3KUYD

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
total genus 39
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyD00
3UTBC 4X23B 4M6BA 3AYWD 2NQBC 3B6GB 4WU9B 3REIB 3AZEB 4E45A 4LD9C 4KGCD 1F66B 4Z2MH 5KDMB 5AY8D 1ULYA 3WAAC 4JJNA 3B0CT 3KXBB 3O62D 3AZFB 1KX3A 5B0ZB 3AV1A 1H3OA 3AZHD 3W97C 5AVCA 3X1TB 2NZDD 4Z2MG 2CWEA 3AZNB 5F99B 3MGPC 3AZGD 5B32A 5CPJD 3LZ1A 1KX5A 3AZLD 4J8XD 2F8NA 3AZJC 4H9NA 5CHLB 3LZ0C 4G91B 4YM6D 1P3AC 3UTAD 5GXQC 3C1CD 5GSUB 2BYKA 5CP6B 4J8UA 5B33B 3RELD 1HQ3D 5AVBD 3MNNB 5CPIC 4J8WA 4KHAB 3WTPD 3W98C 3WA9A 3VH6T 4XZQA 3WTPE 3X1VB 1P3KB 3W99B 3MGRA 3UTBD 4QLCC 1AOIC 1P34C 2NQBD 5BNXA 3REHA 5B24C 2IO5B 4ZUXC 3AYWA 2LY8A 3VH5W 3MGSB 1ID3B 4R8PD 1P3BC 2BYMB 3WAAD 3UT9C 3LELB 5AV9B 5B31C 3AFAB 2YFVB 5AY8A 3B0DC 3W97D 3O62A 1HTAA 3REJC 2FJ7B 1M19D 1M1AC 3KWQB 4NE3A 4XUJC 3X1SC 1P3LB 2NZDA 2CV5B 3AZGA 3AZJD 5GT0B 2AROA 3LZ0D 5BO0B 5CPJA 1P3AD 2HUEC 4ZBJB 5GXQD 5B2IB 4J8XA 3AZLA 4YS3B 1TZYB 1BFMA 5DNNB 4YM6A 3UTAA 5B1MB 5AV8A 3W98D 2HIOB 5AV6C 1P3PC 4H9RA 3B6FB 3RELA 1S32C 5AVBA 4QLCD 3REKB 4KUDC 1AOID 3WTPA 3AV2B 1P34D 1P3FC 4H9QA 5JRGC 5B24D 3UTBA 1EQZC 4Z66C 4ZUXD 2NQBA 1WWSA 3AN2B 3VH5T 4NE6A 4NFTA 3TU4B 4WU8C 3WKJC 1P3BD 4LD9A 3UT9D 3AZIB 1H3OB 4Z5TB 5B31D 5AVCB 3AZMC 1P3GB 3WAAA 3REJD 1P3OC 3W97A 4XUJD 1P3IC 3LZ1D 3X1SD 4AWLB 4WZSB 4J8VB 1M19A 3MGPA 4X23C 3C1BB 3B6GC 2BYKB 3X1UB 3AZEC 1U35B 3KUYC 3AZJA 2PYOB 3LZ0A 4J8WB 3V9RA 1P3AA 5GXQA 1F66C 5AV6D 1P3PD 1S32D 3NQUA 3KXBC 3AZFC 4KUDD 1BH9A 3W98A 3VH6A 4QLCA 1EQZD 4Z66D 1AOIA 1BH8A 3X1TC 1P34A 4WU8D 5B24A 4KGCB 3WKJD 5BT1C 1TAFB 4ZUXA 4HGAC 5AY8B 5C3IB 3O62B 1P3BA 3UT9A 1R4VA 5GSUC 3AZHB 5B31A 5CP6C 5CPKC 1P3OD 5B33C 5FUGA 3MNNC 5B2JC 1P3ID 5B40B 1M18B 3REJA 3AZGB 1JFIB 3X1VC 5E5AB 1P3KC 4CSRA 4X23D 3AZKB 2AROD 4G92B 1M1AA 4XUJA 3AZLB 3X1SA 3MVDB 3W96B 3AZED 4CAYB 3KUYD 2RVQC 3C1CB 3MGSC 1F66D 5AV8D 1HQ3B 3LELC 3KXBD 5DNMB 3AZFD 5AV9C 3A6NB 5AV6A 3AFAC 1P3PA 5GT3B 1S32A 4KUDA 4WNNA 2YFWA 4H9PA 1P3FA 4UUZA 2FJ7C 5JRGA 4EO5B 5BT1D 1EQZA 4Z66A 3KWQC 4LD9D 1P3MB 1P3LC 4R8PB 4WU8A 2CV5C 3NQJA 3WAAB 3WKJA 3LJAB 5GT0C 3VH5A 1KX4B 5B2IC 5GSUD 4YS3C 1TZYC 5CPKD 5DNNC 5B33D 4DRAA 3AZMA 5B2JD 1N1JB 1M19B 2HIOC 5B1LB 3B6FC 1P3OA 5AV5B 3X1VD 3MGPD 1P3KD 3REKC 1P3IA 3AV2C 4DRBA 3R45B 4X23A 3MGQB 5G49B 3B6GA 3AN2C 3AZEA 3TU4C 3KUYA 1ZLAB 5CPID 5B0YB 3AZIC 1F66A 5AV9D 5KDMA 4Z5TC 3AFAD 5AVCC 1P3GC 1AOIB 3KXBA 3AZFA 2FJ7D 3KWQD 3X1TA 1P3LD 4AWLC 4J8VC 4NE5A 