1M19C

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19C00
5B1LD 1M18A 2HIOC 3W99C 3UT9B 1P3ID 2NZDC 5BT1D 5AVBC 3X1TD 3B0CW 3W97A 3MGPC 3KUYB 3A6NC 3VH6T 3KWQD 1P3MA 3C1CA 2BYKA 1H3OA 4H9NB 4JJNA 3AYWC 2HUEB 4WU8B 2YFVB 3AZJD 1P3PA 2LY8A 3R45B 3WAAD 3REJD 3AZND 4J8XC 3LJAA 1WWIA 3MVDA 5B0YD 5CPIC 1P3LC 1ID3B 4QLCA 4J8VD 5GSUA 5GT0B 3X1VB 3LZ0B 1BH8A 5AVCB 1M19A 3AZLA 1AOIC 3V9RB 3X1SD 5AY8B 3MGQC 4WV4B 5JA4A 3AN2C 2F8NB 1P3BD 4CAYB 3O62B 4H9SC 3W96D 5B2JA 5AV9A 4YM6A 3TU4A 5GXQA 4R8PA 3B6GA 3NQJA 5AV5B 3AZFA 1P3AB 5B40A 4YS3D 4X23D 3LELC 5DNNA 5B31C 3AZHB 1KX4B 3KXBB 1KX3B 5CHLB 4ZUXC 3WTPB 3LZ1B 1S32B 2NQBB 4G91C 1BFMA 1F66B 3MGSA 3AZIA 3AFAC 3AZKB 5DNMA 1KX5C 5B1LC 5CPKB 5F99D 1P3IC 5B0ZD 3MNNC 1EQZD 4H9RA 5BT1C 3X1TC 3WKJA 2AROB 2JSSA 4J8WB 1N1JB 3REID 3KWQC 1ZLAD 1P3KD 4WU8A 2NZDA 4XUJB 5AVBA 5GT3D 4G92B 3R45A 5B2ID 3MGPA 3AZEB 3AZJC 2CV5B 1HTAA 3WAAC 3A6NA 3REJC 3AZNC 4H9OA 4WU9B 3AYWA 3X1VA 5B0YC 5GT0A 3W98D 1P34C 4J8VC 3LZ0A 5AVCA 4J8XA 1M18B 2IO5C 3V9RA 5CP6A 4CSRA 1P3LA 5E5AA 3X1SC 3W97B 3AV1B 4WZSB 4Z2MH 4KGCD 2BYKB 3O62A 1H3OB 1P3BC 1P3PB 4XZQB 5JRGD 3W96C 3AN2A 4E45A 1U35B 5B24D 3LJAB 3UTBD 3MVDB 1TZYB 1P3AA 4ZBJB 4QLCB 1BH8B 4YS3C 4X23C 4Z66D 3WTPE 3AZLB 2FJ7D 5B1MB 3B6FD 4LD9D 5JA4B 3B0CT 1P3GD 2RVQD 3LELA 1P3FA 3VH5A 5B31A 4EO5C 5AV6D 5B2JB 5AV9B 4YM6B 5F99C 5GXQB 3B6GB 2BYMB 1EQZC 3AFAA 1KX5A 3NQJB 5B1LA 3REIC 4XUJA 3MGRD 1ZLAC 5B40B 1P3KC 5B32G 3X1TA 5GT3C 5B2IC 3X1UD 3AZMD 5B33B 4Z5TC 3C1BB 3W98C 3AZJA 1HQ3A 3MGSB 3AZIB 3AZNA 5DNMB 3MNND 5BS7A 5B0YA 3AV1A 4H9RB 4J8VA 3WKJB 3B0DC 2HIOB 3VH5W 3REKD 4M6BA 3W99B 4KGCC 2NZDB 5AVBB 3X1SA 4XZQA 3MGPB 3A6NB 1U35A 5JRGC 1TZYA 4H9OB 5B24C 1P34D 3AYWB 5AV8D 3UTBC 3WA9D 3AZGA 3W96A 4WNNB 5CPJD 4J8XB 3RELD 5CP6B 5CPIB 4CSRB 4Z66C 1P3LB 2FJ7C 5B1MA 5E5AB 3VH6A 1A7WA 3B6FC 4YS3A 4LD9C 4X23A 4KHAB 1P3GC 2RVQC 1AOIB 1KU5A 3MGQB 4J8UD 4Z2MG 5AV6C 3AN2B 2BYMA 1B6WA 4NE5A 1P3MD 3C1CD 5F99A 3MGRC 4JJND 1EQZA 5B0ZA 5B33A 3X1UC 3REIA 3C1BA 1ZLAA 1P3KA 3AZMC 2F8NG 5B2IA 2PYOD 1P3FB 3LELB 5GSUD 5B31B 5B32D 1M19D 4ZUXB 3W98A 4G91B 2HIOA 3AFAB 1KX4C 1WWSA 1KX5B 3W99A 5B1LB 3AV2D 3REKC 1P3IB 3UTAD 4AWLC 3X1TB 5CPKC 4Z5TD 3TU4D 4R8PD 3KWQB 3B6GD 4KGCA 2L5AA 2F8NK 1BH9B 5AV8C 3WA9C 5FUGA 4WNNA 3AZFD 1HQ3B 3AZJB 3WAAB 5JRGA 5G49A 3REJB 3AZNB 5CPIA 5CPJC 5B24A 3UTBA 3RELC 5B0YB 4KUDD 5DNND 5C3IC 4J8VB 1P3OD 4WU9C 4KHAA 1AOIA 2IO5B 3REHD 1M1AD 3MGQA 3X1SB 4J8UC 3UT9D 3B6FA 4LD9A 1P3GA 3KUYD 1P3BB 4H9SA 3AZGB 4H9QB 1P3MC 5AV6A 3C1CC 3W96B 4WU8D 5BNXA 4JJNC 4DRBA 3LJAC 1ID3D 3X1VD 4YS3B 5GT0D 4X23B 4H9PB 2PYOC 3LZ0D 5GSUC 5AVCD 3X1UA 5B32C 4ZUXA 3AZMA 1ULYA 1M19C 5AY8D 5E5AD 5BNVA 4HGAB 4EO5B 2F8ND 1P3IA 3MNNA 3AV2C 5F99B 3O62D 1EQZB 5B0ZB 3UTAC 2YFWA 3KWQA 5B2JC 3REIB 3TU4C 4NFTA 1BH9A 4R8PC 1ZLAB 3B6GC 1P3KB 5AV5D 1P3AD 5GT3B 5B2IB 3WAAA 3REJA 3AZFC 1P34A 3AZHD 3WA9A 4KUDC 1KX4D 3W98B 3KXBD 5DNNC 1KX3D 4NE3A 3LZ1D 3WTPD 1S32D 1P3OC 2NQBD 3REHC 1F66D 3RELA 3NQUB 1M1AC 3AZKD 5CPKD 3B0DB 3UT9C 1P3BA 2AROD 4J8WD 4KGCB 3KUYC 4H9QA 4J8UA 5FUGB 4XUJD 5JRGB 5G49B 2HUEC 4WU8C 3AZED 5BO0B 2CV5D 5B24B 3UTBB 4WU9D 4H9PA 1ID3C 3X1VC 5KDMA 5GT0C 1HQ3D 4UUZB 4Z66B 2FJ7B 1M18D 3LZ0C 5AVCC 3B6FB 1R4VA 4LD9B 5CP6C 3W97D 5AY8C 3AV1D 5E5AC 1P3GB 2PYOA 5B32A 5AV6B 5BNXB 3O62C 1P3PD 4XZQD 1JFIB 1U35D 3LJAD 3MVDD 3AV2A 1TZYD 3MGRB 5GT3A 4QLCD 3UTAA 5AV5C 3AZGD 1P3AC 3X1UB 4Z5TA 3AZLD 3VH6W 3AZMB 5B1MD 3AZHC 3KXBC 5BNVB 1KX3C 3LZ1C 3WTPC 3NQUA 4NE6A 1S32C 2NQBC 1TAFA 3MNNB 1P3FC 1F66C 4KUDA 3AZKC 5B2JD 5AV9D 4YM6D 1P3OA 2YFWB 5GXQD 3REHA 1M1AA 3REKB 2AROC 4J8WC 4AWLB 5B31G 5B40D 3UT9A 5BO0A 4XUJC 4G92C 3AZEC 3KUYA 2CV5C 1P34B 5AV8B 3WA9B 5B33D 3C1BD 4H9NA 2YFVA 4UUZA 4Z66A 5CPJB 2FJ7A 3MGSD 3RELB 3AZID 1HQ3C 5DNMD 3KSYA 1M18C 5C3IB 1ID3A 5BS7C 3WKJD 3W97C 3AV1C 2HIOD 3W99D 4DRAA 4J8UB 2NZDD 5AVBD 5AY8A 3MGPD 1P3PC 1JFIA 4XZQC 3A6ND 3B0BA 2F8NA 3MGRA 1B67A 1U35C 1P3MB 3C1CB 3AYWD 3MVDC 1TZYC 4CAYA 4JJNB 4ZBJC 3VH5T 4QLCC 3AZGC 5KDMB 4J8XD 5CP6D 5CPID 1P3LD 1Q9CA 3AZLC 5AV5A 5B1MC 2PYOB 5GSUB 1AOID 5B32B 1M19B 2F8NH 1F1EA 3MGQD 3AZHA 1KX4A 3KXBA 1KX3A 3AN2D 5AV9C 4YM6C 3WTPA 3LZ1A 1S32A 3REKA 5GXQC 2NQBA 4E44A 3AV2B 1F66A 3AZKA 2CWEA 3UTAB 4HGAC 5CPKA 5B40C 4Z5TB 3TU4B 4R8PB 2AROA 5AV8A 5B0ZC 4J8WA 1N1JA 5B33C 3AZFB 3C1BC 5CPJA 1P3FD 3LELD 3AZEA 2CV5A 1TAFB 5B31D 3MGSC 3AZIC 4KUDB 5DNMC 4WU9A 5DNNB 4ZUXD 1P3OB 3REHB 1M1AB 3WKJC 3AFAD 1KX5D
