1M19C

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19C00
3W97C 3AN2C 4H9QB 4J8UD 2CV5B 1P3AC 2AROA 1S32A 4CSRB 3TU4D 4R8PA 5AVBC 4WU8D 1AOID 1TZYA 3O62B 3B0DB 1P3BC 4H9RA 2PYOD 3REHC 4Z5TA 3AZMD 3REKB 3AYWC 2HIOC 5DNNC 4H9NA 4XZQA 3AZGB 3LJAD 2NZDC 5AV8C 5C3IC 5GXQC 3AZFA 4G92B 1EQZA 5CPIC 1ID3C 1P3IA 1F66C 1ZLAD 3C1BA 3W96C 5CHLB 4ZBJB 4J8VA 3WA9D 5B0YA 1N1JA 5CPKC 3AZLA 3REJA 3AV2A 5BT1D 4XUJB 3KWQA 4WU9D 3LELB 2YFVB 3B0BA 4X23C 4Z66C 4ZUXC 5AVCC 1B6WA 1BH9B 4J8WB 3AZNC 3WKJC 1M19A 5AV9D 4NE6A 1P3LB 5GSUB 3VH6T 1KX3B 3MGSB 1KX5D 5B1MB 4LD9D 3REIB 2NQBA 5BO0A 1P34C 2BYKA 4QLCD 5JRGD 5B33A 1BH8A 3AFAC 5CPJB 4YM6D 3AV1D 5B0ZD 5F99D 5B40B 5FUGB 3AZED 3MGQA 3LZ0C 5B24D 5B31C 2RVQC 4CSRA 3B6FC 3MGRB 3RELB 2AROC 3X1SD 3O62A 3MNNA 5GT0A 1TZYC 2BYMA 5AV5B 5B2JD 1TAFB 5KDMA 3C1CC 4J8XC 1P3FD 4Z5TC 4JJNC 1JFIA 4J8UB 3AZGA 1P3MA 3A6NA 3TU4B 3W97D 4WU8B 3AN2D 1AOIB 3WTPC 3X1UA 1M1AA 1P3AD 2F8NH 2PYOB 5B2IC 1EQZC 3AZHA 5AVBD 1F1EA 1U35C 5BNVB 1P3IC 1KX4C 4NE3A 1P3OA 3AZMB 1P3BD 3C1BC 3REHD 3UTAA 5AY8C 3LZ1C 5B0YC 3LJAB 2YFWB 3AZLC 3LELA 3AV2C 2YFVA 4KGCC 3AYWD 2HIOD 4DRAA 5DNND 3WTPE 3AZJA 4J8WA 2NZDD 1ZLAB 5AV8D 5GXQD 4HGAB 3VH5W 5CPID 3WA9B 1ID3D 1F66D 1M19C 2F8ND 1KX3A 3W96D 4WU9B 1P3KC 1HQ3A 4H9OB 5CPKD 3WAAC 5CPJA 3VH6W 5AV9B 5CP6A 1M18C 4X23D 4ZUXD 5AVCD 3AZND 3WKJD 5AV6C 3KXBA 1KX5B 4LD9B 5B1LD 4G91C 3KUYA 4QLCB 3MGQC 3X1TA 5JRGB 1B67A 4NE5A 4YM6B 1P34D 5AV5A 3UT9A 1ULYA 3AFAD 3AV1B 2FJ7B 5F99B 1TAFA 3MGPA 3MNNC 5GT0C 3AZEB 5B24B 4J8UA 2IO5C 3TU4A 3LZ0D 1AOIA 5B31D 3AZGC 1P3MC 2RVQD 3A6NC 3W99C 3B6FD 5GT3A 3X1UC 5B32C 1M1AC 2AROD 5B2JB 1P3GA 1P3FB 3AZHC 1TZYD 3R45B 1P3OC 2YFWA 3C1CD 3UTAC 4YS3C 4J8XD 3AN2B 4Z5TD 3W97B 4JJND 1P3AB 3KSYA 2HUEC 3LELC 1ZLAA 4KUDD 3VH5T 5E5AC 3X1VA 5AVBB 3AZJC 3WTPD 3WA9A 1P3BB 3REHB 5B2ID 1U35D 1P3ID 1KX4D 1P3PA 4H9OA 1KX3C 3C1BD 3AYWB 4CAYA 2HIOB 5DNNB 5AY8D 4EO5C 3LZ1D 5B0YD 3AZIC 3B6GC 2NZDB 1HQ3C 5AV8B 5GXQB 5C3IB 3AZLD 4UUZA 3AV2D 4KGCD 3UTBA 5CPIB 5BS7A 1ID3B 1F66B 2F8NB 5CP6C 5G49A 3V9RB 3W96B 3W98A 1KX5A 1A7WA 5DNMD 3KXBC 2F8NG 4E44A 1M19D 5CPKB 3AZKC 1WWIA 1P3KD 3NQJB 3KUYC 3X1TC 4X23B 4H9QA 3MVDC 3WAAD 4H9PB 5AVCB 4ZUXB 3AZNB 2CV5A 3AV1A 2FJ7A 1M18D 3AZEA 3UT9C 1S32C 5B1LB 3MGPC 5AV6D 4R8PC 5JA4B 3REKA 1P34B 3MGQD 1KU5A 3AFAB 5B2JA 5GT3C 4XZQC 1P3GC 3AZFC 3R45A 3MNND 4E45A 3W97A 5GT0D 3LZ0B 3AN2A 5B31B 3NQUB 4J8VC 3B6FB 4XUJA 5AVBA 2AROB 5B31G 3REJC 1P3MD 3A6ND 3W99D 4HGAC 1P3BA 3X1VC 3KWQC 1TZYB 1BH9A 5B32D 3X1UD 1M1AD 3C1CB 4J8XB 3AZHD 4M6BA 4Z5TB 4JJNB 4AWLC 1P3LA 5DNNA 1P3PC 1P3OD 5GSUA 5BNXB 4KUDB 5GXQA 3MGSA 3UTAD 4YS3D 5B1MA 3WTPB 5CPIA 3REIA 2F8NA 3B0CW 5B2IB 3UTBC 5E5AD 5BS7C 1U35B 1P3IB 3AZJD 1KX4B 1HTAA 2NQBC 3C1BB 5B33C 3W98C 2JSSA 4Z66D 5AY8B 3LZ1B 5B0YB 1N1JB 5B40A 3NQJA 3AV2B 1KX3D 5FUGA 4KGCB 3B6GD 4ZUXA 3AZID 3AZNA 1HQ3D 4NFTA 3MGRA 4WNNB 3RELA 5DNMB 2CV5C 5B1LA 2FJ7C 1M19B 5CP6D 3AZEC 5JA4A 3O62C 5B0ZB 1P3KB 3B0DC 3KXBD 1R4VA 4Z2MG 1P34A 3WAAB 3AZKD 5BO0B 3REKC 3KUYD 3X1TD 2BYKB 1M18B 4WU8A 1BH8B 3X1SB 3MVDD 5AV6B 4G92C 3VH5A 2PYOA 5BNVA 3UT9D 3LZ0A 1S32D 5B31A 3MGPD 3AZMA 4R8PD 4G91B 3MGQB 4ZBJC 3B6FA 3LJAA 2CWEA 4XUJC 3VH6A 3MNNB 5GT0B 5GT3D 3C1CA 4J8XA 2BYMB 4XZQD 4J8WC 4JJNA 1P3GD 2IO5B 3AZFD 5KDMB 5BNXA 4Z2MH 1EQZD 4KUDA 1P3LC 1JFIB 4WU9A 3WTPA 5GSUC 1P3MB 3A6NB 3W99B 3MGSC 3B0CT 5B2IA 4J8VD 5B1MC 3X1UB 5B32B 3REIC 1U35A 1M1AB 1KX4A 3REJD 5AV9A 3AZHB 3X1VD 3KWQD 5AY8A 5B32G 3LZ1A 5CPJC 4KHAB 1P3OB 3UTAB 4YS3B 4KGCA 1BFMA 4LD9A 1P3PD 5B40C 2HUEB 4QLCA 5E5AB 5JRGA 4WNNA 3AZJB 5DNMA 4YM6A 3MGRC 3RELC 4Z66B 3UTBD 3WKJB 5B1LC 2NQBD 5B0ZA 1P3KA 5F99A 5B33D 3W98D 5AV5C 5B24A 1H3OB 4EO5B 3B6GB 3WAAA 3AZIB 1HQ3B 1WWSA 4H9SA 1M18A 4J8UC 3X1SA 5AV6A 3TU4C 5CP6B 4WU8C 1AOIC 2L5AA 2CV5D 3KXBB 2FJ7D 2PYOC 1P3FA 3AZKB 3O62D 3AZMC 3KUYB 3X1TB 2F8NK 3MVDB 3LJAC 1P3AA 3REKD 3UT9B 1S32B 3AZGD 1ZLAC 3MGPB 4R8PB 3REHA 3WA9C 4H9RB 3W99A 4KUDC 3AYWA 5BT1C 2HIOA 4WU9C 5B32A 2NZDA 5AV8A 5GT3B 4H9NB 4XUJD 4XZQB 1P3GB 1ID3A 1F66A 3AZFB 5AV9C 4KHAA 3LELD 1EQZB 3V9RA 3W96A 4YS3A 4J8WD 2LY8A 5CPKA 1KX5C 4J8VB 5E5AA 1P3LD 4LD9C 4WV4B 5GSUD 3REJB 3AZLB 4QLCC 3MGSD 5JRGC 3X1VB 4X23A 3KWQB 5B1MD 4Z66A 4H9PA 5DNMC 5AVCA 4WZSB 3REID 3WKJA 4YM6C 4AWLB 3AV1C 1H3OA 5CPJD 5B0ZC 1P3PB 5F99C 3AZIA 3B6GA 4CAYB 5B24C 5B40D 4H9SC 4UUZB 3UTBB 3X1SC 3AFAA 2NQBB 5G49B 5B33B 3W98B 3MGRD 4DRBA 3RELD 5B2JC 1Q9CA 3AZKA 1P3FC 5AV5D 3MVDA 3NQUA
