2F8NH

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA (146 bp)
total genus 35
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nH00
4LD9B 3AZNC 4H9QB 3AZGB 5F99A 3W99A 3KXBA 1P3OA 5CPIB 5JA4B 2F8NB 3X1VC 3MGSD 3AV1A 4LD9C 2YFVA 3WTPC 5C3IB 1P3OC 1P3LB 3AZKD 5G49A 1HQ3B 5AV6D 3X1VB 3B6FD 1ZLAB 3KXBB 5AV9D 4JJNC 3B0DC 5CPJB 2FJ7D 1P34D 1P3KB 5BO0A 1KX4C 2NZDB 5CP6C 5B40C 1JFIB 2HIOC 3W98D 5FUGB 5AVBB 3AYWB 1P3ID 3AZND 2HUEC 5B24B 5AV6B 2CV5B 3C1BD 3UTAB 5B32D 3WA9B 2NZDD 4Z66A 4E44A 1F1EA 1M19A 3B6GA 4ZBJB 1B6WA 3AZJB 3WKJB 4XUJC 3X1SA 5B1MD 3TU4A 1KX5B 1ID3D 1S32B 1KX3A 3B6GC 3LZ1A 3AZJC 3WKJC 3VH5W 3MVDD 1U35D 5B2JD 3TU4C 4WU9C 3AZIC 3LZ1C 5B31C 3LJAA 5CPKD 4KGCA 3WAAC 1P3MC 1ZLAD 3AV2A 1P3AA 1P3LD 3A6NB 1N1JB 3MGSA 4WU9B 4Z5TB 3AZIA 4Z2MG 5B31A 1EQZD 2AROD 5CHLB 1WWSA 3R45B 3KUYC 3UT9A 1P3AC 1P34B 3AZEB 5B32G 5CPJD 3UTBC 1KX4B 2NZDC 1HTAA 4KUDC 4H9PB 2BYMB 1P34C 3KUYA 3AN2C 3REKB 3W99B 4QLCB 3MGPA 1P34A 3WA9A 1P3BB 3KWQC 5B0ZC 3REJD 2HIOD 1F66A 4J8XD 3MGSB 3UTAC 3B6FC 2BYMA 5GT3B 3MGPC 5CPID 3AZLA 3AZNA 5AV8C 5B0ZA 3REID 3VH5T 5AV6C 5BS7C 1H3OB 4H9RA 5AVCA 1F66B 5B32A 3B6GB 5B2JB 5F99D 4CSRA 1U35B 1TZYB 4H9OA 3W99D 1P3FC 5BS7A 3AZKC 4G92B 3O62D 4J8VC 1BFMA 5B2IB 4XZQB 3RELD 5CPIC 5E5AB 4KUDD 1TZYC 5AVCB 2IO5B 3REHD 1H3OA 2CWEA 3LELB 4J8VB 3AZKA 3W96D 4JJNA 3V9RB 1U35A 5B2JA 3AZLB 5GXQC 3AZGC 5CPKB 4Z5TD 5GSUD 3AZHA 5E5AA 5B24A 2CV5D 1P3LA 1M19B 5B1LD 4H9QA 4ZUXA 3AZEA 3AZGA 3AZMA 5CPJC 3UT9B 4YS3B 3AV1B 1KX5D 1HQ3C 3MGQD 3W99C 3AZJD 3WKJD 3KUYB 5CP6B 5DNMD 4H9PA 4ZUXC 4YM6D 3MNNC 5CPJA 1ID3C 5G49B 3X1VA 5BNXB 3WAAD 3MNNB 5GT3C 1BH9B 1M18D 3W97B 4EO5B 3MGPD 2BYKA 4WNNB 1M19D 5GT3A 4KGCB 4WU8B 5BT1D 3MNND 5BO0B 5GXQD 4YS3A 1N1JA 5DNNA 4WU9A 3AYWD 4XUJB 1P3IB 3LZ0D 4KGCC 4Z66B 1KX4A 3MVDA 5B40D 1TAFA 4CSRB 4M6BA 5AVBA 5B0YA 5AVCD 4R8PA 3C1CA 3LJAD 4X23D 3MGRB 5CPKA 2NQBB 3VH6T 1P3AD 1AOIA 1BH9A 4J8UC 5AV9B 3O62A 5GXQB 1P3GC 3X1UB 3AZKB 3RELA 4KUDA 5B0YB 4KHAA 1TAFB 4AWLC 4J8UB 5B33B 1M19C 1HQ3D 1P3GA 1P3OD 3RELC 4G91C 5GSUB 3LZ1B 1P3PC 4UUZA 3KWQA 3AZMB 3X1UA 4H9SC 2FJ7B 3B6FA 4E45A 5DNMB 3AZGD 4YM6C 4ZUXD 3W97A 4HGAC 5FUGA 3LJAC 5BNVB 1F66D 3WTPD 3W96C 5AV9A 3O62B 4YM6A 4JJNB 1TZYD 3B0CW 5B32C 3MGSC 3X1VD 3B6FB 5B33A 3LZ0C 3AFAB 2HIOB 5BT1C 1P3IC 3REJB 4DRBA 1P3KA 3LELD 3MGRA 3AZHB 5AV5A 4NE5A 5GXQA 4XZQC 5B2IC 3AZHC 3WA9C 1M1AA 4JJND 2IO5C 5F99C 3B6GD 4NFTA 5B2IA 4XZQA 5GSUA 3AZLC 5JRGC 4X23A 1KX5C 3VH6A 3LZ1D 3AN2D 5AV6A 3A6NC 1P3OB 5B1LC 5AVCC 3UTAD 1EQZB 5JRGA 1KX5A 4KGCD 4QLCD 4J8VA 2LY8A 2FJ7A 3AZFD 1M1AB 3WTPB 1ID3B 1P3MD 1ZLAC 3MVDB 4QLCC 1P3AB 4H9NB 3UTBD 2FJ7C 5B40B 1S32D 4YS3C 2RVQD 1P3BC 3LZ0B 4YM6B 2PYOA 1P3FD 3KUYD 4R8PB 3MVDC 3C1CB 3MGQB 5B24C 1JFIA 3NQJB 3A6ND 1Q9CA 2PYOC 4R8PC 3C1CC 5B32B 3WA9D 5B33D 5CP6A 3C1BB 3REIC 3REJA 5B40A 5AVBD 2HIOA 4J8UA 5B0YD 4J8XA 4EO5C 1M18C 5B1MA 3TU4D 2HUEB 3W98A 1ID3A 3AZLD 3C1BC 1P3FB 3MGPB 2F8ND 5B0ZD 3LELA 3REIA 3REJC 2BYKB 1M18B 1R4VA 4G91B 5B1MC 4CAYA 1BH8B 3C1BA 4Z66C 3LELC 4ZBJC 4Z66D 2YFWA 3AV2D 3KXBD 5B1LB 3AV2C 4XUJA 4H9RB 4Z2MH 3X1SD 4KHAB 4Z5TC 3W96A 5AV9C 3AZNB 4WV4B 5B0YC 1AOIB 3X1TC 5B31B 5B33C 4Z5TA 5CPKC 5E5AD 4KUDB 3B0DB 3RELB 1AOIC 3O62C 4J8VD 3W96B 1P3PB 3NQJA 3KSYA 4LD9D 2YFVB 3AZFA 3UT9C 4J8WA 5AV5C 1B67A 4WU8A 3UTBA 5AY8A 1S32A 4ZUXB 1P3PD 2PYOD 5AV8D 1KU5A 4J8WB 3W97C 2RVQC 1P3BD 4X23C 5BNXA 3AYWC 2AROC 4J8UD 3AFAD 2NQBC 5CPIA 3AYWA 1KX3D 1KX4D 5GT0D 3AV2B 2F8NH 3WTPE 3NQUB 5B2JC 5JRGD 3AZIB 3AZHD 1EQZC 1ZLAA 3MGRC 1AOID 4WNNA 4QLCA 4XUJD 1P3LC 3AZMD 4J8XB 3TU4B 3AZMC 3VH6W 5B31D 1EQZA 3REHA 2L5AA 1M1AC 1HQ3A 4HGAB 5AY8B 3W98B 3LJAB 5GSUC 2F8NG 3X1UD 4NE6A 3KXBC 1M18A 3A6NA 3MGQC 2CV5A 3AZEC 3W98C 5B1LA 2NQBD 3X1TD 3AV1C 4H9OB 5KDMA 3AZED 4LD9A 5B0ZB 3UTBB 5CP6D 3WTPA 3MGQA 2CV5C 5AV5B 3MNNA 4WU8D 3X1SC 3REKC 5AY8D 5DNND 3V9RA 3B0BA 4H9NA 4UUZB 3KWQB 3X1SB 5AVBC 3REKA 5B31G 4R8PD 3C1CD 1P3BA 5DNNB 1P3KD 4X23B 3MGRD 1ULYA 5AV5D 5BNVA 2F8NK 5DNNC 5JRGB 1BH8A 4YS3D 4WZSB 3AZFB 1M1AD 4AWLB 1P3GD 1P3MB 5F99B 4J8XC 3AV1D 3R45A 3AZFC 3KWQD 4CAYB 5C3IC 5B24D 3AN2A 3X1UC 5AY8C 3W97D 1WWIA 3WAAB 3B0CT 4J8WD 4DRAA 1KX3C 3AZJA 3WKJA 3X1TB 5DNMA 3AN2B 1P3PA 4NE3A 1KX3B 5AV8A 3AZID 4H9SA 2AROA 3WAAA 1P3MA 3UT9D 5DNMC 5KDMB 5GT0B 2NQBA 3X1TA 1P3IA 3REIB 1A7WA 1P3FA 1P3KC 5GT0C 5GT3D 3AFAA 2AROB 1TZYA 4WU9D 2NZDA 3LZ0A 2PYOB 5GT0A 2YFWB 3AFAC 4J8WC 3REHB 1U35C 3REKD 5B2ID 4XZQD 4WU8C 4G92C 5AV8B 1S32C 2JSSA 5JA4A 3REHC 2F8NA 5E5AC 1P3GB 3VH5A 1F66C 3UTAA 3NQUA 5B1MB
