2F8NH

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
total genus 35
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nH00
4H9OB 5CP6D 5CPKA 3AZKA 5AVCA 1ZLAA 3LJAD 3AZLA 3AV1D 3X1VD 4EO5C 2F8NG 1M19B 3LZ1D 4H9NA 5AV6A 2FJ7D 4E44A 4KGCB 3X1UB 4R8PD 3VH6A 4X23B 3WTPB 4KHAB 3AZHC 2NZDB 3AZIC 4J8WC 4ZUXA 3AZEC 5AV5D 3MGRC 3WA9D 3B6GB 1P3ID 1KX5A 2AROB 3REHA 4HGAC 2HIOC 1S32A 3W98D 3AZJD 5B33C 2PYOB 3AZGA 5B32C 1P3OC 1M18B 3MGPD 3MVDC 5B2JA 3REKA 3WKJC 5JRGC 5CPIA 2RVQD 5AVBA 5B24B 3W97B 3WAAC 5C3IB 3R45A 3C1BD 4XUJA 1HQ3A 1F66B 5CPKC 4ZBJC 5B0YA 5B1LB 4Z5TC 3MNNA 3AZLC 3KXBD 4JJNA 5B31B 3X1TA 1P3PB 1TZYC 5GXQB 1P3MB 5AV6C 4DRBA 3AN2C 3UTAA 3W99A 1N1JB 5FUGB 4QLCC 1ZLAB 5B0ZA 5AV8B 1P3LA 5B1MD 3AZFA 3AZMC 3B0CW 1EQZC 4CAYA 3C1CA 3AV2B 1P3GC 4Z2MH 3REHC 3AZNA 3AZHD 3NQUA 4NFTA 3AZID 1M1AA 4J8WD 3B6FC 3VH5T 3KWQA 5E5AB 3AZGC 4WNNB 3AZED 3MGRD 5BNVA 4CSRA 1KX4B 5KDMB 1P3KB 4AWLB 3V9RB 4H9OA 2HIOD 5DNNB 5CPIC 5GT3C 5B33D 5AVBC 5B32D 1P3OD 1HTAA 5AY8B 5BNXB 1HQ3C 3WKJD 3RELB 3UT9B 5JRGD 5B0YC 1KX3D 4KGCA 3X1UA 1ID3B 4X23A 1U35B 3WAAD 4J8UB 3WTPA 4KHAA 4KUDB 2NZDA 5CPKD 2CV5B 3UTAC 1P3BC 4Z5TD 3AZLD 4XZQB 3TU4B 3AZFC 3B6GA 1TZYD 2AROA 1P3AC 3O62B 5AV6D 4J8XC 2F8NH 3AN2D 2PYOA 2IO5C 4QLCD 4H9QB 4WU9B 1M18A 4H9SA 2F8ND 2NQBC 3AZMD 5B2IB 3AZNC 3X1VB 1M1AC 1EQZD 3KWQC 1BH8A 2HUEB 2JSSA 4CAYB 4YS3C 5B24A 3W97A 3LZ1B 5B31G 1P34C 3UTBD 1F66A 1P3GD 3MGSD 4WU8B 5B1LA 3B6FD 3AZGD 4LD9A 5B31A 1M19C 1P3PA 5GXQA 1P3MA 3LZ0C 4YM6B 5GT3D 5CPID 1N1JA 5FUGA 5AV8A 3AZJB 5BT1C 3WTPC 3X1SD 5BS7A 2NZDC 3MGPB 3VH5A 5F99C 3AV2A 3REIC 5GT0B 1AOIC 2AROC 3B0BA 3C1BB 1P3BD 3UTAD 5E5AA 4WNNA 3VH6W 1M18C 1KX4A 3AZFD 5KDMA 1P3AD 1P3KA 3V9RA 4J8XD 4Z66C 5DNNA 1P3FC 3W96B 5B24C 3KUYC 5C3IC 1B67A 1F1EA 5AY8A 5GSUC 5BNXA 1F66C 2NQBD 3REJA 3AZND 3RELA 3AFAB 3UT9A 5B1MB 1M1AD 1BH8B 4YS3D 3KWQD 1ID3A 1P34D 1U35A 5CHLB 4J8UA 1P3PC 5GXQC 3B0DC 5CPJC 1P3MC 4KUDA 3AZKC 2CV5A 4E45A 5AVCC 1H3OA 1ZLAC 3AZHB 4LD9B 4XZQA 3TU4A 4J8VB 1M19D 5BS7C 3O62A 3AZEB 3MGRB 3LZ0D 5AV9B 4WU9A 4H9QA 4HGAB 2HIOB 3AV2C 5BT1D 3WTPD 5B2IA 1P3OB 4H9RB 2NZDD 3X1VA 4G92B 4ZUXC 3LZ1A 3AYWB 5E5AC 3WKJB 2BYKB 5F99D 3A6NB 3REID 1KX3B 1KX5C 1AOID 1P3KC 1KU5A 3WAAB 4WU8A 5DNNC 1S32C 1M18D 4ZBJB 3LELB 3REKC 5B2JC 4Z5TB 4Z66D 3RELC 3UT9C 4YM6A 1BFMA 1P3FD 1TZYB 1ID3C 5B24D 3KUYD 3W98A 3AZJA 3AN2B 3MGQB 1U35C 3MVDD 5GSUD 1R4VA 4XUJC 1F66D 3NQJB 4QLCB 4KUDC 3REJB 3MGPA 2CV5C 3MNNC 3AZMB 1EQZB 4JJNC 5GT0A 3X1TC 1JFIB 1P3PD 5CPJD 5B40B 3AZKD 3C1BA 3W99C 3UTBB 5AVCD 1H3OB 5DNMB 1P3GB 1ZLAD 3MGSB 4WU9C 5B0ZC 1P3LC 3B6FB 2YFWB 5B2IC 3X1VC 2HUEC 3W96A 5CP6B 3C1CC 1ULYA 3KSYA 3AV2D 5GT3B 2LY8A 3LJAB 3AV1B 3AFAA 5B1MA 4WU8C 3X1SB 4ZUXD 5E5AD 2FJ7B 4R8PB 1KX5D 3REHD 4YM6C 4Z2MG 5DNND 1S32D 5BO0B 3AZHA 1P3BB 4J8VA 3REKD 5B2JD 3AZEA 5AV5B 3MGRA 3WA9B 3RELD 3UT9D 5AV9A 1P3IB 4KGCC 3X1UC 3B0CT 4G91B 1P3AB 1BH9B 5AVBD 4J8XB 1ID3D 2HIOA 3W98B 4X23C 1U35D 5GT0C 2IO5B 4WV4B 4XUJD 1HQ3D 1P3OA 4H9RA 5B0YD 3AYWA 2CV5D 3WKJA 2BYKA 1Q9CA 3MNND 3A6NA 4JJND 1KX3A 4YS3B 3B6GC 3X1TD 1P34B 3WAAA 2PYOC 3VH5W 3W96C 3W99D 4WU9D 5B0ZD 1A7WA 1WWSA 3LELA 1P3LD 4H9SC 4Z5TA 5B2ID 3KXBB 3AFAC 5B1MC 4NE3A 1TZYA 3W97C 3LZ0B 3C1CD 3AN2A 3MGQA 3NQJA 4QLCA 4EO5B 4WU8D 5B1LC 2F8NA 3AZMA 4LD9C 1EQZA 5B31C 1JFIA 4J8VC 5B40A 5JA4B 5F99B 3REIB 5AV9C 4YM6D 3UTBA 5DNMA 1AOIB 1P3GA 4WZSB 3MGSA 3AZIB 4J8WB 5AV8C 3B6FA 2YFWA 5G49B 1TAFB 4G92C 2F8NK 3AYWC 4KGCD 3X1UD 5CP6A 4Z66B 3A6NC 5GT3A 4X23D 5B33B 1P3FB 1KX3C 5GT0D 5B32B 3LJAA 3KUYB 3AV1A 3X1SA 3MVDB 5GSUB 2YFVB 4M6BA 4UUZB 4H9PB 2FJ7A 5JRGB 3LELC 1KX4C 3B6GD 4R8PA 2BYMB 2AROD 4AWLC 2PYOD 5BO0A 3B0DB 5CPJB 3W96D 2L5AA 5CPKB 3MGQC 3AZKB 1P3BA 5AY8C 5AVCB 5AV5A 3REJC 3WA9A 3AZLB 3AFAD 1P3IA 1P3AA 4H9NB 1BH9A 5AV6B 4J8XA 3W97D 4J8UC 5B40C 3UTBC 5B1LD 5DNMC 2F8NB 2NQBA 3MGSC 4LD9D 4XZQC 5B31D 4ZUXB 3TU4C 4YS3A 4J8VD 5GXQD 1P3MD 3O62C 3VH6T 1P34A 5AV9D 1KX5B 3REHB 5CP6C 1S32B 4NE6A 5AV8D 3AZGB 3LJAC 3KXBA 3AV1C 3REKB 4NE5A 5B2JB 3LZ1C 3AYWD 3X1SC 1M19A 3LZ0A 2FJ7C 3A6ND 5CPIB 4R8PC 5AVBB 3R45B 4XUJB 1HQ3B 5B0YB 3LELD 4DRAA 1KX4D 1B6WA 3MNNB 5AV5C 5JA4A 5F99A 1P3KD 3WA9C 3REIA 4JJNB 3X1TB 1P3IC 1AOIA 4G91C 3WTPE 3AZIA 4J8WA 3W98C 3AZJC 3MGQD 3UTAB 5AY8D 5B32G 3W99B 5G49A 1TAFA 5B0ZB 3REJD 3MGPC 1P3LB 1WWIA 2CWEA 3AZFB 4Z66A 2RVQC 1P3FA 5B33A 4J8UD 5B32A 5B40D 3KUYA 4KUDD 3C1CB 3MVDA 5GSUA 3C1BC 2YFVA 5DNMD 4UUZA 2NQBB 4H9PA 3AZNB 3NQUB 5JRGA 1M1AB 4XZQD 3KWQB 3TU4D 2BYMA 3O62D 3KXBC 5BNVB 4CSRB 5CPJA