chains in the Genus database with same CATH superfamily
5B1LD 1M18A 2HIOC 3W99C 3UT9B 1P3ID 2NZDC 5BT1D 5AVBC 3X1TD 3B0CW 3W97A 3MGPC 3KUYB 4UPKA 3A6NC 3VH6T 3KWQD 1P3MA 3C1CA 2BYKA 1H3OA 4H9NB 4JJNA 3AYWC 2HUEB 4WU8B 2YFVB 2G5HC 3AZJD 1P3PA 2LY8A 3R45B 3WAAD 3REJD 3AZND 4J8XC 3LJAA 1WWIA 3MVDA 5B0YD 5CPIC 2Y2PA 1P3LC 1ID3B 4QLCA 4J8VD 5GSUA 5GT0B 3X1VB 3LZ0B 1BH8A 5AVCB 1M19A 3AZLA 1AOIC 3V9RB 3X1SD 5AY8B 3MGQC 4WV4B 5JA4A 3AN2C 2F8NB 1P3BD 2ZY2A 4CAYB 3O62B 4H9SC 3W96D 5B2JA 5AV9A 4YM6A 3TU4A 5GXQA 4R8PA 3B6GA 3NQJA 5AV5B 3AZFA 1P3AB 2Y2KA 1Z2CB 5B40A 2Y2JA 4YS3D 4X23D 3LELC 2Y2OA 5DNNA 5B31C 3AZHB 1KX4B 3KXBB 1KX3B 5CHLB 4ZUXC 3WTPB 3LZ1B 1S32B 2NQBB 4G91C 1BFMA 1F66B 3MGSA 3AZIA 3AFAC 3AZKB 5DNMA 1KX5C 5B1LC 5CPKB 5F99D 1P3IC 5B0ZD 3MNNC 1EQZD 4H9RA 5BT1C 3X1TC 3WKJA 2AROB 2JSSA 4J8WB 1N1JB 4DQYB 3REID 3KWQC 1ZLAD 1P3KD 4WU8A 2NZDA 4XUJB 5AVBA 5GT3D 4G92B 3R45A 5B2ID 3EPLA 3MGPA 3AZEB 3AZJC 2CV5B 1HTAA 3WAAC 3A6NA 3REJC 3AZNC 4H9OA 4WU9B 3AYWA 3X1VA 5B0YC 5GT0A 3W98D 1P34C 1T3UA 2ZY5A 4J8VC 3P5JB 3LZ0A 3A1IA 5AVCA 4J8XA 1M18B 3FDDA 2IO5C 3V9RA 5CP6A 4CSRA 1P3LA 5E5AA 3X1SC 3W97B 3AV1B 4WZSB 4Z2MH 3AL0C 4KGCD 2BYKB 3O62A 1H3OB 1P3BC 3A1KA 1P3PB 4XZQB 5JRGD 3W96C 3AN2A 4E45A 1U35B 5B24D 3LJAB 3UTBD 3MVDB 1TZYB 1P3AA 4ZBJB 4QLCB 1BH8B 4YS3C 4X23C 4Z66D 3WTPE 3AZLB 2FJ7D 5B1MB 3B6FD 4LD9D 5JA4B 3B0CT 1P3GD 2RVQD 3LELA 1P3FA 3VH5A 5B31A 4EO5C 5AV6D 5B2JB 5AV9B 4YM6B 5F99C 5GXQB 3B6GB 2BYMB 1EQZC 3AFAA 1KX5A 3NQJB 5B1LA 3REIC 4XUJA 3MGRD 1ZLAC 5B40B 1P3KC 5B32G 3X1TA 5GT3C 1PZRA 5B2IC 3X1UD 2Y2QA 3AZMD 5B33B 4Z5TC 3C1BB 3W98C 3AZJA 1HQ3A 3MGSB 3AZIB 3AZNA 5DNMB 3MNND 5BS7A 5B0YA 3AV1A 4H9RB 4J8VA 3WKJB 3B0DC 2HIOB 3VH5W 3REKD 4M6BA 3W99B 4KGCC 2NZDB 5AVBB 3X1SA 4XZQA 4WJ3C 3MGPB 3A6NB 1U35A 5JRGC 1TZYA 4H9OB 5B24C 1P34D 3AYWB 5AV8D 3UTBC 3WA9D 3AZGA 3W96A 4WNNB 5CPJD 4J8XB 3RELD 5CP6B 5CPIB 4CSRB 4Z66C 2ZY4A 1P3LB 5B1MA 2FJ7C 5E5AB 3VH6A 1A7WA 3EPKA 3B6FC 4YS3A 4LD9C 4X23A 4KHAB 1P3GC 2RVQC 1AOIB 1KU5A 3MGQB 2ZM5A 4J8UD 2UWXA 4Z2MG 5AV6C 3AN2B 2BYMA 1B6WA 4NE5A 1P3MD 3C1CD 5F99A 3MGRC 3IP4C 4JJND 1EQZA 5B0ZA 2Y2HA 5B33A 3X1UC 3REIA 3C1BA 1ZLAA 1P3KA 3AZMC 2F8NG 5B2IA 2PYOD 1P3FB 3LELB 3KFUG 5GSUD 3H0LC 5B31B 5B32D 1M19D 2J8PA 4ZUXB 3W98A 4G91B 2HIOA 3AFAB 1KX4C 1WWSA 1KX5B 3W99A 5B1LB 3AV2D 2XD1A 3REKC 1P3IB 3UTAD 4AWLC 3X1TB 5CPKC 4Z5TD 3TU4D 4R8PD 3KWQB 3B6GD 4KGCA 2L5AA 2F8NK 1BH9B 5AV8C 3WA9C 5FUGA 4WNNA 3AZFD 1HQ3B 3AZJB 3WAAB 5JRGA 5G49A 2VQRA 3REJB 3AZNB 5CPIA 5CPJC 5B24A 3UTBA 3RELC 5B0YB 4KUDD 5DNND 5C3IC 4J8VB 1P3OD 4WU9C 4KHAA 1AOIA 2IO5B 3REHD 1M1AD 3MGQA 3X1SB 4J8UC 3UT9D 3B6FA 4LD9A 1P3GA 3KUYD 1P3BB 4H9SA 3AZGB 4H9QB 1P3MC 5AV6A 3C1CC 3W96B 4WU8D 5BNXA 4JJNC 4DRBA 3LJAC 1ID3D 3X1VD 4YS3B 5GT0D 4X23B 4H9PB 2PYOC 3LZ0D 5GSUC 5AVCD 3X1UA 5B32C 4ZUXA 3AZMA 1ULYA 1M19C 5AY8D 5E5AD 2JCHA 5BNVA 4HGAB 4EO5B 2F8ND 1P3IA 3MNNA 3AV2C 5F99B 3O62D 1EQZB 5B0ZB 3UTAC 2YFWA 3KWQA 1W2EA 2DQNC 5B2JC 3REIB 3TU4C 2G5IC 1BH9A 4NFTA 4R8PC 2W8SA 3EPJA 1P3KB 1ZLAB 3B6GC 5AV5D 2DF4C 1P3AD 5GT3B 5B2IB 3H0RC 3WAAA 3REJA 3AZFC 1P34A 3AZHD 3WA9A 4KUDC 1KX4D 3W98B 3KXBD 5DNNC 1KX3D 2Y2LA 4NE3A 3LZ1D 3WTPD 1S32D 1P3OC 2NQBD 3REHC 1F66D 3RELA 3NQUB 1M1AC 3AZKD 5CPKD 2JE5A 3B0DB 3UT9C 1P3BA 2AROD 4J8WD 4KGCB 3KUYC 4H9QA 4J8UA 5FUGB 2Y2IA 4XUJD 5JRGB 5G49B 2HUEC 4WU8C 3AZED 5BO0B 3F6TA 2CV5D 5B24B 3UTBB 4WU9D 2F2AC 4H9PA 1ID3C 3X1VC 5KDMA 5GT0C 1HQ3D 4UUZB 4Z66B 2FJ7B 1M18D 3LZ0C 5AVCC 3B6FB 1R4VA 4LD9B 5CP6C 3W97D 2FFFB 5AY8C 5E5AC 3AV1D 1P3GB 2PYOA 2Y2NA 5B32A 5AV6B 5BNXB 3O62C 1P3PD 4XZQD 1JFIB 1U35D 3LJAD 3MVDD 2ZY3A 3AV2A 1TZYD 3MGRB 5GT3A 4QLCD 3UTAA 5AV5C 3AZGD 1P3AC 3X1UB 4Z5TA 3AZLD 2Y2GA 3VH6W 3AZMB 5B1MD 3AZHC 3KXBC 5BNVB 1KX3C 3LZ1C 3WTPC 3NQUA 4NE6A 1S32C 3H0MC 2NQBC 1TAFA 3MNNB 1P3FC 1F66C 4KUDA 3AZKC 5B2JD 5AV9D 4YM6D 1P3OA 2YFWB 5GXQD 3REHA 1M1AA 3REKB 2AROC 4J8WC 2RIQA 2XD5A 4AWLB 5B31G 5B40D 3UT9A 5BO0A 4XUJC 4G92C 3AZEC 3KUYA 2CV5C 1P34B 5AV8B 3WA9B 5B33D 3C1BD 4H9NA 2YFVA 4UUZA 4Z66A 5CPJB 2FJ7A 3MGSD 3RELB 3AZID 1HQ3C 5DNMD 3KSYA 1M18C 5C3IB 2Y2MA 1ID3A 5BS7C 3WKJD 3W97C 3AV1C 2HIOD 3EG5B 3W99D 4DRAA 4J8UB 2NZDD 5AVBD 5AY8A 3MGPD 1P3PC 1JFIA 4XZQC 3A6ND 3B0BA 2F8NA 3MGRA 1B67A 1U35C 1P3MB 3C1CB 3AYWD 3MVDC 1TZYC 4CAYA 4JJNB 4ZBJC 3VH5T 4QLCC 3AZGC 5KDMB 4J8XD 3EPHA 5CP6D 5CPID 2BG1A 1P3LD 1Q9CA 3AZLC 5AV5A 5B1MC 2PYOB 5GSUB 1AOID 5B32B 1M19B 2F8NH 1F1EA 3MGQD 3AZHA 1KX4A 3KXBA 1KX3A 3AN2D 5AV9C 4YM6C 3WTPA 3LZ1A 1S32A 3REKA 5GXQC 2NQBA 4E44A 3AV2B 1F66A 3AZKA 2CWEA 3UTAB 4HGAC 5CPKA 5B40C 4Z5TB 3TU4B 4R8PB 2AROA 5AV8A 5B0ZC 4J8WA 1N1JA 5B33C 3AZFB 3C1BC 5CPJA 1P3FD 3LELD 3AZEA 2CV5A 1TAFB 5B31D 3MGSC 3AZIC 4KUDB 5DNMC 4WU9A 5DNNB 4ZUXD 1P3OB 3REHB 1M1AB 3WKJC 3AFAD 1KX5D