4JJNB 3C1BC 1KX3B 5B31B 3X1UC 1U35C 3AV1B 4YS3D 2PYOC 4J8WC 1TZYD 5DNND 5GSUA 2L5AA 5B32B 5CP6A 5CPKA 3B6FD 5B33A 2F8NK 3LZ1B 1M1AD 5B2JA 3REKD 1KX5B 4KHAA 2F8NH 2F8NB 4H9NB 3X1VA 1P3KA 4WU9C 3REIC 4J8UB 3TU4D 4KGCC 3WA9B 3MGSA 4XZQB 5C3IC 2F8NG 4Z5TD 3MGRB 3O62C 1A7WA 1P3GD 4H9SC 2YFWB 5CPIA 3LELA 4UUZB 5BNXB 5AV9A 3REHB 3AZHC 3AFAA 2YFVA 1P3FD 5JRGD 3AYWB 5B0ZC 5B40C 1M18C 3WKJB 2FJ7A 3AZNC 4J8VD 5F99C 5E5AC 3AZKC 4G92C 3KWQA 3AZLC 3MVDC 1P3LA 3X1UD 2CV5A 3W96C 1U35D 1B6WA 1Q9CA 5GT0A 2PYOD 4G91C 5BO0A 3C1CC 3AZMD 5B2IA 4YS3A 1HQ3C 1TZYA 5DNNA 2NZDB 5DNMC 3A6NC 2HIOA 2AROB 3B6FA 5GT3C 5CPJB 3W99C 3REKA 4J8XB 3KUYB 3AV2A 3B6GD 4WU9D 3REID 4EO5C 4YM6B 3UTAB 2IO5C 5AV8B 1P3MC 1ID3C 4R8PC 4H9RB 3AN2A 3RELB 3TU4A 5AVBB 3LJAC 3WTPB 4H9OA 1KX4C 4H9QB 3AZIA 4Z5TA 3UTBB 5B0ZD 1P3GA 2NQBB 1M19C 5B40D 1M18D 5BS7C 3X1TD 5B1LC 3AZND 5AV5C 4LD9B 5F99D 5E5AD 3AZKD 5BNVA 4HGAB 3MVDD 3W96D 4J8VA 3MGQC 3C1BA 3X1UA 4ZBJC 5CPKB 1U35A 1ZLAC 3W97B 5CP6D 2PYOA 1F1EA 5B2JB 3MNND 5DNMD 5B0YC 5B1MC 3A6ND 3MGPB 5GT3D 3W99D 5JA4A 3AZJB 3LZ0B 3V9RB 1P3AB 2RVQD 5GXQB 4E44A 1P3MD 4WU9A 3MGSD 3REIA 1ID3D 1B67A 4JJNC 4KGCA 3LJAD 1TAFA 3NQUB 5CPIB 1BH9B 3W98B 1KX3C 3LELD 1KX4D 3AV1C 3KSYA 4QLCB 1BH8B 4H9SA 1P34B 5B24B 3AZHA 5B32C 5B1LD 4ZUXB 5AV5D 5B0ZA 3LZ1C 4WV4B 1KX5C 5B40A 1M18A 1WWIA 1KU5A 1JFIA 2CV5D 3AZNA 1P3BB 5F99A 5E5AA 5GT0D 3MGQD 3UT9B 3AZKA 3MVDA 3W96A 5B2ID 3B0DB 4J8UC 5FUGB 4CAYA 1ZLAD 3B0BA 3C1CA 3WA9C 3REJB 4XZQC 5B0YD 5B1MD 2HIOD 1HQ3A 4CSRB 3MGRC 1M1AB 4XUJB 3MNNA 3X1SB 5DNMA 3REHC 5B31G 3A6NA 3AV2D 3AYWC 5GT3A 3W99A 2HUEB 3AN2D 5B32G 4JJND 4H9OB 1KX3D 5AV6B 1P3MA 1P3PB 5AY8C 4R8PA 3AZID 1ID3A 3B0CW 3AV1D 1S32B 3LJAA 5AVCD 2BYMA 4WNNB 4KUDB 1KX4A 4H9PB 1P3FB 5JRGB 2JSSA 5B32D 5BNVB 4Z66B 1EQZB 2NZDC 1KX5D 4WU8B 1N1JA 3NQJB 5BS7A 3AZGC 5B1LA 2F8ND 2AROC 5AV5A 5CPJC 3C1BD 4J8XC 4J8UD 3AZMB 4YM6C 3R45A 3MGQA 3UTAC 4J8WD 5G49A 5AV8C 3WA9D 4XZQD 1P3OB 3RELC 5AVBC 1ZLAA 3MGRD 3VH6W 3WTPC 5JA4B 1P3IB 5B0YA 3REHD 5B1MA
chains in the Genus database with same CATH superfamily
3UTBC 4X23B 4M6BA 3AYWD 2NQBC 3B6GB 4WU9B 3REIB 3AZEB 4DQYB 4E45A 4LD9C 4KGCD 1F66B 4Z2MH 5KDMB 5AY8D 1ULYA 3WAAC 4JJNA 3B0CT 3KXBB 3O62D 3AZFB 1KX3A 5B0ZB 3AV1A 1H3OA 3AZHD 3W97C 2Y2MA 5AVCA 3X1TB 3F6TA 2NZDD 4Z2MG 2CWEA 3AZNB 5F99B 3MGPC 3AZGD 5B32A 5CPJD 3LZ1A 1KX5A 3AZLD 4J8XD 2F8NA 3AZJC 4H9NA 5CHLB 3LZ0C 4G91B 4YM6D 1P3AC 3UTAD 5GXQC 3C1CD 5GSUB 2BYKA 5CP6B 4J8UA 5B33B 3RELD 