chains in the Genus database with same CATH superfamily
4H9OB 5CP6D 5CPKA 3AZKA 5AVCA 1ZLAA 3LJAD 3AZLA 3AV1D 3X1VD 4EO5C 2F8NG 1M19B 3LZ1D 4H9NA 5AV6A 2FJ7D 4E44A 4KGCB 3X1UB 4R8PD 3VH6A 4X23B 3WTPB 4KHAB 3AZHC 2Y2PA 2NZDB 3AZIC 4J8WC 4ZUXA 1W2EA 3AZEC 5AV5D 3MGRC 3WA9D 3B6GB 1P3ID 1KX5A 2AROB 3REHA 4HGAC 2HIOC 1S32A 3W98D 3AZJD 5B33C 2PYOB 3AZGA 5B32C 1P3OC 1M18B 2Y2IA 2ZM5A 3MGPD 3MVDC 5B2JA 3REKA 3WKJC 5JRGC 5CPIA 2RVQD 5AVBA 5B24B 3W97B 3WAAC 5C3IB 3R45A 3C1BD 4XUJA 1HQ3A 2ZY5A 1F66B 5CPKC 4ZBJC 5B0YA 5B1LB 4Z5TC 3MNNA 3F6TA 3IP4C 3AZLC 3KXBD 4JJNA 5B31B 2ZY3A 3X1TA 1P3PB 1TZYC 5GXQB 1P3MB 2DQNC 5AV6C 1PZRA 4DRBA 3AN2C 3UTAA 3W99A 1N1JB 5FUGB 4QLCC 1ZLAB 5B0ZA 5AV8B 1P3LA 5B1MD 3AZFA 3AZMC 3B0CW 3P5JB 1EQZC 3FDDA 4CAYA 3EPHA 3C1CA 3AV2B 2Y2NA 1P3GC 4Z2MH 3REHC 3AZNA 3AZHD 3NQUA 4NFTA 3AZID 1M1AA 4J8WD 3B6FC 3VH5T 3KWQA 5E5AB 3AZGC 4WNNB 3AZED 3MGRD 5BNVA 2Y2QA 4CSRA 1KX4B 5KDMB 1P3KB 4AWLB 3V9RB 4H9OA 2HIOD 5DNNB 5CPIC 5GT3C 5B33D 5AVBC 5B32D 1P3OD 2Y2KA 1HTAA 5AY8B 5BNXB 1HQ3C 3WKJD 3RELB 3UT9B 2UWXA 5JRGD 5B0YC 1KX3D 4KGCA 3X1UA 1ID3B 4X23A 1U35B 3WAAD 4J8UB 3WTPA 4KHAA 4KUDB 2NZDA 5CPKD 2CV5B 3UTAC 1P3BC 4Z5TD 3AZLD 4XZQB 3TU4B 3AZFC 3B6GA 1TZYD 2AROA 1P3AC 3O62B 5AV6D 4J8XC 2F8NH 3AN2D 2PYOA 2DF4C 2IO5C 4QLCD 4H9QB 4WU9B 1M18A 4H9SA 2F8ND 2NQBC 3AZMD 5B2IB 3AZNC 2BG1A 3X1VB 1M1AC 1EQZD 3KWQC 1BH8A 2HUEB 2JSSA 4CAYB 4YS3C 5B24A 3W97A 3LZ1B 5B31G 1P34C 3UTBD 1F66A 1P3GD 3MGSD 4WU8B 5B1LA 3B6FD 3AZGD 4LD9A 5B31A 1M19C 1P3PA 5GXQA 1P3MA 2ZY4A 3LZ0C 4YM6B 5GT3D 5CPID 1N1JA 5FUGA 5AV8A 3AZJB 5BT1C 3WTPC 3X1SD 5BS7A 2NZDC 3MGPB 3VH5A 5F99C 3AV2A 3REIC 2W8SA 5GT0B 1AOIC 2AROC 3B0BA 3C1BB 1P3BD 3UTAD 5E5AA 4WNNA 3VH6W 1M18C 1KX4A 3AZFD 5KDMA 1P3AD 1P3KA 3V9RA 4J8XD 4Z66C 5DNNA 1P3FC 3W96B 5B24C 3KUYC 5C3IC 1B67A 1F1EA 5AY8A 5GSUC 5BNXA 1F66C 2NQBD 3REJA 3AZND 3RELA 3AFAB 3UT9A 5B1MB 1M1AD 1BH8B 4YS3D 3KWQD 1ID3A 1T3UA 1P34D 1U35A 5CHLB 4J8UA 1P3PC 5GXQC 3B0DC 5CPJC 1P3MC 2Y2JA 4KUDA 3AZKC 2CV5A 4E45A 5AVCC 1H3OA 1ZLAC 3AZHB 4LD9B 4XZQA 3TU4A 4J8VB 1M19D 5BS7C 3O62A 3AZEB 3MGRB 3LZ0D 5AV9B 3EPLA 2JCHA 4WU9A 4H9QA 4HGAB 2HIOB 3AV2C 5BT1D 3WTPD 1Z2CB 5B2IA 4H9RB 1P3OB 3X1VA 2NZDD 4G92B 4ZUXC 3LZ1A 3AYWB 5E5AC 3WKJB 2BYKB 5F99D 3A6NB 3REID 1KX3B 1KX5C 2G5HC 1P3KC 1AOID 1KU5A 3WAAB 4WU8A 5DNNC 1S32C 3A1KA 1M18D 4ZBJB 3LELB 3REKC 5B2JC 4Z5TB 4Z66D 3RELC 3UT9C 4YM6A 1BFMA 1P3FD 1TZYB 1ID3C 5B24D 2XD5A 3KUYD 3W98A 3AZJA 3AN2B 3MGQB 1U35C 3MVDD 5GSUD 1R4VA 4XUJC 1F66D 3NQJB 4QLCB 4KUDC 3REJB 3MGPA 2CV5C 3MNNC 3AZMB 1EQZB 4JJNC 5GT0A 3X1TC 1JFIB 1P3PD 5CPJD 5B40B 3AZKD 3C1BA 3W99C 3UTBB 5AVCD 1H3OB 5DNMB 2Y2HA 1P3GB 3MGSB 4WU9C 5B0ZC 1ZLAD 1P3LC 2G5IC 3B6FB 2YFWB 5B2IC 3X1VC 2HUEC 3W96A 2J8PA 5CP6B 3C1CC 1ULYA 3KSYA 3AV2D 5GT3B 3EG5B 2LY8A 2ZY2A 3LJAB 3AV1B 3AFAA 5B1MA 4WU8C 3X1SB 4ZUXD 5E5AD 2FFFB 2FJ7B 4R8PB 1KX5D 3REHD 2JE5A 3A1IA 4Z2MG 5DNND 4YM6C 5BO0B 1S32D 3AZHA 1P3BB 4J8VA 3REKD 5B2JD 3AZEA 5AV5B 3MGRA 3WA9B 3RELD 3UT9D 5AV9A 1P3IB 4KGCC 3X1UC 3B0CT 4G91B 1P3AB 1BH9B 5AVBD 4J8XB 1ID3D 2HIOA 3W98B 4X23C 1U35D 3H0RC 5GT0C 2IO5B 4WV4B 4XUJD 1HQ3D 1P3OA 4H9RA 5B0YD 3AYWA 2CV5D 3KFUG 3WKJA 2BYKA 1Q9CA 3MNND 3A6NA 4JJND 1KX3A 4YS3B 3B6GC 3X1TD 1P34B 3WAAA 2PYOC 3VH5W 3W96C 3W99D 4WU9D 5B0ZD 1A7WA 1WWSA 3LELA 1P3LD 4H9SC 4Z5TA 5B2ID 3KXBB 3AFAC 5B1MC 4UPKA 4NE3A 1TZYA 3W97C 3LZ0B 3C1CD 3AN2A 3MGQA 2Y2MA 3NQJA 4QLCA 4EO5B 4WU8D 5B1LC 3EPJA 2F8NA 3AZMA 4LD9C 1EQZA 5B31C 1JFIA 4J8VC 5B40A 3EPKA 5JA4B 5F99B 3REIB 5AV9C 4YM6D 3UTBA 5DNMA 1AOIB 1P3GA 4WZSB 3MGSA 3AZIB 4J8WB 5AV8C 3B6FA 2YFWA 5G49B 1TAFB 4G92C 2F8NK 3AYWC 4KGCD 3X1UD 5CP6A 3H0LC 4Z66B 3A6NC 5GT3A 4X23D 5B33B 1P3FB 1KX3C 5GT0D 5B32B 3LJAA 3KUYB 3AV1A 3X1SA 3MVDB 5GSUB 2YFVB 4M6BA 4UUZB 4H9PB 2FJ7A 5JRGB 3LELC 1KX4C 3B6GD 4R8PA 2BYMB 2AROD 4AWLC 2VQRA 5BO0A 2PYOD 2Y2LA 3B0DB 5CPJB 3W96D 2L5AA 4WJ3C 5CPKB 3MGQC 3AZKB 1P3BA 5AY8C 3AL0C 5AVCB 5AV5A 3REJC 3WA9A 3AZLB 3AFAD 3H0MC 1P3IA 1P3AA 4H9NB 1BH9A 5AV6B 4J8XA 3W97D 4J8UC 5B40C 3UTBC 5B1LD 5DNMC 2F8NB 2NQBA 3MGSC 4LD9D 4XZQC 5B31D 4ZUXB 3TU4C 4YS3A 4J8VD 5GXQD 1P3MD 3O62C 3VH6T 1P34A 5AV9D 1KX5B 3REHB 5CP6C 1S32B 4NE6A 5AV8D 3AZGB 3LJAC 3KXBA 3AV1C 3REKB 4NE5A 5B2JB 3LZ1C 3AYWD 3X1SC 1M19A 3LZ0A 2FJ7C 3A6ND 5CPIB 4R8PC 5AVBB 3R45B 4XUJB 2F2AC 1HQ3B 5B0YB 3LELD 4DQYB 4DRAA 1KX4D 2XD1A 1B6WA 3MNNB 5AV5C 5JA4A 5F99A 1P3KD 3WA9C 3REIA 4JJNB 3X1TB 1P3IC 1AOIA 4G91C 3WTPE 3AZIA 4J8WA 3W98C 3AZJC 3MGQD 3UTAB 5AY8D 5B32G 3W99B 5G49A 1TAFA 5B0ZB 3REJD 3MGPC 1P3LB 1WWIA 2CWEA 3AZFB 4Z66A 2Y2GA 2RVQC 1P3FA 5B33A 4J8UD 5B32A 5B40D 3KUYA 4KUDD 3C1CB 2Y2OA 3MVDA 5GSUA 3C1BC 2YFVA 5DNMD 4UUZA 2NQBB 4H9PA 3AZNB 3NQUB 5JRGA 1M1AB 2RIQA 4XZQD 3KWQB 3TU4D 2BYMA 3O62D 3KXBC 5BNVB 4CSRB 5CPJA