chains in the Genus database with same CATH topology
5B1LD 1M18A 2HIOC 3W99C 3UT9B 1P3ID 2NZDC 5BT1D 5AVBC 3X1TD 3B0CW 3W97A 3MGPC 3KUYB 4UPKA 3A6NC 3VH6T 3KWQD 1P3MA 3C1CA 2BYKA 1H3OA 4H9NB 4JJNA 3AYWC 2HUEB 4WU8B 2YFVB 2G5HC 3AZJD 1P3PA 2LY8A 3R45B 3WAAD 3REJD 3AZND 4J8XC 3LJAA 1WWIA 3MVDA 5B0YD 5CPIC 2Y2PA 1P3LC 1ID3B 4QLCA 4J8VD 5GSUA 5GT0B 3X1VB 3LZ0B 1BH8A 5AVCB 1M19A 3AZLA 1AOIC 3V9RB 3X1SD 5AY8B 3MGQC 4WV4B 5JA4A 3AN2C 2F8NB 1P3BD 2ZY2A 4CAYB 3O62B 4H9SC 3W96D 5B2JA 5AV9A 4YM6A 3TU4A 5GXQA 4R8PA 3B6GA 3NQJA 5AV5B 3AZFA 1P3AB 2Y2KA 1Z2CB 5B40A 2Y2JA 4YS3D 4X23D 3LELC 2Y2OA 5DNNA 5B31C 3AZHB 1KX4B 3KXBB 1KX3B 5CHLB 4ZUXC 3WTPB 3LZ1B 1S32B 2NQBB 4G91C 1BFMA 1F66B 3MGSA 3AZIA 3AFAC 3AZKB 5DNMA 1KX5C 5B1LC 5CPKB 5F99D 1P3IC 5B0ZD 3MNNC 1EQZD 4H9RA 5BT1C 3X1TC 3WKJA 2AROB 2JSSA 4J8WB 1N1JB 4DQYB 3REID 3KWQC 1ZLAD 1P3KD 4WU8A 2NZDA 4XUJB 5AVBA 5GT3D 4G92B 3R45A 5B2ID 3EPLA 3MGPA 3AZEB 3AZJC 2CV5B 1HTAA 3WAAC 3A6NA 3REJC 3AZNC 4H9OA 4WU9B 3AYWA 3X1VA 5B0YC 5GT0A 3W98D 1P34C 1T3UA 2ZY5A 4J8VC 3P5JB 3LZ0A 3A1IA 5AVCA 4J8XA 1M18B 3FDDA 2IO5C 3V9RA 5CP6A 4CSRA 1P3LA 5E5AA 3X1SC 3W97B 3AV1B 4WZSB 4Z2MH 3AL0C 4KGCD 2BYKB 3O62A 1H3OB 1P3BC 3A1KA 1P3PB 4XZQB 5JRGD 3W96C 3AN2A 4E45A 1U35B 5B24D 3LJAB 3UTBD 3MVDB 1TZYB 1P3AA 4ZBJB 4QLCB 1BH8B 4YS3C 4X23C 4Z66D 3WTPE 3AZLB 2FJ7D 5B1MB 3B6FD 4LD9D 5JA4B 3B0CT 1P3GD 2RVQD 3LELA 1P3FA 3VH5A 5B31A 4EO5C 5AV6D 5B2JB 5AV9B 4YM6B 5F99C 5GXQB 3B6GB 2BYMB 1EQZC 3AFAA 1KX5A 3NQJB 5B1LA 3REIC 4XUJA 3MGRD 1ZLAC 5B40B 1P3KC 5B32G 3X1TA 5GT3C 1PZRA 5B2IC 3X1UD 2Y2QA 3AZMD 5B33B 4Z5TC 3C1BB 3W98C 3AZJA 1HQ3A 3MGSB 3AZIB 3AZNA 5DNMB 3MNND 5BS7A 5B0YA 3AV1A 4H9RB 4J8VA 3WKJB 3B0DC 2HIOB 3VH5W 3REKD 4M6BA 3W99B 4KGCC 2NZDB 5AVBB 3X1SA 4XZQA 4WJ3C 3MGPB 3A6NB 1U35A 5JRGC 1TZYA 4H9OB 5B24C 1P34D 3AYWB 5AV8D 3UTBC 3WA9D 3AZGA 3W96A 4WNNB 5CPJD 4J8XB 3RELD 5CP6B 5CPIB 4CSRB 4Z66C 2ZY4A 1P3LB 5B1MA 2FJ7C 5E5AB 3VH6A 1A7WA 3EPKA 3B6FC 4YS3A 4LD9C 4X23A 4KHAB 1P3GC 2RVQC 1AOIB 1KU5A 3MGQB 2ZM5A 4J8UD 2UWXA 4Z2MG 5AV6C 3AN2B 2BYMA 1B6WA 4NE5A 1P3MD 3C1CD 5F99A 3MGRC 3IP4C 4JJND 1EQZA 5B0ZA 2Y2HA 5B33A 3X1UC 3REIA 3C1BA 1ZLAA 1P3KA 3AZMC 2F8NG 5B2IA 2PYOD 1P3FB 3LELB 3KFUG 5GSUD 3H0LC 5B31B 5B32D 1M19D 2J8PA 4ZUXB 3W98A 4G91B 2HIOA 3AFAB 1KX4C 1WWSA 1KX5B 3W99A 5B1LB 3AV2D 2XD1A 3REKC 1P3IB 3UTAD 4AWLC 3X1TB 5CPKC 4Z5TD 3TU4D 4R8PD 3KWQB 3B6GD 4KGCA 2L5AA 2F8NK 1BH9B 5AV8C 3WA9C 5FUGA 4WNNA 3AZFD 1HQ3B 3AZJB 3WAAB 5JRGA 5G49A 2VQRA 3REJB 3AZNB 5CPIA 5CPJC 5B24A 3UTBA 3RELC 5B0YB 4KUDD 5DNND 5C3IC 4J8VB 1P3OD 4WU9C 4KHAA 1AOIA 2IO5B 3REHD 1M1AD 3MGQA 3X1SB 4J8UC 3UT9D 3B6FA 4LD9A 1P3GA 3KUYD 1P3BB 4H9SA 3AZGB 4H9QB 1P3MC 5AV6A 3C1CC 3W96B 4WU8D 5BNXA 4JJNC 4DRBA 3LJAC 1ID3D 3X1VD 4YS3B 5GT0D 4X23B 4H9PB 2PYOC 3LZ0D 5GSUC 5AVCD 3X1UA 5B32C 4ZUXA 3AZMA 1ULYA 1M19C 5AY8D 5E5AD 2JCHA 5BNVA 4HGAB 4EO5B 2F8ND 1P3IA 3MNNA 3AV2C 5F99B 3O62D 1EQZB 5B0ZB 3UTAC 2YFWA 3KWQA 1W2EA 2DQNC 5B2JC 3REIB 3TU4C 2G5IC 1BH9A 4NFTA 4R8PC 2W8SA 3EPJA 1P3KB 1ZLAB 3B6GC 5AV5D 2DF4C 1P3AD 5GT3B 5B2IB 3H0RC 3WAAA 3REJA 3AZFC 1P34A 3AZHD 3WA9A 4KUDC 1KX4D 3W98B 3KXBD 5DNNC 1KX3D 2Y2LA 4NE3A 3LZ1D 3WTPD 1S32D 1P3OC 2NQBD 3REHC 1F66D 3RELA 3NQUB 1M1AC 3AZKD 5CPKD 2JE5A 3B0DB 3UT9C 1P3BA 2AROD 4J8WD 4KGCB 3KUYC 4H9QA 4J8UA 5FUGB 2Y2IA 4XUJD 5JRGB 5G49B 2HUEC 4WU8C 3AZED 5BO0B 3F6TA 2CV5D 5B24B 3UTBB 4WU9D 2F2AC 4H9PA 1ID3C 3X1VC 5KDMA 5GT0C 1HQ3D 4UUZB 4Z66B 2FJ7B 1M18D 3LZ0C 5AVCC 3B6FB 1R4VA 4LD9B 5CP6C 3W97D 2FFFB 5AY8C 5E5AC 3AV1D 1P3GB 2PYOA 2Y2NA 5B32A 5AV6B 5BNXB 3O62C 1P3PD 4XZQD 1JFIB 1U35D 3LJAD 3MVDD 2ZY3A 3AV2A 1TZYD 3MGRB 5GT3A 4QLCD 3UTAA 5AV5C 3AZGD 1P3AC 3X1UB 4Z5TA 3AZLD 2Y2GA 3VH6W 3AZMB 5B1MD 3AZHC 3KXBC 5BNVB 1KX3C 3LZ1C 3WTPC 3NQUA 4NE6A 1S32C 3H0MC 2NQBC 1TAFA 3MNNB 1P3FC 1F66C 4KUDA 3AZKC 5B2JD 5AV9D 4YM6D 1P3OA 2YFWB 5GXQD 3REHA 