1M19C

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19C00
1WWSA 5CPID 4XZQA 4E45A 1P3PB 5B1MD 3LELC 5B24B 4KUDD 3AV1A 3WA9C 4XUJB 5AVCA 1B6WA 4WNNB 4ZUXC 1P3GA 5B0YC 3MGPB 5AV6B 1ID3C 5AV9C 3WKJB 3A6NB 1P3BD 2YFVA 1P3OD 2NZDC 2LY8A 3KWQD 3W97C 2HIOB 5GT0A 5B0ZD 5AV8D 3TU4A 4G92C 1KX3A 1M18B 3RELA 5G49A 5AV5C 3UTBC 3AFAB 4JJNB 3B6FC 3AZNB 2CV5A 5JRGD 5B32B 4WV4B 4XZQC 1P3KB 5AVBA 3LZ1B 3X1SA 3AZGD 5B2ID 3AV1C 5AVCC 1TZYB 2AROB 1P3GC 2BYMB 1P3FA 4YM6B 1F66B 3MGRB 3AN2D 4EO5C 3X1VD 1AOIB 1BFMA 4J8UA 5E5AA 1P34B 3X1TA 3REIA 4WU9D 5GT0C 3AZKA 3TU4C 1KX3C 3RELC 5KDMB 3AZFD 3LELD 4H9NB 4ZUXB 2CV5C 5CP6A 3WA9D 1S32B 5AVBC 1ID3B 3X1SC 5AV9B 2F8NB 5B0YD 4Z2MH 3KUYD 4XUJA 4LD9D 1M19A 1P3FC 3MGPA 3W97B 2NZDD 4G92B 4J8UC 3A6NA 3WKJA 3MNNA 5E5AC 5AV5B 3UTBB 1P3AA 3O62A 5B33A 3X1TC 3REIC 4XZQB 1P3LB 3B6FD 5GT3D 3AZKC 5BNVA 3VH5A 3AV1B 4J8WA 1M18A 1P3GB 3AFAA 5CP6C 4JJNA 3KXBB 3AZMD 5AVCD 3B6GD 4WZSB 5B32A 3C1BA 3AZED 4EO5B 4XUJC 3W96A 1M19C 2AROA 4Z66A 2BYMA 3AZHA 5AY8D 5GT0B 1N1JA 5GSUA 3WKJC 3A6NC 1KX3B 1M1AD 3RELB 3MNNC 5G49B 3AZJD 4KGCA 3TU4D 1P3AC 3O62C 1EQZB 5B33C 3MGQB 2CV5B 1R4VA 5F99D 5AVBB 3X1SB 5B31G 1P3MB 4J8WC 1M18C 3REHD 3AFAC 4JJNC 1KU5A 3WAAD 5CPKD 5B32C 1S32A 5DNMD 3C1BC 3V9RA 1P3FD 1U35D 3B0BA 4J8UB 1HQ3A 4ZBJC 5E5AB 3W96C 2NQBD 2AROC 4QLCD 4Z66C 3X1TB 3REIB 3AZHC 3AV2D 1KX4A 3AZKB 5GSUC 3C1CA 3MVDA 4KGCC 3X1UA 4Z5TD 3LZ0A 3MGSA 5BT1C 5CP6D 1P3LA 3WTPE 3W98D 1ZLAB 3B0DB 1P3PD 3AZIB 5B24D 1M19B 3VH6A 4XUJD 3KXBA 1S32C 3WTPB 3AZLB 3REKA 3MGPD 1HQ3C 5B40A 5AV6D 5B1LA 3MNNB 1P3AB 3WKJD 3O62B 3A6ND 4J8XA 4WU8A 5B33B 3AYWB 1KX4C 5BNVB 3C1CC 3VH5T 4YS3A 3MVDC 3X1UC 4J8WB 2HIOD 3W99A 3LZ0C 3MGSC 3VH5W 1EQZA 3REJB 3MGQA 1M18D 1TAFA 3AFAD 3C1BB 4JJND 1P3LC 3AZND 5B32D 1P3KD 4ZBJB 5BNXA 1P3MA 4NE6A 3LZ1D 3UT9B 3W96B 3LJAA 1BH9B 4Z66B 2RVQC 3KXBC 3AZHB 1TZYD 3R45B 2PYOB 2AROD 1N1JB 5GSUB 2L5AA 3REKC 5B40C 2F8NG 5B1LC 4KGCB 4YM6D 1F66D 3MGRD 4J8XC 4WU8C 1AOID 4KGCD 1P34D 4YS3C 4H9PA 1KX5A 3W99C 4R8PA 4H9OA 1EQZC 3MGQC 3V9RB 4ZUXD 1S32D 1HQ3B 1ZLAA 1P3MC 1ID3D 4J8VA 3LJAC 5AV9D 2F8ND 1HQ3D 5DNNA 3AZIA 1KX4B 3WTPA 4KHAA 3C1CB 3AZLA 3MVDB 3X1UB 3NQUA 3W97D 3LZ0B 3MGSB 2BYKA 4H9SA 3MGSD 5AV5D 4CAYA 3UTBD 5CPIA 3AYWA 5B1MA 1KX5C 4XZQD 1P3LD 1Q9CA 4KUDA 3B0CT 4DRBA 4R8PC 4X23B 3VH6T 3AV1D 3REJA 2FJ7B 4H9QB 1P3GD 1JFIA 3KXBD 4NE3A 3REKB 4UUZB 5B40B 1ZLAC 5B1LB 4J8VC 3B0DC 1P3BA 3UT9A 1HTAA 5DNNC 4WU8B 4J8XB 3AZIC 1BH9A 3WTPC 3R45A 2PYOA 4YS3B 3AZLC 5AV8A 3W99B 5GT0D 1KX3D 4H9SC 3RELD 1P3IB 1TAFB 5CPIC 5JRGA 3AYWC 5CPJA 1EQZD 3MGQD 2CV5D 5B1MC 5BNXB 5AVBD 5B2IA 3X1SD 4KUDC 3LJAB 1P3MD 5BS7A 5C3IB 3REJC 2CWEA 2IO5C 3AN2A 3X1VA 1P3BC 3UT9C 1B67A 4J8UD 5E5AD 4WU9A 2PYOC 3X1TD 4H9PB 1KX5B 3REID 5AV8C 3AZKD 3AZFA 4R8PB 4H9OB 5B2JB 5JRGC 5CPJC 5JA4A 5B2IC 4J8VB 3KUYA 5DNNB 1ZLAD 3UTAB 5BS7C 4X23A 4LD9A 3AZID 4KHAB 1M19D 5B32G 2FJ7A 4H9QA 3X1VC 3AN2C 3NQUB 3WTPD 4UUZA 5B31B 2F8NK 5GXQB 3AZLD 2F8NH 2BYKB 3MNND 4CAYB 4M6BA 5CPIB 1P3AD 3O62D 4WU9C 5B33D 5GT3A 5B1MB 4HGAC 3AYWD 4KUDB 3AZFC 4J8WD 3AZMA 3B6GA 1P3IA 1JFIB 3REJD 2IO5B 3AZEA 3C1BD 1P3BB 3KUYC 1P3OB 4X23C 4LD9C 3UT9D 3W96D 2FJ7C 3KWQB 5AY8A 4Z66D 5B0ZB 5AV8B 5FUGA 3AZHD 2PYOD 1M1AA 5GSUD 2HUEC 3AZJA 1H3OA 5JRGB 5CHLB 5CPJB 5F99A 5GT3C 5BT1D 3AZGB 5CPJD 5B2IB 4CSRA 4H9RB 3REHA 5B2JA 3AZMC 3B6GC 1P3IC 1BH8A 3WAAA 5CPKA 5DNMA 4G91B 3AZEC 3AN2B 3X1VB 1U35A 2YFWA 1F1EA 2NQBA 4NFTA 3UTAA 5C3IC 4QLCA 4WU9B 3AV2A 3NQJA 5AY8C 4HGAB 1KX4D 1M1AC 5B31A 3AZJC 5GXQA 3AZFB 3C1CD 4Z5TA 3LELB 3MVDD 3X1UD 3WA9B 3LZ0D 5F99C 5JA4B 5BO0B 3W98A 5B0YB 4AWLC 3KUYB 1P3PA 3REHC 5B2JC 5B24A 4LD9B 4DRAA 3WAAC 3B0CW 5CPKC 4X23D 5DNMC 3VH6W 2NZDB 2RVQD 4WNNA 1U35C 2FJ7D 5AV6A 1P3OA 2HUEB 3REKD 2NQBC 5B40D 3UTAC 5B1LD 4QLCC 4J8XD 3AV2C 4WU8D 3B6FB 5GT3B 3KWQA 5B0ZA 4E44A 5B31C 5GXQC 4Z5TC 4YS3D 2HIOA 3AZMB 3W99D 3B6GB 5AVCB 3KSYA 3AZEB 3W98C 1P3ID 3AZNA 3AZGA 1P3KA 4Z2MG 3LZ1A 1P3PC 5B24C 2YFVB 4H9RA 3LJAD 1TZYA 5AY8B 5FUGB 3MGPC 1M1AB 5AV6C 3AZJB 1P3OC 4YM6A 3TU4B 1F66A 1H3OB 3MGRA 1AOIA 5F99B 3KWQC 1P34A 5B0ZC 4AWLB 4CSRB 2HIOC 3REHB 1KX5D 3LELA 3WAAB 1BH8B 3WA9A 5KDMA 5CPKB 4R8PD 5B2JD 5DNMB 4H9NA 1WWIA 5BO0A 4ZUXA 3AZNC 1U35B 3AZGC 1P3FB 5B0YA 2YFWB 1P3KC 3LZ1C 1ID3A 4NE5A 2NQBB 5AV9A 2F8NA 4J8VD 4QLCB 5DNND 3AV2B 3UTAD 1TZYC 3NQJB 4G91C 2NZDA 1ULYA 3W97A 4Z5TB 4YM6C 1F66C 3MGRC 1AOIC 5B31D 1A7WA 5GXQD 5AV5A 2JSSA 3UTBA 5CP6B 1P34C 3B6FA 3W98B
