3KUYD

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 39
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyD00
5FUGB 4WU8B 3NQUB 3C1BC 3WAAB 5AVBA 3UT9D 3A6ND 1BH8B 3VH5T 5CPKB 3RELD 4XUJD 5BNXA 1KX4B 3LZ1C 4R8PB 3MGSC 5B33D 5B40B 5AV8D 1P3MB 4YM6B 3AZJA 3AV2B 5B1MA 4Z5TC 3REHC 1P3OB 4Z66B 1EQZA 5B1LC 5GT0C 1KX3B 1P3FD 3W98D 5CP6D 4KGCC 2HUEC 4UUZA 3AZMC 1AOIC 1KU5A 2F8ND 1P3IA 3B0DB 1P34B 1M1AC 1HQ3D 3AZFB 5AV5B 1R4VA 4LD9A 2NZDA 4CAYB 4DRAA 1U35B 2NQBC 3C1CB 3V9RB 5B32C 3WTPD 3MVDD 3KXBA 4H9SA 2JSSA 5AY8D 4J8WC 5F99C 1M19D 1F66C 4WNNB 3KWQC 3UTBD 4AWLC 1P3BC 4KUDC 3AFAC 5E5AC 5B2IA 3WA9B 5DNMA 1TZYA 2YFVA 3C1BB 4J8VA 4HGAC 3AZHC 2AROA 2BYKA 4YS3B 4WU8D 1P3LB 3LELC 3AZEA 4J8XC 4WU9A 4H9NB 3MGQA 3AZNB 3MGSB 5GSUC 3B6GA 5B0ZC 3AV1A 5GXQC 4Z5TB 2FJ7A 3W99A 1KX4D 4R8PD 1ZLAD 5JRGD 1P3MD 5B40D 2NQBA 1P3PA 3X1TD 4KGCB 1P3OD 3R45B 5AVBD 1N1JA 4NE5A 4Z66D 3KUYC 2BYMB 2PYOD 1M1AB 2IO5B 4CSRA 2F8NG 5CHLB 3KWQA 5B2JB 3X1SC 3UT9A 1M18C 4H9RA 3A6NA 1S32C 3AN2C 4XUJA 1P3GB 5AV5D 4NE6A 1P3AC 5B33A 5AV8A 4J8UD 1EQZD 3AZID 1JFIB 3AZHA 5CPJD 4J8WB 3VH6A 1P3FA 3W98A 5CP6A 3WAAC 5B0ZA 3UTAB 4HGAB 5B31A 1HQ3A 3REJB 5CPKC 4XZQB 3AZKC 3AZGC 4YM6C 3AV2C 3REKC 3LZ0B 3WTPA 3REIB 3MVDA 4ZBJB 4KHAA 5KDMB 5GXQB 1KX3C 4G91B 1H3OA 5AY8A 3LZ1D 3NQJB 1M19A 4E44A 3MGSD 3UTBA 3AN2A 5GT3B 3REHD 4DRBA 1P3AA 3B0DC 1P34C 3AZFC 4H9QB 5B1LD 5GT0D 1B67A 1BH9A 3X1UC 3TU4B 3O62C 4KGCD 5FUGA 3W96C 4WU8A 3AZMD 3X1SB 3C1CC 5AV6C 3NQUA 1U35C 1AOID 1S32B 5AVCC 1M1AD 3WTPE 5BS7A 5CPKA 2NQBD 1KX4A 3B6FC 5B32D 4R8PA 5BO0A 5JRGA 1KX5C 1P3MA 5B40A 1ZLAA 3AZLB 3WA9C 3X1TA 5G49A 1P3OA 1P3KB 4Z66A 4J8WD 5F99D 1F66D 4YS3C 3KWQD 2PYOA 5BNVA 1P3BD 3X1VB 1P3LC 4KUDD 1TAFA 3AFAD 5E5AD 3MGPB 3AZKB 3AZNC 5B0YC 1P34A 2CV5C 3AZGB 4JJNC 3AZHD 5AV5A 3REKB 4J8UA 3AZIA 1WWIA 3LELD 4NFTA 3MNNB 4CAYA 5CPJA 4J8XD 3AYWB 5GSUD 5B0ZD 5GXQD 5B31D 2IO5C 4WNNA 5B2JC 3X1UB 5B24B 3O62B 3WKJB 3W96B 4X23C 3KUYD 5AV6B 1P3GC 3C1BA 5AVCB 4H9OB 4YS3A 3X1SD 3VH5A 2LY8A 3MGRB 1M18D 1S32D 3AN2D 1ULYA 4H9NA 3LZ1A 1P3AD 3B6FB 3MGSA 1KX5B 5B32G 3REHA 4Z5TA 3UTAC 3AZJB 3REJC 5B1MB 5B1LA 5GT0A 4QLCC 4XZQC 3WAAD 4KGCA 3AZMA 1AOIA 3LZ0C 5B0YB 3REIC 1M1AA 2CV5B 4ZBJC 5BT1C 1ID3C 4JJNB 5CPKD 3KSYA 5B2JA 4G91C 5CPIC 4ZUXC 3AZKD 3AZGD 4YM6D 4LD9B 5GT3C 2NZDB 3AV2D 2F8NH 5B32A 1JFIA 1KX3D 3KXBB 3TU4C 3LJAC 4J8WA 1F66A 5F99A 5C3IC 5B31G 4NE3A 1P3BA 4KUDA 3AFAA 1P34D 5E5AA 3AZFD 4X23B 5B2IB 3X1UD 1TZYB 3O62D 2YFVB 4J8VB 3B0CW 1U35D 5AV9B 3W96D 3C1CD 5AV6D 4XZQA 2AROB 2BYKB 3LELA 5AVCD 3AZLC 4J8XA 3W97C 5GSUA 3REIA 4WU9B 1P3KC 5KDMA 5GXQA 3B6GB 3X1VC 3AV1B 3B6FD 3W99B 3NQJA 2FJ7B 4QLCB 1BFMA 3WA9D 3MGPC 3C1BD 1P3PB 4H9QA 3KUYA 4YS3D 2YFWB 3TU4A 1P3LD 2HIOC 1ID3B 3MNNC 4CSRB 3X1SA 5CPIB 1M18A 4ZUXB 3AYWC 3AZND 1S32A 5B0YD 2CV5D 3UT9B 4H9RB 4JJND 4Z5TD 3RELB 4XUJB 4H9PB 5B24C 3LJAB 3WKJC 4G92B 5DNNC 5C3IB 3VH5W 3WAAA 1P3FB 5CP6B 5B2JD 2F8NB 3MGRC 1BH8A 4X23D 1P3GD 3AZKA 3AZGA 4YM6A 3W97B 3AV2A 3REKA 3AZJC 5B1MC 3WTPB 1KX3A 3MVDB 1EQZC 1H3OB 2RVQC 1M19B 3UTAD 4WV4B 4Z2MG 5JA4B 3AZFA 3REJD 1P3IC 4QLCD 3X1UA 4XZQD 3O62A 1BH9B 2HIOB 4LD9C 3W96A 1U35A 2NZDC 3C1CA 5AV6A 3V9RA 3LZ0D 5AVCA 3REID 4H9OA 5BT1D 1ID3D 3KXBC 4H9SC 5CPID 4ZUXD 3MGRA 1WWSA 5GT3D 3B6FA 1P3PD 5DNNB 1KX5A 3WA9A 1ZLAB 5BO0B 5JRGB 5B2IC 5DNMC 3VH6W 1TZYC 3TU4D 3X1TB 3LJAD 5G49B 4J8VC 5AVBB 5AV9C 2AROC 1P3LA 2PYOB 5BNVB 1TAFB 3AZEC 3AZNA 5B0YA 4WU9C 5BNXB 2CV5A 3MGQC 4JJNA 3B6GC 3AV1C 3W99C 2FJ7C 3AZLD 4J8UB 1EQZB 3AZIB 3W97D 5CPJB 3R45A 1P3PC 1P3KD 2BYMA 4UUZB 3X1VD 1P3IB 4EO5C 3MGPD 3UT9C 3A6NC 4X23A 1P3GA 3REKD 3RELC 4XUJC 2HIOD 2F8NK 3MNND 5B33C 5AV8C 3B0BA 5AV9A 4G92C 3AYWD 4WZSB 1P3FC 3W98C 5CP6C 3VH6T 3LZ1B 3UTAA 5DNMB 5B24D 3REJA 3WKJD 3REHB 4E45A 4QLCA 5DNND 5B31C 1HQ3C 5B1LB 5GT0B 2L5AA 3LZ0A 3AZEB 2HUEB 3AZMB 1AOIB 2YFWA 3MGRD 3MGQB 1ID3A 1HTAA 3WTPC 3MVDC 5CPIA 4ZUXA 1KX5D 1B6WA 5AY8C 5GT3A 1M19C 3UTBC 2NQBB 3RELA 3AZJD 5B1MD 4H9PA 5B32B 1N1JB 3LJAA 4EO5B 2RVQD 5F99B 1F66B 3KWQB 1F1EA 4AWLB 4WU8C 1P3BB 1P3ID 3A6NB 4KUDB 3AFAB 5E5AB 2F8NA 1A7WA 5B33B 5AV8B 4LD9D 2NZDD 5BS7C 3AZHB 3AZLA 1KX4C 4R8PC 3W97A 3LELB 5JRGC 1ZLAC 1P3MC 5B40C 1Q9CA 3KXBD 4J8XB 3W98B 3X1TC 1P3KA 1P3OC 5GSUB 5AVBC 4Z66C 5B0ZB 3B0CT 3X1VA 2PYOC 5B31B 1HQ3B 3MGPA 5B2ID 5DNMD 1TZYD 5JA4A 4J8VD 5AV9D 3KUYB 2AROD 5AV5C 2HIOA 3MNNA 4J8UC 4KHAB 3AZIC 4Z2MH 3AZED 3AYWA 5CPJC 4WU9D 1M18B 3MGQD 5AY8B 3UTBB 3AN2B 2CWEA 3B6GD 3AV1D 3W99D 1P3AB 2FJ7D 4M6BA 5B24A 3WKJA 5DNNA