chains in the Genus database with same CATH topology
4H9OB 5CP6D 5CPKA 3AZKA 5AVCA 1ZLAA 3LJAD 3AZLA 3AV1D 3X1VD 4EO5C 2F8NG 1M19B 3LZ1D 4H9NA 5AV6A 2FJ7D 4E44A 4KGCB 3X1UB 4R8PD 3VH6A 4X23B 3WTPB 4KHAB 3AZHC 2Y2PA 2NZDB 3AZIC 4J8WC 4ZUXA 1W2EA 3AZEC 5AV5D 3MGRC 3WA9D 3B6GB 1P3ID 1KX5A 2AROB 3REHA 4HGAC 2HIOC 1S32A 3W98D 3AZJD 5B33C 2PYOB 3AZGA 5B32C 1P3OC 1M18B 2Y2IA 2ZM5A 3MGPD 3MVDC 5B2JA 3REKA 3WKJC 5JRGC 5CPIA 2RVQD 5AVBA 5B24B 3W97B 3WAAC 5C3IB 3R45A 3C1BD 4XUJA 1HQ3A 2ZY5A 1F66B 5CPKC 4ZBJC 5B0YA 5B1LB 4Z5TC 3MNNA 3F6TA 3IP4C 3AZLC 3KXBD 4JJNA 5B31B 2ZY3A 3X1TA 1P3PB 1TZYC 5GXQB 1P3MB 2DQNC 5AV6C 1PZRA 4DRBA 3AN2C 3UTAA 3W99A 1N1JB 5FUGB 4QLCC 1ZLAB 5B0ZA 5AV8B 1P3LA 5B1MD 3AZFA 3AZMC 3B0CW 3P5JB 1EQZC 3FDDA 4CAYA 3EPHA 3C1CA 3AV2B 2Y2NA 1P3GC 4Z2MH 3REHC 3AZNA 3AZHD 3NQUA 4NFTA 3AZID 1M1AA 4J8WD 3B6FC 3VH5T 3KWQA 5E5AB 3AZGC 4WNNB 3AZED 3MGRD 5BNVA 2Y2QA 4CSRA 1KX4B 5KDMB 1P3KB 4AWLB 3V9RB 4H9OA 2HIOD 5DNNB 5CPIC 5GT3C 5B33D 5AVBC 5B32D 1P3OD 2Y2KA 1HTAA 5AY8B 5BNXB 1HQ3C 3WKJD 3RELB 3UT9B 2UWXA 5JRGD 5B0YC 1KX3D 4KGCA 3X1UA 1ID3B 4X23A 1U35B 3WAAD 4J8UB 3WTPA 4KHAA 4KUDB 2NZDA 5CPKD 2CV5B 3UTAC 1P3BC 4Z5TD 3AZLD 4XZQB 3TU4B 3AZFC 3B6GA 1TZYD 2AROA 1P3AC 3O62B 5AV6D 4J8XC 2F8NH 3AN2D 2PYOA 2DF4C 2IO5C 4QLCD 4H9QB 4WU9B 1M18A 4H9SA 2F8ND 2NQBC 3AZMD 5B2IB 3AZNC 2BG1A 3X1VB 1M1AC 1EQZD 3KWQC 1BH8A 2HUEB 2JSSA 4CAYB 4YS3C 5B24A 3W97A 3LZ1B 5B31G 1P34C 3UTBD 1F66A 1P3GD 3MGSD 4WU8B 5B1LA 3B6FD 3AZGD 4LD9A 5B31A 1M19C 1P3PA 5GXQA 1P3MA 2ZY4A 3LZ0C 4YM6B 5GT3D 5CPID 1N1JA 5FUGA 5AV8A 3AZJB 5BT1C 3WTPC 3X1SD 5BS7A 2NZDC 3MGPB 3VH5A 5F99C 3AV2A 3REIC 2W8SA 5GT0B 1AOIC 2AROC 3B0BA 3C1BB 1P3BD 3UTAD 5E5AA 4WNNA 3VH6W 1M18C 1KX4A 3AZFD 5KDMA 1P3AD 1P3KA 3V9RA 4J8XD 4Z66C 5DNNA 1P3FC 3W96B 5B24C 3KUYC 5C3IC 1B67A 1F1EA 5AY8A 5GSUC 5BNXA 1F66C 2NQBD 3REJA 3AZND 3RELA 3AFAB 3UT9A 5B1MB 1M1AD 1BH8B 4YS3D 3KWQD 1ID3A 1T3UA 1P34D 1U35A 5CHLB 4J8UA 1P3PC 5GXQC 3B0DC 5CPJC 1P3MC 2Y2JA 4KUDA 3AZKC 2CV5A 4E45A 5AVCC 1H3OA 1ZLAC 3AZHB 4LD9B 4XZQA 3TU4A 4J8VB 1M19D 5BS7C 3O62A 3AZEB 3MGRB 3LZ0D 5AV9B 3EPLA 2JCHA 4WU9A 4H9QA 4HGAB 2HIOB 3AV2C 5BT1D 3WTPD 1Z2CB 5B2IA 4H9RB 1P3OB 3X1VA 2NZDD 4G92B 4ZUXC 3LZ1A 3AYWB 5E5AC 3WKJB 2BYKB 5F99D 3A6NB 3REID 1KX3B 1KX5C 2G5HC 1P3KC 1AOID 1KU5A 3WAAB 4WU8A 5DNNC 1S32C 3A1KA 1M18D 4ZBJB 3LELB 3REKC 5B2JC 4Z5TB 4Z66D 3RELC 3UT9C 4YM6A 1BFMA 1P3FD 1TZYB 1ID3C 5B24D 2XD5A 3KUYD 3W98A 3AZJA 3AN2B 3MGQB 1U35C 3MVDD 5GSUD 1R4VA 4XUJC 1F66D 3NQJB 4QLCB 4KUDC 3REJB 3MGPA 2CV5C 3MNNC 3AZMB 1EQZB 4JJNC 5GT0A 3X1TC 1JFIB 1P3PD 5CPJD 5B40B 3AZKD 3C1BA 3W99C 3UTBB 5AVCD 1H3OB 5DNMB 2Y2HA 1P3GB 3MGSB 4WU9C 5B0ZC 1ZLAD 1P3LC 2G5IC 3B6FB 2YFWB 5B2IC 3X1VC 2HUEC 3W96A 2J8PA 5CP6B 3C1CC 1ULYA 3KSYA 3AV2D 5GT3B 3EG5B 2LY8A 2ZY2A 3LJAB 3AV1B 3AFAA 5B1MA 4WU8C 3X1SB 4ZUXD 5E5AD 2FFFB 2FJ7B 4R8PB 1KX5D 3REHD 2JE5A 3A1IA 4Z2MG 5DNND 4YM6C 5BO0B 1S32D 3AZHA 1P3BB 4J8VA 3REKD 5B2JD 3AZEA 5AV5B 3MGRA 3WA9B 3RELD 3UT9D 5AV9A 1P3IB 4KGCC 3X1UC 3B0CT 4G91B 1P3AB 1BH9B 5AVBD 4J8XB 1ID3D 2HIOA 3W98B 4X23C 1U35D 3H0RC 5GT0C 2IO5B 4WV4B 4XUJD 1HQ3D 1P3OA 4H9RA 5B0YD 3AYWA 2CV5D 3KFUG 3WKJA 2BYKA 1Q9CA 3MNND 3A6NA 4JJND 1KX3A 4YS3B 3B6GC 3X1TD 1P34B 3WAAA 2PYOC 3VH5W 3W96C 3W99D 4WU9D 5B0ZD 1A7WA 1WWSA 3LELA 1P3LD 4H9SC 4Z5TA 5B2ID 3KXBB 3AFAC 5B1MC 4UPKA 4NE3A 1TZYA 3W97C 3LZ0B 3C1CD 3AN2A 3MGQA 2Y2MA 3NQJA 4QLCA 4EO5B 4WU8D 5B1LC 3EPJA 2F8NA 3AZMA 4LD9C 1EQZA 5B31C 1JFIA 4J8VC 5B40A 3EPKA 5JA4B 5F99B 3REIB 5AV9C 4YM6D 3UTBA 5DNMA 1AOIB 1P3GA 4WZSB 3MGSA 3AZIB 4J8WB 5AV8C 3B6FA 2YFWA 5G49B 1TAFB 4G92C 2F8NK 3AYWC 4KGCD 3X1UD 5CP6A 3H0LC 4Z66B 3A6NC 5GT3A 4X23D 5B33B 1P3FB 1KX3C 5GT0D 5B32B 3LJAA 3KUYB 3AV1A 3X1SA 3MVDB 5GSUB 2YFVB 4M6BA 4UUZB 4H9PB 2FJ7A 5JRGB 3LELC 1KX4C 3B6GD 4R8PA 2BYMB 2AROD 