chains in the Genus database with same CATH superfamily
4LD9B 3AZNC 4H9QB 3AZGB 5F99A 1T3UA 3W99A 3KXBA 1P3OA 5CPIB 5JA4B 2F8NB 3X1VC 3MGSD 3AV1A 4LD9C 2YFVA 3WTPC 5C3IB 1P3OC 1P3LB 3AZKD 5G49A 1HQ3B 5AV6D 3X1VB 3B6FD 2J8PA 1ZLAB 3KXBB 5AV9D 4JJNC 3B0DC 5CPJB 2FJ7D 1P34D 1P3KB 5BO0A 1KX4C 2NZDB 2XD1A 5CP6C 5B40C 1JFIB 2HIOC 2JE5A 3W98D 5FUGB 5AVBB 3AYWB 1P3ID 3AZND 2HUEC 5B24B 5AV6B 2CV5B 3C1BD 3UTAB 5B32D 3WA9B 2NZDD 4Z66A 4E44A 1F1EA 1M19A 2ZM5A 2Y2LA 3B6GA 4ZBJB 1B6WA 3AZJB 3WKJB 4XUJC 3X1SA 5B1MD 3H0MC 3TU4A 1KX5B 1ID3D 1S32B 1KX3A 3B6GC 3LZ1A 3AZJC 3WKJC 3VH5W 3MVDD 1U35D 5B2JD 3TU4C 4WU9C 3AZIC 3LZ1C 5B31C 3LJAA 5CPKD 4KGCA 3WAAC 1P3MC 1ZLAD 3AV2A 1P3AA 1P3LD 3A6NB 1N1JB 3MGSA 4WU9B 4Z5TB 3AZIA 4Z2MG 5B31A 1EQZD 2AROD 5CHLB 1WWSA 3R45B 3KUYC 3UT9A 1P3AC 3AL0C 1P34B 3AZEB 5B32G 5CPJD 3UTBC 1KX4B 2NZDC 1HTAA 4KUDC 4H9PB 2BYMB 1P34C 3KUYA 3AN2C 2Y2KA 3REKB 3KFUG 3W99B 4QLCB 3MGPA 1P34A 3WA9A 1P3BB 3KWQC 5B0ZC 3REJD 2HIOD 1F66A 4J8XD 3MGSB 3UTAC 3B6FC 2BYMA 5GT3B 3MGPC 5CPID 3AZLA 3AZNA 5AV8C 5B0ZA 3REID 3VH5T 5AV6C 5BS7C 1H3OB 4H9RA 5AVCA 1F66B 5B32A 3B6GB 5B2JB 5F99D 4CSRA 1U35B 1TZYB 4H9OA 3W99D 3A1KA 1P3FC 5BS7A 3AZKC 4G92B 3O62D 4J8VC 1BFMA 5B2IB 4XZQB 3RELD 5CPIC 5E5AB 4KUDD 1TZYC 5AVCB 2IO5B 3REHD 1H3OA 2CWEA 3LELB 4J8VB 3AZKA 3W96D 4JJNA 3V9RB 1U35A 5B2JA 3AZLB 2JCHA 5GXQC 3AZGC 5CPKB 3EPHA 4Z5TD 5GSUD 3AZHA 5E5AA 5B24A 2CV5D 1P3LA 1M19B 5B1LD 4H9QA 4ZUXA 3AZEA 3AZGA 3AZMA 5CPJC 3UT9B 4YS3B 3AV1B 1KX5D 1HQ3C 3MGQD 3W99C 3AZJD 3WKJD 3KUYB 5CP6B 5DNMD 4H9PA 4ZUXC 4YM6D 3MNNC 5CPJA 1ID3C 5G49B 3X1VA 5BNXB 3WAAD 3MNNB 5GT3C 1BH9B 1M18D 3W97B 4EO5B 3MGPD 2BYKA 2ZY5A 4WNNB 1M19D 3IP4C 5GT3A 4KGCB 4WU8B 5BT1D 3MNND 5BO0B 5GXQD 4YS3A 1N1JA 5DNNA 2Y2OA 3AYWD 4XUJB 4WU9A 1P3IB 3LZ0D 4KGCC 4Z66B 1KX4A 3MVDA 5B40D 1TAFA 2ZY3A 4M6BA 4CSRB 5AVBA 5B0YA 5AVCD 2XD5A 4R8PA 3C1CA 3LJAD 4X23D 3MGRB 5CPKA 2NQBB 3VH6T 2G5IC 1P3AD 1AOIA 1BH9A 4J8UC 5AV9B 3O62A 5GXQB 1P3GC 3X1UB 3AZKB 3RELA 4KUDA 5B0YB 2DF4C 4KHAA 1TAFB 4AWLC 4J8UB 5B33B 1M19C 1HQ3D 1P3GA 1P3OD 3RELC 4G91C 5GSUB 3LZ1B 2UWXA 1P3PC 4UUZA 3KWQA 3AZMB 2DQNC 2F2AC 4H9SC 3X1UA 2FJ7B 3B6FA 3P5JB 4E45A 5DNMB 3AZGD 4YM6C 4ZUXD 3W97A 4HGAC 5FUGA 3LJAC 5BNVB 1F66D 3WTPD 3W96C 5AV9A 3O62B 4YM6A 4JJNB 1TZYD 3B0CW 5B32C 3MGSC 3X1VD 3B6FB 5B33A 3LZ0C 2ZY2A 4UPKA 3AFAB 2HIOB 5BT1C 1P3IC 3REJB 4DRBA 1P3KA 3LELD 3MGRA 3AZHB 5AV5A 4NE5A 5GXQA 4XZQC 5B2IC 3AZHC 3WA9C 1M1AA 4JJND 2IO5C 5F99C 3B6GD 4NFTA 5B2IA 4XZQA 5GSUA 3AZLC 5JRGC 4X23A 2Y2JA 1KX5C 3VH6A 3LZ1D 3AN2D 5AV6A 3A6NC 1P3OB 5B1LC 5AVCC 3UTAD 3EPJA 1EQZB 5JRGA 1KX5A 2W8SA 4KGCD 2Y2QA 4QLCD 4J8VA 2LY8A 2FJ7A 3AZFD 1M1AB 3WTPB 1ID3B 1P3MD 1ZLAC 3MVDB 4QLCC 1P3AB 4H9NB 3UTBD 2FJ7C 5B40B 1S32D 4YS3C 2Y2MA 2RVQD 1P3BC 3LZ0B 4YM6B 2PYOA 1P3FD 3KUYD 4R8PB 3MVDC 3C1CB 3MGQB 5B24C 1JFIA 3NQJB 3A6ND 1Q9CA 2PYOC 4R8PC 3C1CC 5B32B 3WA9D 5B33D 5CP6A 3C1BB 3REIC 3REJA 5B40A 5AVBD 2HIOA 4J8UA 5B0YD 4J8XA 4EO5C 1M18C 5B1MA 3TU4D 2HUEB 3W98A 1ID3A 3AZLD 3C1BC 1P3FB 3MGPB 2F8ND 5B0ZD 3LELA 3REIA 3REJC 2BYKB 1M18B 1R4VA 4G91B 5B1MC 4CAYA 1BH8B 3C1BA 4Z66C 3LELC 4ZBJC 4Z66D 2FFFB 2YFWA 3KXBD 3AV2D 5B1LB 3AV2C 4XUJA 4H9RB 2Y2GA 4Z2MH 3X1SD 4KHAB 1PZRA 4Z5TC 3W96A 5AV9C 3AZNB 4WV4B 5B0YC 1AOIB 3X1TC 5B31B 5B33C 4Z5TA 5CPKC 5E5AD 4KUDB 3B0DB 3RELB 1AOIC 3O62C 4J8VD 3W96B 1P3PB 3NQJA 3KSYA 4LD9D 2YFVB 3AZFA 3UT9C 4J8WA 2BG1A 5AV5C 1B67A 4WU8A 3UTBA 5AY8A 1S32A 4ZUXB 1P3PD 2PYOD 5AV8D 1KU5A 4J8WB 3W97C 2RVQC 1P3BD 4X23C 5BNXA 3AYWC 1W2EA 2AROC 4J8UD 3AFAD 4WJ3C 2NQBC 5CPIA 3AYWA 1KX3D 1KX4D 5GT0D 3AV2B 2F8NH 2RIQA 3WTPE 3NQUB 5B2JC 5JRGD 3AZIB 3AZHD 1EQZC 1ZLAA 3MGRC 1AOID 4WNNA 4QLCA 3H0RC 4XUJD 1P3LC 3AZMD 4J8XB 3TU4B 2Y2IA 3VH6W 5B31D 3AZMC 1EQZA 3REHA 2L5AA 1M1AC 1HQ3A 4HGAB 3FDDA 5AY8B 3W98B 3LJAB 5GSUC 2F8NG 3X1UD 1Z2CB 4NE6A 3KXBC 1M18A 3A6NA 3MGQC 2CV5A 3AZEC 3W98C 5B1LA 2NQBD 3X1TD 3AV1C 4H9OB 5KDMA 3AZED 4LD9A 5B0ZB 3UTBB 5CP6D 3WTPA 3MGQA 2CV5C 5AV5B 3MNNA 4WU8D 3X1SC 3REKC 5AY8D 5DNND 3V9RA 3B0BA 4H9NA 2Y2PA 4UUZB 3X1SB 3KWQB 5AVBC 3REKA 3F6TA 5B31G 4R8PD 3C1CD 1P3BA 5DNNB 1P3KD 2ZY4A 4X23B 3MGRD 1ULYA 5AV5D 5BNVA 2F8NK 5DNNC 5JRGB 1BH8A 4YS3D 4WZSB 3AZFB 1M1AD 4AWLB 1P3GD 1P3MB 5F99B 4J8XC 3AV1D 3R45A 3AZFC 3KWQD 4CAYB 5C3IC 5B24D 3AN2A 3X1UC 2Y2NA 2VQRA 5AY8C 3W97D 2Y2HA 1WWIA 3WAAB 3B0CT 4J8WD 4DRAA 1KX3C 3AZJA 3WKJA 3X1TB 5DNMA 3AN2B 1P3PA 4NE3A 1KX3B 5AV8A 3AZID 4H9SA 2AROA 3WAAA 1P3MA 3UT9D 5DNMC 5KDMB 5GT0B 2NQBA 3X1TA 1P3IA 3REIB 2G5HC 1A7WA 1P3FA 1P3KC 5GT0C 5GT3D 3AFAA 3EPLA 2AROB 1TZYA 4WU9D 2NZDA 3A1IA 3LZ0A 2PYOB 5GT0A 2YFWB 3AFAC 4J8WC 3REHB 1U35C 3EPKA 4DQYB 3REKD 5B2ID 4XZQD 4WU8C 4G92C 5AV8B 1S32C 2JSSA 5JA4A 3REHC 2F8NA 5E5AC 3H0LC 1P3GB 3VH5A 3EG5B 1F66C 3UTAA 3NQUA 5B1MB