chains in the Genus database with same CATH superfamily
5FUGB 4WU8B 3NQUB 3EPLA 3C1BC 3WAAB 5AVBA 2Y2NA 2ZY3A 3P5JB 2JE5A 3UT9D 3A6ND 1BH8B 2XD5A 3VH5T 5CPKB 3RELD 4XUJD 2FFFB 5BNXA 1KX4B 3LZ1C 4R8PB 3MGSC 5B33D 5B40B 5AV8D 1P3MB 4YM6B 3AZJA 3AV2B 5B1MA 4Z5TC 3REHC 1P3OB 4Z66B 1EQZA 5B1LC 5GT0C 1KX3B 1P3FD 3W98D 5CP6D 4KGCC 2HUEC 4UUZA 3AZMC 1AOIC 1KU5A 2F8ND 1P3IA 3B0DB 1P34B 1M1AC 1HQ3D 3AZFB 5AV5B 1R4VA 3IP4C 4LD9A 2NZDA 4CAYB 4DRAA 1U35B 2NQBC 3A1KA 3C1CB 3V9RB 5B32C 3WTPD 3MVDD 3KXBA 4H9SA 2JSSA 5AY8D 4J8WC 5F99C 1M19D 1F66C 4WNNB 3KWQC 3UTBD 4AWLC 1P3BC 4KUDC 3AFAC 5E5AC 5B2IA 3WA9B 5DNMA 2G5IC 1TZYA 2YFVA 3C1BB 4J8VA 4HGAC 3AZHC 2AROA 2BYKA 4YS3B 4WU8D 1P3LB 2DF4C 3LELC 3F6TA 3AZEA 4J8XC 4WU9A 4H9NB 3MGQA 3AZNB 3MGSB 5GSUC 3B6GA 5B0ZC 3AV1A 5GXQC 4Z5TB 2FJ7A 3W99A 1KX4D 4R8PD 1ZLAD 5JRGD 1P3MD 5B40D 2ZY5A 2NQBA 1P3PA 3X1TD 4KGCB 1P3OD 3R45B 5AVBD 1N1JA 4NE5A 4Z66D 3KUYC 2BYMB 2PYOD 1M1AB 2IO5B 4CSRA 2F8NG 5CHLB 3KWQA 5B2JB 3X1SC 3UT9A 1M18C 4H9RA 3A6NA 1S32C 3AN2C 4XUJA 1P3GB 5AV5D 4NE6A 1P3AC 5B33A 5AV8A 4J8UD 1EQZD 3AZID 1JFIB 3AZHA 2XD1A 5CPJD 3H0RC 4J8WB 3EPHA 3VH6A 1P3FA 3W98A 5CP6A 3WAAC 1T3UA 5B0ZA 3UTAB 4HGAB 5B31A 1HQ3A 3REJB 5CPKC 4XZQB 3AZKC 3AZGC 4YM6C 3AV2C 3REKC 3LZ0B 3H0LC 3WTPA 3REIB 3MVDA 4ZBJB 4KHAA 5KDMB 5GXQB 1KX3C 4G91B 1H3OA 5AY8A 3LZ1D 3NQJB 1M19A 4E44A 3MGSD 3UTBA 3EPJA 3AN2A 5GT3B 3REHD 4DRBA 1P3AA 3B0DC 1P34C 3AZFC 4H9QB 5B1LD 5GT0D 1B67A 1BH9A 3X1UC 3TU4B 3O62C 4KGCD 5FUGA 3W96C 4WU8A 3AZMD 3X1SB 3C1CC 4UPKA 3NQUA 5AV6C 1U35C 1AOID 1S32B 5AVCC 1M1AD 3WTPE 5BS7A 3EG5B 5CPKA 2NQBD 1KX4A 3B6FC 5B32D 4R8PA 5BO0A 5JRGA 1KX5C 2Y2JA 5B40A 1P3MA 3AZLB 1ZLAA 3WA9C 3X1TA 5G49A 1P3OA 1P3KB 4Z66A 4J8WD 5F99D 1F66D 4YS3C 3KWQD 2PYOA 5BNVA 1P3BD 3X1VB 1P3LC 4KUDD 1TAFA 3AFAD 5E5AD 3MGPB 3AZKB 3AZNC 5B0YC 1P34A 2CV5C 3AZGB 4JJNC 3AZHD 5AV5A 3REKB 4J8UA 3AZIA 1WWIA 3LELD 4NFTA 3MNNB 4CAYA 5CPJA 4J8XD 3AYWB 5GSUD 5B0ZD 5GXQD 5B31D 2IO5C 4WNNA 2Y2LA 5B2JC 2ZY2A 3X1UB 5B24B 3O62B 3WKJB 3W96B 4X23C 3KUYD 5AV6B 1P3GC 3C1BA 5AVCB 4H9OB 2Y2GA 4YS3A 3X1SD 3VH5A 2LY8A 3MGRB 1M18D 1S32D 3AN2D 1ULYA 4H9NA 3LZ1A 1P3AD 3B6FB 3MGSA 1KX5B 5B32G 3REHA 4Z5TA 3UTAC 3AZJB 3REJC 5B1MB 5B1LA 5GT0A 4QLCC 4XZQC 3WAAD 4KGCA 3AZMA 1AOIA 3LZ0C 5B0YB 3REIC 1M1AA 2CV5B 4ZBJC 5BT1C 1ID3C 4JJNB 5CPKD 3KSYA 5B2JA 4G91C 5CPIC 4ZUXC 3AZKD 3AZGD 4YM6D 4LD9B 5GT3C 2NZDB 3AV2D 2F8NH 5B32A 4WJ3C 1JFIA 2Y2KA 1KX3D 1Z2CB 3KXBB 3TU4C 3LJAC 4J8WA 1F66A 5F99A 5C3IC 5B31G 2W8SA 4NE3A 1P3BA 3AL0C 4KUDA 2VQRA 3AFAA 1P34D 5E5AA 3AZFD 4X23B 3EPKA 5B2IB 3X1UD 1TZYB 3O62D 2YFVB 4J8VB 3B0CW 1U35D 5AV9B 3W96D 3C1CD 5AV6D 4XZQA 2AROB 2BYKB 3LELA 5AVCD 2Y2PA 3AZLC 4J8XA 3W97C 5GSUA 3REIA 2J8PA 4WU9B 1P3KC 5KDMA 5GXQA 3B6GB 3X1VC 3AV1B 2ZM5A 3B6FD 3NQJA 2FJ7B 4QLCB 3W99B 3WA9D 1BFMA 3MGPC 3C1BD 1P3PB 4H9QA 3KUYA 4YS3D 2YFWB 3TU4A 1P3LD 2HIOC 1ID3B 3MNNC 4CSRB 3X1SA 5CPIB 1M18A 4ZUXB 3AYWC 3AZND 1S32A 5B0YD 2CV5D 3UT9B 4H9RB 3A1IA 4JJND 4Z5TD 3RELB 4XUJB 4H9PB 5B24C 3LJAB 3WKJC 4G92B 5DNNC 5C3IB 3VH5W 3WAAA 1P3FB 5CP6B 2JCHA 5B2JD 2F8NB 3MGRC 1BH8A 4X23D 1P3GD 2Y2IA 3AZKA 3FDDA 3AZGA 4YM6A 3W97B 3AV2A 3REKA 3AZJC 5B1MC 3WTPB 1KX3A 3MVDB 1EQZC 1H3OB 2RVQC 1M19B 3UTAD 4WV4B 4Z2MG 5JA4B 3AZFA 3REJD 1P3IC 4QLCD 3X1UA 4XZQD 3O62A 1BH9B 2HIOB 4LD9C 3W96A 1U35A 2NZDC 3C1CA 5AV6A 3V9RA 3LZ0D 5AVCA 3REID 4H9OA 5BT1D 1ID3D 3KXBC 4H9SC 5CPID 4ZUXD 3MGRA 1WWSA 5GT3D 3B6FA 1P3PD 2RIQA 5DNNB 1KX5A 3WA9A 1ZLAB 5BO0B 5JRGB 5B2IC 5DNMC 3VH6W 1TZYC 3TU4D 3X1TB 3LJAD 5G49B 4J8VC 5AVBB 5AV9C 2AROC 1P3LA 2PYOB 5BNVB 1TAFB 3AZEC 3AZNA 5B0YA 4WU9C 5BNXB 2CV5A 3MGQC 4JJNA 3B6GC 2ZY4A 3AV1C 3W99C 2FJ7C 3AZLD 4J8UB 1EQZB 3AZIB 3W97D 2F2AC 2BG1A 2UWXA 4DQYB 5CPJB 3R45A 1P3PC 1P3KD 2BYMA 4UUZB 3X1VD 1P3IB 4EO5C 3MGPD 3UT9C 3A6NC 4X23A 1P3GA 3REKD 3H0MC 3RELC 4XUJC 2HIOD 2F8NK 3MNND 5B33C 5AV8C 3B0BA 5AV9A 4G92C 3AYWD 4WZSB 1P3FC 3W98C 5CP6C 3VH6T 3LZ1B 3UTAA 5DNMB 5B24D 3REJA 3WKJD 3REHB 4E45A 4QLCA 5DNND 5B31C 1HQ3C 2Y2OA 5B1LB 5GT0B 2L5AA 3LZ0A 3AZEB 2HUEB 3AZMB 1AOIB 2YFWA 3MGRD 3MGQB 1ID3A 1HTAA 3WTPC 3MVDC 5CPIA 4ZUXA 1W2EA 1KX5D 1B6WA 5AY8C 5GT3A 1M19C 3UTBC 2NQBB 3RELA 3AZJD 5B1MD 4H9PA 5B32B 1N1JB 3LJAA 4EO5B 2Y2QA 2RVQD 2DQNC 5F99B 1F66B 3KWQB 1F1EA 4AWLB 4WU8C 1P3BB 1P3ID 3A6NB 4KUDB 3AFAB 5E5AB 2F8NA 1A7WA 5B33B 5AV8B 4LD9D 2NZDD 5BS7C 3AZHB 3AZLA 1KX4C 4R8PC 3W97A 3LELB 5JRGC 1ZLAC 1P3MC 5B40C 1Q9CA 3KXBD 4J8XB 3W98B 3KFUG 3X1TC 1P3KA 1P3OC 5GSUB 5AVBC 4Z66C 5B0ZB 3B0CT 3X1VA 2Y2HA 2PYOC 5B31B 1HQ3B 3MGPA 5B2ID 2Y2MA 5DNMD 1TZYD 5JA4A 4J8VD 5AV9D 3KUYB 2AROD 5AV5C 2HIOA 3MNNA 4J8UC 4KHAB 3AZIC 4Z2MH 3AZED 3AYWA 5CPJC 4WU9D 1M18B 3MGQD 5AY8B 3UTBB 1PZRA 3AN2B 2CWEA 3B6GD 3AV1D 3W99D 1P3AB 2FJ7D 4M6BA 5B24A 2G5HC 3WKJA 5DNNA