4AWLC 2VQRA 5BO0A 2PYOD 2Y2LA 3B0DB 5CPJB 3W96D 2L5AA 4WJ3C 5CPKB 3MGQC 3AZKB 1P3BA 5AY8C 3AL0C 5AVCB 5AV5A 3REJC 3WA9A 3AZLB 3AFAD 3H0MC 1P3IA 1P3AA 4H9NB 1BH9A 5AV6B 4J8XA 3W97D 4J8UC 5B40C 3UTBC 5B1LD 5DNMC 2F8NB 2NQBA 3MGSC 4LD9D 4XZQC 5B31D 4ZUXB 3TU4C 4YS3A 4J8VD 5GXQD 1P3MD 3O62C 3VH6T 1P34A 5AV9D 1KX5B 3REHB 5CP6C 1S32B 4NE6A 5AV8D 3AZGB 3LJAC 3KXBA 3AV1C 3REKB 4NE5A 5B2JB 3LZ1C 3AYWD 3X1SC 1M19A 3LZ0A 2FJ7C 3A6ND 5CPIB 4R8PC 5AVBB 3R45B 4XUJB 2F2AC 1HQ3B 5B0YB 3LELD 4DQYB 4DRAA 1KX4D 2XD1A 1B6WA 3MNNB 5AV5C 5JA4A 5F99A 1P3KD 3WA9C 3REIA 4JJNB 3X1TB 1P3IC 1AOIA 4G91C 3WTPE 3AZIA 4J8WA 3W98C 3AZJC 3MGQD 3UTAB 5AY8D 5B32G 3W99B 5G49A 1TAFA 5B0ZB 3REJD 3MGPC 1P3LB 1WWIA 2CWEA 3AZFB 4Z66A 2Y2GA 2RVQC 1P3FA 5B33A 4J8UD 5B32A 5B40D 3KUYA 4KUDD 3C1CB 2Y2OA 3MVDA 5GSUA 3C1BC 2YFVA 5DNMD 4UUZA 2NQBB 4H9PA 3AZNB 3NQUB 5JRGA 1M1AB 2RIQA 4XZQD 3KWQB 3TU4D 2BYMA 3O62D 3KXBC 5BNVB 4CSRB 5CPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O B;  5CP6 D;  5CPK A;  3AZK A;  5AVC A;  1ZLA A;  3LJA D;  3AZL A;  3AV1 D;  3X1V D;  4EO5 C;  2F8N G;  1M19 B;  3LZ1 D;  4H9N A;  5AV6 A;  2FJ7 D;  4E44 A;  4KGC B;  3X1U B;  4R8P D;  3VH6 A;  4X23 B;  3WTP B;  4KHA B;  3AZH C;  2NZD B;  3AZI C;  4J8W C;  4ZUX A;  3AZE C;  5AV5 D;  3MGR C;  3WA9 D;  3B6G B;  1P3I D;  1KX5 A;  2ARO B;  3REH A;  4HGA C;  2HIO C;  1S32 A;  3W98 D;  3AZJ D;  5B33 C;  2PYO B;  3AZG A;  5B32 C;  1P3O C;  1M18 B;  3MGP D;  3MVD C;  5B2J A;  3REK A;  3WKJ C;  5JRG C;  5CPI A;  2RVQ D;  5AVB A;  5B24 B;  3W97 B;  3WAA C;  5C3I B;  3R45 A;  3C1B D;  4XUJ A;  1HQ3 A;  1F66 B;  5CPK C;  4ZBJ C;  5B0Y A;  5B1L B;  4Z5T C;  3MNN A;  3AZL C;  3KXB D;  4JJN A;  5B31 B;  3X1T A;  1P3P B;  1TZY C;  5GXQ B;  1P3M B;  5AV6 C;  4DRB A;  3AN2 C;  3UTA A;  3W99 A;  1N1J B;  5FUG B;  4QLC C;  1ZLA B;  5B0Z A;  5AV8 B;  1P3L A;  5B1M D;  3AZF A;  3AZM C;  3B0C W;  1EQZ C;  4CAY A;  3C1C A;  3AV2 B;  1P3G C;  4Z2M H;  3REH C;  3AZN A;  3AZH D;  3NQU A;  4NFT A;  3AZI D;  1M1A A;  4J8W D;  3B6F C;  3VH5 T;  3KWQ A;  5E5A B;  3AZG C;  4WNN B;  3AZE D;  3MGR D;  5BNV A;  4CSR A;  1KX4 B;  5KDM B;  1P3K B;  4AWL B;  3V9R B;  4H9O A;  2HIO D;  5DNN B;  5CPI C;  5GT3 C;  5B33 D;  5AVB C;  5B32 D;  1P3O D;  1HTA A;  5AY8 B;  5BNX B;  1HQ3 C;  3WKJ D;  3REL B;  3UT9 B;  5JRG D;  5B0Y C;  1KX3 D;  4KGC A;  3X1U A;  1ID3 B;  4X23 A;  1U35 B;  3WAA D;  4J8U B;  3WTP A;  4KHA A;  4KUD B;  2NZD A;  5CPK D;  2CV5 B;  3UTA C;  1P3B C;  4Z5T D;  3AZL D;  4XZQ B;  3TU4 B;  3AZF C;  3B6G A;  1TZY D;  2ARO A;  1P3A C;  3O62 B;  5AV6 D;  4J8X C;  2F8N H;  3AN2 D;  2PYO A;  2IO5 C;  4QLC D;  4H9Q B;  4WU9 B;  1M18 A;  4H9S A;  2F8N D;  2NQB C;  3AZM D;  5B2I B;  3AZN C;  3X1V B;  1M1A C;  1EQZ D;  3KWQ C;  1BH8 A;  2HUE B;  2JSS A;  4CAY B;  4YS3 C;  5B24 A;  3W97 A;  3LZ1 B;  5B31 G;  1P34 C;  3UTB D;  1F66 A;  1P3G D;  3MGS D;  4WU8 B;  5B1L A;  3B6F D;  3AZG D;  4LD9 A;  5B31 A;  1M19 C;  1P3P A;  5GXQ A;  1P3M A;  3LZ0 C;  4YM6 B;  5GT3 D;  5CPI D;  1N1J A;  5FUG A;  5AV8 A;  3AZJ B;  5BT1 C;  3WTP C;  3X1S D;  5BS7 A;  2NZD C;  3MGP B;  3VH5 A;  5F99 C;  3AV2 A;  3REI C;  5GT0 B;  1AOI C;  2ARO C;  3B0B A;  3C1B B;  1P3B D;  3UTA D;  5E5A A;  4WNN A;  3VH6 W;  1M18 C;  1KX4 A;  3AZF D;  5KDM A;  1P3A D;  1P3K A;  3V9R A;  4J8X D;  4Z66 C;  5DNN A;  1P3F C;  3W96 B;  5B24 C;  3KUY C;  5C3I C;  1B67 A;  1F1E A;  5AY8 A;  5GSU C;  5BNX A;  1F66 C;  2NQB D;  3REJ A;  3AZN D;  3REL A;  3AFA B;  3UT9 A;  5B1M B;  1M1A D;  1BH8 B;  4YS3 D;  3KWQ D;  1ID3 A;  1P34 D;  1U35 A;  5CHL B;  4J8U A;  1P3P C;  5GXQ C;  3B0D C;  5CPJ C;  1P3M C;  4KUD A;  3AZK C;  2CV5 A;  4E45 A;  5AVC C;  1H3O A;  1ZLA C;  3AZH B;  4LD9 B;  4XZQ A;  3TU4 A;  4J8V B;  1M19 D;  5BS7 C;  3O62 A;  3AZE B;  3MGR B;  3LZ0 D;  5AV9 B;  4WU9 A;  4H9Q A;  4HGA B;  2HIO B;  3AV2 C;  5BT1 D;  3WTP D;  5B2I A;  1P3O B;  4H9R B;  2NZD D;  3X1V A;  4G92 B;  4ZUX C;  3LZ1 A;  3AYW B;  5E5A C;  3WKJ B;  2BYK B;  5F99 D;  3A6N B;  3REI D;  1KX3 B;  1KX5 C;  1AOI D;  1P3K C;  1KU5 A;  3WAA B;  4WU8 A;  5DNN C;  1S32 C;  1M18 D;  4ZBJ B;  3LEL B;  3REK C;  5B2J C;  4Z5T B;  4Z66 D;  3REL C;  3UT9 C;  4YM6 A;  1BFM A;  1P3F D;  1TZY B;  1ID3 C;  5B24 D;  3KUY D;  3W98 A;  3AZJ A;  3AN2 B;  3MGQ B;  1U35 C;  3MVD D;  5GSU