1HQ3D 5AVBD 3MNNB 5CPIC 4J8WA 4KHAB 3WTPD 3W98C 3WA9A 3VH6T 4XZQA 3WTPE 3X1VB 1P3KB 3W99B 3MGRA 3UTBD 4QLCC 1AOIC 1P34C 2NQBD 5BNXA 3REHA 5B24C 2IO5B 4ZUXC 3AYWA 2LY8A 3VH5W 3MGSB 1ID3B 4R8PD 1P3BC 2BYMB 3WAAD 3UT9C 3LELB 2Y2IA 5AV9B 5B31C 3AFAB 2YFVB 2Y2QA 5AY8A 3B0DC 3W97D 3O62A 1HTAA 3REJC 2FJ7B 1M19D 1M1AC 3KWQB 4NE3A 4XUJC 3X1SC 1P3LB 2NZDA 2CV5B 3AZGA 3AZJD 5GT0B 2AROA 2ZY5A 3LZ0D 3IP4C 5BO0B 5CPJA 1P3AD 3A1IA 2HUEC 4ZBJB 5GXQD 5B2IB 4J8XA 3AZLA 4YS3B 1TZYB 1BFMA 5DNNB 2G5IC 4YM6A 3UTAA 5B1MB 5AV8A 3W98D 2HIOB 5AV6C 1P3PC 4H9RA 3B6FB 3RELA 1S32C 5AVBA 4QLCD 3REKB 4KUDC 1AOID 3WTPA 3AV2B 1P34D 1P3FC 4H9QA 5JRGC 5B24D 3UTBA 1EQZC 4Z66C 4ZUXD 2NQBA 1WWSA 3AN2B 3VH5T 4NE6A 4NFTA 3TU4B 4WU8C 3WKJC 1P3BD 4LD9A 3UT9D 3AZIB 1H3OB 4Z5TB 5B31D 3H0LC 5AVCB 3AZMC 1P3GB 3WAAA 3REJD 1P3OC 2ZM5A 3W97A 4XUJD 1P3IC 3LZ1D 2Y2LA 3X1SD 4AWLB 4WZSB 4J8VB 1M19A 3MGPA 4X23C 3C1BB 3B6GC 2BYKB 3X1UB 3AZEC 1U35B 3KUYC 3AZJA 2PYOB 3LZ0A 4J8WB 3V9RA 1P3AA 5GXQA 1F66C 5AV6D 1P3PD 1S32D 3NQUA 3KXBC 3AZFC 4KUDD 1BH9A 3W98A 3VH6A 4QLCA 1EQZD 4Z66D 1AOIA 1BH8A 3X1TC 1P34A 4WU8D 5B24A 4KGCB 3WKJD 5BT1C 1TAFB 4ZUXA 4HGAC 5AY8B 5C3IB 2UWXA 2BG1A 3O62B 1P3BA 2DQNC 3UT9A 1R4VA 5GSUC 3AZHB 5B31A 5CP6C 5CPKC 1P3OD 5B33C 5FUGA 3MNNC 5B2JC 1P3ID 5B40B 1M18B 3REJA 3AZGB 1JFIB 3X1VC 5E5AB 1P3KC 4CSRA 4X23D 3AZKB 2AROD 3EPJA 4G92B 1M1AA 4XUJA 3AZLB 3X1SA 3MVDB 3W96B 3AZED 4CAYB 3KUYD 2RVQC 3C1CB 3MGSC 1F66D 5AV8D 1HQ3B 2Y2KA 3LELC 3KXBD 5DNMB 3AZFD 5AV9C 3A6NB 5AV6A 3AFAC 1P3PA 5GT3B 1S32A 4KUDA 3EG5B 2RIQA 4WNNA 2YFWA 4H9PA 1P3FA 4UUZA 2FJ7C 5JRGA 4EO5B 5BT1D 1EQZA 4Z66A 3KWQC 4LD9D 1P3MB 1P3LC 4R8PB 4WU8A 2CV5C 3NQJA 3WAAB 3WKJA 3LJAB 5GT0C 3VH5A 1KX4B 2JE5A 5B2IC 5GSUD 4YS3C 1TZYC 5CPKD 5DNNC 5B33D 4DRAA 3AZMA 5B2JD 1N1JB 1M19B 2DF4C 2HIOC 5B1LB 3B6FC 1P3OA 5AV5B 3X1VD 3MGPD 1P3KD 3REKC 1P3IA 3AV2C 4DRBA 3R45B 4X23A 3MGQB 5G49B 3B6GA 3AN2C 3AZEA 3TU4C 3KUYA 1ZLAB 5CPID 5B0YB 3AZIC 1F66A 5AV9D 5KDMA 4Z5TC 3AFAD 5AVCC 1P3GC 1AOIB 3KXBA 3AZFA 2J8PA 2FJ7D 3P5JB 3KWQD 3X1TA 1P3LD 4AWLC 4J8VC 4NE5A 4JJNB 3C1BC 1KX3B 5B31B 3X1UC 1U35C 3AV1B 4YS3D 2PYOC 3KFUG 4J8WC 1TZYD 5DNND 2G5HC 2FFFB 5GSUA 2L5AA 5B32B 5CP6A 5CPKA 3B6FD 1T3UA 5B33A 2F8NK 3LZ1B 1M1AD 5B2JA 3REKD 1KX5B 4KHAA 2F8NH 2F8NB 4H9NB 3X1VA 1P3KA 4UPKA 4WU9C 3REIC 4J8UB 3TU4D 4KGCC 2ZY2A 2Y2NA 3WA9B 3MGSA 4XZQB 5C3IC 2F8NG 4Z5TD 3MGRB 3O62C 1A7WA 1P3GD 4H9SC 2YFWB 5CPIA 3LELA 4UUZB 5BNXB 5AV9A 3REHB 3AZHC 3AFAA 