chains in the Genus database with same CATH topology
5FUGB 4WU8B 3NQUB 3EPLA 3C1BC 3WAAB 5AVBA 2Y2NA 2ZY3A 3P5JB 2JE5A 3UT9D 3A6ND 1BH8B 2XD5A 3VH5T 5CPKB 3RELD 4XUJD 2FFFB 5BNXA 1KX4B 3LZ1C 4R8PB 3MGSC 5B33D 5B40B 5AV8D 1P3MB 4YM6B 3AZJA 3AV2B 5B1MA 4Z5TC 3REHC 1P3OB 4Z66B 1EQZA 5B1LC 5GT0C 1KX3B 1P3FD 3W98D 5CP6D 4KGCC 2HUEC 4UUZA 3AZMC 1AOIC 1KU5A 2F8ND 1P3IA 3B0DB 1P34B 1M1AC 1HQ3D 3AZFB 5AV5B 1R4VA 3IP4C 4LD9A 2NZDA 4CAYB 4DRAA 1U35B 2NQBC 3A1KA 3C1CB 3V9RB 5B32C 3WTPD 3MVDD 3KXBA 4H9SA 2JSSA 5AY8D 4J8WC 5F99C 1M19D 1F66C 4WNNB 3KWQC 3UTBD 4AWLC 1P3BC 4KUDC 3AFAC 5E5AC 5B2IA 3WA9B 5DNMA 2G5IC 1TZYA 2YFVA 3C1BB 4J8VA 4HGAC 3AZHC 2AROA 2BYKA 4YS3B 4WU8D 1P3LB 2DF4C 3LELC 3F6TA 3AZEA 4J8XC 4WU9A 4H9NB 3MGQA 3AZNB 3MGSB 5GSUC 3B6GA 5B0ZC 3AV1A 5GXQC 4Z5TB 2FJ7A 3W99A 1KX4D 4R8PD 1ZLAD 5JRGD 1P3MD 5B40D 2ZY5A 2NQBA 1P3PA 3X1TD 4KGCB 1P3OD 3R45B 5AVBD 1N1JA 4NE5A 4Z66D 3KUYC 2BYMB 2PYOD 1M1AB 2IO5B 4CSRA 2F8NG 5CHLB 3KWQA 5B2JB 3X1SC 3UT9A 1M18C 4H9RA 3A6NA 1S32C 3AN2C 4XUJA 1P3GB 5AV5D 4NE6A 1P3AC 5B33A 5AV8A 4J8UD 1EQZD 3AZID 1JFIB 3AZHA 2XD1A 5CPJD 3H0RC 4J8WB 3EPHA 3VH6A 1P3FA 3W98A 5CP6A 3WAAC 1T3UA 5B0ZA 3UTAB 4HGAB 5B31A 1HQ3A 3REJB 5CPKC 4XZQB 3AZKC 3AZGC 4YM6C 3AV2C 3REKC 3LZ0B 3H0LC 3WTPA 3REIB 3MVDA 4ZBJB 4KHAA 5KDMB 5GXQB 1KX3C 4G91B 1H3OA 5AY8A 3LZ1D 3NQJB 1M19A 4E44A 3MGSD 3UTBA 3EPJA 3AN2A 5GT3B 3REHD 4DRBA 1P3AA 3B0DC 1P34C 3AZFC 4H9QB 5B1LD 5GT0D 1B67A 1BH9A 3X1UC 3TU4B 3O62C 4KGCD 5FUGA 3W96C 4WU8A 3AZMD 3X1SB 3C1CC 4UPKA 3NQUA 5AV6C 1U35C 1AOID 1S32B 5AVCC 1M1AD 3WTPE 5BS7A 3EG5B 5CPKA 2NQBD 1KX4A 3B6FC 5B32D 4R8PA 5BO0A 5JRGA 1KX5C 2Y2JA 5B40A 1P3MA 3AZLB 1ZLAA 3WA9C 3X1TA 5G49A 1P3OA 1P3KB 4Z66A 4J8WD 5F99D 1F66D 4YS3C 3KWQD 2PYOA 5BNVA 1P3BD 3X1VB 1P3LC 4KUDD 1TAFA 3AFAD 5E5AD 3MGPB 3AZKB 3AZNC 5B0YC 1P34A 2CV5C 3AZGB 4JJNC 3AZHD 5AV5A 3REKB 4J8UA 3AZIA 1WWIA 3LELD 4NFTA 3MNNB 4CAYA 5CPJA 4J8XD 3AYWB 5GSUD 5B0ZD 5GXQD 5B31D 2IO5C 4WNNA 2Y2LA 5B2JC 2ZY2A 3X1UB 5B24B 3O62B 3WKJB 3W96B 4X23C 3KUYD 5AV6B 1P3GC 3C1BA 5AVCB 4H9OB 2Y2GA 4YS3A 3X1SD 3VH5A 2LY8A 3MGRB 1M18D 1S32D 3AN2D 1ULYA 4H9NA 3LZ1A 1P3AD 3B6FB 3MGSA 1KX5B 5B32G 3REHA 4Z5TA 3UTAC 3AZJB 3REJC 5B1MB 5B1LA 5GT0A 4QLCC 4XZQC 3WAAD 4KGCA 3AZMA 1AOIA 3LZ0C 5B0YB 3REIC 1M1AA 2CV5B 4ZBJC 5BT1C 1ID3C 4JJNB 5CPKD 3KSYA 5B2JA 4G91C 5CPIC 4ZUXC 3AZKD 3AZGD 4YM6D 4LD9B 5GT3C 2NZDB 3AV2D 2F8NH 5B32A 4WJ3C 1JFIA 2Y2KA 1KX3D 1Z2CB 3KXBB 3TU4C 3LJAC 4J8WA 1F66A 5F99A 5C3IC 5B31G 2W8SA 4NE3A 1P3BA 3AL0C 4KUDA 2VQRA 3AFAA 1P34D 5E5AA 3AZFD 4X23B 3EPKA 5B2IB 3X1UD 1TZYB 3O62D 2YFVB 4J8VB 3B0CW 1U35D 5AV9B 3W96D 3C1CD 5AV6D 4XZQA 2AROB 2BYKB 3LELA 5AVCD 2Y2PA 3AZLC 4J8XA 3W97C 5GSUA 3REIA 2J8PA 4WU9B 1P3KC 5KDMA 5GXQA 3B6GB 3X1VC 3AV1B 2ZM5A 3B6FD 3NQJA 2FJ7B 4QLCB 3W99B 3WA9D 1BFMA 3MGPC 3C1BD 1P3PB 4H9QA 3KUYA 4YS3D 2YFWB 3TU4A 1P3LD 2HIOC 1ID3B 3MNNC 4CSRB 3X1SA 5CPIB 1M18A 4ZUXB 3AYWC 3AZND 1S32A 5B0YD 2CV5D 3UT9B 4H9RB 3A1IA 4JJND 4Z5TD 3RELB 4XUJB 4H9PB 5B24C 3LJAB 3WKJC 4G92B 5DNNC 5C3IB 3VH5W 3WAAA 1P3FB 5CP6B 2JCHA 5B2JD 2F8NB 3MGRC 1BH8A 4X23D 1P3GD 2Y2IA 3AZKA 3FDDA 3AZGA 4YM6A 3W97B 3AV2A 3REKA 3AZJC 5B1MC 3WTPB 1KX3A 3MVDB 1EQZC 1H3OB 2RVQC 1M19B 3UTAD 4WV4B 4Z2MG 5JA4B 3AZFA 3REJD 1P3IC 4QLCD 3X1UA 4XZQD 3O62A 1BH9B 2HIOB 4LD9C 3W96A 1U35A 2NZDC 3C1CA 5AV6A 3V9RA 3LZ0D 5AVCA 3REID 4H9OA 5BT1D 1ID3D 3KXBC 4H9SC 5CPID 4ZUXD 3MGRA 1WWSA 5GT3D 3B6FA 1P3PD 2RIQA 5DNNB 1KX5A 3WA9A 1ZLAB 5BO0B 5JRGB 5B2IC 5DNMC 3VH6W 1TZYC 3TU4D 3X1TB 3LJAD 5G49B 4J8VC 5AVBB 5AV9C 2AROC 1P3LA 2PYOB 5BNVB 1TAFB 3AZEC 3AZNA 5B0YA 4WU9C 5BNXB 2CV5A 3MGQC 4JJNA 3B6GC 2ZY4A 3AV1C 3W99C 2FJ7C 3AZLD 4J8UB 1EQZB 3AZIB 3W97D 2F2AC 2BG1A 2UWXA 4DQYB 5CPJB 3R45A 1P3PC 1P3KD 2BYMA 4UUZB 3X1VD 1P3IB 4EO5C 3MGPD 3UT9C 3A6NC 4X23A 1P3GA 3REKD 3H0MC 3RELC 4XUJC 