D;  1R4V A;  4XUJ C;  1F66 D;  3NQJ B;  4QLC B;  4KUD C;  3REJ B;  3MGP A;  2CV5 C;  3MNN C;  3AZM B;  1EQZ B;  4JJN C;  5GT0 A;  3X1T C;  1JFI B;  1P3P D;  5CPJ D;  5B40 B;  3AZK D;  3C1B A;  3W99 C;  3UTB B;  5AVC D;  1H3O B;  5DNM B;  1P3G B;  1ZLA D;  3MGS B;  4WU9 C;  5B0Z C;  1P3L C;  3B6F B;  2YFW B;  5B2I C;  3X1V C;  2HUE C;  3W96 A;  5CP6 B;  3C1C C;  1ULY A;  3KSY A;  3AV2 D;  5GT3 B;  2LY8 A;  3LJA B;  3AV1 B;  3AFA A;  5B1M A;  4WU8 C;  3X1S B;  4ZUX D;  5E5A D;  2FJ7 B;  4R8P B;  1KX5 D;  3REH D;  4YM6 C;  4Z2M G;  5DNN D;  1S32 D;  5BO0 B;  3AZH A;  1P3B B;  4J8V A;  3REK D;  5B2J D;  3AZE A;  5AV5 B;  3MGR A;  3WA9 B;  3REL D;  3UT9 D;  5AV9 A;  1P3I B;  4KGC C;  3X1U C;  3B0C T;  4G91 B;  1P3A B;  1BH9 B;  5AVB D;  4J8X B;  1ID3 D;  2HIO A;  3W98 B;  4X23 C;  1U35 D;  5GT0 C;  2IO5 B;  4WV4 B;  4XUJ D;  1HQ3 D;  1P3O A;  4H9R A;  5B0Y D;  3AYW A;  2CV5 D;  3WKJ A;  2BYK A;  1Q9C A;  3MNN D;  3A6N A;  4JJN D;  1KX3 A;  4YS3 B;  3B6G C;  3X1T D;  1P34 B;  3WAA A;  2PYO C;  3VH5 W;  3W96 C;  3W99 D;  4WU9 D;  5B0Z D;  1A7W A;  1WWS A;  3LEL A;  1P3L D;  4H9S C;  4Z5T A;  5B2I D;  3KXB B;  3AFA C;  5B1M C;  4NE3 A;  1TZY A;  3W97 C;  3LZ0 B;  3C1C D;  3AN2 A;  3MGQ A;  3NQJ A;  4QLC A;  4EO5 B;  4WU8 D;  5B1L C;  2F8N A;  3AZM A;  4LD9 C;  1EQZ A;  5B31 C;  1JFI A;  4J8V C;  5B40 A;  5JA4 B;  5F99 B;  3REI B;  5AV9 C;  4YM6 D;  3UTB A;  5DNM A;  1AOI B;  1P3G A;  4WZS B;  3MGS A;  3AZI B;  4J8W B;  5AV8 C;  3B6F A;  2YFW A;  5G49 B;  1TAF B;  4G92 C;  2F8N K;  3AYW C;  4KGC D;  3X1U D;  5CP6 A;  4Z66 B;  3A6N C;  5GT3 A;  4X23 D;  5B33 B;  1P3F B;  1KX3 C;  5GT0 D;  5B32 B;  3LJA A;  3KUY B;  3AV1 A;  3X1S A;  3MVD B;  5GSU B;  2YFV B;  4M6B A;  4UUZ B;  4H9P B;  2FJ7 A;  5JRG B;  3LEL C;  1KX4 C;  3B6G D;  4R8P A;  2BYM B;  2ARO D;  4AWL C;  2PYO D;  5BO0 A;  3B0D B;  5CPJ B;  3W96 D;  2L5A A;  5CPK B;  3MGQ C;  3AZK B;  1P3B A;  5AY8 C;  5AVC B;  5AV5 A;  3REJ C;  3WA9 A;  3AZL B;  3AFA D;  1P3I A;  1P3A A;  4H9N B;  1BH9 A;  5AV6 B;  4J8X A;  3W97 D;  4J8U C;  5B40 C;  3UTB C;  5B1L D;  5DNM C;  2F8N B;  2NQB A;  3MGS C;  4LD9 D;  4XZQ C;  5B31 D;  4ZUX B;  3TU4 C;  4YS3 A;  4J8V D;  5GXQ D;  1P3M D;  3O62 C;  3VH6 T;  1P34 A;  5AV9 D;  1KX5 B;  3REH B;  5CP6 C;  1S32 B;  4NE6 A;  5AV8 D;  3AZG B;  3LJA C;  3KXB A;  3AV1 C;  3REK B;  4NE5 A;  5B2J B;  3LZ1 C;  3AYW D;  3X1S C;  1M19 A;  3LZ0 A;  2FJ7 C;  3A6N D;  5CPI B;  4R8P C;  5AVB B;  3R45 B;  4XUJ B;  1HQ3 B;  5B0Y B;  3LEL D;  4DRA A;  1KX4 D;  1B6W A;  3MNN B;  5AV5 C;  5JA4 A;  5F99 A;  1P3K D;  3WA9 C;  3REI A;  4JJN B;  3X1T B;  1P3I C;  1AOI A;  4G91 C;  3WTP E;  3AZI A;  4J8W A;  3W98 C;  3AZJ C;  3MGQ D;  3UTA B;  5AY8 D;  5B32 G;  3W99 B;  5G49 A;  1TAF A;  5B0Z B;  3REJ D;  3MGP C;  1P3L B;  1WWI A;  2CWE A;  3AZF B;  4Z66 A;  2RVQ C;  1P3F A;  5B33 A;  4J8U D;  5B32 A;  5B40 D;  3KUY A;  4KUD D;  3C1C B;  3MVD A;  5GSU A;  3C1B C;  2YFV A;  5DNM D;  4UUZ A;  2NQB B;  4H9P A;  3AZN B;  3NQU B;  5JRG A;  1M1A B;  4XZQ D;  3KWQ B;  3TU4 D;  2BYM A;  3O62 D;  3KXB C;  5BNV B;  4CSR B;  5CPJ A; 
#chains in the Genus database with same CATH topology
 4H9O B;  5CP6 D;  5CPK A;  3AZK A;  5AVC A;  1ZLA A;  3LJA D;  3AZL A;  3AV1 D;  3X1V D;  4EO5 C;  2F8N G;  1M19 B;  3LZ1 D;  4H9N A;  5AV6 A;  2FJ7 D;  4E44 A;  4KGC B;  3X1U B;  4R8P D;  3VH6 A;  4X23 B;  3WTP B;  4KHA B;  3AZH C;  2Y2P A;  2NZD B;  3AZI C;  4J8W C;  4ZUX A;  1W2E A;  3AZE C;  5AV5 D;  3MGR C;  3WA9 D;  3B6G B;  1P3I D;  1KX5 A;  2ARO B;  3REH A;  4HGA C;  2HIO C;  1S32 A;  3W98 D;  3AZJ D;  5B33 C;  2PYO B;  3AZG A;  5B32 C;  1P3O C;  1M18 B;  2Y2I A;  2ZM5 A;  3MGP D;  3MVD C;  5B2J A;  3REK A;  3WKJ C;  5JRG C;  5CPI A;  2RVQ D;  5AVB A;  5B24 B;  3W97 B;  3WAA C;  5C3I B;  3R45 A;  3C1B D;  4XUJ A;  1HQ3 A;  2ZY5 A;  1F66 B;  5CPK C;  4ZBJ C;  5B0Y A;  5B1L B;  4Z5T C;  3MNN A;  3F6T A;  3IP4 C;  3AZL C;  3KXB D;  4JJN A;  5B31 B;  2ZY3 A;  3X1T A;  1P3P B;  1TZY C;  5GXQ B;  1P3M B;  2DQN C;  5AV6 C;  1PZR A;  4DRB A;  3AN2 C;  3UTA A;  3W99 A;  1N1J B;  5FUG B;  4QLC C;  1ZLA B;  5B0Z A;  5AV8 B;  1P3L A;  5B1M D;  3AZF A;  3AZM C;  3B0C W;  3P5J B;  1EQZ C;  3FDD A;  4CAY A;  3EPH A;  3C1C A;  3AV2 B;  2Y2N A;  1P3G C;  4Z2M H;  3REH C;  3AZN A;  