chains in the Genus database with same CATH superfamily
1WWSA 5CPID 4XZQA 4E45A 1P3PB 5B1MD 3LELC 5B24B 4KUDD 3AV1A 3WA9C 4XUJB 2XD1A 5AVCA 1B6WA 4WNNB 4ZUXC 1P3GA 2J8PA 5B0YC 3MGPB 5AV6B 1ID3C 5AV9C 3WKJB 3A6NB 2FFFB 2YFVA 1P3BD 1P3OD 2NZDC 2LY8A 3KWQD 3W97C 2HIOB 5GT0A 5B0ZD 5AV8D 3TU4A 4G92C 1KX3A 2ZY3A 1M18B 3RELA 5G49A 5AV5C 3UTBC 3AFAB 4JJNB 3B6FC 3AZNB 2CV5A 5JRGD 5B32B 4WV4B 4XZQC 1P3KB 5AVBA 3LZ1B 3X1SA 3AZGD 5B2ID 3AV1C 5AVCC 1TZYB 2AROB 1P3GC 2Y2IA 2BYMB 1P3FA 4YM6B 1F66B 3MGRB 3AN2D 4EO5C 3X1VD 1AOIB 1BFMA 4J8UA 5E5AA 1P34B 3X1TA 3REIA 4WU9D 5GT0C 3AZKA 3TU4C 1KX3C 3RELC 5KDMB 3AZFD 2Y2LA 3LELD 4H9NB 2BG1A 4ZUXB 5CP6A 2CV5C 3WA9D 1S32B 5AVBC 1ID3B 3X1SC 5AV9B 2F8NB 5B0YD 2Y2NA 4Z2MH 3KUYD 4XUJA 4LD9D 1M19A 1P3FC 3MGPA 3W97B 2NZDD 4G92B 4J8UC 3A6NA 3WKJA 3MNNA 5E5AC 5AV5B 3UTBB 1P3AA 3O62A 5B33A 3X1TC 3REIC 4XZQB 1P3LB 3B6FD 5GT3D 3AZKC 5BNVA 3VH5A 3AV1B 4J8WA 1M18A 1P3GB 3AFAA 5CP6C 4JJNA 3KXBB 3AZMD 5AVCD 3B6GD 4WZSB 5B32A 3C1BA 3AZED 1T3UA 4EO5B 4XUJC 3W96A 1M19C 2AROA 4Z66A 2BYMA 3AZHA 5AY8D 5GT0B 1N1JA 5GSUA 3WKJC 3A6NC 1KX3B 1M1AD 3RELB 3MNNC 5G49B 3AZJD 2Y2QA 3A1KA 4KGCA 3TU4D 1P3AC 3A1IA 3O62C 1EQZB 5B33C 3MGQB 2CV5B 3EPLA 1R4VA 5F99D 5AVBB 3X1SB 5B31G 1P3MB 4J8WC 1M18C 3REHD 3AFAC 4JJNC 1KU5A 3WAAD 5CPKD 5B32C 1S32A 5DNMD 3C1BC 3V9RA 1P3FD 1U35D 3B0BA 4J8UB 1HQ3A 4ZBJC 2F2AC 2DF4C 5E5AB 3W96C 2NQBD 2AROC 4QLCD 4Z66C 3X1TB 3REIB 2ZY5A 3AZHC 3AV2D 1KX4A 3AZKB 5GSUC 3C1CA 3MVDA 4KGCC 3X1UA 4Z5TD 3LZ0A 3MGSA 5BT1C 2Y2PA 5CP6D 1P3LA 3WTPE 3W98D 1ZLAB 3B0DB 1P3PD 3AZIB 5B24D 1M19B 3VH6A 1Z2CB 4XUJD 3KXBA 1S32C 3WTPB 3H0MC 2JCHA 3AZLB 3REKA 3MGPD 1HQ3C 5B40A 5AV6D 5B1LA 3MNNB 1P3AB 3WKJD 3O62B 3A6ND 4J8XA 4WU8A 5B33B 3AYWB 1KX4C 5BNVB 3C1CC 3VH5T 3EG5B 4YS3A 3MVDC 3X1UC 4J8WB 2XD5A 2HIOD 3W99A 3LZ0C 3MGSC 2Y2KA 3VH5W 2Y2OA 1EQZA 3REJB 3MGQA 1M18D 1TAFA 3AFAD 3C1BB 4JJND 1P3LC 3AZND 5B32D 1P3KD 4ZBJB 5BNXA 1P3MA 4NE6A 3LZ1D 3UT9B 3W96B 3LJAA 1BH9B 4Z66B 2RVQC 3KXBC 3AZHB 1TZYD 3R45B 2PYOB 2AROD 1N1JB 5GSUB 2L5AA 3REKC 5B40C 2F8NG 5B1LC 4KGCB 4YM6D 1F66D 3MGRD 4J8XC 4WU8C 1AOID 4WJ3C 4KGCD 1P34D 4YS3C 4H9PA 1KX5A 3W99C 3H0LC 2Y2MA 4R8PA 4H9OA 1EQZC 3MGQC 3V9RB 4ZUXD 2ZY4A 3H0RC 1S32D 1HQ3B 1ZLAA 1P3MC 1ID3D 4J8VA 3LJAC 3FDDA 5AV9D 2F8ND 1HQ3D 5DNNA 3AZIA 3EPHA 1KX4B 3WTPA 4KHAA 3C1CB 3AZLA 3MVDB 3X1UB 3NQUA 3W97D 3LZ0B 3MGSB 2BYKA 4H9SA 3MGSD 5AV5D 4CAYA 3UTBD 5CPIA 3AYWA 5B1MA 1KX5C 4XZQD 1P3LD 1Q9CA 4KUDA 3B0CT 4DRBA 4R8PC 4X23B 3VH6T 3AV1D 4UPKA 3REJA 3IP4C 2FJ7B 4H9QB 1P3GD 1JFIA 3KXBD 4NE3A 3REKB 2G5IC 4UUZB 5B40B 1ZLAC 5B1LB 4J8VC 3B0DC 1P3BA 3UT9A 1HTAA 5DNNC 4WU8B 4J8XB 3AZIC 1BH9A 1W2EA 3WTPC 2UWXA 3R45A 2PYOA 4YS3B 3AZLC 5AV8A 3W99B 5GT0D 1KX3D 4H9SC 3RELD 1P3IB 1TAFB 5CPIC 5JRGA 3AYWC 5CPJA 1EQZD 3MGQD 2CV5D 5B1MC 5BNXB 5AVBD 5B2IA 3X1SD 4KUDC 3LJAB 1P3MD 5BS7A 5C3IB 3REJC 2CWEA 2IO5C 3AN2A 3X1VA 1P3BC 3UT9C 1B67A 4J8UD 2Y2GA 5E5AD 4WU9A 2PYOC 3X1TD 4H9PB 1KX5B 3REID 5AV8C 3AZKD 3KFUG 3AZFA 4R8PB 4H9OB 5B2JB 5JRGC 5CPJC 5JA4A 5B2IC 4J8VB 3KUYA 5DNNB 1ZLAD 3UTAB 5BS7C 4X23A 4LD9A 2G5HC 2ZY2A 3AZID 4KHAB 1M19D 5B32G 2FJ7A 4H9QA 3X1VC 3AN2C 3NQUB 3WTPD 4UUZA 5B31B 2F8NK 5GXQB 3AZLD 2F8NH 2BYKB 3MNND 4CAYB 4M6BA 5CPIB 1P3AD 3O62D 4WU9C 5B33D 5GT3A 5B1MB 4HGAC 3AYWD 4KUDB 3AZFC 2VQRA 4J8WD 3AZMA 2ZM5A 3B6GA 1P3IA 1JFIB 2DQNC 3REJD 2IO5B 3AZEA 3C1BD 1P3BB 3KUYC 1P3OB 4X23C 4LD9C 3UT9D 3W96D 2FJ7C 3KWQB 5AY8A 4Z66D 5B0ZB 5AV8B 5FUGA 3AZHD 2PYOD 1M1AA 2JE5A 5GSUD 2HUEC 3AZJA 1H3OA 5JRGB 5CHLB 5CPJB 5F99A 5GT3C 3P5JB 5BT1D 2Y2HA 3AZGB 5CPJD 5B2IB 4CSRA 3EPJA 3AL0C 4H9RB 3REHA 5B2JA 3AZMC 3B6GC 1P3IC 1BH8A 3WAAA 5CPKA 5DNMA 4G91B 3AZEC 3AN2B 3X1VB 1U35A 2YFWA 1F1EA 2NQBA 4NFTA 3UTAA 5C3IC 4QLCA 4WU9B 3AV2A 3NQJA 5AY8C 4HGAB 1KX4D 1M1AC 5B31A 3AZJC 5GXQA 3AZFB 3C1CD 4Z5TA 3LELB 3MVDD 3X1UD 3WA9B 3LZ0D 5F99C 5JA4B 5BO0B 3W98A 5B0YB 4AWLC 3KUYB 1P3PA 3REHC 2W8SA 5B2JC 5B24A 4LD9B 4DRAA 3WAAC 3B0CW 5CPKC 4X23D 5DNMC 3VH6W 2NZDB 2RVQD 4WNNA 1U35C 2FJ7D 5AV6A 1P3OA 2HUEB 2RIQA 3REKD 2NQBC 5B40D 3UTAC 5B1LD 4QLCC 4J8XD 3AV2C 4WU8D 3B6FB 5GT3B 1PZRA 3KWQA 5B0ZA 4E44A 5B31C 5GXQC 4Z5TC 4YS3D 2HIOA 3AZMB 4DQYB 3W99D 3B6GB 5AVCB 3KSYA 3EPKA 3AZEB 3W98C 1P3ID 3AZNA 3AZGA 1P3KA 4Z2MG 3LZ1A 1P3PC 5B24C 2YFVB 4H9RA 3LJAD 1TZYA 5AY8B 3F6TA 5FUGB 3MGPC 1M1AB 5AV6C 3AZJB 1P3OC 4YM6A 3TU4B 1F66A 1H3OB 3MGRA 1AOIA 5F99B 3KWQC 1P34A 5B0ZC 4AWLB 4CSRB 2HIOC 3REHB 1KX5D 3LELA 3WAAB 1BH8B 3WA9A 5KDMA 5CPKB 4R8PD 5B2JD 5DNMB 4H9NA 1WWIA 5BO0A 4ZUXA 3AZNC 1U35B 3AZGC 1P3FB 5B0YA 2YFWB 1P3KC 3LZ1C 1ID3A 4NE5A 2NQBB 5AV9A 2F8NA 4J8VD 4QLCB 5DNND 3AV2B 3UTAD 1TZYC 3NQJB 2Y2JA 4G91C 2NZDA 1ULYA 3W97A 4Z5TB 4YM6C 1F66C 3MGRC 1AOIC 5B31D 1A7WA 5GXQD 5AV5A 2JSSA 3UTBA 5CP6B 1P34C 3B6FA 3W98B