chains in the Genus database with same CATH superfamily
3W97C 3AN2C 4H9QB 3EPJA 4J8UD 2CV5B 1P3AC 2AROA 1S32A 4CSRB 3TU4D 4R8PA 5AVBC 4WU8D 1AOID 1TZYA 3O62B 3B0DB 1P3BC 4H9RA 2PYOD 3REHC 2Y2HA 3H0MC 4Z5TA 3AZMD 3REKB 3AYWC 2HIOC 5DNNC 4H9NA 4XZQA 3AZGB 3LJAD 2NZDC 5AV8C 5C3IC 5GXQC 3AZFA 4G92B 1EQZA 5CPIC 1ID3C 1P3IA 1F66C 1ZLAD 3C1BA 3W96C 5CHLB 4ZBJB 4J8VA 3WA9D 5B0YA 1N1JA 5CPKC 3AZLA 3REJA 3AV2A 5BT1D 4XUJB 3KWQA 4WU9D 3P5JB 3LELB 2YFVB 3B0BA 4X23C 4Z66C 4ZUXC 5AVCC 1B6WA 1BH9B 4J8WB 3AZNC 3WKJC 1M19A 5AV9D 4NE6A 3H0RC 1P3LB 2Y2KA 5GSUB 3VH6T 1KX3B 3MGSB 1KX5D 5B1MB 2XD5A 4LD9D 3REIB 2NQBA 2VQRA 5BO0A 1P34C 2BYKA 4QLCD 5JRGD 5B33A 1BH8A 3AFAC 1PZRA 5CPJB 4YM6D 3AV1D 5B0ZD 5F99D 5B40B 2RIQA 5FUGB 3AZED 3MGQA 3LZ0C 5B24D 5B31C 2RVQC 4CSRA 3B6FC 3MGRB 3RELB 2AROC 3X1SD 3O62A 3MNNA 5GT0A 3H0LC 1TZYC 2BYMA 2ZY2A 5AV5B 5B2JD 1TAFB 3FDDA 5KDMA 3C1CC 4J8XC 1P3FD 4Z5TC 4JJNC 1T3UA 1W2EA 4J8UB 1JFIA 2W8SA 3AZGA 1P3MA 3A6NA 3TU4B 3W97D 4WU8B 3AN2D 1AOIB 3WTPC 3X1UA 1M1AA 1P3AD 2F8NH 2PYOB 5B2IC 1EQZC 3AZHA 5AVBD 1F1EA 1U35C 5BNVB 1P3IC 1KX4C 4NE3A 1P3OA 3AZMB 1P3BD 3C1BC 3REHD 3UTAA 5AY8C 3LZ1C 5B0YC 3LJAB 2YFWB 3AZLC 3LELA 3AV2C 2Y2NA 2YFVA 3AYWD 4KGCC 2HIOD 4DRAA 5DNND 3WTPE 3AZJA 2Y2MA 4J8WA 2NZDD 1ZLAB 5AV8D 5GXQD 4HGAB 3VH5W 5CPID 3WA9B 1ID3D 1F66D 1M19C 2F8ND 3AL0C 1KX3A 3W96D 4WU9B 1P3KC 1HQ3A 4H9OB 5CPKD 2DQNC 3WAAC 5CPJA 3VH6W 5AV9B 5CP6A 1M18C 4X23D 4ZUXD 5AVCD 2G5HC 3AZND 3WKJD 5AV6C 3KXBA 1KX5B 4LD9B 5B1LD 2JE5A 4G91C 3KUYA 4QLCB 3MGQC 3X1TA 5JRGB 1B67A 4NE5A 4YM6B 1P34D 5AV5A 3UT9A 1ULYA 3AFAD 3AV1B 2FJ7B 5F99B 1TAFA 3MGPA 3MNNC 5GT0C 2UWXA 3AZEB 5B24B 4J8UA 2IO5C 2JCHA 3TU4A 3LZ0D 1AOIA 5B31D 3AZGC 1P3MC 2RVQD 3A6NC 3W99C 3B6FD 5GT3A 3X1UC 5B32C 1M1AC 2AROD 5B2JB 1P3GA 1P3FB 3AZHC 2Y2LA 1TZYD 3R45B 1P3OC 2YFWA 3C1CD 3UTAC 4YS3C 4J8XD 3AN2B 4Z5TD 2FFFB 4JJND 3W97B 2BG1A 1P3AB 3KSYA 2HUEC 2F2AC 3LELC 1ZLAA 4KUDD 3VH5T 5E5AC 3X1VA 5AVBB 3AZJC 3WTPD 3WA9A 1P3BB 3REHB 5B2ID 1U35D 1P3ID 1KX4D 1P3PA 4H9OA 1KX3C 3C1BD 3AYWB 4CAYA 2HIOB 5DNNB 5AY8D 4EO5C 3LZ1D 5B0YD 3EPKA 3AZIC 3B6GC 1HQ3C 2NZDB 5AV8B 5GXQB 5C3IB 3AZLD 4UUZA 3AV2D 4KGCD 3UTBA 5CPIB 5BS7A 1ID3B 1F66B 2F8NB 2DF4C 5CP6C 2Y2JA 5G49A 3V9RB 3W96B 3W98A 1KX5A 1A7WA 5DNMD 3KXBC 2F8NG 4E44A 1M19D 5CPKB 3AZKC 1WWIA 1P3KD 3NQJB 3KUYC 3X1TC 4X23B 4H9QA 3MVDC 3WAAD 4H9PB 5AVCB 4ZUXB 3AZNB 2CV5A 3EG5B 3AV1A 2FJ7A 1M18D 3AZEA 3UT9C 1S32C 5B1LB 2Y2GA 3MGPC 5AV6D 4UPKA 4R8PC 5JA4B 2Y2QA 2Y2IA 3REKA 1P34B 3MGQD 1KU5A 3AFAB 5B2JA 5GT3C 2J8PA 4XZQC 1P3GC 3AZFC 3R45A 3MNND 4E45A 3W97A 5GT0D 3LZ0B 3AN2A 5B31B 3NQUB 4J8VC 3B6FB 4XUJA 5AVBA 2AROB 5B31G 3REJC 1P3MD 3A6ND 3W99D 4HGAC 1P3BA 3X1VC 3KWQC 3EPHA 1TZYB 1BH9A 5B32D 3X1UD 1M1AD 3C1CB 4J8XB 3AZHD 4M6BA 4Z5TB 4JJNB 4AWLC 1P3LA 5DNNA 1P3PC 1P3OD 5GSUA 5BNXB 4KUDB 5GXQA 3MGSA 3UTAD 4YS3D 5B1MA 3A1IA 3WTPB 5CPIA 3REIA 2F8NA 3B0CW 5B2IB 3UTBC 2ZY3A 5E5AD 5BS7C 1U35B 1P3IB 3AZJD 1KX4B 1HTAA 3KFUG 2NQBC 3C1BB 5B33C 2ZM5A 3W98C 2JSSA 4Z66D 5AY8B 3LZ1B 5B0YB 1N1JB 5B40A 3NQJA 3AV2B 1KX3D 5FUGA 4KGCB 3B6GD 4ZUXA 3AZID 3AZNA 1HQ3D 4NFTA 3MGRA 4WNNB 3RELA 5DNMB 2CV5C 5B1LA 2FJ7C 1M19B 4WJ3C 5CP6D 3AZEC 5JA4A 3O62C 5B0ZB 1P3KB 3B0DC 3KXBD 1R4VA 2XD1A 4Z2MG 1P34A 3WAAB 3AZKD 5BO0B 3REKC 3KUYD 3X1TD 2BYKB 1M18B 4WU8A 1BH8B 3X1SB 3MVDD 5AV6B 4G92C 3VH5A 2PYOA 5BNVA 3A1KA 3LZ0A 3UT9D 1S32D 5B31A 3EPLA 3MGPD 3AZMA 4R8PD 4G91B 3MGQB 4ZBJC 3B6FA 3LJAA 2CWEA 4XUJC 3VH6A 3MNNB 5GT0B 5GT3D 3C1CA 4J8XA 2BYMB 4XZQD 2ZY4A 4J8WC 4JJNA 4DQYB 1P3GD 2IO5B 3AZFD 5KDMB 5BNXA 4Z2MH 1EQZD 4KUDA 1P3LC 1JFIB 4WU9A 3WTPA 5GSUC 1P3MB 3A6NB 3W99B 3MGSC 3B0CT 5B2IA 4J8VD 5B1MC 3X1UB 5B32B 3REIC 1U35A 1M1AB 1KX4A 3REJD 5AV9A 3AZHB 3X1VD 3KWQD 5AY8A 5B32G 3LZ1A 5CPJC 4KHAB 1P3OB 3UTAB 4YS3B 4KGCA 1BFMA 4LD9A 1P3PD 5B40C 2HUEB 4QLCA 5E5AB 5JRGA 4WNNA 3AZJB 5DNMA 4YM6A 3MGRC 3RELC 4Z66B 3UTBD 3WKJB 5B1LC 2NQBD 5B0ZA 1P3KA 5F99A 5B33D 3W98D 5AV5C 5B24A 1H3OB 4EO5B 3B6GB 3WAAA 3AZIB 3IP4C 1HQ3B 1WWSA 4H9SA 2Y2OA 1M18A 4J8UC 3X1SA 5AV6A 3TU4C 5CP6B 4WU8C 1AOIC 2L5AA 2CV5D 3KXBB 2FJ7D 2PYOC 2G5IC 1P3FA 3AZKB 3O62D 3AZMC 3KUYB 3X1TB 2F8NK 3MVDB 3LJAC 1P3AA 3REKD 3UT9B 1S32B 3AZGD 1ZLAC 3MGPB 4R8PB 3REHA 3WA9C 4H9RB 3W99A 4KUDC 3AYWA 5BT1C 2HIOA 4WU9C 5B32A 2NZDA 5AV8A 5GT3B 4H9NB 4XUJD 4XZQB 1P3GB 1ID3A 1F66A 3AZFB 5AV9C 4KHAA 3F6TA 3LELD 1EQZB 3V9RA 3W96A 4YS3A 4J8WD 2LY8A 5CPKA 2ZY5A 4J8VB 1KX5C 5E5AA 1P3LD 4LD9C 4WV4B 5GSUD 3REJB 3AZLB 4QLCC 3MGSD 5JRGC 3X1VB 4X23A 3KWQB 5B1MD 4Z66A 4H9PA 5AVCA 5DNMC 4WZSB 3REID 3WKJA 1Z2CB 4YM6C 4AWLB 3AV1C 1H3OA 5CPJD 5B0ZC 1P3PB 5F99C 3AZIA 3B6GA 4CAYB 5B24C 2Y2PA 5B40D 4H9SC 4UUZB 3UTBB 3X1SC 3AFAA 2NQBB 5G49B 5B33B 3W98B 3MGRD 4DRBA 3RELD 5B2JC 1Q9CA 3AZKA 1P3FC 5AV5D 3MVDA 3NQUA