1M1AA 3REKB 2AROC 4J8WC 2RIQA 2XD5A 4AWLB 5B31G 5B40D 3UT9A 5BO0A 4XUJC 4G92C 3AZEC 3KUYA 2CV5C 1P34B 5AV8B 3WA9B 5B33D 3C1BD 4H9NA 2YFVA 4UUZA 4Z66A 5CPJB 2FJ7A 3MGSD 3RELB 3AZID 1HQ3C 5DNMD 3KSYA 1M18C 5C3IB 2Y2MA 1ID3A 5BS7C 3WKJD 3W97C 3AV1C 2HIOD 3EG5B 3W99D 4DRAA 4J8UB 2NZDD 5AVBD 5AY8A 3MGPD 1P3PC 1JFIA 4XZQC 3A6ND 3B0BA 2F8NA 3MGRA 1B67A 1U35C 1P3MB 3C1CB 3AYWD 3MVDC 1TZYC 4CAYA 4JJNB 4ZBJC 3VH5T 4QLCC 3AZGC 5KDMB 4J8XD 3EPHA 5CP6D 5CPID 2BG1A 1P3LD 1Q9CA 3AZLC 5AV5A 5B1MC 2PYOB 5GSUB 1AOID 5B32B 1M19B 2F8NH 1F1EA 3MGQD 3AZHA 1KX4A 3KXBA 1KX3A 3AN2D 5AV9C 4YM6C 3WTPA 3LZ1A 1S32A 3REKA 5GXQC 2NQBA 4E44A 3AV2B 1F66A 3AZKA 2CWEA 3UTAB 4HGAC 5CPKA 5B40C 4Z5TB 3TU4B 4R8PB 2AROA 5AV8A 5B0ZC 4J8WA 1N1JA 5B33C 3AZFB 3C1BC 5CPJA 1P3FD 3LELD 3AZEA 2CV5A 1TAFB 5B31D 3MGSC 3AZIC 4KUDB 5DNMC 4WU9A 5DNNB 4ZUXD 1P3OB 3REHB 1M1AB 3WKJC 3AFAD 1KX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L D;  1M18 A;  2HIO C;  3W99 C;  3UT9 B;  1P3I D;  2NZD C;  5BT1 D;  5AVB C;  3X1T D;  3B0C W;  3W97 A;  3MGP C;  3KUY B;  3A6N C;  3VH6 T;  3KWQ D;  1P3M A;  3C1C A;  2BYK A;  1H3O A;  4H9N B;  4JJN A;  3AYW C;  2HUE B;  4WU8 B;  2YFV B;  3AZJ D;  1P3P A;  2LY8 A;  3R45 B;  3WAA D;  3REJ D;  3AZN D;  4J8X C;  3LJA A;  1WWI A;  3MVD A;  5B0Y D;  5CPI C;  1P3L C;  1ID3 B;  4QLC A;  4J8V D;  5GSU A;  5GT0 B;  3X1V B;  3LZ0 B;  1BH8 A;  5AVC B;  1M19 A;  3AZL A;  1AOI C;  3V9R B;  3X1S D;  5AY8 B;  3MGQ C;  4WV4 B;  5JA4 A;  3AN2 C;  2F8N B;  1P3B D;  4CAY B;  3O62 B;  4H9S C;  3W96 D;  5B2J A;  5AV9 A;  4YM6 A;  3TU4 A;  5GXQ A;  4R8P A;  3B6G A;  3NQJ A;  5AV5 B;  3AZF A;  1P3A B;  5B40 A;  4YS3 D;  4X23 D;  3LEL C;  5DNN A;  5B31 C;  3AZH B;  1KX4 B;  3KXB B;  1KX3 B;  5CHL B;  4ZUX C;  3WTP B;  3LZ1 B;  1S32 B;  2NQB B;  4G91 C;  1BFM A;  1F66 B;  3MGS A;  3AZI A;  3AFA C;  3AZK B;  5DNM A;  1KX5 C;  5B1L C;  5CPK B;  5F99 D;  1P3I C;  5B0Z D;  3MNN C;  1EQZ D;  4H9R A;  5BT1 C;  3X1T C;  3WKJ A;  2ARO B;  2JSS A;  4J8W B;  1N1J B;  3REI D;  3KWQ C;  1ZLA D;  1P3K D;  4WU8 A;  2NZD A;  4XUJ B;  5AVB A;  5GT3 D;  4G92 B;  3R45 A;  5B2I D;  3MGP A;  3AZE B;  3AZJ C;  2CV5 B;  1HTA A;  3WAA C;  3A6N A;  3REJ C;  3AZN C;  4H9O A;  4WU9 B;  3AYW A;  3X1V A;  5B0Y C;  5GT0 A;  3W98 D;  1P34 C;  4J8V C;  3LZ0 A;  5AVC A;  4J8X A;  1M18 B;  2IO5 C;  3V9R A;  5CP6 A;  4CSR A;  1P3L A;  5E5A A;  3X1S C;  3W97 B;  3AV1 B;  4WZS B;  4Z2M H;  4KGC D;  2BYK B;  3O62 A;  1H3O B;  1P3B C;  1P3P B;  4XZQ B;  5JRG D;  3W96 C;  3AN2 A;  4E45 A;  1U35 B;  5B24 D;  3LJA B;  3UTB D;  3MVD B;  1TZY B;  1P3A A;  4ZBJ B;  4QLC B;  1BH8 B;  4YS3 C;  4X23 C;  4Z66 D;  3WTP E;  3AZL B;  2FJ7 D;  5B1M B;  3B6F D;  4LD9 D;  5JA4 B;  3B0C T;  1P3G D;  2RVQ D;  3LEL A;  1P3F A;  3VH5 A;  5B31 A;  4EO5 C;  5AV6 D;  5B2J B;  5AV9 B;  4YM6 B;  5F99 C;  5GXQ B;  3B6G B;  2BYM B;  1EQZ C;  3AFA A;  1KX5 A;  3NQJ B;  5B1L A;  3REI C;  4XUJ A;  3MGR D;  1ZLA C;  5B40 B;  1P3K C;  5B32 G;  3X1T A;  5GT3 C;  5B2I C;  3X1U D;  3AZM D;  5B33 B;  4Z5T C;  3C1B B;  3W98 C;  3AZJ A;  1HQ3 A;  3MGS B;  3AZI B;  3AZN A;  5DNM B;  3MNN D;  5BS7 A;  5B0Y A;  3AV1 A;  4H9R B;  4J8V A;  3WKJ B;  3B0D C;  2HIO B;  3VH5 W;  3REK D;  4M6B A;  3W99 B;  4KGC C;  2NZD B;  5AVB B;  3X1S A;  4XZQ A;  3MGP B;  3A6N B;  1U35 A;  5JRG C;  1TZY A;  4H9O B;  5B24 C;  1P34 D;  3AYW B;  5AV8 D;  3UTB C;  3WA9 D;  3AZG A;  3W96 A;  4WNN B;  5CPJ D;  4J8X B;  3REL D;  5CP6 B;  5CPI B;  4CSR B;  4Z66 C;  1P3L B;  2FJ7 C;  5B1M A;  5E5A B;  3VH6 A;  1A7W A;  3B6F C;  4YS3 A;  4LD9 C;  4X23 A;  4KHA B;  1P3G C;  2RVQ C;  1AOI B;  1KU5 A;  3MGQ B;  4J8U D;  4Z2M G;  5AV6 C;  3AN2 B;  2BYM A;  1B6W A;  4NE5 A;  1P3M D;  3C1C D;  5F99 A;  3MGR C;  4JJN D;  1EQZ A;  5B0Z A;  5B33 A;  3X1U C;  3REI A;  3C1B A;  1ZLA A;  1P3K A;  3AZM C;  2F8N G;  5B2I A;  2PYO D;  1P3F B;  3LEL B;  5GSU D;  5B31 B;  5B32 D;  1M19 D;  4ZUX B;  3W98 A;  4G91 B;  2HIO A;  3AFA B;  1KX4 C;  1WWS A;  1KX5 B;  3W99 A;  5B1L B;  3AV2 D;  3REK C;  1P3I B;  3UTA D;  4AWL C;  3X1T B;  5CPK C;  4Z5T D;  3TU4 D;  4R8P D;  3KWQ B;  3B6G D;  4KGC A;  2L5A A;  2F8N K;  1BH9 B;  5AV8 C;  3WA9 C;  5FUG A;  4WNN A;  3AZF D;  1HQ3 B;  3AZJ B;  3WAA B;  5JRG A;  5G49 A;  3REJ B;  3AZN B;  5CPI A;  5CPJ C;  5B24 