chains in the Genus database with same CATH topology
4LD9B 3AZNC 4H9QB 3AZGB 5F99A 1T3UA 3W99A 3KXBA 1P3OA 5CPIB 5JA4B 2F8NB 3X1VC 3MGSD 3AV1A 4LD9C 2YFVA 3WTPC 5C3IB 1P3OC 1P3LB 3AZKD 5G49A 1HQ3B 5AV6D 3X1VB 3B6FD 2J8PA 1ZLAB 3KXBB 5AV9D 4JJNC 3B0DC 5CPJB 2FJ7D 1P34D 1P3KB 5BO0A 1KX4C 2NZDB 2XD1A 5CP6C 5B40C 1JFIB 2HIOC 2JE5A 3W98D 5FUGB 5AVBB 3AYWB 1P3ID 3AZND 2HUEC 5B24B 5AV6B 2CV5B 3C1BD 3UTAB 5B32D 3WA9B 2NZDD 4Z66A 4E44A 1F1EA 1M19A 2ZM5A 2Y2LA 3B6GA 4ZBJB 1B6WA 3AZJB 3WKJB 4XUJC 3X1SA 5B1MD 3H0MC 3TU4A 1KX5B 1ID3D 1S32B 1KX3A 3B6GC 3LZ1A 3AZJC 3WKJC 3VH5W 3MVDD 1U35D 5B2JD 3TU4C 4WU9C 3AZIC 3LZ1C 5B31C 3LJAA 5CPKD 4KGCA 3WAAC 1P3MC 1ZLAD 3AV2A 1P3AA 1P3LD 3A6NB 1N1JB 3MGSA 4WU9B 4Z5TB 3AZIA 4Z2MG 5B31A 1EQZD 2AROD 5CHLB 1WWSA 3R45B 3KUYC 3UT9A 1P3AC 3AL0C 1P34B 3AZEB 5B32G 5CPJD 3UTBC 1KX4B 2NZDC 1HTAA 4KUDC 4H9PB 2BYMB 1P34C 3KUYA 3AN2C 2Y2KA 3REKB 3KFUG 3W99B 4QLCB 3MGPA 1P34A 3WA9A 1P3BB 3KWQC 5B0ZC 3REJD 2HIOD 1F66A 4J8XD 3MGSB 3UTAC 3B6FC 2BYMA 5GT3B 3MGPC 5CPID 3AZLA 3AZNA 5AV8C 5B0ZA 3REID 3VH5T 5AV6C 5BS7C 1H3OB 4H9RA 5AVCA 1F66B 5B32A 3B6GB 5B2JB 5F99D 4CSRA 1U35B 1TZYB 4H9OA 3W99D 3A1KA 1P3FC 5BS7A 3AZKC 4G92B 3O62D 4J8VC 1BFMA 5B2IB 4XZQB 3RELD 5CPIC 5E5AB 4KUDD 1TZYC 5AVCB 2IO5B 3REHD 1H3OA 2CWEA 3LELB 4J8VB 3AZKA 3W96D 4JJNA 3V9RB 1U35A 5B2JA 3AZLB 2JCHA 5GXQC 3AZGC 5CPKB 3EPHA 4Z5TD 5GSUD 3AZHA 5E5AA 5B24A 2CV5D 1P3LA 1M19B 5B1LD 4H9QA 4ZUXA 3AZEA 3AZGA 3AZMA 5CPJC 3UT9B 4YS3B 3AV1B 1KX5D 1HQ3C 3MGQD 3W99C 3AZJD 3WKJD 3KUYB 5CP6B 5DNMD 4H9PA 4ZUXC 4YM6D 3MNNC 5CPJA 1ID3C 5G49B 3X1VA 5BNXB 3WAAD 3MNNB 5GT3C 1BH9B 1M18D 3W97B 4EO5B 3MGPD 2BYKA 2ZY5A 4WNNB 1M19D 3IP4C 5GT3A 4KGCB 4WU8B 5BT1D 3MNND 5BO0B 5GXQD 4YS3A 1N1JA 5DNNA 2Y2OA 3AYWD 4XUJB 4WU9A 1P3IB 3LZ0D 4KGCC 4Z66B 1KX4A 3MVDA 5B40D 1TAFA 2ZY3A 4M6BA 4CSRB 5AVBA 5B0YA 5AVCD 2XD5A 4R8PA 3C1CA 3LJAD 4X23D 3MGRB 5CPKA 2NQBB 3VH6T 2G5IC 1P3AD 1AOIA 1BH9A 4J8UC 5AV9B 3O62A 5GXQB 1P3GC 3X1UB 3AZKB 3RELA 4KUDA 5B0YB 2DF4C 4KHAA 1TAFB 4AWLC 4J8UB 5B33B 1M19C 1HQ3D 1P3GA 1P3OD 3RELC 4G91C 5GSUB 3LZ1B 2UWXA 1P3PC 4UUZA 3KWQA 3AZMB 2DQNC 2F2AC 4H9SC 3X1UA 2FJ7B 3B6FA 3P5JB 4E45A 5DNMB 3AZGD 4YM6C 4ZUXD 3W97A 4HGAC 5FUGA 3LJAC 5BNVB 1F66D 3WTPD 3W96C 5AV9A 3O62B 4YM6A 4JJNB 1TZYD 3B0CW 5B32C 3MGSC 3X1VD 3B6FB 5B33A 3LZ0C 2ZY2A 4UPKA 3AFAB 2HIOB 5BT1C 1P3IC 3REJB 4DRBA 1P3KA 3LELD 3MGRA 3AZHB 5AV5A 4NE5A 5GXQA 4XZQC 5B2IC 3AZHC 3WA9C 1M1AA 4JJND 2IO5C 5F99C 3B6GD 4NFTA 5B2IA 4XZQA 5GSUA 3AZLC 5JRGC 4X23A 2Y2JA 1KX5C 3VH6A 3LZ1D 3AN2D 5AV6A 3A6NC 1P3OB 5B1LC 5AVCC 3UTAD 3EPJA 1EQZB 5JRGA 1KX5A 2W8SA 4KGCD 2Y2QA 4QLCD 4J8VA 2LY8A 2FJ7A 3AZFD 1M1AB 3WTPB 1ID3B 1P3MD 1ZLAC 3MVDB 4QLCC 1P3AB 4H9NB 3UTBD 2FJ7C 5B40B 1S32D 4YS3C 2Y2MA 2RVQD 1P3BC 3LZ0B 4YM6B 2PYOA 1P3FD 3KUYD 4R8PB 3MVDC 3C1CB 3MGQB 5B24C 1JFIA 3NQJB 3A6ND 1Q9CA 2PYOC 4R8PC 3C1CC 5B32B 3WA9D 5B33D 5CP6A 3C1BB 3REIC 3REJA 5B40A 5AVBD 2HIOA 4J8UA 5B0YD 4J8XA 4EO5C 1M18C 5B1MA 3TU4D 2HUEB 3W98A 1ID3A 3AZLD 3C1BC 1P3FB 3MGPB 2F8ND 5B0ZD 3LELA 3REIA 3REJC 2BYKB 1M18B 1R4VA 4G91B 5B1MC 4CAYA 1BH8B 3C1BA 4Z66C 3LELC 4ZBJC 4Z66D 2FFFB 2YFWA 3KXBD 3AV2D 5B1LB 3AV2C 4XUJA 4H9RB 2Y2GA 4Z2MH 3X1SD 4KHAB 1PZRA 4Z5TC 3W96A 5AV9C 3AZNB 4WV4B 5B0YC 1AOIB 3X1TC 5B31B 5B33C 4Z5TA 5CPKC 5E5AD 4KUDB 3B0DB 3RELB 1AOIC 3O62C 4J8VD 3W96B 1P3PB 3NQJA 3KSYA 4LD9D 2YFVB 3AZFA 3UT9C 4J8WA 2BG1A 5AV5C 1B67A 4WU8A 3UTBA 5AY8A 1S32A 4ZUXB 1P3PD 2PYOD 5AV8D 1KU5A 4J8WB 3W97C 2RVQC 1P3BD 4X23C 5BNXA 3AYWC 1W2EA 2AROC 4J8UD 3AFAD 4WJ3C 2NQBC 5CPIA 3AYWA 1KX3D 1KX4D 5GT0D 3AV2B 2F8NH 2RIQA 3WTPE 3NQUB 5B2JC 5JRGD 3AZIB 3AZHD 1EQZC 1ZLAA 3MGRC 1AOID 4WNNA 4QLCA 3H0RC 4XUJD 1P3LC 3AZMD 4J8XB 3TU4B 2Y2IA 3VH6W 5B31D 3AZMC 1EQZA 3REHA 2L5AA 1M1AC 1HQ3A 4HGAB 3FDDA 5AY8B 3W98B 3LJAB 5GSUC 2F8NG 