2YFVA 1P3FD 5JRGD 3AYWB 5B0ZC 5B40C 1M18C 2XD5A 3WKJB 2FJ7A 3AZNC 4J8VD 5F99C 5E5AC 3AZKC 4G92C 3EPHA 3KWQA 3AZLC 3MVDC 1P3LA 3X1UD 2CV5A 3W96C 1U35D 1B6WA 1Q9CA 5GT0A 2PYOD 2Y2JA 4G91C 5BO0A 3C1CC 3AZMD 5B2IA 4YS3A 1HQ3C 1TZYA 5DNNA 2NZDB 5DNMC 3A6NC 3AL0C 2HIOA 2AROB 3B6FA 5GT3C 5CPJB 3W99C 3FDDA 3REKA 4J8XB 3KUYB 3AV2A 3B6GD 4WU9D 3REID 4EO5C 4YM6B 3UTAB 2IO5C 5AV8B 1P3MC 1ID3C 4R8PC 4H9RB 3AN2A 3RELB 3TU4A 5AVBB 3LJAC 3WTPB 4H9OA 1KX4C 4H9QB 3AZIA 4Z5TA 3UTBB 5B0ZD 1P3GA 2NQBB 1M19C 5B40D 1M18D 5BS7C 3X1TD 5B1LC 3AZND 5AV5C 4LD9B 5F99D 5E5AD 3AZKD 5BNVA 4HGAB 3MVDD 3W96D 4J8VA 3MGQC 3C1BA 3X1UA 4ZBJC 5CPKB 1U35A 1ZLAC 3W97B 5CP6D 2PYOA 1F1EA 5B2JB 3MNND 5DNMD 5B0YC 5B1MC 3A6ND 3MGPB 1W2EA 5GT3D 3W99D 5JA4A 3AZJB 3H0MC 3LZ0B 3V9RB 1P3AB 2RVQD 5GXQB 4E44A 4WJ3C 2XD1A 4WU9A 3MGSD 1P3MD 3REIA 1ID3D 1B67A 2Y2OA 4JJNC 4KGCA 3LJAD 1TAFA 3NQUB 5CPIB 1BH9B 3W98B 1KX3C 3LELD 1KX4D 3AV1C 3KSYA 4QLCB 1Z2CB 1BH8B 4H9SA 1P34B 5B24B 3AZHA 5B32C 5B1LD 4ZUXB 5AV5D 5B0ZA 3LZ1C 4WV4B 1KX5C 2VQRA 5B40A 1M18A 1WWIA 1KU5A 1JFIA 2CV5D 3AZNA 1P3BB 5F99A 5E5AA 3EPLA 5GT0D 3MGQD 3UT9B 3AZKA 3MVDA 3W96A 5B2ID 3B0DB 4J8UC 5FUGB 4CAYA 1ZLAD 3B0BA 3C1CA 3WA9C 3REJB 4XZQC 5B0YD 5B1MD 2HIOD 1HQ3A 4CSRB 3MGRC 1M1AB 4XUJB 3MNNA 3X1SB 1PZRA 5DNMA 3REHC 5B31G 3A6NA 3AV2D 3AYWC 5GT3A 2F2AC 3W99A 2HUEB 2ZY3A 3AN2D 5B32G 4JJND 4H9OB 1KX3D 5AV6B 1P3MA 1P3PB 2Y2GA 5AY8C 4R8PA 3AZID 1ID3A 3B0CW 3AV1D 1S32B 3LJAA 5AVCD 2BYMA 4WNNB 4KUDB 3H0RC 2Y2HA 1KX4A 4H9PB 1P3FB 3EPKA 5JRGB 2JSSA 5B32D 2JCHA 5BNVB 4Z66B 1EQZB 2ZY4A 2NZDC 1KX5D 4WU8B 1N1JA 3NQJB 5BS7A 3AZGC 5B1LA 2F8ND 2AROC 5AV5A 5CPJC 3C1BD 4J8XC 2W8SA 4J8UD 3AZMB 2Y2PA 4YM6C 3R45A 3MGQA 3UTAC 4J8WD 5G49A 5AV8C 3WA9D 4XZQD 1P3OB 3A1KA 3RELC 5AVBC 1ZLAA 3MGRD 3VH6W 5JA4B 3WTPC 1P3IB 5B0YA 3REHD 5B1MA
chains in the Genus database with same CATH topology
3UTBC 4X23B 4M6BA 3AYWD 2NQBC 3B6GB 4WU9B 3REIB 3AZEB 4DQYB 4E45A 4LD9C 4KGCD 1F66B 4Z2MH 5KDMB 5AY8D 1ULYA 3WAAC 4JJNA 3B0CT 3KXBB 3O62D 3AZFB 1KX3A 5B0ZB 3AV1A 1H3OA 3AZHD 3W97C 2Y2MA 5AVCA 3X1TB 3F6TA 2NZDD 4Z2MG 2CWEA 3AZNB 5F99B 3MGPC 3AZGD 5B32A 5CPJD 3LZ1A 1KX5A 3AZLD 4J8XD 2F8NA 3AZJC 4H9NA 5CHLB 3LZ0C 4G91B 4YM6D 1P3AC 3UTAD 5GXQC 3C1CD 5GSUB 2BYKA 5CP6B 4J8UA 5B33B 3RELD 1HQ3D 5AVBD 3MNNB 5CPIC 4J8WA 4KHAB 3WTPD 3W98C 3WA9A 3VH6T 4XZQA 3WTPE 3X1VB 1P3KB 3W99B 3MGRA 3UTBD 4QLCC 1AOIC 1P34C 2NQBD 5BNXA 3REHA 5B24C 2IO5B 4ZUXC 3AYWA 2LY8A 3VH5W 3MGSB 1ID3B 4R8PD 