chains in the Genus database with same CATH topology
3W97C 3AN2C 4H9QB 3EPJA 4J8UD 2CV5B 1P3AC 2AROA 1S32A 4CSRB 3TU4D 4R8PA 5AVBC 4WU8D 1AOID 1TZYA 3O62B 3B0DB 1P3BC 4H9RA 2PYOD 3REHC 2Y2HA 3H0MC 4Z5TA 3AZMD 3REKB 3AYWC 2HIOC 5DNNC 4H9NA 4XZQA 3AZGB 3LJAD 2NZDC 5AV8C 5C3IC 5GXQC 3AZFA 4G92B 1EQZA 5CPIC 1ID3C 1P3IA 1F66C 1ZLAD 3C1BA 3W96C 5CHLB 4ZBJB 4J8VA 3WA9D 5B0YA 1N1JA 5CPKC 3AZLA 3REJA 3AV2A 5BT1D 4XUJB 3KWQA 4WU9D 3P5JB 3LELB 2YFVB 3B0BA 4X23C 4Z66C 4ZUXC 5AVCC 1B6WA 1BH9B 4J8WB 3AZNC 3WKJC 1M19A 5AV9D 4NE6A 3H0RC 1P3LB 2Y2KA 5GSUB 3VH6T 1KX3B 3MGSB 1KX5D 5B1MB 2XD5A 4LD9D 3REIB 2NQBA 2VQRA 5BO0A 1P34C 2BYKA 4QLCD 5JRGD 5B33A 1BH8A 3AFAC 1PZRA 5CPJB 4YM6D 3AV1D 5B0ZD 5F99D 5B40B 2RIQA 5FUGB 3AZED 3MGQA 3LZ0C 5B24D 5B31C 2RVQC 4CSRA 3B6FC 3MGRB 3RELB 2AROC 3X1SD 3O62A 3MNNA 5GT0A 3H0LC 1TZYC 2BYMA 2ZY2A 5AV5B 5B2JD 1TAFB 3FDDA 5KDMA 3C1CC 4J8XC 1P3FD 4Z5TC 4JJNC 1T3UA 1W2EA 4J8UB 1JFIA 2W8SA 3AZGA 1P3MA 3A6NA 3TU4B 3W97D 4WU8B 3AN2D 1AOIB 3WTPC 3X1UA 1M1AA 1P3AD 2F8NH 2PYOB 5B2IC 1EQZC 3AZHA 5AVBD 1F1EA 1U35C 5BNVB 1P3IC 1KX4C 4NE3A 1P3OA 3AZMB 1P3BD 3C1BC 3REHD 3UTAA 5AY8C 3LZ1C 5B0YC 3LJAB 2YFWB 3AZLC 3LELA 3AV2C 2Y2NA 2YFVA 3AYWD 4KGCC 2HIOD 4DRAA 5DNND 3WTPE 3AZJA 2Y2MA 4J8WA 2NZDD 1ZLAB 5AV8D 5GXQD 4HGAB 3VH5W 5CPID 3WA9B 1ID3D 1F66D 1M19C 2F8ND 3AL0C 1KX3A 3W96D 4WU9B 1P3KC 1HQ3A 4H9OB 5CPKD 2DQNC 3WAAC 5CPJA 3VH6W 5AV9B 5CP6A 1M18C 4X23D 4ZUXD 5AVCD 2G5HC 3AZND 3WKJD 5AV6C 3KXBA 1KX5B 4LD9B 5B1LD 2JE5A 4G91C 3KUYA 4QLCB 3MGQC 3X1TA 5JRGB 1B67A 4NE5A 4YM6B 1P34D 5AV5A 3UT9A 1ULYA 3AFAD 3AV1B 2FJ7B 5F99B 1TAFA 3MGPA 3MNNC 5GT0C 2UWXA 3AZEB 5B24B 4J8UA 2IO5C 2JCHA 3TU4A 3LZ0D 1AOIA 5B31D 3AZGC 1P3MC 2RVQD 3A6NC 3W99C 3B6FD 5GT3A 3X1UC 5B32C 1M1AC 2AROD 5B2JB 1P3GA 1P3FB 3AZHC 2Y2LA 1TZYD 3R45B 1P3OC 2YFWA 3C1CD 3UTAC 4YS3C 4J8XD 3AN2B 4Z5TD 2FFFB 4JJND 3W97B 2BG1A 1P3AB 3KSYA 2HUEC 2F2AC 3LELC 1ZLAA 4KUDD 3VH5T 5E5AC 3X1VA 5AVBB 3AZJC 3WTPD 3WA9A 1P3BB 3REHB 5B2ID 1U35D 1P3ID 1KX4D 1P3PA 4H9OA 1KX3C 3C1BD 3AYWB 4CAYA 2HIOB 5DNNB 5AY8D 4EO5C 3LZ1D 5B0YD 3EPKA 3AZIC 3B6GC 1HQ3C 2NZDB 5AV8B 5GXQB 5C3IB 3AZLD 4UUZA 3AV2D 4KGCD 3UTBA 5CPIB 5BS7A 1ID3B 1F66B 2F8NB 2DF4C 5CP6C 2Y2JA 5G49A 3V9RB 3W96B 3W98A 1KX5A 1A7WA 5DNMD 3KXBC 2F8NG 4E44A 1M19D 5CPKB 3AZKC 1WWIA 1P3KD 3NQJB 3KUYC 3X1TC 4X23B 4H9QA 3MVDC 3WAAD 4H9PB 5AVCB 4ZUXB 3AZNB 2CV5A 3EG5B 3AV1A 2FJ7A 1M18D 3AZEA 3UT9C 1S32C 5B1LB 2Y2GA 3MGPC 5AV6D 4UPKA 4R8PC 5JA4B 2Y2QA 2Y2IA 3REKA 1P34B 3MGQD 1KU5A 3AFAB 5B2JA 5GT3C 2J8PA 4XZQC 1P3GC 3AZFC 3R45A 3MNND 4E45A 3W97A 5GT0D 3LZ0B 3AN2A 5B31B 3NQUB 4J8VC 3B6FB 4XUJA 5AVBA 2AROB 5B31G 3REJC 1P3MD 3A6ND 3W99D 4HGAC 1P3BA 3X1VC 3KWQC 3EPHA 1TZYB 1BH9A 5B32D 3X1UD 1M1AD 3C1CB 4J8XB 3AZHD 4M6BA 4Z5TB 4JJNB 4AWLC 1P3LA 5DNNA 1P3PC 1P3OD 5GSUA 5BNXB 4KUDB 5GXQA 3MGSA 3UTAD 4YS3D 5B1MA 3A1IA 3WTPB 5CPIA 3REIA 2F8NA 3B0CW 5B2IB 3UTBC 2ZY3A 5E5AD 5BS7C 1U35B 1P3IB 3AZJD 1KX4B 1HTAA 3KFUG 2NQBC 3C1BB 5B33C 2ZM5A 3W98C 2JSSA 4Z66D 5AY8B 3LZ1B 5B0YB 1N1JB 5B40A 3NQJA 3AV2B 1KX3D 5FUGA 4KGCB 3B6GD 4ZUXA 3AZID 3AZNA 1HQ3D 4NFTA 3MGRA 4WNNB 3RELA 5DNMB 2CV5C 5B1LA 2FJ7C 1M19B 4WJ3C 5CP6D 3AZEC 5JA4A 3O62C 5B0ZB 1P3KB 3B0DC 3KXBD 1R4VA 2XD1A 4Z2MG 1P34A 3WAAB 3AZKD 5BO0B 3REKC 3KUYD 3X1TD 2BYKB 1M18B 4WU8A 1BH8B 3X1SB 3MVDD 5AV6B 4G92C 3VH5A 2PYOA 5BNVA 3A1KA 3LZ0A 3UT9D 1S32D 5B31A 3EPLA 3MGPD 3AZMA 4R8PD 4G91B 3MGQB 4ZBJC 3B6FA 3LJAA 2CWEA 4XUJC 3VH6A 3MNNB 5GT0B 5GT3D 3C1CA 4J8XA 2BYMB 4XZQD 2ZY4A 4J8WC 4JJNA 4DQYB 1P3GD 2IO5B 3AZFD 5KDMB 5BNXA 4Z2MH 1EQZD 4KUDA 1P3LC 1JFIB 4WU9A 3WTPA 5GSUC 1P3MB 3A6NB 3W99B 3MGSC 3B0CT 5B2IA 4J8VD 5B1MC 3X1UB 5B32B 3REIC 1U35A 1M1AB 1KX4A 3REJD 5AV9A 3AZHB 3X1VD 3KWQD 5AY8A 5B32G 3LZ1A 5CPJC 4KHAB 1P3OB 3UTAB 4YS3B 4KGCA 1BFMA 4LD9A 1P3PD 5B40C 2HUEB 4QLCA 5E5AB 5JRGA 4WNNA 3AZJB 5DNMA 4YM6A 3MGRC 3RELC 