3AZH D;  3NQU A;  4NFT A;  3AZI D;  1M1A A;  4J8W D;  3B6F C;  3VH5 T;  3KWQ A;  5E5A B;  3AZG C;  4WNN B;  3AZE D;  3MGR D;  5BNV A;  2Y2Q A;  4CSR A;  1KX4 B;  5KDM B;  1P3K B;  4AWL B;  3V9R B;  4H9O A;  2HIO D;  5DNN B;  5CPI C;  5GT3 C;  5B33 D;  5AVB C;  5B32 D;  1P3O D;  2Y2K A;  1HTA A;  5AY8 B;  5BNX B;  1HQ3 C;  3WKJ D;  3REL B;  3UT9 B;  2UWX A;  5JRG D;  5B0Y C;  1KX3 D;  4KGC A;  3X1U A;  1ID3 B;  4X23 A;  1U35 B;  3WAA D;  4J8U B;  3WTP A;  4KHA A;  4KUD B;  2NZD A;  5CPK D;  2CV5 B;  3UTA C;  1P3B C;  4Z5T D;  3AZL D;  4XZQ B;  3TU4 B;  3AZF C;  3B6G A;  1TZY D;  2ARO A;  1P3A C;  3O62 B;  5AV6 D;  4J8X C;  2F8N H;  3AN2 D;  2PYO A;  2DF4 C;  2IO5 C;  4QLC D;  4H9Q B;  4WU9 B;  1M18 A;  4H9S A;  2F8N D;  2NQB C;  3AZM D;  5B2I B;  3AZN C;  2BG1 A;  3X1V B;  1M1A C;  1EQZ D;  3KWQ C;  1BH8 A;  2HUE B;  2JSS A;  4CAY B;  4YS3 C;  5B24 A;  3W97 A;  3LZ1 B;  5B31 G;  1P34 C;  3UTB D;  1F66 A;  1P3G D;  3MGS D;  4WU8 B;  5B1L A;  3B6F D;  3AZG D;  4LD9 A;  5B31 A;  1M19 C;  1P3P A;  5GXQ A;  1P3M A;  2ZY4 A;  3LZ0 C;  4YM6 B;  5GT3 D;  5CPI D;  1N1J A;  5FUG A;  5AV8 A;  3AZJ B;  5BT1 C;  3WTP C;  3X1S D;  5BS7 A;  2NZD C;  3MGP B;  3VH5 A;  5F99 C;  3AV2 A;  3REI C;  2W8S A;  5GT0 B;  1AOI C;  2ARO C;  3B0B A;  3C1B B;  1P3B D;  3UTA D;  5E5A A;  4WNN A;  3VH6 W;  1M18 C;  1KX4 A;  3AZF D;  5KDM A;  1P3A D;  1P3K A;  3V9R A;  4J8X D;  4Z66 C;  5DNN A;  1P3F C;  3W96 B;  5B24 C;  3KUY C;  5C3I C;  1B67 A;  1F1E A;  5AY8 A;  5GSU C;  5BNX A;  1F66 C;  2NQB D;  3REJ A;  3AZN D;  3REL A;  3AFA B;  3UT9 A;  5B1M B;  1M1A D;  1BH8 B;  4YS3 D;  3KWQ D;  1ID3 A;  1T3U A;  1P34 D;  1U35 A;  5CHL B;  4J8U A;  1P3P C;  5GXQ C;  3B0D C;  5CPJ C;  1P3M C;  2Y2J A;  4KUD A;  3AZK C;  2CV5 A;  4E45 A;  5AVC C;  1H3O A;  1ZLA C;  3AZH B;  4LD9 B;  4XZQ A;  3TU4 A;  4J8V B;  1M19 D;  5BS7 C;  3O62 A;  3AZE B;  3MGR B;  3LZ0 D;  5AV9 B;  3EPL A;  2JCH A;  4WU9 A;  4H9Q A;  4HGA B;  2HIO B;  3AV2 C;  5BT1 D;  3WTP D;  1Z2C B;  5B2I A;  4H9R B;  1P3O B;  3X1V A;  2NZD D;  4G92 B;  4ZUX C;  3LZ1 A;  3AYW B;  5E5A C;  3WKJ B;  2BYK B;  5F99 D;  3A6N B;  3REI D;  1KX3 B;  1KX5 C;  2G5H C;  1P3K C;  1AOI D;  1KU5 A;  3WAA B;  4WU8 A;  5DNN C;  1S32 C;  3A1K A;  1M18 D;  4ZBJ B;  3LEL B;  3REK C;  5B2J C;  4Z5T B;  4Z66 D;  3REL C;  3UT9 C;  4YM6 A;  1BFM A;  1P3F D;  1TZY B;  1ID3 C;  5B24 D;  2XD5 A;  3KUY D;  3W98 A;  3AZJ A;  3AN2 B;  3MGQ B;  1U35 C;  3MVD D;  5GSU D;  1R4V A;  4XUJ C;  1F66 D;  3NQJ B;  4QLC B;  4KUD C;  3REJ B;  3MGP A;  2CV5 C;  3MNN C;  3AZM B;  1EQZ B;  4JJN C;  5GT0 A;  3X1T C;  1JFI B;  1P3P D;  5CPJ D;  5B40 B;  3AZK D;  3C1B A;  3W99 C;  3UTB B;  5AVC D;  1H3O B;  5DNM B;  2Y2H A;  1P3G B;  3MGS B;  4WU9 C;  5B0Z C;  1ZLA D;  1P3L C;  2G5I C;  3B6F B;  2YFW B;  5B2I C;  3X1V C;  2HUE C;  3W96 A;  2J8P A;  5CP6 B;  3C1C C;  1ULY A;  3KSY A;  3AV2 D;  5GT3 B;  3EG5 B;  2LY8 A;  2ZY2 A;  3LJA B;  3AV1 B;  3AFA A;  5B1M A;  4WU8 C;  3X1S B;  4ZUX D;  5E5A D;  2FFF B;  2FJ7 B;  4R8P B;  1KX5 D;  3REH D;  2JE5 A;  3A1I A;  4Z2M G;  5DNN D;  4YM6 C;  5BO0 B;  1S32 D;  3AZH A;  1P3B B;  4J8V A;  3REK D;  5B2J D;  3AZE A;  5AV5 B;  3MGR A;  3WA9 B;  3REL D;  3UT9 D;  5AV9 A;  1P3I B;  4KGC C;  3X1U C;  3B0C T;  4G91 B;  1P3A B;  1BH9 B;  5AVB D;  4J8X B;  1ID3 D;  2HIO A;  3W98 B;  4X23 C;  1U35 D;  3H0R C;  5GT0 C;  2IO5 B;  4WV4 B;  4XUJ D;  1HQ3 D;  1P3O A;  4H9R A;  5B0Y D;  3AYW A;  2CV5 D;  3KFU G;  3WKJ A;  2BYK A;  1Q9C A;  3MNN D;  3A6N A;  4JJN D;  1KX3 A;  4YS3 B;  3B6G C;  3X1T D;  1P34 B;  3WAA A;  2PYO C;  3VH5 W;  3W96 C;  3W99 D;  4WU9 D;  5B0Z D;  1A7W A;  1WWS A;  3LEL A;  1P3L D;  4H9S C;  4Z5T A;  5B2I D;  3KXB B;  3AFA C;  5B1M C;  4UPK A;  4NE3 A;  1TZY A;  3W97 C;  3LZ0 B;  3C1C D;  3AN2 A;  3MGQ A;  2Y2M A;  3NQJ A;  4QLC A;  4EO5 B;  4WU8 D;  5B1L C;  3EPJ A;  2F8N A;  3AZM A;  4LD9 C;  1EQZ A;  5B31 C;  1JFI A;  4J8V C;  5B40 A;  3EPK A;  5JA4 B;  5F99 B;  3REI B;  5AV9 C;  4YM6 D;  3UTB A;  5DNM A;  1AOI B;  1P3G A;  4WZS B;  3MGS A;  3AZI B;  4J8W B;  5AV8 C;  3B6F A;  2YFW A;  5G49 B;  1TAF B;  4G92 C;  2F8N K;  3AYW C;  4KGC D;  3X1U D;  5CP6 A;  3H0L C;  4Z66 B;  3A6N C;  5GT3 A;  4X23 D;  5B33 B;  1P3F B;  1KX3 C;  5GT0 D;  5B32 B;  3LJA A;  3KUY B;  3AV1 