3X1UD 1Z2CB 4NE6A 3KXBC 1M18A 3A6NA 3MGQC 2CV5A 3AZEC 3W98C 5B1LA 2NQBD 3X1TD 3AV1C 4H9OB 5KDMA 3AZED 4LD9A 5B0ZB 3UTBB 5CP6D 3WTPA 3MGQA 2CV5C 5AV5B 3MNNA 4WU8D 3X1SC 3REKC 5AY8D 5DNND 3V9RA 3B0BA 4H9NA 2Y2PA 4UUZB 3X1SB 3KWQB 5AVBC 3REKA 3F6TA 5B31G 4R8PD 3C1CD 1P3BA 5DNNB 1P3KD 2ZY4A 4X23B 3MGRD 1ULYA 5AV5D 5BNVA 2F8NK 5DNNC 5JRGB 1BH8A 4YS3D 4WZSB 3AZFB 1M1AD 4AWLB 1P3GD 1P3MB 5F99B 4J8XC 3AV1D 3R45A 3AZFC 3KWQD 4CAYB 5C3IC 5B24D 3AN2A 3X1UC 2Y2NA 2VQRA 5AY8C 3W97D 2Y2HA 1WWIA 3WAAB 3B0CT 4J8WD 4DRAA 1KX3C 3AZJA 3WKJA 3X1TB 5DNMA 3AN2B 1P3PA 4NE3A 1KX3B 5AV8A 3AZID 4H9SA 2AROA 3WAAA 1P3MA 3UT9D 5DNMC 5KDMB 5GT0B 2NQBA 3X1TA 1P3IA 3REIB 2G5HC 1A7WA 1P3FA 1P3KC 5GT0C 5GT3D 3AFAA 3EPLA 2AROB 1TZYA 4WU9D 2NZDA 3A1IA 3LZ0A 2PYOB 5GT0A 2YFWB 3AFAC 4J8WC 3REHB 1U35C 3EPKA 4DQYB 3REKD 5B2ID 4XZQD 4WU8C 4G92C 5AV8B 1S32C 2JSSA 5JA4A 3REHC 2F8NA 5E5AC 3H0LC 1P3GB 3VH5A 3EG5B 1F66C 3UTAA 3NQUA 5B1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 B;  3AZN C;  4H9Q B;  3AZG B;  5F99 A;  3W99 A;  3KXB A;  1P3O A;  5CPI B;  5JA4 B;  2F8N B;  3X1V C;  3MGS D;  3AV1 A;  4LD9 C;  2YFV A;  3WTP C;  5C3I B;  1P3O C;  1P3L B;  3AZK D;  5G49 A;  1HQ3 B;  5AV6 D;  3X1V B;  3B6F D;  1ZLA B;  3KXB B;  5AV9 D;  4JJN C;  3B0D C;  5CPJ B;  2FJ7 D;  1P34 D;  1P3K B;  5BO0 A;  1KX4 C;  2NZD B;  5CP6 C;  5B40 C;  1JFI B;  2HIO C;  3W98 D;  5FUG B;  5AVB B;  3AYW B;  1P3I D;  3AZN D;  2HUE C;  5B24 B;  5AV6 B;  2CV5 B;  3C1B D;  3UTA B;  5B32 D;  3WA9 B;  2NZD D;  4Z66 A;  4E44 A;  1F1E A;  1M19 A;  3B6G A;  4ZBJ B;  1B6W A;  3AZJ B;  3WKJ B;  4XUJ C;  3X1S A;  5B1M D;  3TU4 A;  1KX5 B;  1ID3 D;  1S32 B;  1KX3 A;  3B6G C;  3LZ1 A;  3AZJ C;  3WKJ C;  3VH5 W;  3MVD D;  1U35 D;  5B2J D;  3TU4 C;  4WU9 C;  3AZI C;  3LZ1 C;  5B31 C;  3LJA A;  5CPK D;  4KGC A;  3WAA C;  1P3M C;  1ZLA D;  3AV2 A;  1P3A A;  1P3L D;  3A6N B;  1N1J B;  3MGS A;  4WU9 B;  4Z5T B;  3AZI A;  4Z2M G;  5B31 A;  1EQZ D;  2ARO D;  5CHL B;  1WWS A;  3R45 B;  3KUY C;  3UT9 A;  1P3A C;  1P34 B;  3AZE B;  5B32 G;  5CPJ D;  3UTB C;  1KX4 B;  2NZD C;  1HTA A;  4KUD C;  4H9P B;  2BYM B;  1P34 C;  3KUY A;  3AN2 C;  3REK B;  3W99 B;  4QLC B;  3MGP A;  1P34 A;  3WA9 A;  1P3B B;  3KWQ C;  5B0Z C;  3REJ D;  2HIO D;  1F66 A;  4J8X D;  3MGS B;  3UTA C;  3B6F C;  2BYM A;  5GT3 B;  3MGP C;  5CPI D;  3AZL A;  3AZN A;  5AV8 C;  5B0Z A;  3REI D;  3VH5 T;  5AV6 C;  5BS7 C;  1H3O B;  4H9R A;  5AVC A;  1F66 B;  5B32 A;  3B6G B;  5B2J B;  5F99 D;  4CSR A;  1U35 B;  1TZY B;  4H9O A;  3W99 D;  1P3F C;  5BS7 A;  3AZK C;  4G92 B;  3O62 D;  4J8V C;  1BFM A;  5B2I B;  4XZQ B;  3REL D;  5CPI C;  5E5A B;  4KUD D;  1TZY C;  5AVC B;  2IO5 B;  3REH D;  1H3O A;  2CWE A;  3LEL B;  4J8V B;  3AZK A;  3W96 D;  4JJN A;  3V9R B;  1U35 A;  5B2J A;  3AZL B;  5GXQ C;  3AZG C;  5CPK B;  4Z5T D;  5GSU D;  3AZH A;  5E5A A;  5B24 A;  2CV5 D;  1P3L A;  1M19 B;  5B1L D;  4H9Q A;  4ZUX A;  3AZE A;  3AZG A;  3AZM A;  5CPJ C;  3UT9 B;  4YS3 B;  3AV1 B;  1KX5 D;  1HQ3 C;  3MGQ D;  3W99 C;  3AZJ D;  3WKJ D;  3KUY B;  5CP6 B;  5DNM D;  4H9P A;  4ZUX C;  4YM6 D;  3MNN C;  5CPJ A;  1ID3 C;  5G49 B;  3X1V A;  5BNX B;  3WAA D;  3MNN B;  5GT3 C;  1BH9 B;  1M18 D;  3W97 B;  4EO5 B;  3MGP D;  2BYK A;  4WNN B;  1M19 D;  5GT3 A;  4KGC B;  4WU8 B;  5BT1 D;  3MNN D;  5BO0 B;  5GXQ D;  4YS3 A;  1N1J A;  5DNN A;  4WU9 A;  3AYW D;  4XUJ B;  1P3I B;  3LZ0 D;  4KGC C;  4Z66 B;  1KX4 A;  3MVD A;  5B40 D;  1TAF A;  4CSR B;  4M6B A;  5AVB A;  5B0Y A;  5AVC D;  4R8P A;  3C1C A;  3LJA D;  4X23 D;  3MGR B;  5CPK A;  2NQB B;  3VH6 T;  1P3A D;  1AOI A;  1BH9 A;  4J8U C;  5AV9 B;  3O62 A;  5GXQ B;  1P3G C;  3X1U B;  3AZK B;  3REL A;  4KUD A;  5B0Y B;  4KHA A;  1TAF B;  4AWL C;  4J8U B;  5B33 B;  1M19 C;  1HQ3 D;  1P3G A;  1P3O D;  3REL C;  4G91 C;  5GSU B;  3LZ1 B;  1P3P C;  4UUZ A;  3KWQ A;  3AZM B;  3X1U A;  4H9S C;  2FJ7 B;  3B6F A;  4E45 A;  5DNM B;  3AZG D;  4YM6 C;  4ZUX D;  3W97 A;  4HGA C;  5FUG A;  3LJA C;  5BNV B;  1F66 D;  3WTP D;  3W96 C;  5AV9 A;  3O62 B;  4YM6 A;  4JJN B;  1TZY D;  3B0C W;  5B32 C;  3MGS C;  3X1V D;  3B6F B;  5B33 A;  3LZ0 C;  3AFA B;  2HIO B;  5BT1 C;  1P3I C;  3REJ B;  4DRB A;  1P3K A;  3LEL D;  3MGR A;  3AZH B;  5AV5 A;  4NE5 A;  5GXQ A;  4XZQ C;  5B2I C;  3AZH C;  3WA9 C;  1M1A A;  4JJN D;  2IO5 C;  