4Z66B 3UTBD 3WKJB 5B1LC 2NQBD 5B0ZA 1P3KA 5F99A 5B33D 3W98D 5AV5C 5B24A 1H3OB 4EO5B 3B6GB 3WAAA 3AZIB 3IP4C 1HQ3B 1WWSA 4H9SA 2Y2OA 1M18A 4J8UC 3X1SA 5AV6A 3TU4C 5CP6B 4WU8C 1AOIC 2L5AA 2CV5D 3KXBB 2FJ7D 2PYOC 2G5IC 1P3FA 3AZKB 3O62D 3AZMC 3KUYB 3X1TB 2F8NK 3MVDB 3LJAC 1P3AA 3REKD 3UT9B 1S32B 3AZGD 1ZLAC 3MGPB 4R8PB 3REHA 3WA9C 4H9RB 3W99A 4KUDC 3AYWA 5BT1C 2HIOA 4WU9C 5B32A 2NZDA 5AV8A 5GT3B 4H9NB 4XUJD 4XZQB 1P3GB 1ID3A 1F66A 3AZFB 5AV9C 4KHAA 3F6TA 3LELD 1EQZB 3V9RA 3W96A 4YS3A 4J8WD 2LY8A 5CPKA 2ZY5A 4J8VB 1KX5C 5E5AA 1P3LD 4LD9C 4WV4B 5GSUD 3REJB 3AZLB 4QLCC 3MGSD 5JRGC 3X1VB 4X23A 3KWQB 5B1MD 4Z66A 4H9PA 5AVCA 5DNMC 4WZSB 3REID 3WKJA 1Z2CB 4YM6C 4AWLB 3AV1C 1H3OA 5CPJD 5B0ZC 1P3PB 5F99C 3AZIA 3B6GA 4CAYB 5B24C 2Y2PA 5B40D 4H9SC 4UUZB 3UTBB 3X1SC 3AFAA 2NQBB 5G49B 5B33B 3W98B 3MGRD 4DRBA 3RELD 5B2JC 1Q9CA 3AZKA 1P3FC 5AV5D 3MVDA 3NQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W97 C;  3AN2 C;  4H9Q B;  4J8U D;  2CV5 B;  1P3A C;  2ARO A;  1S32 A;  4CSR B;  3TU4 D;  4R8P A;  5AVB C;  4WU8 D;  1AOI D;  1TZY A;  3O62 B;  3B0D B;  1P3B C;  4H9R A;  2PYO D;  3REH C;  4Z5T A;  3AZM D;  3REK B;  3AYW C;  2HIO C;  5DNN C;  4H9N A;  4XZQ A;  3AZG B;  3LJA D;  2NZD C;  5AV8 C;  5C3I C;  5GXQ C;  3AZF A;  4G92 B;  1EQZ A;  5CPI C;  1ID3 C;  1P3I A;  1F66 C;  1ZLA D;  3C1B A;  3W96 C;  5CHL B;  4ZBJ B;  4J8V A;  3WA9 D;  5B0Y A;  1N1J A;  5CPK C;  3AZL A;  3REJ A;  3AV2 A;  5BT1 D;  4XUJ B;  3KWQ A;  4WU9 D;  3LEL B;  2YFV B;  3B0B A;  4X23 C;  4Z66 C;  4ZUX C;  5AVC C;  1B6W A;  1BH9 B;  4J8W B;  3AZN C;  3WKJ C;  1M19 A;  5AV9 D;  4NE6 A;  1P3L B;  5GSU B;  3VH6 T;  1KX3 B;  3MGS B;  1KX5 D;  5B1M B;  4LD9 D;  3REI B;  2NQB A;  5BO0 A;  1P34 C;  2BYK A;  4QLC D;  5JRG D;  5B33 A;  1BH8 A;  3AFA C;  5CPJ B;  4YM6 D;  3AV1 D;  5B0Z D;  5F99 D;  5B40 B;  5FUG B;  3AZE D;  3MGQ A;  3LZ0 C;  5B24 D;  5B31 C;  2RVQ C;  4CSR A;  3B6F C;  3MGR B;  3REL B;  2ARO C;  3X1S D;  3O62 A;  3MNN A;  5GT0 A;  1TZY C;  2BYM A;  5AV5 B;  5B2J D;  1TAF B;  5KDM A;  3C1C C;  4J8X C;  1P3F D;  4Z5T C;  4JJN C;  1JFI A;  4J8U B;  3AZG A;  1P3M A;  3A6N A;  3TU4 B;  3W97 D;  4WU8 B;  3AN2 D;  1AOI B;  3WTP C;  3X1U A;  1M1A A;  1P3A D;  2F8N H;  2PYO B;  5B2I C;  1EQZ C;  3AZH A;  5AVB D;  1F1E A;  1U35 C;  5BNV B;  1P3I C;  1KX4 C;  4NE3 A;  1P3O A;  3AZM B;  1P3B D;  3C1B C;  3REH D;  3UTA A;  5AY8 C;  3LZ1 C;  5B0Y C;  3LJA B;  2YFW B;  3AZL C;  3LEL A;  3AV2 C;  2YFV A;  4KGC C;  3AYW D;  2HIO D;  4DRA A;  5DNN D;  3WTP E;  3AZJ A;  4J8W A;  2NZD D;  1ZLA B;  5AV8 D;  5GXQ D;  4HGA B;  3VH5 W;  5CPI D;  3WA9 B;  1ID3 D;  1F66 D;  1M19 C;  2F8N D;  1KX3 A;  3W96 D;  4WU9 B;  1P3K C;  1HQ3 A;  4H9O B;  5CPK D;  3WAA C;  5CPJ A;  3VH6 W;  5AV9 B;  5CP6 A;  1M18 C;  4X23 D;  4ZUX D;  5AVC D;  3AZN D;  3WKJ D;  5AV6 C;  3KXB A;  1KX5 B;  4LD9 B;  5B1L D;  4G91 C;  3KUY A;  4QLC B;  3MGQ C;  3X1T A;  5JRG B;  1B67 A;  4NE5 A;  4YM6 B;  1P34 D;  5AV5 A;  3UT9 A;  1ULY A;  3AFA D;  3AV1 B;  2FJ7 B;  5F99 B;  1TAF A;  3MGP A;  3MNN C;  5GT0 C;  3AZE B;  5B24 B;  4J8U A;  2IO5 C;  3TU4 A;  3LZ0 D;  1AOI A;  5B31 D;  3AZG C;  1P3M C;  2RVQ D;  3A6N C;  3W99 C;  3B6F D;  5GT3 A;  3X1U C;  5B32 C;  1M1A C;  2ARO D;  5B2J B;  1P3G A;  1P3F B;  3AZH C;  1TZY D;  3R45 B;  1P3O C;  2YFW A;  3C1C D;  3UTA C;  4YS3 C;  4J8X D;  3AN2 B;  4Z5T D;  3W97 B;  4JJN D;  1P3A B;  3KSY A;  2HUE C;  3LEL C;  1ZLA A;  4KUD D;  3VH5 T;  5E5A C;  3X1V A;  5AVB B;  3AZJ C;  3WTP D;  3WA9 A;  1P3B B;  3REH B;  5B2I D;  1U35 D;  1P3I D;  1KX4 D;  1P3P A;  4H9O A;  1KX3 C;  3C1B D;  3AYW B;  4CAY A;  2HIO B;  5DNN B;  5AY8 D;  4EO5 C;  3LZ1 D;  5B0Y D;  3AZI C;  3B6G C;  2NZD B;  1HQ3 C;  5AV8 B;  5GXQ B;  5C3I B;  3AZL D;  4UUZ A;  3AV2 D;  4KGC D;  3UTB A;  5CPI B;  5BS7 A;  1ID3 B;  1F66 B;  2F8N B;  5CP6 C;  5G49 A;  3V9R B;  3W96 B;  3W98 A;  1KX5 A;  1A7W A;  5DNM D;  3KXB C;  2F8N G;  4E44 A;  1M19 D;  5CPK B;  3AZK C;  1WWI A;  1P3K D;  3NQJ B;  3KUY C;  3X1T C;  4X23 B;  4H9Q A;  3MVD C;  3WAA D;  4H9P B;  5AVC B;  4ZUX B;  3AZN B;  2CV5 A;  3AV1 A;  2FJ7 A;  1M18 D;  3AZE A;  3UT9 C;  1S32 C;  5B1L B;  3MGP C;  5AV6 D;  4R8P C;  5JA4 B;  3REK A;  1P34 B;  3MGQ D;  1KU5 A;  3AFA B;  5B2J A;  5GT3 C;  4XZQ C;  1P3G C;  3AZF C;  