2HIOD 2F8NK 3MNND 5B33C 5AV8C 3B0BA 5AV9A 4G92C 3AYWD 4WZSB 1P3FC 3W98C 5CP6C 3VH6T 3LZ1B 3UTAA 5DNMB 5B24D 3REJA 3WKJD 3REHB 4E45A 4QLCA 5DNND 5B31C 1HQ3C 2Y2OA 5B1LB 5GT0B 2L5AA 3LZ0A 3AZEB 2HUEB 3AZMB 1AOIB 2YFWA 3MGRD 3MGQB 1ID3A 1HTAA 3WTPC 3MVDC 5CPIA 4ZUXA 1W2EA 1KX5D 1B6WA 5AY8C 5GT3A 1M19C 3UTBC 2NQBB 3RELA 3AZJD 5B1MD 4H9PA 5B32B 1N1JB 3LJAA 4EO5B 2Y2QA 2RVQD 2DQNC 5F99B 1F66B 3KWQB 1F1EA 4AWLB 4WU8C 1P3BB 1P3ID 3A6NB 4KUDB 3AFAB 5E5AB 2F8NA 1A7WA 5B33B 5AV8B 4LD9D 2NZDD 5BS7C 3AZHB 3AZLA 1KX4C 4R8PC 3W97A 3LELB 5JRGC 1ZLAC 1P3MC 5B40C 1Q9CA 3KXBD 4J8XB 3W98B 3KFUG 3X1TC 1P3KA 1P3OC 5GSUB 5AVBC 4Z66C 5B0ZB 3B0CT 3X1VA 2Y2HA 2PYOC 5B31B 1HQ3B 3MGPA 5B2ID 2Y2MA 5DNMD 1TZYD 5JA4A 4J8VD 5AV9D 3KUYB 2AROD 5AV5C 2HIOA 3MNNA 4J8UC 4KHAB 3AZIC 4Z2MH 3AZED 3AYWA 5CPJC 4WU9D 1M18B 3MGQD 5AY8B 3UTBB 1PZRA 3AN2B 2CWEA 3B6GD 3AV1D 3W99D 1P3AB 2FJ7D 4M6BA 5B24A 2G5HC 3WKJA 5DNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG B;  4WU8 B;  3NQU B;  3C1B C;  3WAA B;  5AVB A;  3UT9 D;  3A6N D;  1BH8 B;  3VH5 T;  5CPK B;  3REL D;  4XUJ D;  5BNX A;  1KX4 B;  3LZ1 C;  4R8P B;  3MGS C;  5B33 D;  5B40 B;  5AV8 D;  1P3M B;  4YM6 B;  3AZJ A;  3AV2 B;  5B1M A;  4Z5T C;  3REH C;  1P3O B;  4Z66 B;  1EQZ A;  5B1L C;  5GT0 C;  1KX3 B;  1P3F D;  3W98 D;  5CP6 D;  4KGC C;  2HUE C;  4UUZ A;  3AZM C;  1AOI C;  1KU5 A;  2F8N D;  1P3I A;  3B0D B;  1P34 B;  1M1A C;  1HQ3 D;  3AZF B;  5AV5 B;  1R4V A;  4LD9 A;  2NZD A;  4CAY B;  4DRA A;  1U35 B;  2NQB C;  3C1C B;  3V9R B;  5B32 C;  3WTP D;  3MVD D;  3KXB A;  4H9S A;  2JSS A;  5AY8 D;  4J8W C;  5F99 C;  1M19 D;  1F66 C;  4WNN B;  3KWQ C;  3UTB D;  4AWL C;  1P3B C;  4KUD C;  3AFA C;  5E5A C;  5B2I A;  3WA9 B;  5DNM A;  1TZY A;  2YFV A;  3C1B B;  4J8V A;  4HGA C;  3AZH C;  2ARO A;  2BYK A;  4YS3 B;  4WU8 D;  1P3L B;  3LEL C;  3AZE A;  4J8X C;  4WU9 A;  4H9N B;  3MGQ A;  3AZN B;  3MGS B;  5GSU C;  3B6G A;  5B0Z C;  3AV1 A;  5GXQ C;  4Z5T B;  2FJ7 A;  3W99 A;  1KX4 D;  4R8P D;  1ZLA D;  5JRG D;  1P3M D;  5B40 D;  2NQB A;  1P3P A;  3X1T D;  4KGC B;  1P3O D;  3R45 B;  5AVB D;  1N1J A;  4NE5 A;  4Z66 D;  3KUY C;  2BYM B;  2PYO D;  1M1A B;  2IO5 B;  4CSR A;  2F8N G;  5CHL B;  3KWQ A;  5B2J B;  3X1S C;  3UT9 A;  1M18 C;  4H9R A;  3A6N A;  1S32 C;  3AN2 C;  4XUJ A;  1P3G B;  5AV5 D;  4NE6 A;  1P3A C;  5B33 A;  5AV8 A;  4J8U D;  1EQZ D;  3AZI D;  1JFI B;  3AZH A;  5CPJ D;  4J8W B;  3VH6 A;  1P3F A;  3W98 A;  5CP6 A;  3WAA C;  5B0Z A;  3UTA B;  4HGA B;  5B31 A;  1HQ3 A;  3REJ B;  5CPK C;  4XZQ B;  3AZK C;  3AZG C;  4YM6 C;  3AV2 C;  3REK C;  3LZ0 B;  3WTP A;  3REI B;  3MVD A;  4ZBJ B;  4KHA A;  5KDM B;  5GXQ B;  1KX3 C;  4G91 B;  1H3O A;  5AY8 A;  3LZ1 D;  3NQJ B;  1M19 A;  4E44 A;  3MGS D;  3UTB A;  3AN2 A;  5GT3 B;  3REH D;  4DRB A;  1P3A A;  3B0D C;  1P34 C;  3AZF C;  4H9Q B;  5B1L D;  5GT0 D;  1B67 A;  1BH9 A;  3X1U C;  3TU4 B;  3O62 C;  4KGC D;  5FUG A;  3W96 C;  4WU8 A;  3AZM D;  3X1S B;  3C1C C;  5AV6 C;  3NQU A;  1U35 C;  1AOI D;  1S32 B;  5AVC C;  1M1A D;  3WTP E;  5BS7 A;  5CPK A;  2NQB D;  1KX4 A;  3B6F C;  5B32 D;  4R8P A;  5BO0 A;  5JRG A;  1KX5 C;  1P3M A;  5B40 A;  1ZLA A;  3AZL B;  3WA9 C;  3X1T A;  5G49 A;  1P3O A;  1P3K B;  4Z66 A;  4J8W D;  5F99 D;  1F66 D;  4YS3 C;  3KWQ D;  2PYO A;  5BNV A;  1P3B D;  3X1V B;  1P3L C;  4KUD D;  1TAF A;  3AFA D;  5E5A D;  3MGP B;  3AZK B;  3AZN C;  5B0Y C;  1P34 A;  2CV5 C;  3AZG B;  4JJN C;  3AZH D;  5AV5 A;  3REK B;  4J8U A;  3AZI A;  1WWI A;  3LEL D;  4NFT A;  3MNN B;  4CAY A;  5CPJ A;  4J8X D;  3AYW B;  5GSU D;  5B0Z D;  5GXQ D;  5B31 D;  2IO5 C;  4WNN A;  5B2J C;  3X1U B;  5B24 B;  3O62 B;  3WKJ B;  3W96 B;  4X23 C;  3KUY D;  5AV6 B;  1P3G C;  3C1B A;  5AVC B;  4H9O B;  4YS3 A;  3X1S D;  3VH5 A;  2LY8 A;  3MGR B;  1M18 D;  1S32 D;  3AN2 D;  1ULY A;  4H9N A;  3LZ1 A;  1P3A D;  3B6F B;  3MGS A;  1KX5 B;  5B32 G;  3REH A;  4Z5T A;  3UTA C;  3AZJ B;  3REJ C;  5B1M B;  5B1L A;  5GT0 A;  4QLC C;  4XZQ C;  3WAA D;  4KGC A;  3AZM A;  1AOI A;  3LZ0 C;  5B0Y B;  3REI C;  1M1A A;  2CV5 B;  4ZBJ C;  5BT1 C;  1ID3 C;  4JJN B;  5CPK D;  3KSY A;  5B2J A;  4G91 C;  5CPI C;  4ZUX C;  3AZK D;  3AZG D;  4YM6 D;  4LD9 B;  5GT3 C;  2NZD B;  3AV2 D;  2F8N H;  5B32 A;  1JFI A;  1KX3 D;  3KXB B;  3TU4 C;  3LJA C;  4J8W A;  1F66 A;  5F99 A;  