5F99 C;  3B6G D;  4NFT A;  5B2I A;  4XZQ A;  5GSU A;  3AZL C;  5JRG C;  4X23 A;  1KX5 C;  3VH6 A;  3LZ1 D;  3AN2 D;  5AV6 A;  3A6N C;  1P3O B;  5B1L C;  5AVC C;  3UTA D;  1EQZ B;  5JRG A;  1KX5 A;  4KGC D;  4QLC D;  4J8V A;  2LY8 A;  2FJ7 A;  3AZF D;  1M1A B;  3WTP B;  1ID3 B;  1P3M D;  1ZLA C;  3MVD B;  4QLC C;  1P3A B;  4H9N B;  3UTB D;  2FJ7 C;  5B40 B;  1S32 D;  4YS3 C;  2RVQ D;  1P3B C;  3LZ0 B;  4YM6 B;  2PYO A;  1P3F D;  3KUY D;  4R8P B;  3MVD C;  3C1C B;  3MGQ B;  5B24 C;  1JFI A;  3NQJ B;  3A6N D;  1Q9C A;  2PYO C;  4R8P C;  3C1C C;  5B32 B;  3WA9 D;  5B33 D;  5CP6 A;  3C1B B;  3REI C;  3REJ A;  5B40 A;  5AVB D;  2HIO A;  4J8U A;  5B0Y D;  4J8X A;  4EO5 C;  1M18 C;  5B1M A;  3TU4 D;  2HUE B;  3W98 A;  1ID3 A;  3AZL D;  3C1B C;  1P3F B;  3MGP B;  2F8N D;  5B0Z D;  3LEL A;  3REI A;  3REJ C;  2BYK B;  1M18 B;  1R4V A;  4G91 B;  5B1M C;  4CAY A;  1BH8 B;  3C1B A;  4Z66 C;  3LEL C;  4ZBJ C;  4Z66 D;  2YFW A;  3AV2 D;  3KXB D;  5B1L B;  3AV2 C;  4XUJ A;  4H9R B;  4Z2M H;  3X1S D;  4KHA B;  4Z5T C;  3W96 A;  5AV9 C;  3AZN B;  4WV4 B;  5B0Y C;  1AOI B;  3X1T C;  5B31 B;  5B33 C;  4Z5T A;  5CPK C;  5E5A D;  4KUD B;  3B0D B;  3REL B;  1AOI C;  3O62 C;  4J8V D;  3W96 B;  1P3P B;  3NQJ A;  3KSY A;  4LD9 D;  2YFV B;  3AZF A;  3UT9 C;  4J8W A;  5AV5 C;  1B67 A;  4WU8 A;  3UTB A;  5AY8 A;  1S32 A;  4ZUX B;  1P3P D;  2PYO D;  5AV8 D;  1KU5 A;  4J8W B;  3W97 C;  2RVQ C;  1P3B D;  4X23 C;  5BNX A;  3AYW C;  2ARO C;  4J8U D;  3AFA D;  2NQB C;  5CPI A;  3AYW A;  1KX3 D;  1KX4 D;  5GT0 D;  3AV2 B;  2F8N H;  3WTP E;  3NQU B;  5B2J C;  5JRG D;  3AZI B;  3AZH D;  1EQZ C;  1ZLA A;  3MGR C;  1AOI D;  4WNN A;  4QLC A;  4XUJ D;  1P3L C;  3AZM D;  4J8X B;  3TU4 B;  3AZM C;  3VH6 W;  5B31 D;  1EQZ A;  3REH A;  2L5A A;  1M1A C;  1HQ3 A;  4HGA B;  5AY8 B;  3W98 B;  3LJA B;  5GSU C;  2F8N G;  3X1U D;  4NE6 A;  3KXB C;  1M18 A;  3A6N A;  3MGQ C;  2CV5 A;  3AZE C;  3W98 C;  5B1L A;  2NQB D;  3X1T D;  3AV1 C;  4H9O B;  5KDM A;  3AZE D;  4LD9 A;  5B0Z B;  3UTB B;  5CP6 D;  3WTP A;  3MGQ A;  2CV5 C;  5AV5 B;  3MNN A;  4WU8 D;  3X1S C;  3REK C;  5AY8 D;  5DNN D;  3V9R A;  3B0B A;  4H9N A;  4UUZ B;  3KWQ B;  3X1S B;  5AVB C;  3REK A;  5B31 G;  4R8P D;  3C1C D;  1P3B A;  5DNN B;  1P3K D;  4X23 B;  3MGR D;  1ULY A;  5AV5 D;  5BNV A;  2F8N K;  5DNN C;  5JRG B;  1BH8 A;  4YS3 D;  4WZS B;  3AZF B;  1M1A D;  4AWL B;  1P3G D;  1P3M B;  5F99 B;  4J8X C;  3AV1 D;  3R45 A;  3AZF C;  3KWQ D;  4CAY B;  5C3I C;  5B24 D;  3AN2 A;  3X1U C;  5AY8 C;  3W97 D;  1WWI A;  3WAA B;  3B0C T;  4J8W D;  4DRA A;  1KX3 C;  3AZJ A;  3WKJ A;  3X1T B;  5DNM A;  3AN2 B;  1P3P A;  4NE3 A;  1KX3 B;  5AV8 A;  3AZI D;  4H9S A;  2ARO A;  3WAA A;  1P3M A;  3UT9 D;  5DNM C;  5KDM B;  5GT0 B;  2NQB A;  3X1T A;  1P3I A;  3REI B;  1A7W A;  1P3F A;  1P3K C;  5GT0 C;  5GT3 D;  3AFA A;  2ARO B;  1TZY A;  4WU9 D;  2NZD A;  3LZ0 A;  2PYO B;  5GT0 A;  2YFW B;  3AFA C;  4J8W C;  3REH B;  1U35 C;  3REK D;  5B2I D;  4XZQ D;  4WU8 C;  4G92 C;  5AV8 B;  1S32 C;  2JSS A;  5JA4 A;  3REH C;  2F8N A;  5E5A C;  1P3G B;  3VH5 A;  1F66 C;  3UTA A;  3NQU A;  5B1M B; 
#chains in the Genus database with same CATH topology
 4LD9 B;  3AZN C;  4H9Q B;  3AZG B;  5F99 A;  1T3U A;  3W99 A;  3KXB A;  1P3O A;  5CPI B;  5JA4 B;  2F8N B;  3X1V C;  3MGS D;  3AV1 A;  4LD9 C;  2YFV A;  3WTP C;  5C3I B;  1P3O C;  1P3L B;  3AZK D;  5G49 A;  1HQ3 B;  5AV6 D;  3X1V B;  3B6F D;  2J8P A;  1ZLA B;  3KXB B;  5AV9 D;  4JJN C;  3B0D C;  5CPJ B;  2FJ7 D;  1P34 D;  1P3K B;  5BO0 A;  1KX4 C;  2NZD B;  2XD1 A;  5CP6 C;  5B40 C;  1JFI B;  2HIO C;  2JE5 A;  3W98 D;  5FUG B;  5AVB B;  3AYW B;  1P3I D;  3AZN D;  2HUE C;  5B24 B;  5AV6 B;  2CV5 B;  3C1B D;  3UTA B;  5B32 D;  3WA9 B;  2NZD D;  4Z66 A;  4E44 A;  1F1E A;  1M19 A;  2ZM5 A;  2Y2L A;  3B6G A;  4ZBJ B;  1B6W A;  3AZJ B;  3WKJ B;  4XUJ C;  3X1S A;  5B1M D;  3H0M C;  3TU4 A;  1KX5 B;  1ID3 D;  1S32 B;  1KX3 A;  3B6G C;  3LZ1 A;  3AZJ C;  3WKJ C;  3VH5 W;  3MVD D;  1U35 D;  5B2J D;  3TU4 C;  4WU9 C;  3AZI C;  3LZ1 C;  5B31 C;  3LJA A;  5CPK D;  4KGC A;  3WAA C;  1P3M C;  1ZLA D;  3AV2 A;  1P3A A;  1P3L D;  3A6N B;  1N1J B;  3MGS A;  4WU9 B;  4Z5T B;  3AZI A;  4Z2M G;  5B31 A;  1EQZ D;  2ARO D;  5CHL B;  1WWS A;  3R45 B;  3KUY C;  3UT9 A;  1P3A C;  3AL0 C;  1P34 