3R45 A;  3MNN D;  4E45 A;  3W97 A;  5GT0 D;  3LZ0 B;  3AN2 A;  5B31 B;  3NQU B;  4J8V C;  3B6F B;  4XUJ A;  5AVB A;  2ARO B;  5B31 G;  3REJ C;  1P3M D;  3A6N D;  3W99 D;  4HGA C;  1P3B A;  3X1V C;  3KWQ C;  1TZY B;  1BH9 A;  5B32 D;  3X1U D;  1M1A D;  3C1C B;  4J8X B;  3AZH D;  4M6B A;  4Z5T B;  4JJN B;  4AWL C;  1P3L A;  5DNN A;  1P3P C;  1P3O D;  5GSU A;  5BNX B;  4KUD B;  5GXQ A;  3MGS A;  3UTA D;  4YS3 D;  5B1M A;  3WTP B;  5CPI A;  3REI A;  2F8N A;  3B0C W;  5B2I B;  3UTB C;  5E5A D;  5BS7 C;  1U35 B;  1P3I B;  3AZJ D;  1KX4 B;  1HTA A;  2NQB C;  3C1B B;  5B33 C;  3W98 C;  2JSS A;  4Z66 D;  5AY8 B;  3LZ1 B;  5B0Y B;  1N1J B;  5B40 A;  3NQJ A;  3AV2 B;  1KX3 D;  5FUG A;  4KGC B;  3B6G D;  4ZUX A;  3AZI D;  3AZN A;  1HQ3 D;  4NFT A;  3MGR A;  4WNN B;  3REL A;  5DNM B;  2CV5 C;  5B1L A;  2FJ7 C;  1M19 B;  5CP6 D;  3AZE C;  5JA4 A;  3O62 C;  5B0Z B;  1P3K B;  3B0D C;  3KXB D;  1R4V A;  4Z2M G;  1P34 A;  3WAA B;  3AZK D;  5BO0 B;  3REK C;  3KUY D;  3X1T D;  2BYK B;  1M18 B;  4WU8 A;  1BH8 B;  3X1S B;  3MVD D;  5AV6 B;  4G92 C;  3VH5 A;  2PYO A;  5BNV A;  3UT9 D;  3LZ0 A;  1S32 D;  5B31 A;  3MGP D;  3AZM A;  4R8P D;  4G91 B;  3MGQ B;  4ZBJ C;  3B6F A;  3LJA A;  2CWE A;  4XUJ C;  3VH6 A;  3MNN B;  5GT0 B;  5GT3 D;  3C1C A;  4J8X A;  2BYM B;  4XZQ D;  4J8W C;  4JJN A;  1P3G D;  2IO5 B;  3AZF D;  5KDM B;  5BNX A;  4Z2M H;  1EQZ D;  4KUD A;  1P3L C;  1JFI B;  4WU9 A;  3WTP A;  5GSU C;  1P3M B;  3A6N B;  3W99 B;  3MGS C;  3B0C T;  5B2I A;  4J8V D;  5B1M C;  3X1U B;  5B32 B;  3REI C;  1U35 A;  1M1A B;  1KX4 A;  3REJ D;  5AV9 A;  3AZH B;  3X1V D;  3KWQ D;  5AY8 A;  5B32 G;  3LZ1 A;  5CPJ C;  4KHA B;  1P3O B;  3UTA B;  4YS3 B;  4KGC A;  1BFM A;  4LD9 A;  1P3P D;  5B40 C;  2HUE B;  4QLC A;  5E5A B;  5JRG A;  4WNN A;  3AZJ B;  5DNM A;  4YM6 A;  3MGR C;  3REL C;  4Z66 B;  3UTB D;  3WKJ B;  5B1L C;  2NQB D;  5B0Z A;  1P3K A;  5F99 A;  5B33 D;  3W98 D;  5AV5 C;  5B24 A;  1H3O B;  4EO5 B;  3B6G B;  3WAA A;  3AZI B;  1HQ3 B;  1WWS A;  4H9S A;  1M18 A;  4J8U C;  3X1S A;  5AV6 A;  3TU4 C;  5CP6 B;  4WU8 C;  1AOI C;  2L5A A;  2CV5 D;  3KXB B;  2FJ7 D;  2PYO C;  1P3F A;  3AZK B;  3O62 D;  3AZM C;  3KUY B;  3X1T B;  2F8N K;  3MVD B;  3LJA C;  1P3A A;  3REK D;  3UT9 B;  1S32 B;  3AZG D;  1ZLA C;  3MGP B;  4R8P B;  3REH A;  3WA9 C;  4H9R B;  3W99 A;  4KUD C;  3AYW A;  5BT1 C;  2HIO A;  4WU9 C;  5B32 A;  2NZD A;  5AV8 A;  5GT3 B;  4H9N B;  4XUJ D;  4XZQ B;  1P3G B;  1ID3 A;  1F66 A;  3AZF B;  5AV9 C;  4KHA A;  3LEL D;  1EQZ B;  3V9R A;  3W96 A;  4YS3 A;  4J8W D;  2LY8 A;  5CPK A;  1KX5 C;  4J8V B;  5E5A A;  1P3L D;  4LD9 C;  4WV4 B;  5GSU D;  3REJ B;  3AZL B;  4QLC C;  3MGS D;  5JRG C;  3X1V B;  4X23 A;  3KWQ B;  5B1M D;  4Z66 A;  4H9P A;  5DNM C;  5AVC A;  4WZS B;  3REI D;  3WKJ A;  4YM6 C;  4AWL B;  3AV1 C;  1H3O A;  5CPJ D;  5B0Z C;  1P3P B;  5F99 C;  3AZI A;  3B6G A;  4CAY B;  5B24 C;  5B40 D;  4H9S C;  4UUZ B;  3UTB B;  3X1S C;  3AFA A;  2NQB B;  5G49 B;  5B33 B;  3W98 B;  3MGR D;  4DRB A;  3REL D;  5B2J C;  1Q9C A;  3AZK A;  1P3F C;  5AV5 D;  3MVD A;  3NQU A; 
#chains in the Genus database with same CATH topology
 3W97 C;  3AN2 C;  4H9Q B;  3EPJ A;  4J8U D;  2CV5 B;  1P3A C;  2ARO A;  1S32 A;  4CSR B;  3TU4 D;  4R8P A;  5AVB C;  4WU8 D;  1AOI D;  1TZY A;  3O62 B;  3B0D B;  1P3B C;  4H9R A;  2PYO D;  3REH C;  2Y2H A;  3H0M C;  4Z5T A;  3AZM D;  3REK B;  3AYW C;  2HIO C;  5DNN C;  4H9N A;  4XZQ A;  3AZG B;  3LJA D;  2NZD C;  5AV8 C;  5C3I C;  5GXQ C;  3AZF A;  4G92 B;  1EQZ A;  5CPI C;  1ID3 C;  1P3I A;  1F66 C;  1ZLA D;  3C1B A;  3W96 C;  5CHL B;  4ZBJ B;  4J8V A;  3WA9 D;  5B0Y A;  1N1J A;  5CPK C;  3AZL A;  3REJ A;  3AV2 A;  5BT1 D;  4XUJ B;  3KWQ A;  4WU9 D;  3P5J B;  3LEL B;  2YFV B;  3B0B A;  4X23 C;  4Z66 C;  4ZUX C;  5AVC C;  1B6W A;  1BH9 B;  4J8W B;  3AZN C;  3WKJ C;  1M19 A;  5AV9 D;  4NE6 A;  3H0R C;  1P3L B;  2Y2K A;  5GSU B;  3VH6 T;  1KX3 B;  3MGS B;  1KX5 D;  5B1M B;  2XD5 A;  4LD9 D;  3REI B;  2NQB A;  2VQR A;  5BO0 A;  1P34 C;  2BYK A;  4QLC D;  5JRG D;  5B33 A;  1BH8 A;  3AFA C;  1PZR A;  5CPJ B;  4YM6 D;  3AV1 D;  5B0Z D;  5F99 D;  5B40 B;  2RIQ A;  5FUG B;  3AZE D;  3MGQ A;  3LZ0 C;  5B24 D;  5B31 C;  2RVQ C;  4CSR A;  3B6F C;  3MGR B;  3REL B;  2ARO C;  3X1S D;  3O62 A;  3MNN A;  5GT0 A;  