chains in the Genus database with same CATH topology
1WWSA 5CPID 4XZQA 4E45A 1P3PB 5B1MD 3LELC 5B24B 4KUDD 3AV1A 3WA9C 4XUJB 2XD1A 5AVCA 1B6WA 4WNNB 4ZUXC 1P3GA 2J8PA 5B0YC 3MGPB 5AV6B 1ID3C 5AV9C 3WKJB 3A6NB 2FFFB 2YFVA 1P3BD 1P3OD 2NZDC 2LY8A 3KWQD 3W97C 2HIOB 5GT0A 5B0ZD 5AV8D 3TU4A 4G92C 1KX3A 2ZY3A 1M18B 3RELA 5G49A 5AV5C 3UTBC 3AFAB 4JJNB 3B6FC 3AZNB 2CV5A 5JRGD 5B32B 4WV4B 4XZQC 1P3KB 5AVBA 3LZ1B 3X1SA 3AZGD 5B2ID 3AV1C 5AVCC 1TZYB 2AROB 1P3GC 2Y2IA 2BYMB 1P3FA 4YM6B 1F66B 3MGRB 3AN2D 4EO5C 3X1VD 1AOIB 1BFMA 4J8UA 5E5AA 1P34B 3X1TA 3REIA 4WU9D 5GT0C 3AZKA 3TU4C 1KX3C 3RELC 5KDMB 3AZFD 2Y2LA 3LELD 4H9NB 2BG1A 4ZUXB 5CP6A 2CV5C 3WA9D 1S32B 5AVBC 1ID3B 3X1SC 5AV9B 2F8NB 5B0YD 2Y2NA 4Z2MH 3KUYD 4XUJA 4LD9D 1M19A 1P3FC 3MGPA 3W97B 2NZDD 4G92B 4J8UC 3A6NA 3WKJA 3MNNA 5E5AC 5AV5B 3UTBB 1P3AA 3O62A 5B33A 3X1TC 3REIC 4XZQB 1P3LB 3B6FD 5GT3D 3AZKC 5BNVA 3VH5A 3AV1B 4J8WA 1M18A 1P3GB 3AFAA 5CP6C 4JJNA 3KXBB 3AZMD 5AVCD 3B6GD 4WZSB 5B32A 3C1BA 3AZED 1T3UA 4EO5B 4XUJC 3W96A 1M19C 2AROA 4Z66A 2BYMA 3AZHA 5AY8D 5GT0B 1N1JA 5GSUA 3WKJC 3A6NC 1KX3B 1M1AD 3RELB 3MNNC 5G49B 3AZJD 2Y2QA 3A1KA 4KGCA 3TU4D 1P3AC 3A1IA 3O62C 1EQZB 5B33C 3MGQB 2CV5B 3EPLA 1R4VA 5F99D 5AVBB 3X1SB 5B31G 1P3MB 4J8WC 1M18C 3REHD 3AFAC 4JJNC 1KU5A 3WAAD 5CPKD 5B32C 1S32A 5DNMD 3C1BC 3V9RA 1P3FD 1U35D 3B0BA 4J8UB 1HQ3A 4ZBJC 2F2AC 2DF4C 5E5AB 3W96C 2NQBD 2AROC 4QLCD 4Z66C 3X1TB 3REIB 2ZY5A 3AZHC 3AV2D 1KX4A 3AZKB 5GSUC 3C1CA 3MVDA 4KGCC 3X1UA 4Z5TD 3LZ0A 3MGSA 5BT1C 2Y2PA 5CP6D 1P3LA 3WTPE 3W98D 1ZLAB 3B0DB 1P3PD 3AZIB 5B24D 1M19B 3VH6A 1Z2CB 4XUJD 3KXBA 1S32C 3WTPB 3H0MC 2JCHA 3AZLB 3REKA 3MGPD 1HQ3C 5B40A 5AV6D 5B1LA 3MNNB 1P3AB 3WKJD 3O62B 3A6ND 4J8XA 4WU8A 5B33B 3AYWB 1KX4C 5BNVB 3C1CC 3VH5T 3EG5B 4YS3A 3MVDC 3X1UC 4J8WB 2XD5A 2HIOD 3W99A 3LZ0C 3MGSC 2Y2KA 3VH5W 2Y2OA 1EQZA 3REJB 3MGQA 1M18D 1TAFA 3AFAD 3C1BB 4JJND 1P3LC 3AZND 5B32D 1P3KD 4ZBJB 5BNXA 1P3MA 4NE6A 3LZ1D 3UT9B 3W96B 3LJAA 1BH9B 4Z66B 2RVQC 3KXBC 3AZHB 1TZYD 3R45B 2PYOB 2AROD 1N1JB 5GSUB 2L5AA 3REKC 5B40C 2F8NG 5B1LC 4KGCB 4YM6D 1F66D 3MGRD 4J8XC 4WU8C 1AOID 4WJ3C 4KGCD 1P34D 4YS3C 4H9PA 1KX5A 3W99C 3H0LC 2Y2MA 4R8PA 4H9OA 1EQZC 3MGQC 3V9RB 4ZUXD 2ZY4A 3H0RC 1S32D 1HQ3B 1ZLAA 1P3MC 1ID3D 4J8VA 3LJAC 3FDDA 5AV9D 2F8ND 1HQ3D 5DNNA 3AZIA 3EPHA 1KX4B 3WTPA 4KHAA 3C1CB 3AZLA 3MVDB 3X1UB 3NQUA 3W97D 3LZ0B 3MGSB 2BYKA 4H9SA 3MGSD 5AV5D 4CAYA 3UTBD 5CPIA 3AYWA 5B1MA 1KX5C 4XZQD 1P3LD 1Q9CA 4KUDA 3B0CT 4DRBA 4R8PC 4X23B 3VH6T 3AV1D 4UPKA 3REJA 3IP4C 2FJ7B 4H9QB 1P3GD 1JFIA 3KXBD 4NE3A 3REKB 2G5IC 4UUZB 5B40B 1ZLAC 5B1LB 4J8VC 3B0DC 1P3BA 3UT9A 1HTAA 5DNNC 4WU8B 4J8XB 3AZIC 1BH9A 1W2EA 3WTPC 2UWXA 3R45A 2PYOA 4YS3B 3AZLC 5AV8A 3W99B 5GT0D 1KX3D 4H9SC 3RELD 1P3IB 1TAFB 5CPIC 5JRGA 3AYWC 5CPJA 1EQZD 3MGQD 2CV5D 5B1MC 5BNXB 5AVBD 5B2IA 3X1SD 4KUDC 3LJAB 1P3MD 5BS7A 5C3IB 3REJC 2CWEA 2IO5C 3AN2A 3X1VA 1P3BC 3UT9C 1B67A 4J8UD 2Y2GA 5E5AD 4WU9A 2PYOC 3X1TD 4H9PB 1KX5B 3REID 5AV8C 3AZKD 3KFUG 3AZFA 4R8PB 4H9OB 5B2JB 5JRGC 5CPJC 5JA4A 5B2IC 4J8VB 3KUYA 5DNNB 1ZLAD 3UTAB 5BS7C 4X23A 4LD9A 2G5HC 2ZY2A 3AZID 4KHAB 1M19D 5B32G 2FJ7A 4H9QA 3X1VC 3AN2C 3NQUB 3WTPD 4UUZA 5B31B 2F8NK 5GXQB 3AZLD 2F8NH 2BYKB 3MNND 4CAYB 4M6BA 5CPIB 1P3AD 3O62D 4WU9C 5B33D 5GT3A 5B1MB 4HGAC 3AYWD 4KUDB 3AZFC 2VQRA 4J8WD 3AZMA 2ZM5A 3B6GA 1P3IA 1JFIB 2DQNC 3REJD 2IO5B 3AZEA 3C1BD 1P3BB 3KUYC 1P3OB 4X23C 4LD9C 3UT9D 3W96D 2FJ7C 3KWQB 5AY8A 4Z66D 5B0ZB 5AV8B 5FUGA 3AZHD 2PYOD 1M1AA 2JE5A 5GSUD 2HUEC 3AZJA 1H3OA 5JRGB 5CHLB 5CPJB 5F99A 5GT3C 3P5JB 5BT1D 2Y2HA 3AZGB 5CPJD 5B2IB 4CSRA 3EPJA 3AL0C 4H9RB 3REHA 5B2JA 3AZMC 3B6GC 1P3IC 1BH8A 3WAAA 5CPKA 5DNMA 4G91B 3AZEC 3AN2B 3X1VB 1U35A 2YFWA 1F1EA 2NQBA 4NFTA 3UTAA 5C3IC 4QLCA 4WU9B 3AV2A 3NQJA 5AY8C 4HGAB 1KX4D 1M1AC 5B31A 3AZJC 5GXQA 3AZFB 3C1CD 4Z5TA 3LELB 3MVDD 3X1UD 3WA9B 3LZ0D 5F99C 5JA4B 5BO0B 3W98A 