B;  3AZE B;  5B32 G;  5CPJ D;  3UTB C;  1KX4 B;  2NZD C;  1HTA A;  4KUD C;  4H9P B;  2BYM B;  1P34 C;  3KUY A;  3AN2 C;  2Y2K A;  3REK B;  3KFU G;  3W99 B;  4QLC B;  3MGP A;  1P34 A;  3WA9 A;  1P3B B;  3KWQ C;  5B0Z C;  3REJ D;  2HIO D;  1F66 A;  4J8X D;  3MGS B;  3UTA C;  3B6F C;  2BYM A;  5GT3 B;  3MGP C;  5CPI D;  3AZL A;  3AZN A;  5AV8 C;  5B0Z A;  3REI D;  3VH5 T;  5AV6 C;  5BS7 C;  1H3O B;  4H9R A;  5AVC A;  1F66 B;  5B32 A;  3B6G B;  5B2J B;  5F99 D;  4CSR A;  1U35 B;  1TZY B;  4H9O A;  3W99 D;  3A1K A;  1P3F C;  5BS7 A;  3AZK C;  4G92 B;  3O62 D;  4J8V C;  1BFM A;  5B2I B;  4XZQ B;  3REL D;  5CPI C;  5E5A B;  4KUD D;  1TZY C;  5AVC B;  2IO5 B;  3REH D;  1H3O A;  2CWE A;  3LEL B;  4J8V B;  3AZK A;  3W96 D;  4JJN A;  3V9R B;  1U35 A;  5B2J A;  3AZL B;  2JCH A;  5GXQ C;  3AZG C;  5CPK B;  3EPH A;  4Z5T D;  5GSU D;  3AZH A;  5E5A A;  5B24 A;  2CV5 D;  1P3L A;  1M19 B;  5B1L D;  4H9Q A;  4ZUX A;  3AZE A;  3AZG A;  3AZM A;  5CPJ C;  3UT9 B;  4YS3 B;  3AV1 B;  1KX5 D;  1HQ3 C;  3MGQ D;  3W99 C;  3AZJ D;  3WKJ D;  3KUY B;  5CP6 B;  5DNM D;  4H9P A;  4ZUX C;  4YM6 D;  3MNN C;  5CPJ A;  1ID3 C;  5G49 B;  3X1V A;  5BNX B;  3WAA D;  3MNN B;  5GT3 C;  1BH9 B;  1M18 D;  3W97 B;  4EO5 B;  3MGP D;  2BYK A;  2ZY5 A;  4WNN B;  1M19 D;  3IP4 C;  5GT3 A;  4KGC B;  4WU8 B;  5BT1 D;  3MNN D;  5BO0 B;  5GXQ D;  4YS3 A;  1N1J A;  5DNN A;  2Y2O A;  3AYW D;  4XUJ B;  4WU9 A;  1P3I B;  3LZ0 D;  4KGC C;  4Z66 B;  1KX4 A;  3MVD A;  5B40 D;  1TAF A;  2ZY3 A;  4M6B A;  4CSR B;  5AVB A;  5B0Y A;  5AVC D;  2XD5 A;  4R8P A;  3C1C A;  3LJA D;  4X23 D;  3MGR B;  5CPK A;  2NQB B;  3VH6 T;  2G5I C;  1P3A D;  1AOI A;  1BH9 A;  4J8U C;  5AV9 B;  3O62 A;  5GXQ B;  1P3G C;  3X1U B;  3AZK B;  3REL A;  4KUD A;  5B0Y B;  2DF4 C;  4KHA A;  1TAF B;  4AWL C;  4J8U B;  5B33 B;  1M19 C;  1HQ3 D;  1P3G A;  1P3O D;  3REL C;  4G91 C;  5GSU B;  3LZ1 B;  2UWX A;  1P3P C;  4UUZ A;  3KWQ A;  3AZM B;  2DQN C;  2F2A C;  4H9S C;  3X1U A;  2FJ7 B;  3B6F A;  3P5J B;  4E45 A;  5DNM B;  3AZG D;  4YM6 C;  4ZUX D;  3W97 A;  4HGA C;  5FUG A;  3LJA C;  5BNV B;  1F66 D;  3WTP D;  3W96 C;  5AV9 A;  3O62 B;  4YM6 A;  4JJN B;  1TZY D;  3B0C W;  5B32 C;  3MGS C;  3X1V D;  3B6F B;  5B33 A;  3LZ0 C;  2ZY2 A;  4UPK A;  3AFA B;  2HIO B;  5BT1 C;  1P3I C;  3REJ B;  4DRB A;  1P3K A;  3LEL D;  3MGR A;  3AZH B;  5AV5 A;  4NE5 A;  5GXQ A;  4XZQ C;  5B2I C;  3AZH C;  3WA9 C;  1M1A A;  4JJN D;  2IO5 C;  5F99 C;  3B6G D;  4NFT A;  5B2I A;  4XZQ A;  5GSU A;  3AZL C;  5JRG C;  4X23 A;  2Y2J A;  1KX5 C;  3VH6 A;  3LZ1 D;  3AN2 D;  5AV6 A;  3A6N C;  1P3O B;  5B1L C;  5AVC C;  3UTA D;  3EPJ A;  1EQZ B;  5JRG A;  1KX5 A;  2W8S A;  4KGC D;  2Y2Q A;  4QLC D;  4J8V A;  2LY8 A;  2FJ7 A;  3AZF D;  1M1A B;  3WTP B;  1ID3 B;  1P3M D;  1ZLA C;  3MVD B;  4QLC C;  1P3A B;  4H9N B;  3UTB D;  2FJ7 C;  5B40 B;  1S32 D;  4YS3 C;  2Y2M A;  2RVQ D;  1P3B C;  3LZ0 B;  4YM6 B;  2PYO A;  1P3F D;  3KUY D;  4R8P B;  3MVD C;  3C1C B;  3MGQ B;  5B24 C;  1JFI A;  3NQJ B;  3A6N D;  1Q9C A;  2PYO C;  4R8P C;  3C1C C;  5B32 B;  3WA9 D;  5B33 D;  5CP6 A;  3C1B B;  3REI C;  3REJ A;  5B40 A;  5AVB D;  2HIO A;  4J8U A;  5B0Y D;  4J8X A;  4EO5 C;  1M18 C;  5B1M A;  3TU4 D;  2HUE B;  3W98 A;  1ID3 A;  3AZL D;  3C1B C;  1P3F B;  3MGP B;  2F8N D;  5B0Z D;  3LEL A;  3REI A;  3REJ C;  2BYK B;  1M18 B;  1R4V A;  4G91 B;  5B1M C;  4CAY A;  1BH8 B;  3C1B A;  4Z66 C;  3LEL C;  4ZBJ C;  4Z66 D;  2FFF B;  2YFW A;  3KXB D;  3AV2 D;  5B1L B;  3AV2 C;  4XUJ A;  4H9R B;  2Y2G A;  4Z2M H;  3X1S D;  4KHA B;  1PZR A;  4Z5T C;  3W96 A;  5AV9 C;  3AZN B;  4WV4 B;  5B0Y C;  1AOI B;  3X1T C;  5B31 B;  5B33 C;  4Z5T A;  5CPK C;  5E5A D;  4KUD B;  3B0D B;  3REL B;  1AOI C;  3O62 C;  4J8V D;  3W96 B;  1P3P B;  3NQJ A;  3KSY A;  4LD9 D;  2YFV B;  3AZF A;  3UT9 C;  4J8W A;  2BG1 A;  5AV5 C;  1B67 A;  4WU8 A;  3UTB A;  5AY8 A;  1S32 A;  4ZUX B;  1P3P D;  2PYO D;  5AV8 D;  1KU5 A;  4J8W B;  3W97 C;  2RVQ C;  1P3B D;  4X23 C;  5BNX A;  3AYW C;  1W2E A;  2ARO C;  4J8U D;  3AFA D;  4WJ3 C;  2NQB C;  5CPI A;  3AYW A;  1KX3 D;  1KX4 D;  5GT0 D;  3AV2 B;  2F8N H;  2RIQ A;  3WTP E;  3NQU B;  5B2J C;  5JRG D;  3AZI B;  3AZH D;  1EQZ C;  1ZLA A;  3MGR C;  1AOI D;  4WNN A;  4QLC A;  3H0R C;  4XUJ D;  1P3L C;  3AZM D;  4J8X B;  3TU4 B;  2Y2I A;  3VH6 