1P3BC 2BYMB 3WAAD 3UT9C 3LELB 2Y2IA 5AV9B 5B31C 3AFAB 2YFVB 2Y2QA 5AY8A 3B0DC 3W97D 3O62A 1HTAA 3REJC 2FJ7B 1M19D 1M1AC 3KWQB 4NE3A 4XUJC 3X1SC 1P3LB 2NZDA 2CV5B 3AZGA 3AZJD 5GT0B 2AROA 2ZY5A 3LZ0D 3IP4C 5BO0B 5CPJA 1P3AD 3A1IA 2HUEC 4ZBJB 5GXQD 5B2IB 4J8XA 3AZLA 4YS3B 1TZYB 1BFMA 5DNNB 2G5IC 4YM6A 3UTAA 5B1MB 5AV8A 3W98D 2HIOB 5AV6C 1P3PC 4H9RA 3B6FB 3RELA 1S32C 5AVBA 4QLCD 3REKB 4KUDC 1AOID 3WTPA 3AV2B 1P34D 1P3FC 4H9QA 5JRGC 5B24D 3UTBA 1EQZC 4Z66C 4ZUXD 2NQBA 1WWSA 3AN2B 3VH5T 4NE6A 4NFTA 3TU4B 4WU8C 3WKJC 1P3BD 4LD9A 3UT9D 3AZIB 1H3OB 4Z5TB 5B31D 3H0LC 5AVCB 3AZMC 1P3GB 3WAAA 3REJD 1P3OC 2ZM5A 3W97A 4XUJD 1P3IC 3LZ1D 2Y2LA 3X1SD 4AWLB 4WZSB 4J8VB 1M19A 3MGPA 4X23C 3C1BB 3B6GC 2BYKB 3X1UB 3AZEC 1U35B 3KUYC 3AZJA 2PYOB 3LZ0A 4J8WB 3V9RA 1P3AA 5GXQA 1F66C 5AV6D 1P3PD 1S32D 3NQUA 3KXBC 3AZFC 4KUDD 1BH9A 3W98A 3VH6A 4QLCA 1EQZD 4Z66D 1AOIA 1BH8A 3X1TC 1P34A 4WU8D 5B24A 4KGCB 3WKJD 5BT1C 1TAFB 4ZUXA 4HGAC 5AY8B 5C3IB 2UWXA 2BG1A 3O62B 1P3BA 2DQNC 3UT9A 1R4VA 5GSUC 3AZHB 5B31A 5CP6C 5CPKC 1P3OD 5B33C 5FUGA 3MNNC 5B2JC 1P3ID 5B40B 1M18B 3REJA 3AZGB 1JFIB 3X1VC 5E5AB 1P3KC 4CSRA 4X23D 3AZKB 2AROD 3EPJA 4G92B 1M1AA 4XUJA 3AZLB 3X1SA 3MVDB 3W96B 3AZED 4CAYB 3KUYD 2RVQC 3C1CB 3MGSC 1F66D 5AV8D 1HQ3B 2Y2KA 3LELC 3KXBD 5DNMB 3AZFD 5AV9C 3A6NB 5AV6A 3AFAC 1P3PA 5GT3B 1S32A 4KUDA 3EG5B 2RIQA 4WNNA 2YFWA 4H9PA 1P3FA 4UUZA 2FJ7C 5JRGA 4EO5B 5BT1D 1EQZA 4Z66A 3KWQC 4LD9D 1P3MB 1P3LC 4R8PB 4WU8A 2CV5C 3NQJA 3WAAB 3WKJA 3LJAB 5GT0C 3VH5A 1KX4B 2JE5A 5B2IC 5GSUD 4YS3C 1TZYC 5CPKD 5DNNC 5B33D 4DRAA 3AZMA 5B2JD 1N1JB 1M19B 2DF4C 2HIOC 5B1LB 3B6FC 1P3OA 5AV5B 3X1VD 3MGPD 1P3KD 3REKC 1P3IA 3AV2C 4DRBA 3R45B 4X23A 3MGQB 5G49B 3B6GA 3AN2C 3AZEA 3TU4C 3KUYA 1ZLAB 5CPID 5B0YB 3AZIC 1F66A 5AV9D 5KDMA 4Z5TC 3AFAD 5AVCC 1P3GC 1AOIB 3KXBA 3AZFA 2J8PA 2FJ7D 3P5JB 3KWQD 3X1TA 1P3LD 4AWLC 4J8VC 4NE5A 4JJNB 3C1BC 1KX3B 5B31B 3X1UC 1U35C 3AV1B 4YS3D 2PYOC 3KFUG 4J8WC 1TZYD 5DNND 2G5HC 2FFFB 5GSUA 2L5AA 5B32B 5CP6A 5CPKA 3B6FD 1T3UA 5B33A 2F8NK 3LZ1B 1M1AD 5B2JA 3REKD 1KX5B 4KHAA 2F8NH 2F8NB 4H9NB 3X1VA 1P3KA 4UPKA 4WU9C 3REIC 4J8UB 3TU4D 4KGCC 2ZY2A 2Y2NA 3WA9B 3MGSA 4XZQB 5C3IC 2F8NG 4Z5TD 3MGRB 3O62C 1A7WA 1P3GD 4H9SC 2YFWB 5CPIA 3LELA 4UUZB 5BNXB 5AV9A 3REHB 3AZHC 3AFAA 2YFVA 1P3FD 5JRGD 3AYWB 5B0ZC 5B40C 1M18C 2XD5A 3WKJB 2FJ7A 3AZNC 4J8VD 5F99C 5E5AC 3AZKC 4G92C 3EPHA 3KWQA 3AZLC 3MVDC 1P3LA 3X1UD 2CV5A 3W96C 1U35D 1B6WA 1Q9CA 5GT0A 2PYOD 2Y2JA 4G91C 5BO0A 