A;  3X1S A;  3MVD B;  5GSU B;  2YFV B;  4M6B A;  4UUZ B;  4H9P B;  2FJ7 A;  5JRG B;  3LEL C;  1KX4 C;  3B6G D;  4R8P A;  2BYM B;  2ARO D;  4AWL C;  2VQR A;  5BO0 A;  2PYO D;  2Y2L A;  3B0D B;  5CPJ B;  3W96 D;  2L5A A;  4WJ3 C;  5CPK B;  3MGQ C;  3AZK B;  1P3B A;  5AY8 C;  3AL0 C;  5AVC B;  5AV5 A;  3REJ C;  3WA9 A;  3AZL B;  3AFA D;  3H0M C;  1P3I A;  1P3A A;  4H9N B;  1BH9 A;  5AV6 B;  4J8X A;  3W97 D;  4J8U C;  5B40 C;  3UTB C;  5B1L D;  5DNM C;  2F8N B;  2NQB A;  3MGS C;  4LD9 D;  4XZQ C;  5B31 D;  4ZUX B;  3TU4 C;  4YS3 A;  4J8V D;  5GXQ D;  1P3M D;  3O62 C;  3VH6 T;  1P34 A;  5AV9 D;  1KX5 B;  3REH B;  5CP6 C;  1S32 B;  4NE6 A;  5AV8 D;  3AZG B;  3LJA C;  3KXB A;  3AV1 C;  3REK B;  4NE5 A;  5B2J B;  3LZ1 C;  3AYW D;  3X1S C;  1M19 A;  3LZ0 A;  2FJ7 C;  3A6N D;  5CPI B;  4R8P C;  5AVB B;  3R45 B;  4XUJ B;  2F2A C;  1HQ3 B;  5B0Y B;  3LEL D;  4DQY B;  4DRA A;  1KX4 D;  2XD1 A;  1B6W A;  3MNN B;  5AV5 C;  5JA4 A;  5F99 A;  1P3K D;  3WA9 C;  3REI A;  4JJN B;  3X1T B;  1P3I C;  1AOI A;  4G91 C;  3WTP E;  3AZI A;  4J8W A;  3W98 C;  3AZJ C;  3MGQ D;  3UTA B;  5AY8 D;  5B32 G;  3W99 B;  5G49 A;  1TAF A;  5B0Z B;  3REJ D;  3MGP C;  1P3L B;  1WWI A;  2CWE A;  3AZF B;  4Z66 A;  2Y2G A;  2RVQ C;  1P3F A;  5B33 A;  4J8U D;  5B32 A;  5B40 D;  3KUY A;  4KUD D;  3C1C B;  2Y2O A;  3MVD A;  5GSU A;  3C1B C;  2YFV A;  5DNM D;  4UUZ A;  2NQB B;  4H9P A;  3AZN B;  3NQU B;  5JRG A;  1M1A B;  2RIQ A;  4XZQ D;  3KWQ B;  3TU4 D;  2BYM A;  3O62 D;  3KXB C;  5BNV B;  4CSR B;  5CPJ A; 
#chains in the Genus database with same CATH homology
 4H9O B;  5CP6 D;  5CPK A;  3AZK A;  5AVC A;  1ZLA A;  3LJA D;  3AZL A;  3AV1 D;  3X1V D;  4EO5 C;  2F8N G;  1M19 B;  3LZ1 D;  4H9N A;  5AV6 A;  2FJ7 D;  4E44 A;  4KGC B;  3X1U B;  4R8P D;  3VH6 A;  4X23 B;  3WTP B;  4KHA B;  3AZH C;  2Y2P A;  2NZD B;  3AZI C;  4J8W C;  4ZUX A;  1W2E A;  3AZE C;  5AV5 D;  3MGR C;  3WA9 D;  3B6G B;  1P3I D;  1KX5 A;  2ARO B;  3REH A;  4HGA C;  2HIO C;  1S32 A;  3W98 D;  3AZJ D;  5B33 C;  2PYO B;  3AZG A;  5B32 C;  1P3O C;  1M18 B;  2Y2I A;  2ZM5 A;  3MGP D;  3MVD C;  5B2J A;  3REK A;  3WKJ C;  5JRG C;  5CPI A;  2RVQ D;  5AVB A;  5B24 B;  3W97 B;  3WAA C;  5C3I B;  3R45 A;  3C1B D;  4XUJ A;  1HQ3 A;  2ZY5 A;  1F66 B;  5CPK C;  4ZBJ C;  5B0Y A;  5B1L B;  4Z5T C;  3MNN A;  3F6T A;  3IP4 C;  3AZL C;  3KXB D;  4JJN A;  5B31 B;  2ZY3 A;  3X1T A;  1P3P B;  1TZY C;  5GXQ B;  1P3M B;  2DQN C;  5AV6 C;  1PZR A;  4DRB A;  3AN2 C;  3UTA A;  3W99 A;  1N1J B;  5FUG B;  4QLC C;  1ZLA B;  5B0Z A;  5AV8 B;  1P3L A;  5B1M D;  3AZF A;  3AZM C;  3B0C W;  3P5J B;  1EQZ C;  3FDD A;  4CAY A;  3EPH A;  3C1C A;  3AV2 B;  2Y2N A;  1P3G C;  4Z2M H;  3REH C;  3AZN A;  3AZH D;  3NQU A;  4NFT A;  3AZI D;  1M1A A;  4J8W D;  3B6F C;  3VH5 T;  3KWQ A;  5E5A B;  3AZG C;  4WNN B;  3AZE D;  3MGR D;  5BNV A;  2Y2Q A;  4CSR A;  1KX4 B;  5KDM B;  1P3K B;  4AWL B;  3V9R B;  4H9O A;  2HIO D;  5DNN B;  5CPI C;  5GT3 C;  5B33 D;  5AVB C;  5B32 D;  1P3O D;  2Y2K A;  1HTA A;  5AY8 B;  5BNX B;  1HQ3 C;  3WKJ D;  3REL B;  3UT9 B;  2UWX A;  5JRG D;  5B0Y C;  1KX3 D;  4KGC A;  3X1U A;  1ID3 B;  4X23 A;  1U35 B;  3WAA D;  4J8U B;  3WTP A;  4KHA A;  4KUD B;  2NZD A;  5CPK D;  2CV5 B;  3UTA C;  1P3B C;  4Z5T D;  3AZL D;  4XZQ B;  3TU4 B;  3AZF C;  3B6G A;  1TZY D;  2ARO A;  1P3A C;  3O62 B;  5AV6 D;  4J8X C;  2F8N H;  3AN2 D;  2PYO A;  2DF4 C;  2IO5 C;  4QLC D;  4H9Q B;  4WU9 B;  1M18 A;  4H9S A;  2F8N D;  2NQB C;  3AZM D;  5B2I B;  3AZN C;  2BG1 A;  3X1V B;  1M1A C;  1EQZ D;  3KWQ C;  1BH8 A;  2HUE B;  2JSS A;  4CAY B;  4YS3 C;  5B24 A;  3W97 A;  3LZ1 B;  5B31 G;  1P34 C;  3UTB D;  1F66 A;  1P3G D;  3MGS D;  4WU8 B;  5B1L A;  3B6F D;  3AZG D;  4LD9 A;  5B31 A;  1M19 C;  1P3P A;  5GXQ A;  1P3M A;  2ZY4 A;  3LZ0 C;  4YM6 B;  5GT3 D;  5CPI D;  1N1J A;  5FUG A;  5AV8 A;  3AZJ B;  5BT1 C;  3WTP C;  3X1S D;  5BS7 A;  2NZD C;  3MGP B;  3VH5 A;  5F99 C;  3AV2 A;  3REI C;  2W8S A;  5GT0 B;  1AOI C;  2ARO C;  3B0B A;  3C1B B;  1P3B D;  3UTA D;  5E5A A;  4WNN A;  3VH6 W;  1M18 C;  1KX4 A;  3AZF D;  5KDM A;  1P3A D;  1P3K A;  3V9R A;  4J8X D;  4Z66 C;  5DNN A;  1P3F C;  3W96 B;  5B24 C;  3KUY C;  5C3I C;  1B67 A;  1F1E A;  5AY8 A;  5GSU C;  5BNX A;  1F66 C;  2NQB D;  3REJ A;  3AZN D;  3REL A;  3AFA B;  3UT9 A;  