W;  5B31 D;  3AZM C;  1EQZ A;  3REH A;  2L5A A;  1M1A C;  1HQ3 A;  4HGA B;  3FDD A;  5AY8 B;  3W98 B;  3LJA B;  5GSU C;  2F8N G;  3X1U D;  1Z2C B;  4NE6 A;  3KXB C;  1M18 A;  3A6N A;  3MGQ C;  2CV5 A;  3AZE C;  3W98 C;  5B1L A;  2NQB D;  3X1T D;  3AV1 C;  4H9O B;  5KDM A;  3AZE D;  4LD9 A;  5B0Z B;  3UTB B;  5CP6 D;  3WTP A;  3MGQ A;  2CV5 C;  5AV5 B;  3MNN A;  4WU8 D;  3X1S C;  3REK C;  5AY8 D;  5DNN D;  3V9R A;  3B0B A;  4H9N A;  2Y2P A;  4UUZ B;  3X1S B;  3KWQ B;  5AVB C;  3REK A;  3F6T A;  5B31 G;  4R8P D;  3C1C D;  1P3B A;  5DNN B;  1P3K D;  2ZY4 A;  4X23 B;  3MGR D;  1ULY A;  5AV5 D;  5BNV A;  2F8N K;  5DNN C;  5JRG B;  1BH8 A;  4YS3 D;  4WZS B;  3AZF B;  1M1A D;  4AWL B;  1P3G D;  1P3M B;  5F99 B;  4J8X C;  3AV1 D;  3R45 A;  3AZF C;  3KWQ D;  4CAY B;  5C3I C;  5B24 D;  3AN2 A;  3X1U C;  2Y2N A;  2VQR A;  5AY8 C;  3W97 D;  2Y2H A;  1WWI A;  3WAA B;  3B0C T;  4J8W D;  4DRA A;  1KX3 C;  3AZJ A;  3WKJ A;  3X1T B;  5DNM A;  3AN2 B;  1P3P A;  4NE3 A;  1KX3 B;  5AV8 A;  3AZI D;  4H9S A;  2ARO A;  3WAA A;  1P3M A;  3UT9 D;  5DNM C;  5KDM B;  5GT0 B;  2NQB A;  3X1T A;  1P3I A;  3REI B;  2G5H C;  1A7W A;  1P3F A;  1P3K C;  5GT0 C;  5GT3 D;  3AFA A;  3EPL A;  2ARO B;  1TZY A;  4WU9 D;  2NZD A;  3A1I A;  3LZ0 A;  2PYO B;  5GT0 A;  2YFW B;  3AFA C;  4J8W C;  3REH B;  1U35 C;  3EPK A;  4DQY B;  3REK D;  5B2I D;  4XZQ D;  4WU8 C;  4G92 C;  5AV8 B;  1S32 C;  2JSS A;  5JA4 A;  3REH C;  2F8N A;  5E5A C;  3H0L C;  1P3G B;  3VH5 A;  3EG5 B;  1F66 C;  3UTA A;  3NQU A;  5B1M B; 
#chains in the Genus database with same CATH homology
 4LD9 B;  3AZN C;  4H9Q B;  3AZG B;  5F99 A;  1T3U A;  3W99 A;  3KXB A;  1P3O A;  5CPI B;  5JA4 B;  2F8N B;  3X1V C;  3MGS D;  3AV1 A;  4LD9 C;  2YFV A;  3WTP C;  5C3I B;  1P3O C;  1P3L B;  3AZK D;  5G49 A;  1HQ3 B;  5AV6 D;  3X1V B;  3B6F D;  2J8P A;  1ZLA B;  3KXB B;  5AV9 D;  4JJN C;  3B0D C;  5CPJ B;  2FJ7 D;  1P34 D;  1P3K B;  5BO0 A;  1KX4 C;  2NZD B;  2XD1 A;  5CP6 C;  5B40 C;  1JFI B;  2HIO C;  2JE5 A;  3W98 D;  5FUG B;  5AVB B;  3AYW B;  1P3I D;  3AZN D;  2HUE C;  5B24 B;  5AV6 B;  2CV5 B;  3C1B D;  3UTA B;  5B32 D;  3WA9 B;  2NZD D;  4Z66 A;  4E44 A;  1F1E A;  1M19 A;  2ZM5 A;  2Y2L A;  3B6G A;  4ZBJ B;  1B6W A;  3AZJ B;  3WKJ B;  4XUJ C;  3X1S A;  5B1M D;  3H0M C;  3TU4 A;  1KX5 B;  1ID3 D;  1S32 B;  1KX3 A;  3B6G C;  3LZ1 A;  3AZJ C;  3WKJ C;  3VH5 W;  3MVD D;  1U35 D;  5B2J D;  3TU4 C;  4WU9 C;  3AZI C;  3LZ1 C;  5B31 C;  3LJA A;  5CPK D;  4KGC A;  3WAA C;  1P3M C;  1ZLA D;  3AV2 A;  1P3A A;  1P3L D;  3A6N B;  1N1J B;  3MGS A;  4WU9 B;  4Z5T B;  3AZI A;  4Z2M G;  5B31 A;  1EQZ D;  2ARO D;  5CHL B;  1WWS A;  3R45 B;  3KUY C;  3UT9 A;  1P3A C;  3AL0 C;  1P34 B;  3AZE B;  5B32 G;  5CPJ D;  3UTB C;  1KX4 B;  2NZD C;  1HTA A;  4KUD C;  4H9P B;  2BYM B;  1P34 C;  3KUY A;  3AN2 C;  2Y2K A;  3REK B;  3KFU G;  3W99 B;  4QLC B;  3MGP A;  1P34 A;  3WA9 A;  1P3B B;  3KWQ C;  5B0Z C;  3REJ D;  2HIO D;  1F66 A;  4J8X D;  3MGS B;  3UTA C;  3B6F C;  2BYM A;  5GT3 B;  3MGP C;  5CPI D;  3AZL A;  3AZN A;  5AV8 C;  5B0Z A;  3REI D;  3VH5 T;  5AV6 C;  5BS7 C;  1H3O B;  4H9R A;  5AVC A;  1F66 B;  5B32 A;  3B6G B;  5B2J B;  5F99 D;  4CSR A;  1U35 B;  1TZY B;  4H9O A;  3W99 D;  3A1K A;  1P3F C;  5BS7 A;  3AZK C;  4G92 B;  3O62 D;  4J8V C;  1BFM A;  5B2I B;  4XZQ B;  3REL D;  5CPI C;  5E5A B;  4KUD D;  1TZY C;  5AVC B;  2IO5 B;  3REH D;  1H3O A;  2CWE A;  3LEL B;  4J8V B;  3AZK A;  3W96 D;  4JJN A;  3V9R B;  1U35 A;  5B2J A;  3AZL B;  2JCH A;  5GXQ C;  3AZG C;  5CPK B;  3EPH A;  4Z5T D;  5GSU D;  3AZH A;  5E5A A;  5B24 A;  2CV5 D;  1P3L A;  1M19 B;  5B1L D;  4H9Q A;  4ZUX A;  3AZE A;  3AZG A;  3AZM A;  5CPJ C;  3UT9 B;  4YS3 B;  3AV1 B;  1KX5 D;  1HQ3 C;  3MGQ D;  3W99 C;  3AZJ D;  3WKJ D;  3KUY B;  5CP6 B;  5DNM D;  4H9P A;  4ZUX C;  4YM6 D;  3MNN C;  5CPJ A;  1ID3 C;  5G49 B;  3X1V A;  5BNX B;  3WAA D;  3MNN B;  5GT3 C;  1BH9 B;  1M18 D;  3W97 B;  4EO5 B;  3MGP D;  2BYK A;  2ZY5 A;  4WNN B;  1M19 D;  3IP4 C;  5GT3 A;  4KGC B;  4WU8 B;  5BT1 D;  3MNN D;  5BO0 B;  5GXQ D;  4YS3 A;  1N1J A;  5DNN A;  2Y2O A;  3AYW D;  4XUJ B;  4WU9 A;  1P3I B;  3LZ0 D;  4KGC C;  4Z66 B;  1KX4 A;  3MVD A;  5B40 D;  1TAF A;  2ZY3 A;  4M6B A;  4CSR B;  5AVB A;  5B0Y A;  5AVC D;  2XD5 A;  4R8P A;  3C1C A;  3LJA D;  