3H0L C;  1TZY C;  2BYM A;  2ZY2 A;  5AV5 B;  5B2J D;  1TAF B;  3FDD A;  5KDM A;  3C1C C;  4J8X C;  1P3F D;  4Z5T C;  4JJN C;  1T3U A;  1W2E A;  4J8U B;  1JFI A;  2W8S A;  3AZG A;  1P3M A;  3A6N A;  3TU4 B;  3W97 D;  4WU8 B;  3AN2 D;  1AOI B;  3WTP C;  3X1U A;  1M1A A;  1P3A D;  2F8N H;  2PYO B;  5B2I C;  1EQZ C;  3AZH A;  5AVB D;  1F1E A;  1U35 C;  5BNV B;  1P3I C;  1KX4 C;  4NE3 A;  1P3O A;  3AZM B;  1P3B D;  3C1B C;  3REH D;  3UTA A;  5AY8 C;  3LZ1 C;  5B0Y C;  3LJA B;  2YFW B;  3AZL C;  3LEL A;  3AV2 C;  2Y2N A;  2YFV A;  3AYW D;  4KGC C;  2HIO D;  4DRA A;  5DNN D;  3WTP E;  3AZJ A;  2Y2M A;  4J8W A;  2NZD D;  1ZLA B;  5AV8 D;  5GXQ D;  4HGA B;  3VH5 W;  5CPI D;  3WA9 B;  1ID3 D;  1F66 D;  1M19 C;  2F8N D;  3AL0 C;  1KX3 A;  3W96 D;  4WU9 B;  1P3K C;  1HQ3 A;  4H9O B;  5CPK D;  2DQN C;  3WAA C;  5CPJ A;  3VH6 W;  5AV9 B;  5CP6 A;  1M18 C;  4X23 D;  4ZUX D;  5AVC D;  2G5H C;  3AZN D;  3WKJ D;  5AV6 C;  3KXB A;  1KX5 B;  4LD9 B;  5B1L D;  2JE5 A;  4G91 C;  3KUY A;  4QLC B;  3MGQ C;  3X1T A;  5JRG B;  1B67 A;  4NE5 A;  4YM6 B;  1P34 D;  5AV5 A;  3UT9 A;  1ULY A;  3AFA D;  3AV1 B;  2FJ7 B;  5F99 B;  1TAF A;  3MGP A;  3MNN C;  5GT0 C;  2UWX A;  3AZE B;  5B24 B;  4J8U A;  2IO5 C;  2JCH A;  3TU4 A;  3LZ0 D;  1AOI A;  5B31 D;  3AZG C;  1P3M C;  2RVQ D;  3A6N C;  3W99 C;  3B6F D;  5GT3 A;  3X1U C;  5B32 C;  1M1A C;  2ARO D;  5B2J B;  1P3G A;  1P3F B;  3AZH C;  2Y2L A;  1TZY D;  3R45 B;  1P3O C;  2YFW A;  3C1C D;  3UTA C;  4YS3 C;  4J8X D;  3AN2 B;  4Z5T D;  2FFF B;  4JJN D;  3W97 B;  2BG1 A;  1P3A B;  3KSY A;  2HUE C;  2F2A C;  3LEL C;  1ZLA A;  4KUD D;  3VH5 T;  5E5A C;  3X1V A;  5AVB B;  3AZJ C;  3WTP D;  3WA9 A;  1P3B B;  3REH B;  5B2I D;  1U35 D;  1P3I D;  1KX4 D;  1P3P A;  4H9O A;  1KX3 C;  3C1B D;  3AYW B;  4CAY A;  2HIO B;  5DNN B;  5AY8 D;  4EO5 C;  3LZ1 D;  5B0Y D;  3EPK A;  3AZI C;  3B6G C;  1HQ3 C;  2NZD B;  5AV8 B;  5GXQ B;  5C3I B;  3AZL D;  4UUZ A;  3AV2 D;  4KGC D;  3UTB A;  5CPI B;  5BS7 A;  1ID3 B;  1F66 B;  2F8N B;  2DF4 C;  5CP6 C;  2Y2J A;  5G49 A;  3V9R B;  3W96 B;  3W98 A;  1KX5 A;  1A7W A;  5DNM D;  3KXB C;  2F8N G;  4E44 A;  1M19 D;  5CPK B;  3AZK C;  1WWI A;  1P3K D;  3NQJ B;  3KUY C;  3X1T C;  4X23 B;  4H9Q A;  3MVD C;  3WAA D;  4H9P B;  5AVC B;  4ZUX B;  3AZN B;  2CV5 A;  3EG5 B;  3AV1 A;  2FJ7 A;  1M18 D;  3AZE A;  3UT9 C;  1S32 C;  5B1L B;  2Y2G A;  3MGP C;  5AV6 D;  4UPK A;  4R8P C;  5JA4 B;  2Y2Q A;  2Y2I A;  3REK A;  1P34 B;  3MGQ D;  1KU5 A;  3AFA B;  5B2J A;  5GT3 C;  2J8P A;  4XZQ C;  1P3G C;  3AZF C;  3R45 A;  3MNN D;  4E45 A;  3W97 A;  5GT0 D;  3LZ0 B;  3AN2 A;  5B31 B;  3NQU B;  4J8V C;  3B6F B;  4XUJ A;  5AVB A;  2ARO B;  5B31 G;  3REJ C;  1P3M D;  3A6N D;  3W99 D;  4HGA C;  1P3B A;  3X1V C;  3KWQ C;  3EPH A;  1TZY B;  1BH9 A;  5B32 D;  3X1U D;  1M1A D;  3C1C B;  4J8X B;  3AZH D;  4M6B A;  4Z5T B;  4JJN B;  4AWL C;  1P3L A;  5DNN A;  1P3P C;  1P3O D;  5GSU A;  5BNX B;  4KUD B;  5GXQ A;  3MGS A;  3UTA D;  4YS3 D;  5B1M A;  3A1I A;  3WTP B;  5CPI A;  3REI A;  2F8N A;  3B0C W;  5B2I B;  3UTB C;  2ZY3 A;  5E5A D;  5BS7 C;  1U35 B;  1P3I B;  3AZJ D;  1KX4 B;  1HTA A;  3KFU G;  2NQB C;  3C1B B;  5B33 C;  2ZM5 A;  3W98 C;  2JSS A;  4Z66 D;  5AY8 B;  3LZ1 B;  5B0Y B;  1N1J B;  5B40 A;  3NQJ A;  3AV2 B;  1KX3 D;  5FUG A;  4KGC B;  3B6G D;  4ZUX A;  3AZI D;  3AZN A;  1HQ3 D;  4NFT A;  3MGR A;  4WNN B;  3REL A;  5DNM B;  2CV5 C;  5B1L A;  2FJ7 C;  1M19 B;  4WJ3 C;  5CP6 D;  3AZE C;  5JA4 A;  3O62 C;  5B0Z B;  1P3K B;  3B0D C;  3KXB D;  1R4V A;  2XD1 A;  4Z2M G;  1P34 A;  3WAA B;  3AZK D;  5BO0 B;  3REK C;  3KUY D;  3X1T D;  2BYK B;  1M18 B;  4WU8 A;  1BH8 B;  3X1S B;  3MVD D;  5AV6 B;  4G92 C;  3VH5 A;  2PYO A;  5BNV A;  3A1K A;  3LZ0 A;  3UT9 D;  1S32 D;  5B31 A;  3EPL A;  3MGP D;  3AZM A;  4R8P D;  4G91 B;  3MGQ B;  4ZBJ C;  3B6F A;  3LJA A;  2CWE A;  4XUJ C;  3VH6 A;  3MNN B;  5GT0 B;  5GT3 D;  3C1C A;  4J8X A;  2BYM B;  4XZQ D;  2ZY4 A;  4J8W C;  4JJN A;  4DQY B;  1P3G D;  2IO5 B;  3AZF D;  5KDM B;  5BNX A;  4Z2M H;  1EQZ D;  4KUD A;  1P3L C;  1JFI B;  4WU9 A;  3WTP A;  5GSU C;  1P3M B;  3A6N B;  3W99 B;  3MGS C;  3B0C T;  5B2I A;  4J8V D;  5B1M C;  3X1U B;  5B32 B;  3REI C;  1U35 A;  1M1A B;  1KX4 A;  3REJ D;  5AV9 A;  3AZH B;  3X1V D;  3KWQ D;  5AY8 A;  5B32 