3C1CC 3AZMD 5B2IA 4YS3A 1HQ3C 1TZYA 5DNNA 2NZDB 5DNMC 3A6NC 3AL0C 2HIOA 2AROB 3B6FA 5GT3C 5CPJB 3W99C 3FDDA 3REKA 4J8XB 3KUYB 3AV2A 3B6GD 4WU9D 3REID 4EO5C 4YM6B 3UTAB 2IO5C 5AV8B 1P3MC 1ID3C 4R8PC 4H9RB 3AN2A 3RELB 3TU4A 5AVBB 3LJAC 3WTPB 4H9OA 1KX4C 4H9QB 3AZIA 4Z5TA 3UTBB 5B0ZD 1P3GA 2NQBB 1M19C 5B40D 1M18D 5BS7C 3X1TD 5B1LC 3AZND 5AV5C 4LD9B 5F99D 5E5AD 3AZKD 5BNVA 4HGAB 3MVDD 3W96D 4J8VA 3MGQC 3C1BA 3X1UA 4ZBJC 5CPKB 1U35A 1ZLAC 3W97B 5CP6D 2PYOA 1F1EA 5B2JB 3MNND 5DNMD 5B0YC 5B1MC 3A6ND 3MGPB 1W2EA 5GT3D 3W99D 5JA4A 3AZJB 3H0MC 3LZ0B 3V9RB 1P3AB 2RVQD 5GXQB 4E44A 4WJ3C 2XD1A 4WU9A 3MGSD 1P3MD 3REIA 1ID3D 1B67A 2Y2OA 4JJNC 4KGCA 3LJAD 1TAFA 3NQUB 5CPIB 1BH9B 3W98B 1KX3C 3LELD 1KX4D 3AV1C 3KSYA 4QLCB 1Z2CB 1BH8B 4H9SA 1P34B 5B24B 3AZHA 5B32C 5B1LD 4ZUXB 5AV5D 5B0ZA 3LZ1C 4WV4B 1KX5C 2VQRA 5B40A 1M18A 1WWIA 1KU5A 1JFIA 2CV5D 3AZNA 1P3BB 5F99A 5E5AA 3EPLA 5GT0D 3MGQD 3UT9B 3AZKA 3MVDA 3W96A 5B2ID 3B0DB 4J8UC 5FUGB 4CAYA 1ZLAD 3B0BA 3C1CA 3WA9C 3REJB 4XZQC 5B0YD 5B1MD 2HIOD 1HQ3A 4CSRB 3MGRC 1M1AB 4XUJB 3MNNA 3X1SB 1PZRA 5DNMA 3REHC 5B31G 3A6NA 3AV2D 3AYWC 5GT3A 2F2AC 3W99A 2HUEB 2ZY3A 3AN2D 5B32G 4JJND 4H9OB 1KX3D 5AV6B 1P3MA 1P3PB 2Y2GA 5AY8C 4R8PA 3AZID 1ID3A 3B0CW 3AV1D 1S32B 3LJAA 5AVCD 2BYMA 4WNNB 4KUDB 3H0RC 2Y2HA 1KX4A 4H9PB 1P3FB 3EPKA 5JRGB 2JSSA 5B32D 2JCHA 5BNVB 4Z66B 1EQZB 2ZY4A 2NZDC 1KX5D 4WU8B 1N1JA 3NQJB 5BS7A 3AZGC 5B1LA 2F8ND 2AROC 5AV5A 5CPJC 3C1BD 4J8XC 2W8SA 4J8UD 3AZMB 2Y2PA 4YM6C 3R45A 3MGQA 3UTAC 4J8WD 5G49A 5AV8C 3WA9D 4XZQD 1P3OB 3A1KA 3RELC 5AVBC 1ZLAA 3MGRD 3VH6W 5JA4B 3WTPC 1P3IB 5B0YA 3REHD 5B1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB C;  4X23 B;  4M6B A;  3AYW D;  2NQB C;  3B6G B;  4WU9 B;  3REI B;  3AZE B;  4E45 A;  4LD9 C;  4KGC D;  1F66 B;  4Z2M H;  5KDM B;  5AY8 D;  1ULY A;  3WAA C;  4JJN A;  3B0C T;  3KXB B;  3O62 D;  3AZF B;  1KX3 A;  5B0Z B;  3AV1 A;  1H3O A;  3AZH D;  3W97 C;  5AVC A;  3X1T B;  2NZD D;  4Z2M G;  2CWE A;  3AZN B;  5F99 B;  3MGP C;  3AZG D;  5B32 A;  5CPJ D;  3LZ1 A;  1KX5 A;  3AZL D;  4J8X D;  2F8N A;  3AZJ C;  4H9N A;  5CHL B;  3LZ0 C;  4G91 B;  4YM6 D;  1P3A C;  3UTA D;  5GXQ C;  3C1C D;  5GSU B;  2BYK A;  5CP6 B;  4J8U A;  5B33 B;  3REL D;  1HQ3 D;  5AVB D;  3MNN B;  5CPI C;  4J8W A;  4KHA B;  3WTP D;  3W98 C;  3WA9 A;  3VH6 T;  4XZQ A;  3WTP E;  3X1V B;  1P3K B;  3W99 B;  3MGR A;  3UTB D;  4QLC C;  1AOI C;  1P34 C;  2NQB D;  5BNX A;  3REH A;  5B24 C;  2IO5 