5B0YB 4AWLC 3KUYB 1P3PA 3REHC 2W8SA 5B2JC 5B24A 4LD9B 4DRAA 3WAAC 3B0CW 5CPKC 4X23D 5DNMC 3VH6W 2NZDB 2RVQD 4WNNA 1U35C 2FJ7D 5AV6A 1P3OA 2HUEB 2RIQA 3REKD 2NQBC 5B40D 3UTAC 5B1LD 4QLCC 4J8XD 3AV2C 4WU8D 3B6FB 5GT3B 1PZRA 3KWQA 5B0ZA 4E44A 5B31C 5GXQC 4Z5TC 4YS3D 2HIOA 3AZMB 4DQYB 3W99D 3B6GB 5AVCB 3KSYA 3EPKA 3AZEB 3W98C 1P3ID 3AZNA 3AZGA 1P3KA 4Z2MG 3LZ1A 1P3PC 5B24C 2YFVB 4H9RA 3LJAD 1TZYA 5AY8B 3F6TA 5FUGB 3MGPC 1M1AB 5AV6C 3AZJB 1P3OC 4YM6A 3TU4B 1F66A 1H3OB 3MGRA 1AOIA 5F99B 3KWQC 1P34A 5B0ZC 4AWLB 4CSRB 2HIOC 3REHB 1KX5D 3LELA 3WAAB 1BH8B 3WA9A 5KDMA 5CPKB 4R8PD 5B2JD 5DNMB 4H9NA 1WWIA 5BO0A 4ZUXA 3AZNC 1U35B 3AZGC 1P3FB 5B0YA 2YFWB 1P3KC 3LZ1C 1ID3A 4NE5A 2NQBB 5AV9A 2F8NA 4J8VD 4QLCB 5DNND 3AV2B 3UTAD 1TZYC 3NQJB 2Y2JA 4G91C 2NZDA 1ULYA 3W97A 4Z5TB 4YM6C 1F66C 3MGRC 1AOIC 5B31D 1A7WA 5GXQD 5AV5A 2JSSA 3UTBA 5CP6B 1P34C 3B6FA 3W98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWS A;  5CPI D;  4XZQ A;  4E45 A;  1P3P B;  5B1M D;  3LEL C;  5B24 B;  4KUD D;  3AV1 A;  3WA9 C;  4XUJ B;  5AVC A;  1B6W A;  4WNN B;  4ZUX C;  1P3G A;  5B0Y C;  3MGP B;  5AV6 B;  1ID3 C;  5AV9 C;  3WKJ B;  3A6N B;  1P3B D;  2YFV A;  1P3O D;  2NZD C;  2LY8 A;  3KWQ D;  3W97 C;  2HIO B;  5GT0 A;  5B0Z D;  5AV8 D;  3TU4 A;  4G92 C;  1KX3 A;  1M18 B;  3REL A;  5G49 A;  5AV5 C;  3UTB C;  3AFA B;  4JJN B;  3B6F C;  3AZN B;  2CV5 A;  5JRG D;  5B32 B;  4WV4 B;  4XZQ C;  1P3K B;  5AVB A;  3LZ1 B;  3X1S A;  3AZG D;  5B2I D;  3AV1 C;  5AVC C;  1TZY B;  2ARO B;  1P3G C;  2BYM B;  1P3F A;  4YM6 B;  1F66 B;  3MGR B;  3AN2 D;  4EO5 C;  3X1V D;  1AOI B;  1BFM A;  4J8U A;  5E5A A;  1P34 B;  3X1T A;  3REI A;  4WU9 D;  5GT0 C;  3AZK A;  3TU4 C;  1KX3 C;  3REL C;  5KDM B;  3AZF D;  3LEL D;  4H9N B;  4ZUX B;  2CV5 C;  5CP6 A;  3WA9 D;  1S32 B;  5AVB C;  1ID3 B;  3X1S C;  5AV9 B;  2F8N B;  5B0Y D;  4Z2M H;  3KUY D;  4XUJ A;  4LD9 D;  1M19 A;  1P3F C;  3MGP A;  3W97 B;  2NZD D;  4G92 B;  4J8U C;  3A6N A;  3WKJ A;  3MNN A;  5E5A C;  5AV5 B;  3UTB B;  1P3A A;  3O62 A;  5B33 A;  3X1T C;  3REI C;  4XZQ B;  1P3L B;  3B6F D;  5GT3 D;  3AZK C;  5BNV A;  3VH5 A;  3AV1 B;  4J8W A;  1M18 A;  1P3G B;  3AFA A;  5CP6 C;  4JJN A;  3KXB B;  3AZM D;  5AVC D;  3B6G D;  4WZS B;  5B32 A;  3C1B A;  3AZE D;  4EO5 B;  4XUJ C;  3W96 A;  1M19 C;  2ARO A;  4Z66 A;  2BYM A;  3AZH A;  5AY8 D;  5GT0 B;  1N1J A;  5GSU A;  3WKJ C;  3A6N C;  1KX3 B;  1M1A D;  3REL B;  3MNN C;  5G49 B;  3AZJ D;  4KGC A;  3TU4 D;  1P3A C;  3O62 C;  1EQZ B;  5B33 C;  3MGQ B;  2CV5 B;  1R4V A;  5F99 D;  5AVB B;  3X1S B;  5B31 G;  1P3M B;  4J8W C;  1M18 C;  3REH D;  3AFA C;  4JJN C;  1KU5 A;  3WAA D;  5CPK D;  5B32 C;  1S32 A;  5DNM D;  3C1B C;  3V9R A;  1P3F D;  1U35 D;  3B0B A;  4J8U B;  1HQ3 A;  4ZBJ C;  5E5A B;  3W96 C;  2NQB D;  2ARO C;  4QLC D;  4Z66 C;  3X1T B;  3REI B;  3AZH C;  3AV2 D;  1KX4 A;  3AZK B;  5GSU C;  3C1C A;  3MVD A;  4KGC C;  3X1U A;  4Z5T D;  3LZ0 A;  3MGS A;  5BT1 C;  5CP6 D;  1P3L A;  3WTP E;  3W98 D;  1ZLA B;  3B0D B;  1P3P D;  3AZI B;  5B24 D;  1M19 B;  3VH6 A;  4XUJ D;  3KXB A;  1S32 C;  3WTP B;  3AZL B;  3REK A;  3MGP D;  1HQ3 C;  5B40 A;  5AV6 D;  5B1L A;  3MNN B;  1P3A B;  3WKJ D;  3O62 B;  3A6N D;  4J8X A;  4WU8 A;  5B33 B;  3AYW B;  1KX4 C;  5BNV B;  3C1C C;  3VH5 T;  4YS3 A;  3MVD C;  3X1U C;  4J8W B;  2HIO D;  3W99 A;  3LZ0 C;  3MGS C;  3VH5 W;  1EQZ A;  3REJ B;  3MGQ A;  1M18 D;  1TAF A;  3AFA D;  3C1B B;  4JJN D;  1P3L C;  3AZN D;  5B32 D;  1P3K D;  4ZBJ B;  5BNX A;  1P3M A;  4NE6 A;  3LZ1 D;  3UT9 B;  3W96 B;  3LJA A;  1BH9 B;  4Z66 B;  2RVQ C;  3KXB C;  3AZH B;  1TZY D;  3R45 B;  2PYO B;  2ARO D;  1N1J B;  5GSU B;  2L5A A;  3REK C;  5B40 C;  2F8N G;  5B1L C;  4KGC B;  4YM6 D;  1F66 D;  3MGR D;  4J8X C;  4WU8 C;  1AOI D;  4KGC D;  1P34 D;  4YS3 C;  4H9P A;  1KX5 A;  3W99 C;  4R8P A;  4H9O A;  1EQZ C;  3MGQ C;  3V9R B;  4ZUX D;  1S32 D;  1HQ3 B;  1ZLA A;  1P3M C;  1ID3 D;  4J8V A;  3LJA C;  5AV9 D;  2F8N D;  1HQ3 D;  5DNN A;  3AZI A;  1KX4 B;  3WTP A;  4KHA A;  3C1C B;  3AZL A;  3MVD B;  3X1U B;  3NQU A;  3W97 D;  3LZ0 B;  3MGS B;  2BYK A;  4H9S A;  3MGS D;  5AV5 D;  4CAY A;  3UTB D;  5CPI A;  3AYW A;  5B1M A;  1KX5 C;  4XZQ D;  1P3L D;  1Q9C A;  4KUD A;  3B0C T;  4DRB A;  4R8P C;  4X23 B;  3VH6 T;  3AV1 D;  3REJ A;  2FJ7 B;  4H9Q B;  1P3G