5C3I C;  5B31 G;  4NE3 A;  1P3B A;  4KUD A;  3AFA A;  1P34 D;  5E5A A;  3AZF D;  4X23 B;  5B2I B;  3X1U D;  1TZY B;  3O62 D;  2YFV B;  4J8V B;  3B0C W;  1U35 D;  5AV9 B;  3W96 D;  3C1C D;  5AV6 D;  4XZQ A;  2ARO B;  2BYK B;  3LEL A;  5AVC D;  3AZL C;  4J8X A;  3W97 C;  5GSU A;  3REI A;  4WU9 B;  1P3K C;  5KDM A;  5GXQ A;  3B6G B;  3X1V C;  3AV1 B;  3B6F D;  3W99 B;  3NQJ A;  2FJ7 B;  4QLC B;  1BFM A;  3WA9 D;  3MGP C;  3C1B D;  1P3P B;  4H9Q A;  3KUY A;  4YS3 D;  2YFW B;  3TU4 A;  1P3L D;  2HIO C;  1ID3 B;  3MNN C;  4CSR B;  3X1S A;  5CPI B;  1M18 A;  4ZUX B;  3AYW C;  3AZN D;  1S32 A;  5B0Y D;  2CV5 D;  3UT9 B;  4H9R B;  4JJN D;  4Z5T D;  3REL B;  4XUJ B;  4H9P B;  5B24 C;  3LJA B;  3WKJ C;  4G92 B;  5DNN C;  5C3I B;  3VH5 W;  3WAA A;  1P3F B;  5CP6 B;  5B2J D;  2F8N B;  3MGR C;  1BH8 A;  4X23 D;  1P3G D;  3AZK A;  3AZG A;  4YM6 A;  3W97 B;  3AV2 A;  3REK A;  3AZJ C;  5B1M C;  3WTP B;  1KX3 A;  3MVD B;  1EQZ C;  1H3O B;  2RVQ C;  1M19 B;  3UTA D;  4WV4 B;  4Z2M G;  5JA4 B;  3AZF A;  3REJ D;  1P3I C;  4QLC D;  3X1U A;  4XZQ D;  3O62 A;  1BH9 B;  2HIO B;  4LD9 C;  3W96 A;  1U35 A;  2NZD C;  3C1C A;  5AV6 A;  3V9R A;  3LZ0 D;  5AVC A;  3REI D;  4H9O A;  5BT1 D;  1ID3 D;  3KXB C;  4H9S C;  5CPI D;  4ZUX D;  3MGR A;  1WWS A;  5GT3 D;  3B6F A;  1P3P D;  5DNN B;  1KX5 A;  3WA9 A;  1ZLA B;  5BO0 B;  5JRG B;  5B2I C;  5DNM C;  3VH6 W;  1TZY C;  3TU4 D;  3X1T B;  3LJA D;  5G49 B;  4J8V C;  5AVB B;  5AV9 C;  2ARO C;  1P3L A;  2PYO B;  5BNV B;  1TAF B;  3AZE C;  3AZN A;  5B0Y A;  4WU9 C;  5BNX B;  2CV5 A;  3MGQ C;  4JJN A;  3B6G C;  3AV1 C;  3W99 C;  2FJ7 C;  3AZL D;  4J8U B;  1EQZ B;  3AZI B;  3W97 D;  5CPJ B;  3R45 A;  1P3P C;  1P3K D;  2BYM A;  4UUZ B;  3X1V D;  1P3I B;  4EO5 C;  3MGP D;  3UT9 C;  3A6N C;  4X23 A;  1P3G A;  3REK D;  3REL C;  4XUJ C;  2HIO D;  2F8N K;  3MNN D;  5B33 C;  5AV8 C;  3B0B A;  5AV9 A;  4G92 C;  3AYW D;  4WZS B;  1P3F C;  3W98 C;  5CP6 C;  3VH6 T;  3LZ1 B;  3UTA A;  5DNM B;  5B24 D;  3REJ A;  3WKJ D;  3REH B;  4E45 A;  4QLC A;  5DNN D;  5B31 C;  1HQ3 C;  5B1L B;  5GT0 B;  2L5A A;  3LZ0 A;  3AZE B;  2HUE B;  3AZM B;  1AOI B;  2YFW A;  3MGR D;  3MGQ B;  1ID3 A;  1HTA A;  3WTP C;  3MVD C;  5CPI A;  4ZUX A;  1KX5 D;  1B6W A;  5AY8 C;  5GT3 A;  1M19 C;  3UTB C;  2NQB B;  3REL A;  3AZJ D;  5B1M D;  4H9P A;  5B32 B;  1N1J B;  3LJA A;  4EO5 B;  2RVQ D;  5F99 B;  1F66 B;  3KWQ B;  1F1E A;  4AWL B;  4WU8 C;  1P3B B;  1P3I D;  3A6N B;  4KUD B;  3AFA B;  5E5A B;  2F8N A;  1A7W A;  5B33 B;  5AV8 B;  4LD9 D;  2NZD D;  5BS7 C;  3AZH B;  3AZL A;  1KX4 C;  4R8P C;  3W97 A;  3LEL B;  5JRG C;  1ZLA C;  1P3M C;  5B40 C;  1Q9C A;  3KXB D;  4J8X B;  3W98 B;  3X1T C;  1P3K A;  1P3O C;  5GSU B;  5AVB C;  4Z66 C;  5B0Z B;  3B0C T;  3X1V A;  2PYO C;  5B31 B;  1HQ3 B;  3MGP A;  5B2I D;  5DNM D;  1TZY D;  5JA4 A;  4J8V D;  5AV9 D;  3KUY B;  2ARO D;  5AV5 C;  2HIO A;  3MNN A;  4J8U C;  4KHA B;  3AZI C;  4Z2M H;  3AZE D;  3AYW A;  5CPJ C;  4WU9 D;  1M18 B;  3MGQ D;  5AY8 B;  3UTB B;  3AN2 B;  2CWE A;  3B6G D;  3AV1 D;  3W99 D;  1P3A B;  2FJ7 D;  4M6B A;  5B24 A;  3WKJ A;  5DNN A; 
#chains in the Genus database with same CATH topology
 5FUG B;  4WU8 B;  3NQU B;  3EPL A;  3C1B C;  3WAA B;  5AVB A;  2Y2N A;  2ZY3 A;  3P5J B;  2JE5 A;  3UT9 D;  3A6N D;  1BH8 B;  2XD5 A;  3VH5 T;  5CPK B;  3REL D;  4XUJ D;  2FFF B;  5BNX A;  1KX4 B;  3LZ1 C;  4R8P B;  3MGS C;  5B33 D;  5B40 B;  5AV8 D;  1P3M B;  4YM6 B;  3AZJ A;  3AV2 B;  5B1M A;  4Z5T C;  3REH C;  1P3O B;  4Z66 B;  1EQZ A;  5B1L C;  5GT0 C;  1KX3 B;  1P3F D;  3W98 D;  5CP6 D;  4KGC C;  2HUE C;  4UUZ A;  3AZM C;  1AOI C;  1KU5 A;  2F8N D;  1P3I A;  3B0D B;  1P34 B;  1M1A C;  1HQ3 D;  3AZF B;  5AV5 B;  1R4V A;  3IP4 C;  4LD9 A;  2NZD A;  4CAY B;  4DRA A;  1U35 B;  2NQB C;  3A1K A;  3C1C B;  3V9R B;  5B32 C;  3WTP D;  3MVD D;  3KXB A;  4H9S A;  2JSS A;  5AY8 D;  4J8W C;  5F99 C;  1M19 D;  1F66 C;  4WNN B;  3KWQ C;  3UTB D;  4AWL C;  1P3B C;  4KUD C;  3AFA C;  5E5A C;  5B2I A;  3WA9 B;  5DNM A;  2G5I C;  1TZY A;  2YFV A;  3C1B B;  4J8V A;  4HGA C;  3AZH C;  2ARO A;  2BYK A;  4YS3 B;  4WU8 D;  1P3L B;  2DF4 C;  3LEL C;  3F6T A;  3AZE A;  4J8X C;  4WU9 A;  4H9N B;  3MGQ A;  3AZN B;  3MGS B;  5GSU C;  3B6G A;  5B0Z C;  3AV1 A;  5GXQ C;  4Z5T B;  2FJ7 A;  3W99 A;  1KX4 