B;  4ZUX C;  3AYW A;  2LY8 A;  3VH5 W;  3MGS B;  1ID3 B;  4R8P D;  1P3B C;  2BYM B;  3WAA D;  3UT9 C;  3LEL B;  5AV9 B;  5B31 C;  3AFA B;  2YFV B;  5AY8 A;  3B0D C;  3W97 D;  3O62 A;  1HTA A;  3REJ C;  2FJ7 B;  1M19 D;  1M1A C;  3KWQ B;  4NE3 A;  4XUJ C;  3X1S C;  1P3L B;  2NZD A;  2CV5 B;  3AZG A;  3AZJ D;  5GT0 B;  2ARO A;  3LZ0 D;  5BO0 B;  5CPJ A;  1P3A D;  2HUE C;  4ZBJ B;  5GXQ D;  5B2I B;  4J8X A;  3AZL A;  4YS3 B;  1TZY B;  1BFM A;  5DNN B;  4YM6 A;  3UTA A;  5B1M B;  5AV8 A;  3W98 D;  2HIO B;  5AV6 C;  1P3P C;  4H9R A;  3B6F B;  3REL A;  1S32 C;  5AVB A;  4QLC D;  3REK B;  4KUD C;  1AOI D;  3WTP A;  3AV2 B;  1P34 D;  1P3F C;  4H9Q A;  5JRG C;  5B24 D;  3UTB A;  1EQZ C;  4Z66 C;  4ZUX D;  2NQB A;  1WWS A;  3AN2 B;  3VH5 T;  4NE6 A;  4NFT A;  3TU4 B;  4WU8 C;  3WKJ C;  1P3B D;  4LD9 A;  3UT9 D;  3AZI B;  1H3O B;  4Z5T B;  5B31 D;  5AVC B;  3AZM C;  1P3G B;  3WAA A;  3REJ D;  1P3O C;  3W97 A;  4XUJ D;  1P3I C;  3LZ1 D;  3X1S D;  4AWL B;  4WZS B;  4J8V B;  1M19 A;  3MGP A;  4X23 C;  3C1B B;  3B6G C;  2BYK B;  3X1U B;  3AZE C;  1U35 B;  3KUY C;  3AZJ A;  2PYO B;  3LZ0 A;  4J8W B;  3V9R A;  1P3A A;  5GXQ A;  1F66 C;  5AV6 D;  1P3P D;  1S32 D;  3NQU A;  3KXB C;  3AZF C;  4KUD D;  1BH9 A;  3W98 A;  3VH6 A;  4QLC A;  1EQZ D;  4Z66 D;  1AOI A;  1BH8 A;  3X1T C;  1P34 A;  4WU8 D;  5B24 A;  4KGC B;  3WKJ D;  5BT1 C;  1TAF B;  4ZUX A;  4HGA C;  5AY8 B;  5C3I B;  3O62 B;  1P3B A;  3UT9 A;  1R4V A;  5GSU C;  3AZH B;  5B31 A;  5CP6 C;  5CPK C;  1P3O D;  5B33 C;  5FUG A;  3MNN C;  5B2J C;  1P3I D;  5B40 B;  1M18 B;  3REJ A;  3AZG B;  1JFI B;  3X1V C;  5E5A B;  1P3K C;  4CSR A;  4X23 D;  3AZK B;  2ARO D;  4G92 B;  1M1A A;  4XUJ A;  3AZL B;  3X1S A;  3MVD B;  3W96 B;  3AZE D;  4CAY B;  3KUY D;  2RVQ C;  3C1C B;  3MGS C;  1F66 D;  5AV8 D;  1HQ3 B;  3LEL C;  3KXB D;  5DNM B;  3AZF D;  5AV9 C;  3A6N B;  5AV6 A;  3AFA C;  1P3P A;  5GT3 B;  1S32 A;  4KUD A;  4WNN A;  2YFW A;  4H9P A;  1P3F A;  4UUZ A;  2FJ7 C;  5JRG A;  4EO5 B;  5BT1 D;  1EQZ A;  4Z66 A;  3KWQ C;  4LD9 D;  1P3M B;  1P3L C;  4R8P B;  4WU8 A;  2CV5 C;  3NQJ A;  3WAA B;  3WKJ A;  3LJA B;  5GT0 C;  3VH5 A;  1KX4 B;  5B2I C;  5GSU D;  4YS3 C;  1TZY C;  5CPK D;  5DNN C;  5B33 D;  4DRA A;  3AZM A;  5B2J D;  1N1J B;  1M19 B;  2HIO C;  5B1L B;  3B6F C;  1P3O A;  5AV5 B;  3X1V D;  3MGP D;  1P3K D;  3REK C;  1P3I A;  3AV2 C;  4DRB A;  3R45 B;  4X23 A;  3MGQ B;  5G49 B;  3B6G A;  3AN2 C;  