A;  3UTB A;  3REL C;  5B0Y B;  4KUD D;  5DNN D;  5C3I C;  4J8V B;  1P3O D;  4WU9 C;  4KHA A;  1AOI A;  2IO5 B;  3REH D;  1M1A D;  3MGQ A;  3X1S B;  4J8U C;  3UT9 D;  3B6F A;  4LD9 A;  1P3G A;  3KUY D;  1P3B B;  4H9S A;  3AZG B;  4H9Q B;  1P3M C;  5AV6 A;  3C1C C;  3W96 B;  4WU8 D;  5BNX A;  4JJN C;  4DRB A;  3LJA C;  1ID3 D;  3X1V D;  4YS3 B;  5GT0 D;  4X23 B;  4H9P B;  2PYO C;  3LZ0 D;  5GSU C;  5AVC D;  3X1U A;  5B32 C;  4ZUX A;  3AZM A;  1ULY A;  1M19 C;  5AY8 D;  5E5A D;  5BNV A;  4HGA B;  4EO5 B;  2F8N D;  1P3I A;  3MNN A;  3AV2 C;  5F99 B;  3O62 D;  1EQZ B;  5B0Z B;  3UTA C;  2YFW A;  3KWQ A;  5B2J C;  3REI B;  3TU4 C;  4NFT A;  1BH9 A;  4R8P C;  1ZLA B;  3B6G C;  1P3K B;  5AV5 D;  1P3A D;  5GT3 B;  5B2I B;  3WAA A;  3REJ A;  3AZF C;  1P34 A;  3AZH D;  3WA9 A;  4KUD C;  1KX4 D;  3W98 B;  3KXB D;  5DNN C;  1KX3 D;  4NE3 A;  3LZ1 D;  3WTP D;  1S32 D;  1P3O C;  2NQB D;  3REH C;  1F66 D;  3REL A;  3NQU B;  1M1A C;  3AZK D;  5CPK D;  3B0D B;  3UT9 C;  1P3B A;  2ARO D;  4J8W D;  4KGC B;  3KUY C;  4H9Q A;  4J8U A;  5FUG B;  4XUJ D;  5JRG B;  5G49 B;  2HUE C;  4WU8 C;  3AZE D;  5BO0 B;  2CV5 D;  5B24 B;  3UTB B;  4WU9 D;  4H9P A;  1ID3 C;  3X1V C;  5KDM A;  5GT0 C;  1HQ3 D;  4UUZ B;  4Z66 B;  2FJ7 B;  1M18 D;  3LZ0 C;  5AVC C;  3B6F B;  1R4V A;  4LD9 B;  5CP6 C;  3W97 D;  5AY8 C;  3AV1 D;  5E5A C;  1P3G B;  2PYO A;  5B32 A;  5AV6 B;  5BNX B;  3O62 C;  1P3P D;  4XZQ D;  1JFI B;  1U35 D;  3LJA D;  3MVD D;  3AV2 A;  1TZY D;  3MGR B;  5GT3 A;  4QLC D;  3UTA A;  5AV5 C;  3AZG D;  1P3A C;  3X1U B;  4Z5T A;  3AZL D;  3VH6 W;  3AZM B;  5B1M D;  3AZH C;  3KXB C;  5BNV B;  1KX3 C;  3LZ1 C;  3WTP C;  3NQU A;  4NE6 A;  1S32 C;  2NQB C;  1TAF A;  3MNN B;  1P3F C;  1F66 C;  4KUD A;  3AZK C;  5B2J D;  5AV9 D;  4YM6 D;  1P3O A;  2YFW B;  5GXQ D;  3REH A;  1M1A A;  3REK B;  2ARO C;  4J8W C;  4AWL B;  5B31 G;  5B40 D;  3UT9 A;  5BO0 A;  4XUJ C;  4G92 C;  3AZE C;  3KUY A;  2CV5 C;  1P34 B;  5AV8 B;  3WA9 B;  5B33 D;  3C1B D;  4H9N A;  2YFV A;  4UUZ A;  4Z66 A;  5CPJ B;  2FJ7 A;  3MGS D;  3REL B;  3AZI D;  1HQ3 C;  5DNM D;  3KSY A;  1M18 C;  5C3I B;  1ID3 A;  5BS7 C;  3WKJ D;  3W97 C;  3AV1 C;  2HIO D;  3W99 D;  4DRA A;  4J8U B;  2NZD D;  5AVB D;  5AY8 A;  3MGP D;  1P3P C;  1JFI A;  4XZQ C;  3A6N D;  3B0B A;  2F8N A;  3MGR A;  1B67 A;  1U35 C;  1P3M B;  3C1C B;  3AYW D;  3MVD C;  1TZY C;  4CAY A;  4JJN B;  4ZBJ C;  3VH5 T;  4QLC C;  3AZG C;  5KDM B;  4J8X D;  5CP6 D;  5CPI D;  1P3L D;  1Q9C A;  3AZL C;  5AV5 A;  5B1M C;  2PYO B;  5GSU B;  1AOI D;  5B32 B;  1M19 B;  2F8N H;  1F1E A;  3MGQ D;  3AZH A;  1KX4 A;  3KXB A;  1KX3 A;  3AN2 D;  5AV9 C;  4YM6 C;  3WTP A;  3LZ1 A;  1S32 A;  3REK A;  5GXQ C;  2NQB A;  4E44 A;  3AV2 B;  1F66 A;  3AZK A;  2CWE A;  3UTA B;  4HGA C;  5CPK A;  5B40 C;  4Z5T B;  3TU4 B;  4R8P B;  2ARO A;  5AV8 A;  5B0Z C;  4J8W A;  1N1J A;  5B33 C;  3AZF B;  3C1B C;  5CPJ A;  1P3F D;  3LEL D;  3AZE A;  2CV5 A;  1TAF B;  5B31 D;  3MGS C;  3AZI C;  4KUD B;  5DNM C;  4WU9 A;  5DNN B;  4ZUX D;  1P3O B;  3REH B;  1M1A B;  3WKJ C;  3AFA D;  1KX5 D; 
#chains in the Genus database with same CATH topology
 5B1L D;  1M18 A;  2HIO C;  3W99 C;  3UT9 B;  1P3I D;  2NZD C;  5BT1 D;  5AVB C;  3X1T D;  3B0C W;  3W97 A;  3MGP C;  3KUY B;  4UPK A;  3A6N C;  3VH6 T;  3KWQ D;  1P3M A;  3C1C A;  2BYK A;  1H3O A;  4H9N B;  4JJN A;  3AYW C;  2HUE B;  4WU8 B;  2YFV B;  2G5H C;  3AZJ D;  1P3P A;  2LY8 A;  3R45 B;  3WAA D;  3REJ D;  3AZN D;  4J8X C;  3LJA A;  1WWI A;  3MVD A;  5B0Y D;  5CPI C;  2Y2P A;  1P3L C;  1ID3 B;  4QLC A;  4J8V D;  5GSU A;  5GT0 B;  3X1V B;  3LZ0 B;  1BH8 A;  5AVC B;  1M19 A;  3AZL A;  1AOI C;  3V9R B;  3X1S D;  5AY8 B;  3MGQ C;  4WV4 B;  5JA4 A;  3AN2 C;  2F8N B;  1P3B D;  2ZY2 A;  4CAY B;  3O62 B;  4H9S C;  3W96 D;  5B2J A;  5AV9 A;  4YM6 A;  3TU4 A;  5GXQ A;  4R8P A;  3B6G A;  3NQJ A;  5AV5 B;  3AZF A;  1P3A B;  2Y2K A;  1Z2C B;  5B40 A;  2Y2J A;  4YS3 D;  4X23 D;  3LEL C;  2Y2O A;  5DNN A;  5B31 C;  3AZH B;  1KX4 B;  3KXB B;  1KX3 B;  5CHL B;  4ZUX C;  3WTP B;  3LZ1 B;  1S32 B;  2NQB B;  4G91 C;  1BFM A;  1F66 B;  3MGS A;  3AZI A;  3AFA C;  3AZK B;  5DNM A;  1KX5 C;  5B1L C;  5CPK B;  5F99 D;  1P3I C;  5B0Z D;  3MNN C;  1EQZ D;  4H9R A;  5BT1 C;  3X1T C;  3WKJ A;  2ARO B;  2JSS A;  4J8W B;  