G;  3LZ1 A;  5CPJ C;  4KHA B;  1P3O B;  3UTA B;  4YS3 B;  4KGC A;  1BFM A;  4LD9 A;  1P3P D;  5B40 C;  2HUE B;  4QLC A;  5E5A B;  5JRG A;  4WNN A;  3AZJ B;  5DNM A;  4YM6 A;  3MGR C;  3REL C;  4Z66 B;  3UTB D;  3WKJ B;  5B1L C;  2NQB D;  5B0Z A;  1P3K A;  5F99 A;  5B33 D;  3W98 D;  5AV5 C;  5B24 A;  1H3O B;  4EO5 B;  3B6G B;  3WAA A;  3AZI B;  3IP4 C;  1HQ3 B;  1WWS A;  4H9S A;  2Y2O A;  1M18 A;  4J8U C;  3X1S A;  5AV6 A;  3TU4 C;  5CP6 B;  4WU8 C;  1AOI C;  2L5A A;  2CV5 D;  3KXB B;  2FJ7 D;  2PYO C;  2G5I C;  1P3F A;  3AZK B;  3O62 D;  3AZM C;  3KUY B;  3X1T B;  2F8N K;  3MVD B;  3LJA C;  1P3A A;  3REK D;  3UT9 B;  1S32 B;  3AZG D;  1ZLA C;  3MGP B;  4R8P B;  3REH A;  3WA9 C;  4H9R B;  3W99 A;  4KUD C;  3AYW A;  5BT1 C;  2HIO A;  4WU9 C;  5B32 A;  2NZD A;  5AV8 A;  5GT3 B;  4H9N B;  4XUJ D;  4XZQ B;  1P3G B;  1ID3 A;  1F66 A;  3AZF B;  5AV9 C;  4KHA A;  3F6T A;  3LEL D;  1EQZ B;  3V9R A;  3W96 A;  4YS3 A;  4J8W D;  2LY8 A;  5CPK A;  2ZY5 A;  4J8V B;  1KX5 C;  5E5A A;  1P3L D;  4LD9 C;  4WV4 B;  5GSU D;  3REJ B;  3AZL B;  4QLC C;  3MGS D;  5JRG C;  3X1V B;  4X23 A;  3KWQ B;  5B1M D;  4Z66 A;  4H9P A;  5AVC A;  5DNM C;  4WZS B;  3REI D;  3WKJ A;  1Z2C B;  4YM6 C;  4AWL B;  3AV1 C;  1H3O A;  5CPJ D;  5B0Z C;  1P3P B;  5F99 C;  3AZI A;  3B6G A;  4CAY B;  5B24 C;  2Y2P A;  5B40 D;  4H9S C;  4UUZ B;  3UTB B;  3X1S C;  3AFA A;  2NQB B;  5G49 B;  5B33 B;  3W98 B;  3MGR D;  4DRB A;  3REL D;  5B2J C;  1Q9C A;  3AZK A;  1P3F C;  5AV5 D;  3MVD A;  3NQU A; 
#chains in the Genus database with same CATH homology
 3W97 C;  3AN2 C;  4H9Q B;  3EPJ A;  4J8U D;  2CV5 B;  1P3A C;  2ARO A;  1S32 A;  4CSR B;  3TU4 D;  4R8P A;  5AVB C;  4WU8 D;  1AOI D;  1TZY A;  3O62 B;  3B0D B;  1P3B C;  4H9R A;  2PYO D;  3REH C;  2Y2H A;  3H0M C;  4Z5T A;  3AZM D;  3REK B;  3AYW C;  2HIO C;  5DNN C;  4H9N A;  4XZQ A;  3AZG B;  3LJA D;  2NZD C;  5AV8 C;  5C3I C;  5GXQ C;  3AZF A;  4G92 B;  1EQZ A;  5CPI C;  1ID3 C;  1P3I A;  1F66 C;  1ZLA D;  3C1B A;  3W96 C;  5CHL B;  4ZBJ B;  4J8V A;  3WA9 D;  5B0Y A;  1N1J A;  5CPK C;  3AZL A;  3REJ A;  3AV2 A;  5BT1 D;  4XUJ B;  3KWQ A;  4WU9 D;  3P5J B;  3LEL B;  2YFV B;  3B0B A;  4X23 C;  4Z66 C;  4ZUX C;  5AVC C;  1B6W A;  1BH9 B;  4J8W B;  3AZN C;  3WKJ C;  1M19 A;  5AV9 D;  4NE6 A;  3H0R C;  1P3L B;  2Y2K A;  5GSU B;  3VH6 T;  1KX3 B;  3MGS B;  1KX5 D;  5B1M B;  2XD5 A;  4LD9 D;  3REI B;  2NQB A;  2VQR A;  5BO0 A;  1P34 C;  2BYK A;  4QLC D;  5JRG D;  5B33 A;  1BH8 A;  3AFA C;  1PZR A;  5CPJ B;  4YM6 D;  3AV1 D;  5B0Z D;  5F99 D;  5B40 B;  2RIQ A;  5FUG B;  3AZE D;  3MGQ A;  3LZ0 C;  5B24 D;  5B31 C;  2RVQ C;  4CSR A;  3B6F C;  3MGR B;  3REL B;  2ARO C;  3X1S D;  3O62 A;  3MNN A;  5GT0 A;  3H0L C;  1TZY C;  2BYM A;  2ZY2 A;  5AV5 B;  5B2J D;  1TAF B;  3FDD A;  5KDM A;  3C1C C;  4J8X C;  1P3F D;  4Z5T C;  4JJN C;  1T3U A;  1W2E A;  4J8U B;  1JFI A;  2W8S A;  3AZG A;  1P3M A;  3A6N A;  3TU4 B;  3W97 D;  4WU8 B;  3AN2 D;  1AOI B;  3WTP C;  3X1U A;  1M1A A;  1P3A D;  2F8N H;  2PYO B;  5B2I C;  1EQZ C;  3AZH A;  5AVB D;  1F1E A;  1U35 C;  5BNV B;  1P3I C;  1KX4 C;  4NE3 A;  1P3O A;  3AZM B;  1P3B D;  3C1B C;  3REH D;  3UTA A;  5AY8 C;  3LZ1 C;  5B0Y C;  3LJA B;  2YFW B;  3AZL C;  3LEL A;  3AV2 C;  2Y2N A;  2YFV A;  3AYW D;  4KGC C;  2HIO D;  4DRA A;  5DNN D;  3WTP E;  3AZJ A;  2Y2M A;  4J8W A;  2NZD D;  1ZLA B;  5AV8 D;  5GXQ D;  4HGA B;  3VH5 W;  5CPI D;  3WA9 B;  1ID3 D;  1F66 D;  1M19 C;  2F8N D;  3AL0 C;  1KX3 A;  3W96 D;  4WU9 B;  1P3K C;  1HQ3 A;  4H9O B;  5CPK D;  2DQN C;  3WAA C;  5CPJ A;  3VH6 W;  5AV9 B;  5CP6 A;  1M18 C;  4X23 D;  4ZUX D;  5AVC D;  2G5H C;  3AZN D;  3WKJ D;  5AV6 C;  3KXB A;  1KX5 B;  4LD9 B;  5B1L D;  2JE5 A;  4G91 C;  3KUY A;  4QLC B;  3MGQ C;  3X1T A;  5JRG B;  1B67 A;  4NE5 A;  4YM6 B;  1P34 D;  5AV5 A;  3UT9 A;  1ULY A;  3AFA D;  3AV1 B;  2FJ7 B;  5F99 B;  1TAF A;  3MGP A;  3MNN C;  5GT0 C;  2UWX A;  3AZE B;  5B24 B;  4J8U A;  2IO5 C;  2JCH A;  3TU4 A;  3LZ0 D;  1AOI A;  5B31 D;  3AZG C;  1P3M C;  2RVQ D;  3A6N C;  3W99 C;  3B6F D;  5GT3 A;  3X1U C;  5B32 C;  1M1A C;  2ARO D;  5B2J B;  1P3G A;  1P3F B;  3AZH C;  2Y2L A;  1TZY D;  3R45 B;  1P3O C;  2YFW A;  3C1C D;  3UTA C;  4YS3 C;  4J8X D;  3AN2 B;  4Z5T D;  2FFF B;  4JJN D;  3W97 B;  2BG1 A;  1P3A B;  