;  4WU9 C;  3REH D;  1S32 D;  4QLC B;  3EPL A;  3AZI C;  3KWQ C;  1P3P C;  3UTB D;  5E5A D;  3C1C C;  4KUD A;  5AV6 A;  3AZE C;  5F99 D;  3AFA D;  5CP6 C;  3AV1 D;  3REL A;  5AY8 D;  3KUY D;  3REJ B;  1P3L C;  1P3B C;  3W99 A;  4G91 B;  1BH8 A;  2Y2H A;  3AZG D;  3REK C;  1TZY A;  3X1S C;  4Z5T D;  3KFU G;  1KX5 A;  2LY8 A;  5AVC C;  5GT3 B;  5G49 A;  5B0Y B;  2HIO A;  3X1T C;  3AZI B;  1PZR A;  2Y2Q A;  4WU8 B;  2HUE B;  3X1U C;  3X1V C;  3AZH C;  4JJN C;  2PYO A;  4G92 C;  1AOI A;  2ARO A;  1JFI A;  2JCH A;  2YFW A;  3P5J B;  1P3B B;  5B24 D;  1P3K B;  2Y2I A;  2W8S A;  2BYM A;  1ID3 A;  5B40 B;  4KHA A;  3X1S B;  3LZ0 D;  2NQB A;  4Z66 C;  1P3A C;  3LEL D;  5B31 B;  3X1T B;  5CPK A;  5JRG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...