D;  4R8P D;  1ZLA D;  5JRG D;  1P3M D;  5B40 D;  2ZY5 A;  2NQB A;  1P3P A;  3X1T D;  4KGC B;  1P3O D;  3R45 B;  5AVB D;  1N1J A;  4NE5 A;  4Z66 D;  3KUY C;  2BYM B;  2PYO D;  1M1A B;  2IO5 B;  4CSR A;  2F8N G;  5CHL B;  3KWQ A;  5B2J B;  3X1S C;  3UT9 A;  1M18 C;  4H9R A;  3A6N A;  1S32 C;  3AN2 C;  4XUJ A;  1P3G B;  5AV5 D;  4NE6 A;  1P3A C;  5B33 A;  5AV8 A;  4J8U D;  1EQZ D;  3AZI D;  1JFI B;  3AZH A;  2XD1 A;  5CPJ D;  3H0R C;  4J8W B;  3EPH A;  3VH6 A;  1P3F A;  3W98 A;  5CP6 A;  3WAA C;  1T3U A;  5B0Z A;  3UTA B;  4HGA B;  5B31 A;  1HQ3 A;  3REJ B;  5CPK C;  4XZQ B;  3AZK C;  3AZG C;  4YM6 C;  3AV2 C;  3REK C;  3LZ0 B;  3H0L C;  3WTP A;  3REI B;  3MVD A;  4ZBJ B;  4KHA A;  5KDM B;  5GXQ B;  1KX3 C;  4G91 B;  1H3O A;  5AY8 A;  3LZ1 D;  3NQJ B;  1M19 A;  4E44 A;  3MGS D;  3UTB A;  3EPJ A;  3AN2 A;  5GT3 B;  3REH D;  4DRB A;  1P3A A;  3B0D C;  1P34 C;  3AZF C;  4H9Q B;  5B1L D;  5GT0 D;  1B67 A;  1BH9 A;  3X1U C;  3TU4 B;  3O62 C;  4KGC D;  5FUG A;  3W96 C;  4WU8 A;  3AZM D;  3X1S B;  3C1C C;  4UPK A;  3NQU A;  5AV6 C;  1U35 C;  1AOI D;  1S32 B;  5AVC C;  1M1A D;  3WTP E;  5BS7 A;  3EG5 B;  5CPK A;  2NQB D;  1KX4 A;  3B6F C;  5B32 D;  4R8P A;  5BO0 A;  5JRG A;  1KX5 C;  2Y2J A;  5B40 A;  1P3M A;  3AZL B;  1ZLA A;  3WA9 C;  3X1T A;  5G49 A;  1P3O A;  1P3K B;  4Z66 A;  4J8W D;  5F99 D;  1F66 D;  4YS3 C;  3KWQ D;  2PYO A;  5BNV A;  1P3B D;  3X1V B;  1P3L C;  4KUD D;  1TAF A;  3AFA D;  5E5A D;  3MGP B;  3AZK B;  3AZN C;  5B0Y C;  1P34 A;  2CV5 C;  3AZG B;  4JJN C;  3AZH D;  5AV5 A;  3REK B;  4J8U A;  3AZI A;  1WWI A;  3LEL D;  4NFT A;  3MNN B;  4CAY A;  5CPJ A;  4J8X D;  3AYW B;  5GSU D;  5B0Z D;  5GXQ D;  5B31 D;  2IO5 C;  4WNN A;  2Y2L A;  5B2J C;  2ZY2 A;  3X1U B;  5B24 B;  3O62 B;  3WKJ B;  3W96 B;  4X23 C;  3KUY D;  5AV6 B;  1P3G C;  3C1B A;  5AVC B;  4H9O B;  2Y2G A;  4YS3 A;  3X1S D;  3VH5 A;  2LY8 A;  3MGR B;  1M18 D;  1S32 D;  3AN2 D;  1ULY A;  4H9N A;  3LZ1 A;  1P3A D;  3B6F B;  3MGS A;  1KX5 B;  5B32 G;  3REH A;  4Z5T A;  3UTA C;  3AZJ B;  3REJ C;  5B1M B;  5B1L A;  5GT0 A;  4QLC C;  4XZQ C;  3WAA D;  4KGC A;  3AZM A;  1AOI A;  3LZ0 C;  5B0Y B;  3REI C;  1M1A A;  2CV5 B;  4ZBJ C;  5BT1 C;  1ID3 C;  4JJN B;  5CPK D;  3KSY A;  5B2J A;  4G91 C;  5CPI C;  4ZUX C;  3AZK D;  3AZG D;  4YM6 D;  4LD9 B;  5GT3 C;  2NZD B;  3AV2 D;  2F8N H;  5B32 A;  4WJ3 C;  1JFI A;  2Y2K A;  1KX3 D;  1Z2C B;  3KXB B;  3TU4 C;  3LJA C;  4J8W A;  1F66 A;  5F99 A;  5C3I C;  5B31 G;  2W8S A;  4NE3 A;  1P3B A;  3AL0 C;  4KUD A;  2VQR A;  3AFA A;  1P34 D;  5E5A A;  3AZF D;  4X23 B;  3EPK A;  5B2I B;  3X1U D;  1TZY B;  3O62 D;  2YFV B;  4J8V B;  3B0C W;  1U35 D;  5AV9 B;  3W96 D;  3C1C D;  5AV6 D;  4XZQ A;  2ARO B;  2BYK B;  3LEL A;  5AVC D;  2Y2P A;  3AZL C;  4J8X A;  3W97 C;  5GSU A;  3REI A;  2J8P A;  4WU9 B;  1P3K C;  5KDM A;  5GXQ A;  3B6G B;  3X1V C;  3AV1 B;  2ZM5 A;  3B6F D;  3NQJ A;  2FJ7 B;  4QLC B;  3W99 B;  3WA9 D;  1BFM A;  3MGP C;  3C1B D;  1P3P B;  4H9Q A;  3KUY A;  4YS3 D;  2YFW B;  3TU4 A;  1P3L D;  2HIO C;  1ID3 B;  3MNN C;  4CSR B;  3X1S A;  5CPI B;  1M18 A;  4ZUX B;  3AYW C;  3AZN D;  1S32 A;  5B0Y D;  2CV5 D;  3UT9 B;  4H9R B;  3A1I A;  4JJN D;  4Z5T D;  3REL B;  4XUJ B;  4H9P B;  5B24 C;  3LJA B;  3WKJ C;  4G92 B;  5DNN C;  5C3I B;  3VH5 W;  3WAA A;  1P3F B;  5CP6 B;  2JCH A;  5B2J D;  2F8N B;  3MGR C;  1BH8 A;  4X23 D;  1P3G D;  2Y2I A;  3AZK A;  3FDD A;  3AZG A;  4YM6 A;  3W97 B;  3AV2 A;  3REK A;  3AZJ C;  5B1M C;  3WTP B;  1KX3 A;  3MVD B;  1EQZ C;  1H3O B;  2RVQ C;  1M19 B;  3UTA D;  4WV4 B;  4Z2M G;  5JA4 B;  3AZF A;  3REJ D;  1P3I C;  4QLC D;  3X1U A;  4XZQ D;  3O62 A;  1BH9 B;  2HIO B;  4LD9 C;  3W96 A;  1U35 A;  2NZD C;  3C1C A;  5AV6 A;  3V9R A;  3LZ0 D;  5AVC A;  3REI D;  4H9O A;  5BT1 D;  1ID3 D;  3KXB C;  4H9S C;  5CPI D;  4ZUX D;  3MGR A;  1WWS A;  5GT3 D;  3B6F A;  1P3P D;  2RIQ A;  5DNN B;  1KX5 A;  3WA9 A;  1ZLA B;  5BO0 B;  5JRG B;  5B2I C;  5DNM C;  3VH6 W;  1TZY C;  3TU4 D;  3X1T B;  3LJA D;  5G49 B;  4J8V C;  5AVB B;  5AV9 C;  2ARO C;  1P3L A;  2PYO B;  5BNV B;  1TAF B;  3AZE C;  3AZN A;  5B0Y A;  4WU9 C;  5BNX B;  2CV5 A;  3MGQ C;  4JJN A;  3B6G C;  2ZY4 A;  3AV1 C;  3W99 C;  2FJ7 C;  3AZL D;  4J8U B;  1EQZ B;  3AZI B;  3W97 D;  2F2A C;  2BG1 A;  2UWX A;  4DQY B;  5CPJ B;  