4X23 D;  3MGR B;  5CPK A;  2NQB B;  3VH6 T;  2G5I C;  1P3A D;  1AOI A;  1BH9 A;  4J8U C;  5AV9 B;  3O62 A;  5GXQ B;  1P3G C;  3X1U B;  3AZK B;  3REL A;  4KUD A;  5B0Y B;  2DF4 C;  4KHA A;  1TAF B;  4AWL C;  4J8U B;  5B33 B;  1M19 C;  1HQ3 D;  1P3G A;  1P3O D;  3REL C;  4G91 C;  5GSU B;  3LZ1 B;  2UWX A;  1P3P C;  4UUZ A;  3KWQ A;  3AZM B;  2DQN C;  2F2A C;  4H9S C;  3X1U A;  2FJ7 B;  3B6F A;  3P5J B;  4E45 A;  5DNM B;  3AZG D;  4YM6 C;  4ZUX D;  3W97 A;  4HGA C;  5FUG A;  3LJA C;  5BNV B;  1F66 D;  3WTP D;  3W96 C;  5AV9 A;  3O62 B;  4YM6 A;  4JJN B;  1TZY D;  3B0C W;  5B32 C;  3MGS C;  3X1V D;  3B6F B;  5B33 A;  3LZ0 C;  2ZY2 A;  4UPK A;  3AFA B;  2HIO B;  5BT1 C;  1P3I C;  3REJ B;  4DRB A;  1P3K A;  3LEL D;  3MGR A;  3AZH B;  5AV5 A;  4NE5 A;  5GXQ A;  4XZQ C;  5B2I C;  3AZH C;  3WA9 C;  1M1A A;  4JJN D;  2IO5 C;  5F99 C;  3B6G D;  4NFT A;  5B2I A;  4XZQ A;  5GSU A;  3AZL C;  5JRG C;  4X23 A;  2Y2J A;  1KX5 C;  3VH6 A;  3LZ1 D;  3AN2 D;  5AV6 A;  3A6N C;  1P3O B;  5B1L C;  5AVC C;  3UTA D;  3EPJ A;  1EQZ B;  5JRG A;  1KX5 A;  2W8S A;  4KGC D;  2Y2Q A;  4QLC D;  4J8V A;  2LY8 A;  2FJ7 A;  3AZF D;  1M1A B;  3WTP B;  1ID3 B;  1P3M D;  1ZLA C;  3MVD B;  4QLC C;  1P3A B;  4H9N B;  3UTB D;  2FJ7 C;  5B40 B;  1S32 D;  4YS3 C;  2Y2M A;  2RVQ D;  1P3B C;  3LZ0 B;  4YM6 B;  2PYO A;  1P3F D;  3KUY D;  4R8P B;  3MVD C;  3C1C B;  3MGQ B;  5B24 C;  1JFI A;  3NQJ B;  3A6N D;  1Q9C A;  2PYO C;  4R8P C;  3C1C C;  5B32 B;  3WA9 D;  5B33 D;  5CP6 A;  3C1B B;  3REI C;  3REJ A;  5B40 A;  5AVB D;  2HIO A;  4J8U A;  5B0Y D;  4J8X A;  4EO5 C;  1M18 C;  5B1M A;  3TU4 D;  2HUE B;  3W98 A;  1ID3 A;  3AZL D;  3C1B C;  1P3F B;  3MGP B;  2F8N D;  5B0Z D;  3LEL A;  3REI A;  3REJ C;  2BYK B;  1M18 B;  1R4V A;  4G91 B;  5B1M C;  4CAY A;  1BH8 B;  3C1B A;  4Z66 C;  3LEL C;  4ZBJ C;  4Z66 D;  2FFF B;  2YFW A;  3KXB D;  3AV2 D;  5B1L B;  3AV2 C;  4XUJ A;  4H9R B;  2Y2G A;  4Z2M H;  3X1S D;  4KHA B;  1PZR A;  4Z5T C;  3W96 A;  5AV9 C;  3AZN B;  4WV4 B;  5B0Y C;  1AOI B;  3X1T C;  5B31 B;  5B33 C;  4Z5T A;  5CPK C;  5E5A D;  4KUD B;  3B0D B;  3REL B;  1AOI C;  3O62 C;  4J8V D;  3W96 B;  1P3P B;  3NQJ A;  3KSY A;  4LD9 D;  2YFV B;  3AZF A;  3UT9 C;  4J8W A;  2BG1 A;  5AV5 C;  1B67 A;  4WU8 A;  3UTB A;  5AY8 A;  1S32 A;  4ZUX B;  1P3P D;  2PYO D;  5AV8 D;  1KU5 A;  4J8W B;  3W97 C;  2RVQ C;  1P3B D;  4X23 C;  5BNX A;  3AYW C;  1W2E A;  2ARO C;  4J8U D;  3AFA D;  4WJ3 C;  2NQB C;  5CPI A;  3AYW A;  1KX3 D;  1KX4 D;  5GT0 D;  3AV2 B;  2F8N H;  2RIQ A;  3WTP E;  3NQU B;  5B2J C;  5JRG D;  3AZI B;  3AZH D;  1EQZ C;  1ZLA A;  3MGR C;  1AOI D;  4WNN A;  4QLC A;  3H0R C;  4XUJ D;  1P3L C;  3AZM D;  4J8X B;  3TU4 B;  2Y2I A;  3VH6 W;  5B31 D;  3AZM C;  1EQZ A;  3REH A;  2L5A A;  1M1A C;  1HQ3 A;  4HGA B;  3FDD A;  5AY8 B;  3W98 B;  3LJA B;  5GSU C;  2F8N G;  3X1U D;  1Z2C B;  4NE6 A;  3KXB C;  1M18 A;  3A6N A;  3MGQ C;  2CV5 A;  3AZE C;  3W98 C;  5B1L A;  2NQB D;  3X1T D;  3AV1 C;  4H9O B;  5KDM A;  3AZE D;  4LD9 A;  5B0Z B;  3UTB B;  5CP6 D;  3WTP A;  3MGQ A;  2CV5 C;  5AV5 B;  3MNN A;  4WU8 D;  3X1S C;  3REK C;  5AY8 D;  5DNN D;  3V9R A;  3B0B A;  4H9N A;  2Y2P A;  4UUZ B;  3X1S B;  3KWQ B;  5AVB C;  3REK A;  3F6T A;  5B31 G;  4R8P D;  3C1C D;  1P3B A;  5DNN B;  1P3K D;  2ZY4 A;  4X23 B;  3MGR D;  1ULY A;  5AV5 D;  5BNV A;  2F8N K;  5DNN C;  5JRG B;  1BH8 A;  4YS3 D;  4WZS B;  3AZF B;  1M1A D;  4AWL B;  1P3G D;  1P3M B;  5F99 B;  4J8X C;  3AV1 D;  3R45 A;  3AZF C;  3KWQ D;  4CAY B;  5C3I C;  5B24 D;  3AN2 A;  3X1U C;  2Y2N A;  2VQR A;  5AY8 C;  3W97 D;  2Y2H A;  1WWI A;  3WAA B;  3B0C T;  4J8W D;  4DRA A;  1KX3 C;  3AZJ A;  3WKJ A;  3X1T B;  5DNM A;  3AN2 B;  1P3P A;  4NE3 A;  1KX3 B;  5AV8 A;  3AZI D;  4H9S A;  2ARO A;  3WAA A;  1P3M A;  3UT9 D;  5DNM C;  5KDM B;  5GT0 B;  2NQB A;  3X1T A;  1P3I A;  3REI B;  2G5H C;  1A7W A;  1P3F A;  1P3K C;  5GT0 C;  5GT3 D;  3AFA A;  3EPL A;  2ARO B;  1TZY A;  4WU9 D;  2NZD A;  3A1I A;  3LZ0 A;  2PYO B;  5GT0 A;  2YFW B;  3AFA C;  4J8W C;  3REH B;  1U35 C;  3EPK A;  4DQY B;  3REK D;  5B2I D;  4XZQ D;  4WU8 C;  4G92 C;  5AV8 B;  1S32 C;  2JSS A;  5JA4 A;  3REH C;  2F8N A;  5E5A C;  3H0L C;  1P3G B;  3VH5 A;  3EG5 B;  1F66 C;  3UTA A;  3NQU A;  5B1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...