1N1J B;  4DQY B;  3REI D;  3KWQ C;  1ZLA D;  1P3K D;  4WU8 A;  2NZD A;  4XUJ B;  5AVB A;  5GT3 D;  4G92 B;  3R45 A;  5B2I D;  3EPL A;  3MGP A;  3AZE B;  3AZJ C;  2CV5 B;  1HTA A;  3WAA C;  3A6N A;  3REJ C;  3AZN C;  4H9O A;  4WU9 B;  3AYW A;  3X1V A;  5B0Y C;  5GT0 A;  3W98 D;  1P34 C;  1T3U A;  2ZY5 A;  4J8V C;  3P5J B;  3LZ0 A;  3A1I A;  5AVC A;  4J8X A;  1M18 B;  3FDD A;  2IO5 C;  3V9R A;  5CP6 A;  4CSR A;  1P3L A;  5E5A A;  3X1S C;  3W97 B;  3AV1 B;  4WZS B;  4Z2M H;  3AL0 C;  4KGC D;  2BYK B;  3O62 A;  1H3O B;  1P3B C;  3A1K A;  1P3P B;  4XZQ B;  5JRG D;  3W96 C;  3AN2 A;  4E45 A;  1U35 B;  5B24 D;  3LJA B;  3UTB D;  3MVD B;  1TZY B;  1P3A A;  4ZBJ B;  4QLC B;  1BH8 B;  4YS3 C;  4X23 C;  4Z66 D;  3WTP E;  3AZL B;  2FJ7 D;  5B1M B;  3B6F D;  4LD9 D;  5JA4 B;  3B0C T;  1P3G D;  2RVQ D;  3LEL A;  1P3F A;  3VH5 A;  5B31 A;  4EO5 C;  5AV6 D;  5B2J B;  5AV9 B;  4YM6 B;  5F99 C;  5GXQ B;  3B6G B;  2BYM B;  1EQZ C;  3AFA A;  1KX5 A;  3NQJ B;  5B1L A;  3REI C;  4XUJ A;  3MGR D;  1ZLA C;  5B40 B;  1P3K C;  5B32 G;  3X1T A;  5GT3 C;  1PZR A;  5B2I C;  3X1U D;  2Y2Q A;  3AZM D;  5B33 B;  4Z5T C;  3C1B B;  3W98 C;  3AZJ A;  1HQ3 A;  3MGS B;  3AZI B;  3AZN A;  5DNM B;  3MNN D;  5BS7 A;  5B0Y A;  3AV1 A;  4H9R B;  4J8V A;  3WKJ B;  3B0D C;  2HIO B;  3VH5 W;  3REK D;  4M6B A;  3W99 B;  4KGC C;  2NZD B;  5AVB B;  3X1S A;  4XZQ A;  4WJ3 C;  3MGP B;  3A6N B;  1U35 A;  5JRG C;  1TZY A;  4H9O B;  5B24 C;  1P34 D;  3AYW B;  5AV8 D;  3UTB C;  3WA9 D;  3AZG A;  3W96 A;  4WNN B;  5CPJ D;  4J8X B;  3REL D;  5CP6 B;  5CPI B;  4CSR B;  4Z66 C;  2ZY4 A;  1P3L B;  5B1M A;  2FJ7 C;  5E5A B;  3VH6 A;  1A7W A;  3EPK A;  3B6F C;  4YS3 A;  4LD9 C;  4X23 A;  4KHA B;  1P3G C;  2RVQ C;  1AOI B;  1KU5 A;  3MGQ B;  2ZM5 A;  4J8U D;  2UWX A;  4Z2M G;  5AV6 C;  3AN2 B;  2BYM A;  1B6W A;  4NE5 A;  1P3M D;  3C1C D;  5F99 A;  3MGR C;  3IP4 C;  4JJN D;  1EQZ A;  5B0Z A;  2Y2H A;  5B33 A;  3X1U C;  3REI A;  3C1B A;  1ZLA A;  1P3K A;  3AZM C;  2F8N G;  5B2I A;  2PYO D;  1P3F B;  3LEL B;  3KFU G;  5GSU D;  3H0L C;  5B31 B;  5B32 D;  1M19 D;  2J8P A;  4ZUX B;  3W98 A;  4G91 B;  2HIO A;  3AFA B;  1KX4 C;  1WWS A;  1KX5 B;  3W99 A;  5B1L B;  3AV2 D;  2XD1 A;  3REK C;  1P3I B;  3UTA D;  4AWL C;  3X1T B;  5CPK C;  4Z5T D;  3TU4 D;  4R8P D;  3KWQ B;  3B6G D;  4KGC A;  2L5A A;  2F8N K;  1BH9 B;  5AV8 C;  3WA9 C;  5FUG A;  4WNN A;  3AZF D;  1HQ3 B;  3AZJ B;  3WAA B;  5JRG A;  5G49 A;  2VQR A;  3REJ B;  3AZN B;  5CPI A;  5CPJ C;  5B24 A;  3UTB A;  3REL C;  5B0Y B;  4KUD D;  5DNN D;  5C3I C;  4J8V B;  1P3O D;  4WU9 C;  4KHA A;  1AOI A;  2IO5 B;  3REH D;  1M1A D;  3MGQ A;  3X1S B;  4J8U C;  3UT9 D;  3B6F A;  4LD9 A;  1P3G A;  3KUY D;  1P3B B;  4H9S A;  3AZG B;  4H9Q B;  1P3M C;  5AV6 A;  3C1C C;  3W96 B;  4WU8 D;  5BNX A;  4JJN C;  4DRB A;  3LJA C;  1ID3 D;  3X1V D;  4YS3 B;  5GT0 D;  4X23 B;  4H9P B;  2PYO C;  3LZ0 D;  5GSU C;  5AVC D;  3X1U A;  5B32 C;  4ZUX A;  3AZM A;  1ULY A;  1M19 C;  5AY8 D;  5E5A D;  2JCH A;  5BNV A;  4HGA B;  4EO5 B;  2F8N D;  1P3I A;  3MNN A;  3AV2 C;  5F99 B;  3O62 D;  1EQZ B;  5B0Z B;  3UTA C;  2YFW A;  3KWQ A;  1W2E A;  2DQN C;  5B2J C;  3REI B;  3TU4 C;  2G5I C;  1BH9 A;  4NFT A;  4R8P C;  2W8S A;  3EPJ A;  1P3K B;  1ZLA B;  3B6G C;  5AV5 D;  2DF4 C;  1P3A D;  5GT3 B;  5B2I B;  3H0R C;  3WAA A;  3REJ A;  3AZF C;  1P34 A;  3AZH D;  3WA9 A;  4KUD C;  1KX4 D;  3W98 B;  3KXB D;  5DNN C;  1KX3 D;  2Y2L A;  4NE3 A;  3LZ1 D;  3WTP D;  1S32 D;  1P3O C;  2NQB D;  3REH C;  1F66 D;  3REL A;  3NQU B;  1M1A C;  3AZK D;  5CPK D;  2JE5 A;  3B0D B;  3UT9 C;  1P3B A;  2ARO D;  4J8W D;  4KGC B;  3KUY C;  4H9Q A;  4J8U A;  5FUG B;  2Y2I A;  4XUJ D;  5JRG B;  5G49 B;  2HUE C;  4WU8 C;  3AZE D;  5BO0 B;  3F6T A;  2CV5 D;  5B24 B;  3UTB B;  4WU9 D;  2F2A C;  4H9P A;  1ID3 C;  3X1V C;  5KDM A;  5GT0 C;  1HQ3 D;  4UUZ B;  4Z66 B;  2FJ7 B;  1M18 D;  3LZ0 C;  5AVC C;  3B6F B;  1R4V A;  4LD9 B;  5CP6 C;  3W97 D;  2FFF B;  5AY8 C;  5E5A C;  3AV1 D;  1P3G B;  2PYO A;  2Y2N A;  5B32 A;  5AV6 B;  5BNX B;  3O62 C;  1P3P D;  4XZQ D;  1JFI B;  1U35 D;  3LJA D;  3MVD D;  2ZY3 A;  3AV2 A;  1TZY D;  3MGR B;  5GT3 A;  4QLC D;  3UTA A;  5AV5 C;  3AZG D;  1P3A C;  3X1U B;  4Z5T A;  3AZL D;  2Y2G A;  3VH6 W;  3AZM B;  5B1M D;  3AZH C;  3KXB C;  5BNV