3R45 A;  1P3P C;  1P3K D;  2BYM A;  4UUZ B;  3X1V D;  1P3I B;  4EO5 C;  3MGP D;  3UT9 C;  3A6N C;  4X23 A;  1P3G A;  3REK D;  3H0M C;  3REL C;  4XUJ C;  2HIO D;  2F8N K;  3MNN D;  5B33 C;  5AV8 C;  3B0B A;  5AV9 A;  4G92 C;  3AYW D;  4WZS B;  1P3F C;  3W98 C;  5CP6 C;  3VH6 T;  3LZ1 B;  3UTA A;  5DNM B;  5B24 D;  3REJ A;  3WKJ D;  3REH B;  4E45 A;  4QLC A;  5DNN D;  5B31 C;  1HQ3 C;  2Y2O A;  5B1L B;  5GT0 B;  2L5A A;  3LZ0 A;  3AZE B;  2HUE B;  3AZM B;  1AOI B;  2YFW A;  3MGR D;  3MGQ B;  1ID3 A;  1HTA A;  3WTP C;  3MVD C;  5CPI A;  4ZUX A;  1W2E A;  1KX5 D;  1B6W A;  5AY8 C;  5GT3 A;  1M19 C;  3UTB C;  2NQB B;  3REL A;  3AZJ D;  5B1M D;  4H9P A;  5B32 B;  1N1J B;  3LJA A;  4EO5 B;  2Y2Q A;  2RVQ D;  2DQN C;  5F99 B;  1F66 B;  3KWQ B;  1F1E A;  4AWL B;  4WU8 C;  1P3B B;  1P3I D;  3A6N B;  4KUD B;  3AFA B;  5E5A B;  2F8N A;  1A7W A;  5B33 B;  5AV8 B;  4LD9 D;  2NZD D;  5BS7 C;  3AZH B;  3AZL A;  1KX4 C;  4R8P C;  3W97 A;  3LEL B;  5JRG C;  1ZLA C;  1P3M C;  5B40 C;  1Q9C A;  3KXB D;  4J8X B;  3W98 B;  3KFU G;  3X1T C;  1P3K A;  1P3O C;  5GSU B;  5AVB C;  4Z66 C;  5B0Z B;  3B0C T;  3X1V A;  2Y2H A;  2PYO C;  5B31 B;  1HQ3 B;  3MGP A;  5B2I D;  2Y2M A;  5DNM D;  1TZY D;  5JA4 A;  4J8V D;  5AV9 D;  3KUY B;  2ARO D;  5AV5 C;  2HIO A;  3MNN A;  4J8U C;  4KHA B;  3AZI C;  4Z2M H;  3AZE D;  3AYW A;  5CPJ C;  4WU9 D;  1M18 B;  3MGQ D;  5AY8 B;  3UTB B;  1PZR A;  3AN2 B;  2CWE A;  3B6G D;  3AV1 D;  3W99 D;  1P3A B;  2FJ7 D;  4M6B A;  5B24 A;  2G5H C;  3WKJ A;  5DNN A; 
#chains in the Genus database with same CATH homology
 5FUG B;  4WU8 B;  3NQU B;  3EPL A;  3C1B C;  3WAA B;  5AVB A;  2Y2N A;  2ZY3 A;  3P5J B;  2JE5 A;  3UT9 D;  3A6N D;  1BH8 B;  2XD5 A;  3VH5 T;  5CPK B;  3REL D;  4XUJ D;  2FFF B;  5BNX A;  1KX4 B;  3LZ1 C;  4R8P B;  3MGS C;  5B33 D;  5B40 B;  5AV8 D;  1P3M B;  4YM6 B;  3AZJ A;  3AV2 B;  5B1M A;  4Z5T C;  3REH C;  1P3O B;  4Z66 B;  1EQZ A;  5B1L C;  5GT0 C;  1KX3 B;  1P3F D;  3W98 D;  5CP6 D;  4KGC C;  2HUE C;  4UUZ A;  3AZM C;  1AOI C;  1KU5 A;  2F8N D;  1P3I A;  3B0D B;  1P34 B;  1M1A C;  1HQ3 D;  3AZF B;  5AV5 B;  1R4V A;  3IP4 C;  4LD9 A;  2NZD A;  4CAY B;  4DRA A;  1U35 B;  2NQB C;  3A1K A;  3C1C B;  3V9R B;  5B32 C;  3WTP D;  3MVD D;  3KXB A;  4H9S A;  2JSS A;  5AY8 D;  4J8W C;  5F99 C;  1M19 D;  1F66 C;  4WNN B;  3KWQ C;  3UTB D;  4AWL C;  1P3B C;  4KUD C;  3AFA C;  5E5A C;  5B2I A;  3WA9 B;  5DNM A;  2G5I C;  1TZY A;  2YFV A;  3C1B B;  4J8V A;  4HGA C;  3AZH C;  2ARO A;  2BYK A;  4YS3 B;  4WU8 D;  1P3L B;  2DF4 C;  3LEL C;  3F6T A;  3AZE A;  4J8X C;  4WU9 A;  4H9N B;  3MGQ A;  3AZN B;  3MGS B;  5GSU C;  3B6G A;  5B0Z C;  3AV1 A;  5GXQ C;  4Z5T B;  2FJ7 A;  3W99 A;  1KX4 D;  4R8P D;  1ZLA D;  5JRG D;  1P3M D;  5B40 D;  2ZY5 A;  2NQB A;  1P3P A;  3X1T D;  4KGC B;  1P3O D;  3R45 B;  5AVB D;  1N1J A;  4NE5 A;  4Z66 D;  3KUY C;  2BYM B;  2PYO D;  1M1A B;  2IO5 B;  4CSR A;  2F8N G;  5CHL B;  3KWQ A;  5B2J B;  3X1S C;  3UT9 A;  1M18 C;  4H9R A;  3A6N A;  1S32 C;  3AN2 C;  4XUJ A;  1P3G B;  5AV5 D;  4NE6 A;  1P3A C;  5B33 A;  5AV8 A;  4J8U D;  1EQZ D;  3AZI D;  1JFI B;  3AZH A;  2XD1 A;  5CPJ D;  3H0R C;  4J8W B;  3EPH A;  3VH6 A;  1P3F A;  3W98 A;  5CP6 A;  3WAA C;  1T3U A;  5B0Z A;  3UTA B;  4HGA B;  5B31 A;  1HQ3 A;  3REJ B;  5CPK C;  4XZQ B;  3AZK C;  3AZG C;  4YM6 C;  3AV2 C;  3REK C;  3LZ0 B;  3H0L C;  3WTP A;  3REI B;  3MVD A;  4ZBJ B;  4KHA A;  5KDM B;  5GXQ B;  1KX3 C;  4G91 B;  1H3O A;  5AY8 A;  3LZ1 D;  3NQJ B;  1M19 A;  4E44 A;  3MGS D;  3UTB A;  3EPJ A;  3AN2 A;  5GT3 B;  3REH D;  4DRB A;  1P3A A;  3B0D C;  1P34 C;  3AZF C;  4H9Q B;  5B1L D;  5GT0 D;  1B67 A;  1BH9 A;  3X1U C;  3TU4 B;  3O62 C;  4KGC D;  5FUG A;  3W96 C;  4WU8 A;  3AZM D;  3X1S B;  3C1C C;  4UPK A;  3NQU A;  5AV6 C;  1U35 C;  1AOI D;  1S32 B;  5AVC C;  1M1A D;  3WTP E;  5BS7 A;  3EG5 B;  5CPK A;  2NQB D;  1KX4 A;  3B6F C;  5B32 D;  4R8P A;  5BO0 A;  5JRG A;  1KX5 C;  2Y2J A;  5B40 A;  1P3M A;  3AZL B;  1ZLA A;  3WA9 C;  3X1T A;  5G49 A;  1P3O A;  1P3K B;  4Z66 A;  4J8W D;  5F99 D;  1F66 D;  4YS3 C;  3KWQ D;  2PYO A;  5BNV A;  1P3B D;  3X1V B;  1P3L C;  4KUD D;  1TAF A;  3AFA D;  5E5A D;  3MGP B;  3AZK B;  3AZN C;  5B0Y C;  1P34 A;  2CV5 C;  3AZG B;  4JJN C;  3AZH D;  5AV5 A;  3REK B;  4J8U A;  3AZI A;  