3KSY A;  2HUE C;  2F2A C;  3LEL C;  1ZLA A;  4KUD D;  3VH5 T;  5E5A C;  3X1V A;  5AVB B;  3AZJ C;  3WTP D;  3WA9 A;  1P3B B;  3REH B;  5B2I D;  1U35 D;  1P3I D;  1KX4 D;  1P3P A;  4H9O A;  1KX3 C;  3C1B D;  3AYW B;  4CAY A;  2HIO B;  5DNN B;  5AY8 D;  4EO5 C;  3LZ1 D;  5B0Y D;  3EPK A;  3AZI C;  3B6G C;  1HQ3 C;  2NZD B;  5AV8 B;  5GXQ B;  5C3I B;  3AZL D;  4UUZ A;  3AV2 D;  4KGC D;  3UTB A;  5CPI B;  5BS7 A;  1ID3 B;  1F66 B;  2F8N B;  2DF4 C;  5CP6 C;  2Y2J A;  5G49 A;  3V9R B;  3W96 B;  3W98 A;  1KX5 A;  1A7W A;  5DNM D;  3KXB C;  2F8N G;  4E44 A;  1M19 D;  5CPK B;  3AZK C;  1WWI A;  1P3K D;  3NQJ B;  3KUY C;  3X1T C;  4X23 B;  4H9Q A;  3MVD C;  3WAA D;  4H9P B;  5AVC B;  4ZUX B;  3AZN B;  2CV5 A;  3EG5 B;  3AV1 A;  2FJ7 A;  1M18 D;  3AZE A;  3UT9 C;  1S32 C;  5B1L B;  2Y2G A;  3MGP C;  5AV6 D;  4UPK A;  4R8P C;  5JA4 B;  2Y2Q A;  2Y2I A;  3REK A;  1P34 B;  3MGQ D;  1KU5 A;  3AFA B;  5B2J A;  5GT3 C;  2J8P A;  4XZQ C;  1P3G C;  3AZF C;  3R45 A;  3MNN D;  4E45 A;  3W97 A;  5GT0 D;  3LZ0 B;  3AN2 A;  5B31 B;  3NQU B;  4J8V C;  3B6F B;  4XUJ A;  5AVB A;  2ARO B;  5B31 G;  3REJ C;  1P3M D;  3A6N D;  3W99 D;  4HGA C;  1P3B A;  3X1V C;  3KWQ C;  3EPH A;  1TZY B;  1BH9 A;  5B32 D;  3X1U D;  1M1A D;  3C1C B;  4J8X B;  3AZH D;  4M6B A;  4Z5T B;  4JJN B;  4AWL C;  1P3L A;  5DNN A;  1P3P C;  1P3O D;  5GSU A;  5BNX B;  4KUD B;  5GXQ A;  3MGS A;  3UTA D;  4YS3 D;  5B1M A;  3A1I A;  3WTP B;  5CPI A;  3REI A;  2F8N A;  3B0C W;  5B2I B;  3UTB C;  2ZY3 A;  5E5A D;  5BS7 C;  1U35 B;  1P3I B;  3AZJ D;  1KX4 B;  1HTA A;  3KFU G;  2NQB C;  3C1B B;  5B33 C;  2ZM5 A;  3W98 C;  2JSS A;  4Z66 D;  5AY8 B;  3LZ1 B;  5B0Y B;  1N1J B;  5B40 A;  3NQJ A;  3AV2 B;  1KX3 D;  5FUG A;  4KGC B;  3B6G D;  4ZUX A;  3AZI D;  3AZN A;  1HQ3 D;  4NFT A;  3MGR A;  4WNN B;  3REL A;  5DNM B;  2CV5 C;  5B1L A;  2FJ7 C;  1M19 B;  4WJ3 C;  5CP6 D;  3AZE C;  5JA4 A;  3O62 C;  5B0Z B;  1P3K B;  3B0D C;  3KXB D;  1R4V A;  2XD1 A;  4Z2M G;  1P34 A;  3WAA B;  3AZK D;  5BO0 B;  3REK C;  3KUY D;  3X1T D;  2BYK B;  1M18 B;  4WU8 A;  1BH8 B;  3X1S B;  3MVD D;  5AV6 B;  4G92 C;  3VH5 A;  2PYO A;  5BNV A;  3A1K A;  3LZ0 A;  3UT9 D;  1S32 D;  5B31 A;  3EPL A;  3MGP D;  3AZM A;  4R8P D;  4G91 B;  3MGQ B;  4ZBJ C;  3B6F A;  3LJA A;  2CWE A;  4XUJ C;  3VH6 A;  3MNN B;  5GT0 B;  5GT3 D;  3C1C A;  4J8X A;  2BYM B;  4XZQ D;  2ZY4 A;  4J8W C;  4JJN A;  4DQY B;  1P3G D;  2IO5 B;  3AZF D;  5KDM B;  5BNX A;  4Z2M H;  1EQZ D;  4KUD A;  1P3L C;  1JFI B;  4WU9 A;  3WTP A;  5GSU C;  1P3M B;  3A6N B;  3W99 B;  3MGS C;  3B0C T;  5B2I A;  4J8V D;  5B1M C;  3X1U B;  5B32 B;  3REI C;  1U35 A;  1M1A B;  1KX4 A;  3REJ D;  5AV9 A;  3AZH B;  3X1V D;  3KWQ D;  5AY8 A;  5B32 G;  3LZ1 A;  5CPJ C;  4KHA B;  1P3O B;  3UTA B;  4YS3 B;  4KGC A;  1BFM A;  4LD9 A;  1P3P D;  5B40 C;  2HUE B;  4QLC A;  5E5A B;  5JRG A;  4WNN A;  3AZJ B;  5DNM A;  4YM6 A;  3MGR C;  3REL C;  4Z66 B;  3UTB D;  3WKJ B;  5B1L C;  2NQB D;  5B0Z A;  1P3K A;  5F99 A;  5B33 D;  3W98 D;  5AV5 C;  5B24 A;  1H3O B;  4EO5 B;  3B6G B;  3WAA A;  3AZI B;  3IP4 C;  1HQ3 B;  1WWS A;  4H9S A;  2Y2O A;  1M18 A;  4J8U C;  3X1S A;  5AV6 A;  3TU4 C;  5CP6 B;  4WU8 C;  1AOI C;  2L5A A;  2CV5 D;  3KXB B;  2FJ7 D;  2PYO C;  2G5I C;  1P3F A;  3AZK B;  3O62 D;  3AZM C;  3KUY B;  3X1T B;  2F8N K;  3MVD B;  3LJA C;  1P3A A;  3REK D;  3UT9 B;  1S32 B;  3AZG D;  1ZLA C;  3MGP B;  4R8P B;  3REH A;  3WA9 C;  4H9R B;  3W99 A;  4KUD C;  3AYW A;  5BT1 C;  2HIO A;  4WU9 C;  5B32 A;  2NZD A;  5AV8 A;  5GT3 B;  4H9N B;  4XUJ D;  4XZQ B;  1P3G B;  1ID3 A;  1F66 A;  3AZF B;  5AV9 C;  4KHA A;  3F6T A;  3LEL D;  1EQZ B;  3V9R A;  3W96 A;  4YS3 A;  4J8W D;  2LY8 A;  5CPK A;  2ZY5 A;  4J8V B;  1KX5 C;  5E5A A;  1P3L D;  4LD9 C;  4WV4 B;  5GSU D;  3REJ B;  3AZL B;  4QLC C;  3MGS D;  5JRG C;  3X1V B;  4X23 A;  3KWQ B;  5B1M D;  4Z66 A;  4H9P A;  5AVC A;  5DNM C;  4WZS B;  3REI D;  3WKJ A;  1Z2C B;  4YM6 C;  4AWL B;  3AV1 C;  1H3O A;  5CPJ D;  5B0Z C;  1P3P B;  5F99 C;  3AZI A;  3B6G A;  4CAY B;  5B24 C;  2Y2P A;  5B40 D;  4H9S C;  4UUZ B;  3UTB B;  3X1S C;  3AFA A;  2NQB B;  5G49 B;  5B33 B;  3W98 B;  3MGR D;  4DRB A;  3REL D;  5B2J C;  1Q9C A;  3AZK A;  1P3F C;  5AV5 D;  3MVD A;  3NQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...