5B1M B;  1M1A D;  1BH8 B;  4YS3 D;  3KWQ D;  1ID3 A;  1T3U A;  1P34 D;  1U35 A;  5CHL B;  4J8U A;  1P3P C;  5GXQ C;  3B0D C;  5CPJ C;  1P3M C;  2Y2J A;  4KUD A;  3AZK C;  2CV5 A;  4E45 A;  5AVC C;  1H3O A;  1ZLA C;  3AZH B;  4LD9 B;  4XZQ A;  3TU4 A;  4J8V B;  1M19 D;  5BS7 C;  3O62 A;  3AZE B;  3MGR B;  3LZ0 D;  5AV9 B;  3EPL A;  2JCH A;  4WU9 A;  4H9Q A;  4HGA B;  2HIO B;  3AV2 C;  5BT1 D;  3WTP D;  1Z2C B;  5B2I A;  4H9R B;  1P3O B;  3X1V A;  2NZD D;  4G92 B;  4ZUX C;  3LZ1 A;  3AYW B;  5E5A C;  3WKJ B;  2BYK B;  5F99 D;  3A6N B;  3REI D;  1KX3 B;  1KX5 C;  2G5H C;  1P3K C;  1AOI D;  1KU5 A;  3WAA B;  4WU8 A;  5DNN C;  1S32 C;  3A1K A;  1M18 D;  4ZBJ B;  3LEL B;  3REK C;  5B2J C;  4Z5T B;  4Z66 D;  3REL C;  3UT9 C;  4YM6 A;  1BFM A;  1P3F D;  1TZY B;  1ID3 C;  5B24 D;  2XD5 A;  3KUY D;  3W98 A;  3AZJ A;  3AN2 B;  3MGQ B;  1U35 C;  3MVD D;  5GSU D;  1R4V A;  4XUJ C;  1F66 D;  3NQJ B;  4QLC B;  4KUD C;  3REJ B;  3MGP A;  2CV5 C;  3MNN C;  3AZM B;  1EQZ B;  4JJN C;  5GT0 A;  3X1T C;  1JFI B;  1P3P D;  5CPJ D;  5B40 B;  3AZK D;  3C1B A;  3W99 C;  3UTB B;  5AVC D;  1H3O B;  5DNM B;  2Y2H A;  1P3G B;  3MGS B;  4WU9 C;  5B0Z C;  1ZLA D;  1P3L C;  2G5I C;  3B6F B;  2YFW B;  5B2I C;  3X1V C;  2HUE C;  3W96 A;  2J8P A;  5CP6 B;  3C1C C;  1ULY A;  3KSY A;  3AV2 D;  5GT3 B;  3EG5 B;  2LY8 A;  2ZY2 A;  3LJA B;  3AV1 B;  3AFA A;  5B1M A;  4WU8 C;  3X1S B;  4ZUX D;  5E5A D;  2FFF B;  2FJ7 B;  4R8P B;  1KX5 D;  3REH D;  2JE5 A;  3A1I A;  4Z2M G;  5DNN D;  4YM6 C;  5BO0 B;  1S32 D;  3AZH A;  1P3B B;  4J8V A;  3REK D;  5B2J D;  3AZE A;  5AV5 B;  3MGR A;  3WA9 B;  3REL D;  3UT9 D;  5AV9 A;  1P3I B;  4KGC C;  3X1U C;  3B0C T;  4G91 B;  1P3A B;  1BH9 B;  5AVB D;  4J8X B;  1ID3 D;  2HIO A;  3W98 B;  4X23 C;  1U35 D;  3H0R C;  5GT0 C;  2IO5 B;  4WV4 B;  4XUJ D;  1HQ3 D;  1P3O A;  4H9R A;  5B0Y D;  3AYW A;  2CV5 D;  3KFU G;  3WKJ A;  2BYK A;  1Q9C A;  3MNN D;  3A6N A;  4JJN D;  1KX3 A;  4YS3 B;  3B6G C;  3X1T D;  1P34 B;  3WAA A;  2PYO C;  3VH5 W;  3W96 C;  3W99 D;  4WU9 D;  5B0Z D;  1A7W A;  1WWS A;  3LEL A;  1P3L D;  4H9S C;  4Z5T A;  5B2I D;  3KXB B;  3AFA C;  5B1M C;  4UPK A;  4NE3 A;  1TZY A;  3W97 C;  3LZ0 B;  3C1C D;  3AN2 A;  3MGQ A;  2Y2M A;  3NQJ A;  4QLC A;  4EO5 B;  4WU8 D;  5B1L C;  3EPJ A;  2F8N A;  3AZM A;  4LD9 C;  1EQZ A;  5B31 C;  1JFI A;  4J8V C;  5B40 A;  3EPK A;  5JA4 B;  5F99 B;  3REI B;  5AV9 C;  4YM6 D;  3UTB A;  5DNM A;  1AOI B;  1P3G A;  4WZS B;  3MGS A;  3AZI B;  4J8W B;  5AV8 C;  3B6F A;  2YFW A;  5G49 B;  1TAF B;  4G92 C;  2F8N K;  3AYW C;  4KGC D;  3X1U D;  5CP6 A;  3H0L C;  4Z66 B;  3A6N C;  5GT3 A;  4X23 D;  5B33 B;  1P3F B;  1KX3 C;  5GT0 D;  5B32 B;  3LJA A;  3KUY B;  3AV1 A;  3X1S A;  3MVD B;  5GSU B;  2YFV B;  4M6B A;  4UUZ B;  4H9P B;  2FJ7 A;  5JRG B;  3LEL C;  1KX4 C;  3B6G D;  4R8P A;  2BYM B;  2ARO D;  4AWL C;  2VQR A;  5BO0 A;  2PYO D;  2Y2L A;  3B0D B;  5CPJ B;  3W96 D;  2L5A A;  4WJ3 C;  5CPK B;  3MGQ C;  3AZK B;  1P3B A;  5AY8 C;  3AL0 C;  5AVC B;  5AV5 A;  3REJ C;  3WA9 A;  3AZL B;  3AFA D;  3H0M C;  1P3I A;  1P3A A;  4H9N B;  1BH9 A;  5AV6 B;  4J8X A;  3W97 D;  4J8U C;  5B40 C;  3UTB C;  5B1L D;  5DNM C;  2F8N B;  2NQB A;  3MGS C;  4LD9 D;  4XZQ C;  5B31 D;  4ZUX B;  3TU4 C;  4YS3 A;  4J8V D;  5GXQ D;  1P3M D;  3O62 C;  3VH6 T;  1P34 A;  5AV9 D;  1KX5 B;  3REH B;  5CP6 C;  1S32 B;  4NE6 A;  5AV8 D;  3AZG B;  3LJA C;  3KXB A;  3AV1 C;  3REK B;  4NE5 A;  5B2J B;  3LZ1 C;  3AYW D;  3X1S C;  1M19 A;  3LZ0 A;  2FJ7 C;  3A6N D;  5CPI B;  4R8P C;  5AVB B;  3R45 B;  4XUJ B;  2F2A C;  1HQ3 B;  5B0Y B;  3LEL D;  4DQY B;  4DRA A;  1KX4 D;  2XD1 A;  1B6W A;  3MNN B;  5AV5 C;  5JA4 A;  5F99 A;  1P3K D;  3WA9 C;  3REI A;  4JJN B;  3X1T B;  1P3I C;  1AOI A;  4G91 C;  3WTP E;  3AZI A;  4J8W A;  3W98 C;  3AZJ C;  3MGQ D;  3UTA B;  5AY8 D;  5B32 G;  3W99 B;  5G49 A;  1TAF A;  5B0Z B;  3REJ D;  3MGP C;  1P3L B;  1WWI A;  2CWE A;  3AZF B;  4Z66 A;  2Y2G A;  2RVQ C;  1P3F A;  5B33 A;  4J8U D;  5B32 A;  5B40 D;  3KUY A;  4KUD D;  3C1C B;  2Y2O A;  3MVD A;  5GSU A;  3C1B C;  2YFV A;  5DNM D;  4UUZ A;  2NQB B;  4H9P A;  3AZN B;  3NQU B;  5JRG A;  1M1A B;  2RIQ A;  4XZQ D;  3KWQ B;  3TU4 D;  2BYM A;  3O62 D;  3KXB C;  5BNV B;  4CSR B;  5CPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...