B;  1KX3 C;  3LZ1 C;  3WTP C;  3NQU A;  4NE6 A;  1S32 C;  3H0M C;  2NQB C;  1TAF A;  3MNN B;  1P3F C;  1F66 C;  4KUD A;  3AZK C;  5B2J D;  5AV9 D;  4YM6 D;  1P3O A;  2YFW B;  5GXQ D;  3REH A;  1M1A A;  3REK B;  2ARO C;  4J8W C;  2RIQ A;  2XD5 A;  4AWL B;  5B31 G;  5B40 D;  3UT9 A;  5BO0 A;  4XUJ C;  4G92 C;  3AZE C;  3KUY A;  2CV5 C;  1P34 B;  5AV8 B;  3WA9 B;  5B33 D;  3C1B D;  4H9N A;  2YFV A;  4UUZ A;  4Z66 A;  5CPJ B;  2FJ7 A;  3MGS D;  3REL B;  3AZI D;  1HQ3 C;  5DNM D;  3KSY A;  1M18 C;  5C3I B;  2Y2M A;  1ID3 A;  5BS7 C;  3WKJ D;  3W97 C;  3AV1 C;  2HIO D;  3EG5 B;  3W99 D;  4DRA A;  4J8U B;  2NZD D;  5AVB D;  5AY8 A;  3MGP D;  1P3P C;  1JFI A;  4XZQ C;  3A6N D;  3B0B A;  2F8N A;  3MGR A;  1B67 A;  1U35 C;  1P3M B;  3C1C B;  3AYW D;  3MVD C;  1TZY C;  4CAY A;  4JJN B;  4ZBJ C;  3VH5 T;  4QLC C;  3AZG C;  5KDM B;  4J8X D;  3EPH A;  5CP6 D;  5CPI D;  2BG1 A;  1P3L D;  1Q9C A;  3AZL C;  5AV5 A;  5B1M C;  2PYO B;  5GSU B;  1AOI D;  5B32 B;  1M19 B;  2F8N H;  1F1E A;  3MGQ D;  3AZH A;  1KX4 A;  3KXB A;  1KX3 A;  3AN2 D;  5AV9 C;  4YM6 C;  3WTP A;  3LZ1 A;  1S32 A;  3REK A;  5GXQ C;  2NQB A;  4E44 A;  3AV2 B;  1F66 A;  3AZK A;  2CWE A;  3UTA B;  4HGA C;  5CPK A;  5B40 C;  4Z5T B;  3TU4 B;  4R8P B;  2ARO A;  5AV8 A;  5B0Z C;  4J8W A;  1N1J A;  5B33 C;  3AZF B;  3C1B C;  5CPJ A;  1P3F D;  3LEL D;  3AZE A;  2CV5 A;  1TAF B;  5B31 D;  3MGS C;  3AZI C;  4KUD B;  5DNM C;  4WU9 A;  5DNN B;  4ZUX D;  1P3O B;  3REH B;  1M1A B;  3WKJ C;  3AFA D;  1KX5 D; 
#chains in the Genus database with same CATH homology
 5B1L D;  1M18 A;  2HIO C;  3W99 C;  3UT9 B;  1P3I D;  2NZD C;  5BT1 D;  5AVB C;  3X1T D;  3B0C W;  3W97 A;  3MGP C;  3KUY B;  4UPK A;  3A6N C;  3VH6 T;  3KWQ D;  1P3M A;  3C1C A;  2BYK A;  1H3O A;  4H9N B;  4JJN A;  3AYW C;  2HUE B;  4WU8 B;  2YFV B;  2G5H C;  3AZJ D;  1P3P A;  2LY8 A;  3R45 B;  3WAA D;  3REJ D;  3AZN D;  4J8X C;  3LJA A;  1WWI A;  3MVD A;  5B0Y D;  5CPI C;  2Y2P A;  1P3L C;  1ID3 B;  4QLC A;  4J8V D;  5GSU A;  5GT0 B;  3X1V B;  3LZ0 B;  1BH8 A;  5AVC B;  1M19 A;  3AZL A;  1AOI C;  3V9R B;  3X1S D;  5AY8 B;  3MGQ C;  4WV4 B;  5JA4 A;  3AN2 C;  2F8N B;  1P3B D;  2ZY2 A;  4CAY B;  3O62 B;  4H9S C;  3W96 D;  5B2J A;  5AV9 A;  4YM6 A;  3TU4 A;  5GXQ A;  4R8P A;  3B6G A;  3NQJ A;  5AV5 B;  3AZF A;  1P3A B;  2Y2K A;  1Z2C B;  5B40 A;  2Y2J A;  4YS3 D;  4X23 D;  3LEL C;  2Y2O A;  5DNN A;  5B31 C;  3AZH B;  1KX4 B;  3KXB B;  1KX3 B;  5CHL B;  4ZUX C;  3WTP B;  3LZ1 B;  1S32 B;  2NQB B;  4G91 C;  1BFM A;  1F66 B;  3MGS A;  3AZI A;  3AFA C;  3AZK B;  5DNM A;  1KX5 C;  5B1L C;  5CPK B;  5F99 D;  1P3I C;  5B0Z D;  3MNN C;  1EQZ D;  4H9R A;  5BT1 C;  3X1T C;  3WKJ A;  2ARO B;  2JSS A;  4J8W B;  1N1J B;  4DQY B;  3REI D;  3KWQ C;  1ZLA D;  1P3K D;  4WU8 A;  2NZD A;  4XUJ B;  5AVB A;  5GT3 D;  4G92 B;  3R45 A;  5B2I D;  3EPL A;  3MGP A;  3AZE B;  3AZJ C;  2CV5 B;  1HTA A;  3WAA C;  3A6N A;  3REJ C;  3AZN C;  4H9O A;  4WU9 B;  3AYW A;  3X1V A;  5B0Y C;  5GT0 A;  3W98 D;  1P34 C;  1T3U A;  2ZY5 A;  4J8V C;  3P5J B;  3LZ0 A;  3A1I A;  5AVC A;  4J8X A;  1M18 B;  3FDD A;  2IO5 C;  3V9R A;  5CP6 A;  4CSR A;  1P3L A;  5E5A A;  3X1S C;  3W97 B;  3AV1 B;  4WZS B;  4Z2M H;  3AL0 C;  4KGC D;  2BYK B;  3O62 A;  1H3O B;  1P3B C;  3A1K A;  1P3P B;  4XZQ B;  5JRG D;  3W96 C;  3AN2 A;  4E45 A;  1U35 B;  5B24 D;  3LJA B;  3UTB D;  3MVD B;  1TZY B;  1P3A A;  4ZBJ B;  4QLC B;  1BH8 B;  4YS3 C;  4X23 C;  4Z66 D;  3WTP E;  3AZL B;  2FJ7 D;  5B1M B;  3B6F D;  4LD9 D;  5JA4 B;  3B0C T;  1P3G D;  2RVQ D;  3LEL A;  1P3F A;  3VH5 A;  5B31 A;  4EO5 C;  5AV6 D;  5B2J B;  5AV9 B;  4YM6 B;  5F99 C;  5GXQ B;  3B6G B;  2BYM B;  1EQZ C;  3AFA A;  1KX5 A;  3NQJ B;  5B1L A;  3REI C;  4XUJ A;  3MGR D;  1ZLA C;  5B40 B;  1P3K C;  5B32 G;  3X1T A;  5GT3 C;  1PZR A;  5B2I C;  3X1U D;  2Y2Q A;  3AZM D;  5B33 B;  4Z5T C;  3C1B B;  3W98 C;  3AZJ A;  1HQ3 A;  3MGS B;  3AZI B;  3AZN A;  5DNM B;  3MNN D;  5BS7 A;  5B0Y A;  3AV1 A;  4H9R B;  4J8V A;  3WKJ B;  3B0D C;  2HIO B;  3VH5 W;  3REK D;  4M6B A;  3W99 B;  4KGC C;  2NZD B;  5AVB B;  3X1S A;  4XZQ A;  4WJ3 C;  3MGP B;  3A6N B;  1U35 A;  5JRG C;  1TZY A;  4H9O B;  5B24 C;  1P34 D;  3AYW B;  5AV8 D;  3UTB C;  3WA9 D;  3AZG A;  3W96 A;  4WNN B;  5CPJ D;  4J8X B;  3REL D;  5CP6 B;  