D;  1JFI A;  3KXB D;  4NE3 A;  3REK B;  4UUZ B;  5B40 B;  1ZLA C;  5B1L B;  4J8V C;  3B0D C;  1P3B A;  3UT9 A;  1HTA A;  5DNN C;  4WU8 B;  4J8X B;  3AZI C;  1BH9 A;  3WTP C;  3R45 A;  2PYO A;  4YS3 B;  3AZL C;  5AV8 A;  3W99 B;  5GT0 D;  1KX3 D;  4H9S C;  3REL D;  1P3I B;  1TAF B;  5CPI C;  5JRG A;  3AYW C;  5CPJ A;  1EQZ D;  3MGQ D;  2CV5 D;  5B1M C;  5BNX B;  5AVB D;  5B2I A;  3X1S D;  4KUD C;  3LJA B;  1P3M D;  5BS7 A;  5C3I B;  3REJ C;  2CWE A;  2IO5 C;  3AN2 A;  3X1V A;  1P3B C;  3UT9 C;  1B67 A;  4J8U D;  5E5A D;  4WU9 A;  2PYO C;  3X1T D;  4H9P B;  1KX5 B;  3REI D;  5AV8 C;  3AZK D;  3AZF A;  4R8P B;  4H9O B;  5B2J B;  5JRG C;  5CPJ C;  5JA4 A;  5B2I C;  4J8V B;  3KUY A;  5DNN B;  1ZLA D;  3UTA B;  5BS7 C;  4X23 A;  4LD9 A;  3AZI D;  4KHA B;  1M19 D;  5B32 G;  2FJ7 A;  4H9Q A;  3X1V C;  3AN2 C;  3NQU B;  3WTP D;  4UUZ A;  5B31 B;  2F8N K;  5GXQ B;  3AZL D;  2F8N H;  2BYK B;  3MNN D;  4CAY B;  4M6B A;  5CPI B;  1P3A D;  3O62 D;  4WU9 C;  5B33 D;  5GT3 A;  5B1M B;  4HGA C;  3AYW D;  4KUD B;  3AZF C;  4J8W D;  3AZM A;  3B6G A;  1P3I A;  1JFI B;  3REJ D;  2IO5 B;  3AZE A;  3C1B D;  1P3B B;  3KUY C;  1P3O B;  4X23 C;  4LD9 C;  3UT9 D;  3W96 D;  2FJ7 C;  3KWQ B;  5AY8 A;  4Z66 D;  5B0Z B;  5AV8 B;  5FUG A;  3AZH D;  2PYO D;  1M1A A;  5GSU D;  2HUE C;  3AZJ A;  1H3O A;  5JRG B;  5CHL B;  5CPJ B;  5F99 A;  5GT3 C;  5BT1 D;  3AZG B;  5CPJ D;  5B2I B;  4CSR A;  4H9R B;  3REH A;  5B2J A;  3AZM C;  3B6G C;  1P3I C;  1BH8 A;  3WAA A;  5CPK A;  5DNM A;  4G91 B;  3AZE C;  3AN2 B;  3X1V B;  1U35 A;  2YFW A;  1F1E A;  2NQB A;  4NFT A;  3UTA A;  5C3I C;  4QLC A;  4WU9 B;  3AV2 A;  3NQJ A;  5AY8 C;  4HGA B;  1KX4 D;  1M1A C;  5B31 A;  3AZJ C;  5GXQ A;  3AZF B;  3C1C D;  4Z5T A;  3LEL B;  3MVD D;  3X1U D;  3WA9 B;  3LZ0 D;  5F99 C;  5JA4 B;  5BO0 B;  3W98 A;  5B0Y B;  4AWL C;  3KUY B;  1P3P A;  3REH C;  5B2J C;  5B24 A;  4LD9 B;  4DRA A;  3WAA C;  3B0C W;  5CPK C;  4X23 D;  5DNM C;  3VH6 W;  2NZD B;  2RVQ D;  4WNN A;  1U35 C;  2FJ7 D;  5AV6 A;  1P3O A;  2HUE B;  3REK D;  2NQB C;  5B40 D;  3UTA C;  5B1L D;  4QLC C;  4J8X D;  3AV2 C;  4WU8 D;  3B6F B;  5GT3 B;  3KWQ A;  5B0Z A;  4E44 A;  5B31 C;  5GXQ C;  4Z5T C;  4YS3 D;  2HIO A;  3AZM B;  3W99 D;  3B6G B;  5AVC B;  3KSY A;  3AZE B;  3W98 C;  1P3I D;  3AZN A;  3AZG A;  1P3K A;  4Z2M G;  3LZ1 A;  1P3P C;  5B24 C;  2YFV B;  4H9R A;  3LJA D;  1TZY A;  5AY8 B;  5FUG B;  3MGP C;  1M1A B;  5AV6 C;  3AZJ B;  1P3O C;  4YM6 A;  3TU4 B;  1F66 A;  1H3O B;  3MGR A;  1AOI A;  5F99 B;  3KWQ C;  1P34 A;  5B0Z C;  4AWL B;  4CSR B;  2HIO C;  3REH B;  1KX5 D;  3LEL A;  3WAA B;  1BH8 B;  3WA9 A;  5KDM A;  5CPK B;  4R8P D;  5B2J D;  5DNM B;  4H9N A;  1WWI A;  5BO0 A;  4ZUX A;  3AZN C;  1U35 B;  3AZG C;  1P3F B;  5B0Y A;  2YFW B;  1P3K C;  3LZ1 C;  1ID3 A;  4NE5 A;  2NQB B;  5AV9 A;  2F8N A;  4J8V D;  4QLC B;  5DNN D;  3AV2 B;  3UTA D;  1TZY C;  3NQJ B;  4G91 C;  2NZD A;  1ULY A;  3W97 A;  4Z5T B;  4YM6 C;  1F66 C;  3MGR C;  1AOI C;  5B31 D;  1A7W A;  5GXQ D;  5AV5 A;  2JSS A;  3UTB A;  5CP6 B;  1P34 C;  3B6F A;  3W98 B; 
#chains in the Genus database with same CATH topology
 1WWS A;  5CPI D;  4XZQ A;  4E45 A;  1P3P B;  5B1M D;  3LEL C;  5B24 B;  4KUD D;  3AV1 A;  3WA9 C;  4XUJ B;  2XD1 A;  5AVC A;  1B6W A;  4WNN B;  4ZUX C;  1P3G A;  2J8P A;  5B0Y C;  3MGP B;  5AV6 B;  1ID3 C;  5AV9 C;  3WKJ B;  3A6N B;  2FFF B;  2YFV A;  1P3B D;  1P3O D;  2NZD C;  2LY8 A;  3KWQ D;  3W97 C;  2HIO B;  5GT0 A;  5B0Z D;  5AV8 D;  3TU4 A;  4G92 C;  1KX3 A;  2ZY3 A;  1M18 B;  3REL A;  5G49 A;  5AV5 C;  3UTB C;  3AFA B;  4JJN B;  3B6F C;  3AZN B;  2CV5 A;  5JRG D;  5B32 B;  4WV4 B;  4XZQ C;  1P3K B;  5AVB A;  3LZ1 B;  3X1S A;  3AZG D;  5B2I D;  3AV1 C;  5AVC C;  1TZY B;  2ARO B;  1P3G C;  2Y2I A;  2BYM B;  1P3F A;  4YM6 B;  1F66 B;  3MGR B;  3AN2 D;  4EO5 C;  3X1V D;  1AOI B;  1BFM A;  4J8U A;  5E5A A;  1P34 B;  3X1T A;  3REI A;  4WU9 D;  5GT0 C;  3AZK A;  3TU4 C;  1KX3 C;  3REL C;  5KDM B;  3AZF D;  2Y2L A;  3LEL D;  4H9N B;  2BG1 A;  4ZUX B;  5CP6 A;  2CV5 C;  3WA9 D;  1S32 B;  5AVB C;  1ID3 B;  3X1S C;  5AV9 B;  2F8N B;  5B0Y D;  2Y2N A;  4Z2M H;  3KUY D;  4XUJ A;  4LD9 D;  1M19 A;  1P3F C;  3MGP A;  3W97 B;  2NZD D;  4G92 B;  4J8U C;  3A6N A;  3WKJ A;  3MNN A;  5E5A C;  5AV5 B;  3UTB B;  