1WWI A;  3LEL D;  4NFT A;  3MNN B;  4CAY A;  5CPJ A;  4J8X D;  3AYW B;  5GSU D;  5B0Z D;  5GXQ D;  5B31 D;  2IO5 C;  4WNN A;  2Y2L A;  5B2J C;  2ZY2 A;  3X1U B;  5B24 B;  3O62 B;  3WKJ B;  3W96 B;  4X23 C;  3KUY D;  5AV6 B;  1P3G C;  3C1B A;  5AVC B;  4H9O B;  2Y2G A;  4YS3 A;  3X1S D;  3VH5 A;  2LY8 A;  3MGR B;  1M18 D;  1S32 D;  3AN2 D;  1ULY A;  4H9N A;  3LZ1 A;  1P3A D;  3B6F B;  3MGS A;  1KX5 B;  5B32 G;  3REH A;  4Z5T A;  3UTA C;  3AZJ B;  3REJ C;  5B1M B;  5B1L A;  5GT0 A;  4QLC C;  4XZQ C;  3WAA D;  4KGC A;  3AZM A;  1AOI A;  3LZ0 C;  5B0Y B;  3REI C;  1M1A A;  2CV5 B;  4ZBJ C;  5BT1 C;  1ID3 C;  4JJN B;  5CPK D;  3KSY A;  5B2J A;  4G91 C;  5CPI C;  4ZUX C;  3AZK D;  3AZG D;  4YM6 D;  4LD9 B;  5GT3 C;  2NZD B;  3AV2 D;  2F8N H;  5B32 A;  4WJ3 C;  1JFI A;  2Y2K A;  1KX3 D;  1Z2C B;  3KXB B;  3TU4 C;  3LJA C;  4J8W A;  1F66 A;  5F99 A;  5C3I C;  5B31 G;  2W8S A;  4NE3 A;  1P3B A;  3AL0 C;  4KUD A;  2VQR A;  3AFA A;  1P34 D;  5E5A A;  3AZF D;  4X23 B;  3EPK A;  5B2I B;  3X1U D;  1TZY B;  3O62 D;  2YFV B;  4J8V B;  3B0C W;  1U35 D;  5AV9 B;  3W96 D;  3C1C D;  5AV6 D;  4XZQ A;  2ARO B;  2BYK B;  3LEL A;  5AVC D;  2Y2P A;  3AZL C;  4J8X A;  3W97 C;  5GSU A;  3REI A;  2J8P A;  4WU9 B;  1P3K C;  5KDM A;  5GXQ A;  3B6G B;  3X1V C;  3AV1 B;  2ZM5 A;  3B6F D;  3NQJ A;  2FJ7 B;  4QLC B;  3W99 B;  3WA9 D;  1BFM A;  3MGP C;  3C1B D;  1P3P B;  4H9Q A;  3KUY A;  4YS3 D;  2YFW B;  3TU4 A;  1P3L D;  2HIO C;  1ID3 B;  3MNN C;  4CSR B;  3X1S A;  5CPI B;  1M18 A;  4ZUX B;  3AYW C;  3AZN D;  1S32 A;  5B0Y D;  2CV5 D;  3UT9 B;  4H9R B;  3A1I A;  4JJN D;  4Z5T D;  3REL B;  4XUJ B;  4H9P B;  5B24 C;  3LJA B;  3WKJ C;  4G92 B;  5DNN C;  5C3I B;  3VH5 W;  3WAA A;  1P3F B;  5CP6 B;  2JCH A;  5B2J D;  2F8N B;  3MGR C;  1BH8 A;  4X23 D;  1P3G D;  2Y2I A;  3AZK A;  3FDD A;  3AZG A;  4YM6 A;  3W97 B;  3AV2 A;  3REK A;  3AZJ C;  5B1M C;  3WTP B;  1KX3 A;  3MVD B;  1EQZ C;  1H3O B;  2RVQ C;  1M19 B;  3UTA D;  4WV4 B;  4Z2M G;  5JA4 B;  3AZF A;  3REJ D;  1P3I C;  4QLC D;  3X1U A;  4XZQ D;  3O62 A;  1BH9 B;  2HIO B;  4LD9 C;  3W96 A;  1U35 A;  2NZD C;  3C1C A;  5AV6 A;  3V9R A;  3LZ0 D;  5AVC A;  3REI D;  4H9O A;  5BT1 D;  1ID3 D;  3KXB C;  4H9S C;  5CPI D;  4ZUX D;  3MGR A;  1WWS A;  5GT3 D;  3B6F A;  1P3P D;  2RIQ A;  5DNN B;  1KX5 A;  3WA9 A;  1ZLA B;  5BO0 B;  5JRG B;  5B2I C;  5DNM C;  3VH6 W;  1TZY C;  3TU4 D;  3X1T B;  3LJA D;  5G49 B;  4J8V C;  5AVB B;  5AV9 C;  2ARO C;  1P3L A;  2PYO B;  5BNV B;  1TAF B;  3AZE C;  3AZN A;  5B0Y A;  4WU9 C;  5BNX B;  2CV5 A;  3MGQ C;  4JJN A;  3B6G C;  2ZY4 A;  3AV1 C;  3W99 C;  2FJ7 C;  3AZL D;  4J8U B;  1EQZ B;  3AZI B;  3W97 D;  2F2A C;  2BG1 A;  2UWX A;  4DQY B;  5CPJ B;  3R45 A;  1P3P C;  1P3K D;  2BYM A;  4UUZ B;  3X1V D;  1P3I B;  4EO5 C;  3MGP D;  3UT9 C;  3A6N C;  4X23 A;  1P3G A;  3REK D;  3H0M C;  3REL C;  4XUJ C;  2HIO D;  2F8N K;  3MNN D;  5B33 C;  5AV8 C;  3B0B A;  5AV9 A;  4G92 C;  3AYW D;  4WZS B;  1P3F C;  3W98 C;  5CP6 C;  3VH6 T;  3LZ1 B;  3UTA A;  5DNM B;  5B24 D;  3REJ A;  3WKJ D;  3REH B;  4E45 A;  4QLC A;  5DNN D;  5B31 C;  1HQ3 C;  2Y2O A;  5B1L B;  5GT0 B;  2L5A A;  3LZ0 A;  3AZE B;  2HUE B;  3AZM B;  1AOI B;  2YFW A;  3MGR D;  3MGQ B;  1ID3 A;  1HTA A;  3WTP C;  3MVD C;  5CPI A;  4ZUX A;  1W2E A;  1KX5 D;  1B6W A;  5AY8 C;  5GT3 A;  1M19 C;  3UTB C;  2NQB B;  3REL A;  3AZJ D;  5B1M D;  4H9P A;  5B32 B;  1N1J B;  3LJA A;  4EO5 B;  2Y2Q A;  2RVQ D;  2DQN C;  5F99 B;  1F66 B;  3KWQ B;  1F1E A;  4AWL B;  4WU8 C;  1P3B B;  1P3I D;  3A6N B;  4KUD B;  3AFA B;  5E5A B;  2F8N A;  1A7W A;  5B33 B;  5AV8 B;  4LD9 D;  2NZD D;  5BS7 C;  3AZH B;  3AZL A;  1KX4 C;  4R8P C;  3W97 A;  3LEL B;  5JRG C;  1ZLA C;  1P3M C;  5B40 C;  1Q9C A;  3KXB D;  4J8X B;  3W98 B;  3KFU G;  3X1T C;  1P3K A;  1P3O C;  5GSU B;  5AVB C;  4Z66 C;  5B0Z B;  3B0C T;  3X1V A;  2Y2H A;  2PYO C;  5B31 B;  1HQ3 B;  3MGP A;  5B2I D;  2Y2M A;  5DNM D;  1TZY D;  5JA4 A;  4J8V D;  5AV9 D;  3KUY B;  2ARO D;  5AV5 C;  2HIO A;  3MNN A;  4J8U C;  4KHA B;  3AZI C;  4Z2M H;  3AZE D;  3AYW A;  5CPJ C;  4WU9 D;  1M18 B;  3MGQ D;  5AY8 B;  3UTB B;  1PZR A;  3AN2 B;  2CWE A;  3B6G D;  3AV1 D;  3W99 D;  1P3A B;  2FJ7 D;  4M6B A;  5B24 A;  2G5H C;  3WKJ A;  5DNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...