5CPI B;  4CSR B;  4Z66 C;  2ZY4 A;  1P3L B;  5B1M A;  2FJ7 C;  5E5A B;  3VH6 A;  1A7W A;  3EPK A;  3B6F C;  4YS3 A;  4LD9 C;  4X23 A;  4KHA B;  1P3G C;  2RVQ C;  1AOI B;  1KU5 A;  3MGQ B;  2ZM5 A;  4J8U D;  2UWX A;  4Z2M G;  5AV6 C;  3AN2 B;  2BYM A;  1B6W A;  4NE5 A;  1P3M D;  3C1C D;  5F99 A;  3MGR C;  3IP4 C;  4JJN D;  1EQZ A;  5B0Z A;  2Y2H A;  5B33 A;  3X1U C;  3REI A;  3C1B A;  1ZLA A;  1P3K A;  3AZM C;  2F8N G;  5B2I A;  2PYO D;  1P3F B;  3LEL B;  3KFU G;  5GSU D;  3H0L C;  5B31 B;  5B32 D;  1M19 D;  2J8P A;  4ZUX B;  3W98 A;  4G91 B;  2HIO A;  3AFA B;  1KX4 C;  1WWS A;  1KX5 B;  3W99 A;  5B1L B;  3AV2 D;  2XD1 A;  3REK C;  1P3I B;  3UTA D;  4AWL C;  3X1T B;  5CPK C;  4Z5T D;  3TU4 D;  4R8P D;  3KWQ B;  3B6G D;  4KGC A;  2L5A A;  2F8N K;  1BH9 B;  5AV8 C;  3WA9 C;  5FUG A;  4WNN A;  3AZF D;  1HQ3 B;  3AZJ B;  3WAA B;  5JRG A;  5G49 A;  2VQR A;  3REJ B;  3AZN B;  5CPI A;  5CPJ C;  5B24 A;  3UTB A;  3REL C;  5B0Y B;  4KUD D;  5DNN D;  5C3I C;  4J8V B;  1P3O D;  4WU9 C;  4KHA A;  1AOI A;  2IO5 B;  3REH D;  1M1A D;  3MGQ A;  3X1S B;  4J8U C;  3UT9 D;  3B6F A;  4LD9 A;  1P3G A;  3KUY D;  1P3B B;  4H9S A;  3AZG B;  4H9Q B;  1P3M C;  5AV6 A;  3C1C C;  3W96 B;  4WU8 D;  5BNX A;  4JJN C;  4DRB A;  3LJA C;  1ID3 D;  3X1V D;  4YS3 B;  5GT0 D;  4X23 B;  4H9P B;  2PYO C;  3LZ0 D;  5GSU C;  5AVC D;  3X1U A;  5B32 C;  4ZUX A;  3AZM A;  1ULY A;  1M19 C;  5AY8 D;  5E5A D;  2JCH A;  5BNV A;  4HGA B;  4EO5 B;  2F8N D;  1P3I A;  3MNN A;  3AV2 C;  5F99 B;  3O62 D;  1EQZ B;  5B0Z B;  3UTA C;  2YFW A;  3KWQ A;  1W2E A;  2DQN C;  5B2J C;  3REI B;  3TU4 C;  2G5I C;  1BH9 A;  4NFT A;  4R8P C;  2W8S A;  3EPJ A;  1P3K B;  1ZLA B;  3B6G C;  5AV5 D;  2DF4 C;  1P3A D;  5GT3 B;  5B2I B;  3H0R C;  3WAA A;  3REJ A;  3AZF C;  1P34 A;  3AZH D;  3WA9 A;  4KUD C;  1KX4 D;  3W98 B;  3KXB D;  5DNN C;  1KX3 D;  2Y2L A;  4NE3 A;  3LZ1 D;  3WTP D;  1S32 D;  1P3O C;  2NQB D;  3REH C;  1F66 D;  3REL A;  3NQU B;  1M1A C;  3AZK D;  5CPK D;  2JE5 A;  3B0D B;  3UT9 C;  1P3B A;  2ARO D;  4J8W D;  4KGC B;  3KUY C;  4H9Q A;  4J8U A;  5FUG B;  2Y2I A;  4XUJ D;  5JRG B;  5G49 B;  2HUE C;  4WU8 C;  3AZE D;  5BO0 B;  3F6T A;  2CV5 D;  5B24 B;  3UTB B;  4WU9 D;  2F2A C;  4H9P A;  1ID3 C;  3X1V C;  5KDM A;  5GT0 C;  1HQ3 D;  4UUZ B;  4Z66 B;  2FJ7 B;  1M18 D;  3LZ0 C;  5AVC C;  3B6F B;  1R4V A;  4LD9 B;  5CP6 C;  3W97 D;  2FFF B;  5AY8 C;  5E5A C;  3AV1 D;  1P3G B;  2PYO A;  2Y2N A;  5B32 A;  5AV6 B;  5BNX B;  3O62 C;  1P3P D;  4XZQ D;  1JFI B;  1U35 D;  3LJA D;  3MVD D;  2ZY3 A;  3AV2 A;  1TZY D;  3MGR B;  5GT3 A;  4QLC D;  3UTA A;  5AV5 C;  3AZG D;  1P3A C;  3X1U B;  4Z5T A;  3AZL D;  2Y2G A;  3VH6 W;  3AZM B;  5B1M D;  3AZH C;  3KXB C;  5BNV B;  1KX3 C;  3LZ1 C;  3WTP C;  3NQU A;  4NE6 A;  1S32 C;  3H0M C;  2NQB C;  1TAF A;  3MNN B;  1P3F C;  1F66 C;  4KUD A;  3AZK C;  5B2J D;  5AV9 D;  4YM6 D;  1P3O A;  2YFW B;  5GXQ D;  3REH A;  1M1A A;  3REK B;  2ARO C;  4J8W C;  2RIQ A;  2XD5 A;  4AWL B;  5B31 G;  5B40 D;  3UT9 A;  5BO0 A;  4XUJ C;  4G92 C;  3AZE C;  3KUY A;  2CV5 C;  1P34 B;  5AV8 B;  3WA9 B;  5B33 D;  3C1B D;  4H9N A;  2YFV A;  4UUZ A;  4Z66 A;  5CPJ B;  2FJ7 A;  3MGS D;  3REL B;  3AZI D;  1HQ3 C;  5DNM D;  3KSY A;  1M18 C;  5C3I B;  2Y2M A;  1ID3 A;  5BS7 C;  3WKJ D;  3W97 C;  3AV1 C;  2HIO D;  3EG5 B;  3W99 D;  4DRA A;  4J8U B;  2NZD D;  5AVB D;  5AY8 A;  3MGP D;  1P3P C;  1JFI A;  4XZQ C;  3A6N D;  3B0B A;  2F8N A;  3MGR A;  1B67 A;  1U35 C;  1P3M B;  3C1C B;  3AYW D;  3MVD C;  1TZY C;  4CAY A;  4JJN B;  4ZBJ C;  3VH5 T;  4QLC C;  3AZG C;  5KDM B;  4J8X D;  3EPH A;  5CP6 D;  5CPI D;  2BG1 A;  1P3L D;  1Q9C A;  3AZL C;  5AV5 A;  5B1M C;  2PYO B;  5GSU B;  1AOI D;  5B32 B;  1M19 B;  2F8N H;  1F1E A;  3MGQ D;  3AZH A;  1KX4 A;  3KXB A;  1KX3 A;  3AN2 D;  5AV9 C;  4YM6 C;  3WTP A;  3LZ1 A;  1S32 A;  3REK A;  5GXQ C;  2NQB A;  4E44 A;  3AV2 B;  1F66 A;  3AZK A;  2CWE A;  3UTA B;  4HGA C;  5CPK A;  5B40 C;  4Z5T B;  3TU4 B;  4R8P B;  2ARO A;  5AV8 A;  5B0Z C;  4J8W A;  1N1J A;  5B33 C;  3AZF B;  3C1B C;  5CPJ A;  1P3F D;  3LEL D;  3AZE A;  2CV5 A;  1TAF B;  5B31 D;  3MGS C;  3AZI C;  4KUD B;  5DNM C;  4WU9 A;  5DNN B;  4ZUX D;  1P3O B;  3REH B;  1M1A B;  3WKJ C;  3AFA D;  1KX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...