1P3A A;  3O62 A;  5B33 A;  3X1T C;  3REI C;  4XZQ B;  1P3L B;  3B6F D;  5GT3 D;  3AZK C;  5BNV A;  3VH5 A;  3AV1 B;  4J8W A;  1M18 A;  1P3G B;  3AFA A;  5CP6 C;  4JJN A;  3KXB B;  3AZM D;  5AVC D;  3B6G D;  4WZS B;  5B32 A;  3C1B A;  3AZE D;  1T3U A;  4EO5 B;  4XUJ C;  3W96 A;  1M19 C;  2ARO A;  4Z66 A;  2BYM A;  3AZH A;  5AY8 D;  5GT0 B;  1N1J A;  5GSU A;  3WKJ C;  3A6N C;  1KX3 B;  1M1A D;  3REL B;  3MNN C;  5G49 B;  3AZJ D;  2Y2Q A;  3A1K A;  4KGC A;  3TU4 D;  1P3A C;  3A1I A;  3O62 C;  1EQZ B;  5B33 C;  3MGQ B;  2CV5 B;  3EPL A;  1R4V A;  5F99 D;  5AVB B;  3X1S B;  5B31 G;  1P3M B;  4J8W C;  1M18 C;  3REH D;  3AFA C;  4JJN C;  1KU5 A;  3WAA D;  5CPK D;  5B32 C;  1S32 A;  5DNM D;  3C1B C;  3V9R A;  1P3F D;  1U35 D;  3B0B A;  4J8U B;  1HQ3 A;  4ZBJ C;  2F2A C;  2DF4 C;  5E5A B;  3W96 C;  2NQB D;  2ARO C;  4QLC D;  4Z66 C;  3X1T B;  3REI B;  2ZY5 A;  3AZH C;  3AV2 D;  1KX4 A;  3AZK B;  5GSU C;  3C1C A;  3MVD A;  4KGC C;  3X1U A;  4Z5T D;  3LZ0 A;  3MGS A;  5BT1 C;  2Y2P A;  5CP6 D;  1P3L A;  3WTP E;  3W98 D;  1ZLA B;  3B0D B;  1P3P D;  3AZI B;  5B24 D;  1M19 B;  3VH6 A;  1Z2C B;  4XUJ D;  3KXB A;  1S32 C;  3WTP B;  3H0M C;  2JCH A;  3AZL B;  3REK A;  3MGP D;  1HQ3 C;  5B40 A;  5AV6 D;  5B1L A;  3MNN B;  1P3A B;  3WKJ D;  3O62 B;  3A6N D;  4J8X A;  4WU8 A;  5B33 B;  3AYW B;  1KX4 C;  5BNV B;  3C1C C;  3VH5 T;  3EG5 B;  4YS3 A;  3MVD C;  3X1U C;  4J8W B;  2XD5 A;  2HIO D;  3W99 A;  3LZ0 C;  3MGS C;  2Y2K A;  3VH5 W;  2Y2O A;  1EQZ A;  3REJ B;  3MGQ A;  1M18 D;  1TAF A;  3AFA D;  3C1B B;  4JJN D;  1P3L C;  3AZN D;  5B32 D;  1P3K D;  4ZBJ B;  5BNX A;  1P3M A;  4NE6 A;  3LZ1 D;  3UT9 B;  3W96 B;  3LJA A;  1BH9 B;  4Z66 B;  2RVQ C;  3KXB C;  3AZH B;  1TZY D;  3R45 B;  2PYO B;  2ARO D;  1N1J B;  5GSU B;  2L5A A;  3REK C;  5B40 C;  2F8N G;  5B1L C;  4KGC B;  4YM6 D;  1F66 D;  3MGR D;  4J8X C;  4WU8 C;  1AOI D;  4WJ3 C;  4KGC D;  1P34 D;  4YS3 C;  4H9P A;  1KX5 A;  3W99 C;  3H0L C;  2Y2M A;  4R8P A;  4H9O A;  1EQZ C;  3MGQ C;  3V9R B;  4ZUX D;  2ZY4 A;  3H0R C;  1S32 D;  1HQ3 B;  1ZLA A;  1P3M C;  1ID3 D;  4J8V A;  3LJA C;  3FDD A;  5AV9 D;  2F8N D;  1HQ3 D;  5DNN A;  3AZI A;  3EPH A;  1KX4 B;  3WTP A;  4KHA A;  3C1C B;  3AZL A;  3MVD B;  3X1U B;  3NQU A;  3W97 D;  3LZ0 B;  3MGS B;  2BYK A;  4H9S A;  3MGS D;  5AV5 D;  4CAY A;  3UTB D;  5CPI A;  3AYW A;  5B1M A;  1KX5 C;  4XZQ D;  1P3L D;  1Q9C A;  4KUD A;  3B0C T;  4DRB A;  4R8P C;  4X23 B;  3VH6 T;  3AV1 D;  4UPK A;  3REJ A;  3IP4 C;  2FJ7 B;  4H9Q B;  1P3G D;  1JFI A;  3KXB D;  4NE3 A;  3REK B;  2G5I C;  4UUZ B;  5B40 B;  1ZLA C;  5B1L B;  4J8V C;  3B0D C;  1P3B A;  3UT9 A;  1HTA A;  5DNN C;  4WU8 B;  4J8X B;  3AZI C;  1BH9 A;  1W2E A;  3WTP C;  2UWX A;  3R45 A;  2PYO A;  4YS3 B;  3AZL C;  5AV8 A;  3W99 B;  5GT0 D;  1KX3 D;  4H9S C;  3REL D;  1P3I B;  1TAF B;  5CPI C;  5JRG A;  3AYW C;  5CPJ A;  1EQZ D;  3MGQ D;  2CV5 D;  5B1M C;  5BNX B;  5AVB D;  5B2I A;  3X1S D;  4KUD C;  3LJA B;  1P3M D;  5BS7 A;  5C3I B;  3REJ C;  2CWE A;  2IO5 C;  3AN2 A;  3X1V A;  1P3B C;  3UT9 C;  1B67 A;  4J8U D;  2Y2G A;  5E5A D;  4WU9 A;  2PYO C;  3X1T D;  4H9P B;  1KX5 B;  3REI D;  5AV8 C;  3AZK D;  3KFU G;  3AZF A;  4R8P B;  4H9O B;  5B2J B;  5JRG C;  5CPJ C;  5JA4 A;  5B2I C;  4J8V B;  3KUY A;  5DNN B;  1ZLA D;  3UTA B;  5BS7 C;  4X23 A;  4LD9 A;  2G5H C;  2ZY2 A;  3AZI D;  4KHA B;  1M19 D;  5B32 G;  2FJ7 A;  4H9Q A;  3X1V C;  3AN2 C;  3NQU B;  3WTP D;  4UUZ A;  5B31 B;  2F8N K;  5GXQ B;  3AZL D;  2F8N H;  2BYK B;  3MNN D;  4CAY B;  4M6B A;  5CPI B;  1P3A D;  3O62 D;  4WU9 C;  5B33 D;  5GT3 A;  5B1M B;  4HGA C;  3AYW D;  4KUD B;  3AZF C;  2VQR A;  4J8W D;  3AZM A;  2ZM5 A;  3B6G A;  1P3I A;  1JFI B;  2DQN C;  3REJ D;  2IO5 B;  3AZE A;  3C1B D;  1P3B B;  3KUY C;  1P3O B;  4X23 C;  4LD9 C;  3UT9 D;  3W96 D;  2FJ7 C;  3KWQ B;  5AY8 A;  4Z66 D;  5B0Z B;  5AV8 B;  5FUG A;  3AZH D;  2PYO D;  1M1A A;  2JE5 A;  5GSU D;  2HUE C;  3AZJ A;  1H3O A;  5JRG B;  5CHL B;  5CPJ B;  5F99 A;  5GT3 C;  3P5J B;  5BT1 D;  2Y2H A;  3AZG B;  5CPJ D;  5B2I B;  4CSR A;  3EPJ A;  3AL0 C;  4H9R B;  3REH A;  5B2J A;  3AZM C;  3B6G C;  1P3I C;  1BH8 A;  3WAA A;  5CPK A;  5DNM A;  4G91 B;  3AZE C;  3AN2 B;  3X1V B;  1U35 A;  2YFW A;  1F1E A;  2NQB A;  4NFT A;  3UTA A;  5C3I C;  4QLC A;  4WU9 B;  3AV2 A;  3NQJ A;  5AY8 C;  4HGA B;  1KX4 D;  1M1A C;  5B31 A;  3AZJ C;  5GXQ A;  3AZF B;  3C1C D;  4Z5T A;  3LEL B;  3MVD D;  3X1U D;  3WA9 B;  3LZ0 D;  5F99 C;  5JA4 B;  5BO0 B;  3W98 A;  5B0Y B;  4AWL C;  3KUY B;  1P3P A;  3REH C;  2W8S A;  5B2J C;  5B24 A;  4LD9 B;  4DRA A;  3WAA C;  3B0C W;  5CPK C;  4X23 D;  5DNM C;  3VH6 W;  2NZD B;  2RVQ D;  4WNN A;  1U35 C;  2FJ7 D;  5AV6 A;  1P3O A;  2HUE B;  2RIQ A;  3REK D;  2NQB C;  5B40 D;  3UTA C;  5B1L D;  4QLC C;  4J8X D;  3AV2 C;  4WU8 D;  3B6F B;  5GT3 B;  1PZR A;  3KWQ A;  5B0Z A;  4E44 A;  5B31 C;  5GXQ C;  4Z5T C;  4YS3 D;  2HIO A;  3AZM B;  4DQY B;  3W99 D;  3B6G B;  5AVC B;  3KSY A;  3EPK A;  3AZE B;  3W98 C;  1P3I D;  3AZN A;  3AZG A;  1P3K A;  4Z2M G;  3LZ1 A;  1P3P C;  5B24 C;  2YFV B;  4H9R A;  3LJA D;  1TZY A;  5AY8 B;  3F6T A;  5FUG B;  3MGP C;  1M1A B;  5AV6 C;  3AZJ B;  1P3O C;  4YM6 A;  3TU4 B;  1F66 A;  1H3O B;  3MGR A;  1AOI A;  5F99 B;  3KWQ C;  1P34 A;  5B0Z C;  4AWL B;  4CSR B;  2HIO C;  3REH B;  1KX5 D;  3LEL A;  3WAA B;  1BH8 B;  3WA9 A;  5KDM A;  5CPK B;  4R8P D;  5B2J D;  5DNM B;  4H9N A;  1WWI A;  5BO0 A;  4ZUX A;  3AZN C;  1U35 B;  3AZG C;  1P3F B;  5B0Y A;  2YFW B;  1P3K C;  3LZ1 C;  1ID3 A;  4NE5 A;  2NQB B;  5AV9 A;  2F8N A;  4J8V D;  4QLC B;  5DNN D;  3AV2 B;  3UTA D;  1TZY C;  3NQJ B;  2Y2J A;  4G91 C;  2NZD A;  1ULY A;  3W97 A;  4Z5T B;  4YM6 C;  1F66 C;  3MGR C;  1AOI C;  5B31 D;  1A7W A;  5GXQ D;  5AV5 A;  2JSS A;  3UTB A;  5CP6 B;  1P34 C;  3B6F A;  3W98 B; 
#chains in the Genus database with same CATH homology
 1WWS A;  5CPI D;  4XZQ A;  4E45 A;  1P3P B;  5B1M D;  3LEL C;  5B24 B;  4KUD D;  3AV1 A;  3WA9 C;  4XUJ B;  2XD1 A;  5AVC A;  1B6W A;  4WNN B;  4ZUX C;  1P3G A;  2J8P A;  5B0Y C;  3MGP B;  5AV6 B;  1ID3 C;  5AV9 C;  3WKJ B;  3A6N B;  2FFF B;  2YFV A;  1P3B D;  1P3O D;  2NZD C;  2LY8 A;  3KWQ D;  3W97 C;  2HIO B;  5GT0 A;  5B0Z D;  5AV8 D;  3TU4 A;  4G92 C;  1KX3 A;  2ZY3 A;  1M18 B;  3REL A;  5G49 A;  5AV5 C;  3UTB C;  3AFA B;  4JJN B;  3B6F C;  3AZN B;  2CV5 A;  5JRG D;  5B32 B;  4WV4 B;  4XZQ C;  1P3K B;  5AVB A;  3LZ1 B;  3X1S A;  3AZG D;  5B2I D;  3AV1 C;  5AVC C;  1TZY B;  2ARO B;  1P3G C;  2Y2I A;  2BYM B;  1P3F A;  4YM6 B;  1F66 B;  3MGR B;  3AN2 D;  4EO5 C;  3X1V D;  1AOI B;  1BFM A;  4J8U A;  5E5A A;  1P34 B;  3X1T A;  3REI A;  4WU9 D;  5GT0 C;  3AZK A;  3TU4 C;  1KX3 C;  3REL C;  5KDM B;  3AZF D;  2Y2L A;  3LEL D;  4H9N B;  2BG1 A;  4ZUX B;  5CP6 A;  2CV5 C;  3WA9 D;  1S32 B;  5AVB C;  1ID3 B;  3X1S C;  5AV9 B;  2F8N B;  5B0Y D;  2Y2N A;  4Z2M H;  3KUY D;  4XUJ A;  4LD9 D;  1M19 A;  1P3F C;  3MGP A;  3W97 B;  2NZD D;  4G92 B;  4J8U C;  3A6N A;  3WKJ A;  3MNN A;  5E5A C;  5AV5 B;  3UTB B;  1P3A A;  3O62 A;  5B33 A;  3X1T C;  3REI C;  4XZQ B;  1P3L B;  3B6F D;  5GT3 D;  3AZK C;  5BNV A;  3VH5 A;  3AV1 B;  4J8W A;  1M18 A;  1P3G B;  3AFA A;  5CP6 C;  4JJN A;  3KXB B;  3AZM D;  5AVC D;  3B6G D;  4WZS B;  5B32 A;  3C1B A;  3AZE D;  1T3U A;  4EO5 B;  4XUJ C;  3W96 A;  1M19 C;  2ARO A;  4Z66 A;  2BYM A;  3AZH A;  5AY8 D;  5GT0 B;  1N1J A;  5GSU A;  3WKJ C;  3A6N C;  1KX3 B;  1M1A D;  3REL B;  3MNN C;  5G49 B;  3AZJ D;  2Y2Q A;  3A1K A;  4KGC A;  3TU4 D;  1P3A C;  3A1I A;  3O62 C;  1EQZ B;  5B33 C;  3MGQ B;  2CV5 B;  3EPL A;  1R4V A;  5F99 D;  5AVB B;  3X1S B;  5B31 G;  1P3M B;  4J8W C;  1M18 C;  3REH D;  3AFA C;  4JJN C;  1KU5 A;  3WAA D;  5CPK D;  5B32 C;  1S32 A;  5DNM D;  3C1B C;  3V9R A;  1P3F D;  1U35 D;  3B0B A;  4J8U B;  1HQ3 A;  4ZBJ C;  2F2A C;  2DF4 C;  5E5A B;  3W96 C;  2NQB D;  2ARO C;  4QLC D;  4Z66 C;  3X1T B;  3REI B;  2ZY5 A;  3AZH C;  3AV2 D;  1KX4 A;  3AZK B;  5GSU C;  3C1C A;  3MVD A;  4KGC C;  3X1U A;  4Z5T D;  3LZ0 A;  3MGS A;  5BT1 C;  2Y2P A;  5CP6 D;  1P3L A;  3WTP E;  3W98 D;  1ZLA B;  3B0D B;  1P3P D;  3AZI B;  5B24 D;  1M19 B;  3VH6 A;  1Z2C B;  4XUJ D;  3KXB A;  1S32 C;  3WTP B;  3H0M C;  2JCH A;  3AZL B;  3REK A;  3MGP D;  1HQ3 C;  5B40 A;  5AV6 D;  5B1L A;  3MNN B;  1P3A B;  3WKJ D;  3O62 B;  3A6N D;  4J8X A;  4WU8 A;  5B33 B;  3AYW B;  1KX4 C;  5BNV B;  3C1C C;  3VH5 T;  3EG5 B;  4YS3 A;  3MVD C;  3X1U C;  4J8W B;  2XD5 A;  2HIO D;  3W99 A;  3LZ0 C;  3MGS C;  2Y2K A;  3VH5 W;  2Y2O A;  1EQZ A;  3REJ B;  3MGQ A;  1M18 D;  1TAF A;  3AFA D;  3C1B B;  4JJN D;  1P3L C;  3AZN D;  5B32 D;  1P3K D;  4ZBJ B;  5BNX A;  1P3M A;  4NE6 A;  3LZ1 D;  3UT9 B;  3W96 B;  3LJA A;  1BH9 B;  4Z66 B;  2RVQ C;  3KXB C;  3AZH B;  1TZY D;  3R45 B;  2PYO B;  2ARO D;  1N1J B;  5GSU B;  2L5A A;  3REK C;  5B40 C;  2F8N G;  5B1L C;  4KGC B;  4YM6 D;  1F66 D;  3MGR D;  4J8X C;  4WU8 C;  1AOI D;  4WJ3 C;  4KGC D;  1P34 D;  4YS3 C;  4H9P A;  1KX5 A;  3W99 C;  3H0L C;  2Y2M A;  4R8P A;  4H9O A;  1EQZ C;  3MGQ C;  3V9R B;  4ZUX D;  2ZY4 A;  3H0R C;  1S32 D;  1HQ3 B;  1ZLA A;  1P3M C;  1ID3 D;  4J8V A;  3LJA C;  3FDD A;  5AV9 D;  2F8N D;  1HQ3 D;  5DNN A;  3AZI A;  3EPH A;  1KX4 B;  3WTP A;  4KHA A;  3C1C B;  3AZL A;  3MVD B;  3X1U B;  3NQU A;  3W97 D;  3LZ0 B;  3MGS B;  2BYK A;  4H9S A;  3MGS D;  5AV5 D;  4CAY A;  3UTB D;  5CPI A;  3AYW A;  5B1M A;  1KX5 C;  4XZQ D;  1P3L D;  1Q9C A;  4KUD A;  3B0C T;  4DRB A;  4R8P C;  4X23 B;  3VH6 T;  3AV1 D;  4UPK A;  3REJ A;  3IP4 C;  2FJ7 B;  4H9Q B;  1P3G D;  1JFI A;  3KXB D;  4NE3 A;  3REK B;  2G5I C;  4UUZ B;  5B40 B;  1ZLA C;  5B1L B;  4J8V C;  3B0D C;  1P3B A;  3UT9 A;  1HTA A;  5DNN C;  4WU8 B;  4J8X B;  3AZI C;  1BH9 A;  1W2E A;  3WTP C;  2UWX A;  3R45 A;  2PYO A;  4YS3 B;  3AZL C;  5AV8 A;  3W99 B;  5GT0 D;  1KX3 D;  4H9S C;  3REL D;  1P3I B;  1TAF B;  5CPI C;  5JRG A;  3AYW C;  5CPJ A;  1EQZ D;  3MGQ D;  2CV5 D;  5B1M C;  5BNX B;  5AVB D;  5B2I A;  3X1S D;  4KUD C;  3LJA B;  1P3M D;  5BS7 A;  5C3I B;  3REJ C;  2CWE A;  2IO5 C;  3AN2 A;  3X1V A;  1P3B C;  3UT9 C;  1B67 A;  4J8U D;  2Y2G A;  5E5A D;  4WU9 A;  2PYO C;  3X1T D;  4H9P B;  1KX5 B;  3REI D;  5AV8 C;  3AZK D;  3KFU G;  3AZF A;  4R8P B;  4H9O B;  5B2J B;  5JRG C;  5CPJ C;  5JA4 A;  5B2I C;  4J8V B;  3KUY A;  5DNN B;  1ZLA D;  3UTA B;  5BS7 C;  4X23 A;  4LD9 A;  2G5H C;  2ZY2 A;  3AZI D;  4KHA B;  1M19 D;  5B32 G;  2FJ7 A;  4H9Q A;  3X1V C;  3AN2 C;  3NQU B;  3WTP D;  4UUZ A;  5B31 B;  2F8N K;  5GXQ B;  3AZL D;  2F8N H;  2BYK B;  3MNN D;  4CAY B;  4M6B A;  5CPI B;  1P3A D;  3O62 D;  4WU9 C;  5B33 D;  5GT3 A;  5B1M B;  4HGA C;  3AYW D;  4KUD B;  3AZF C;  2VQR A;  4J8W D;  3AZM A;  2ZM5 A;  3B6G A;  1P3I A;  1JFI B;  2DQN C;  3REJ D;  2IO5 B;  3AZE A;  3C1B D;  1P3B B;  3KUY C;  1P3O B;  4X23 C;  4LD9 C;  3UT9 D;  3W96 D;  2FJ7 C;  3KWQ B;  5AY8 A;  4Z66 D;  5B0Z B;  5AV8 B;  5FUG A;  3AZH D;  2PYO D;  1M1A A;  2JE5 A;  5GSU D;  2HUE C;  3AZJ A;  1H3O A;  5JRG B;  5CHL B;  5CPJ B;  5F99 A;  5GT3 C;  3P5J B;  5BT1 D;  2Y2H A;  3AZG B;  5CPJ D;  5B2I B;  4CSR A;  3EPJ A;  3AL0 C;  4H9R B;  3REH A;  5B2J A;  3AZM C;  3B6G C;  1P3I C;  1BH8 A;  3WAA A;  5CPK A;  5DNM A;  4G91 B;  3AZE C;  3AN2 B;  3X1V B;  1U35 A;  2YFW A;  1F1E A;  2NQB A;  4NFT A;  3UTA A;  5C3I C;  4QLC A;  4WU9 B;  3AV2 A;  3NQJ A;  5AY8 C;  4HGA B;  1KX4 D;  1M1A C;  5B31 A;  3AZJ C;  5GXQ A;  3AZF B;  3C1C D;  4Z5T A;  3LEL B;  3MVD D;  3X1U D;  3WA9 B;  3LZ0 D;  5F99 C;  5JA4 B;  5BO0 B;  3W98 A;  5B0Y B;  4AWL C;  3KUY B;  1P3P A;  3REH C;  2W8S A;  5B2J C;  5B24 A;  4LD9 B;  4DRA A;  3WAA C;  3B0C W;  5CPK C;  4X23 D;  5DNM C;  3VH6 W;  2NZD B;  2RVQ D;  4WNN A;  1U35 C;  2FJ7 D;  5AV6 A;  1P3O A;  2HUE B;  2RIQ A;  3REK D;  2NQB C;  5B40 D;  3UTA C;  5B1L D;  4QLC C;  4J8X D;  3AV2 C;  4WU8 D;  3B6F B;  5GT3 B;  1PZR A;  3KWQ A;  5B0Z A;  4E44 A;  5B31 C;  5GXQ C;  4Z5T C;  4YS3 D;  2HIO A;  3AZM B;  4DQY B;  3W99 D;  3B6G B;  5AVC B;  3KSY A;  3EPK A;  3AZE B;  3W98 C;  1P3I D;  3AZN A;  3AZG A;  1P3K A;  4Z2M G;  3LZ1 A;  1P3P C;  5B24 C;  2YFV B;  4H9R A;  3LJA D;  1TZY A;  5AY8 B;  3F6T A;  5FUG B;  3MGP C;  1M1A B;  5AV6 C;  3AZJ B;  1P3O C;  4YM6 A;  3TU4 B;  1F66 A;  1H3O B;  3MGR A;  1AOI A;  5F99 B;  3KWQ C;  1P34 A;  5B0Z C;  4AWL B;  4CSR B;  2HIO C;  3REH B;  1KX5 D;  3LEL A;  3WAA B;  1BH8 B;  3WA9 A;  5KDM A;  5CPK B;  4R8P D;  5B2J D;  5DNM B;  4H9N A;  1WWI A;  5BO0 A;  4ZUX A;  3AZN C;  1U35 B;  3AZG C;  1P3F B;  5B0Y A;  2YFW B;  1P3K C;  3LZ1 C;  1ID3 A;  4NE5 A;  2NQB B;  5AV9 A;  2F8N A;  4J8V D;  4QLC B;  5DNN D;  3AV2 B;  3UTA D;  1TZY C;  3NQJ B;  2Y2J A;  4G91 C;  2NZD A;  1ULY A;  3W97 A;  4Z5T B;  4YM6 C;  1F66 C;  3MGR C;  1AOI C;  5B31 D;  1A7W A;  5GXQ D;  5AV5 A;  2JSS A;  3UTB A;  5CP6 B;  1P34 C;  3B6F A;  3W98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...