3AZE A;  3TU4 C;  3KUY A;  1ZLA B;  5CPI D;  5B0Y B;  3AZI C;  1F66 A;  5AV9 D;  5KDM A;  4Z5T C;  3AFA D;  5AVC C;  1P3G C;  1AOI B;  3KXB A;  3AZF A;  2FJ7 D;  3KWQ D;  3X1T A;  1P3L D;  4AWL C;  4J8V C;  4NE5 A;  4JJN B;  3C1B C;  1KX3 B;  5B31 B;  3X1U C;  1U35 C;  3AV1 B;  4YS3 D;  2PYO C;  4J8W C;  1TZY D;  5DNN D;  5GSU A;  2L5A A;  5B32 B;  5CP6 A;  5CPK A;  3B6F D;  5B33 A;  2F8N K;  3LZ1 B;  1M1A D;  5B2J A;  3REK D;  1KX5 B;  4KHA A;  2F8N H;  2F8N B;  4H9N B;  3X1V A;  1P3K A;  4WU9 C;  3REI C;  4J8U B;  3TU4 D;  4KGC C;  3WA9 B;  3MGS A;  4XZQ B;  5C3I C;  2F8N G;  4Z5T D;  3MGR B;  3O62 C;  1A7W A;  1P3G D;  4H9S C;  2YFW B;  5CPI A;  3LEL A;  4UUZ B;  5BNX B;  5AV9 A;  3REH B;  3AZH C;  3AFA A;  2YFV A;  1P3F D;  5JRG D;  3AYW B;  5B0Z C;  5B40 C;  1M18 C;  3WKJ B;  2FJ7 A;  3AZN C;  4J8V D;  5F99 C;  5E5A C;  3AZK C;  4G92 C;  3KWQ A;  3AZL C;  3MVD C;  1P3L A;  3X1U D;  2CV5 A;  3W96 C;  1U35 D;  1B6W A;  1Q9C A;  5GT0 A;  2PYO D;  4G91 C;  5BO0 A;  3C1C C;  3AZM D;  5B2I A;  4YS3 A;  1HQ3 C;  1TZY A;  5DNN A;  2NZD B;  5DNM C;  3A6N C;  2HIO A;  2ARO B;  3B6F A;  5GT3 C;  5CPJ B;  3W99 C;  3REK A;  4J8X B;  3KUY B;  3AV2 A;  3B6G D;  4WU9 D;  3REI D;  4EO5 C;  4YM6 B;  3UTA B;  2IO5 C;  5AV8 B;  1P3M C;  1ID3 C;  4R8P C;  4H9R B;  3AN2 A;  3REL B;  3TU4 A;  5AVB B;  3LJA C;  3WTP B;  4H9O A;  1KX4 C;  4H9Q B;  3AZI A;  4Z5T A;  3UTB B;  5B0Z D;  1P3G A;  2NQB B;  1M19 C;  5B40 D;  1M18 D;  5BS7 C;  3X1T D;  5B1L C;  3AZN D;  5AV5 C;  4LD9 B;  5F99 D;  5E5A D;  3AZK D;  5BNV A;  4HGA B;  3MVD D;  3W96 D;  4J8V A;  3MGQ C;  3C1B A;  3X1U A;  4ZBJ C;  5CPK B;  1U35 A;  1ZLA C;  3W97 B;  5CP6 D;  2PYO A;  1F1E A;  5B2J B;  3MNN D;  5DNM D;  5B0Y C;  5B1M C;  3A6N D;  3MGP B;  5GT3 D;  3W99 D;  5JA4 A;  3AZJ B;  3LZ0 B;  3V9R B;  1P3A B;  2RVQ D;  5GXQ B;  4E44 A;  1P3M D;  4WU9 A;  3MGS D;  3REI A;  1ID3 D;  1B67 A;  4JJN C;  4KGC A;  3LJA D;  1TAF A;  3NQU B;  5CPI B;  1BH9 B;  3W98 B;  1KX3 C;  3LEL D;  1KX4 D;  3AV1 C;  3KSY A;  4QLC B;  1BH8 B;  4H9S A;  1P34 B;  5B24 B;  3AZH A;  5B32 C;  5B1L D;  4ZUX B;  5AV5 D;  5B0Z A;  3LZ1 C;  4WV4 B;  1KX5 C;  5B40 A;  1M18 A;  1WWI A;  1KU5 A;  1JFI A;  2CV5 D;  3AZN A;  1P3B B;  5F99 A;  5E5A A;  5GT0 D;  3MGQ D;  3UT9 B;  3AZK A;  3MVD A;  3W96 A;  5B2I D;  3B0D B;  4J8U C;  5FUG B;  4CAY A;  1ZLA D;  3B0B A;  3C1C A;  3WA9 C;  3REJ B;  4XZQ C;  5B0Y D;  5B1M D;  2HIO D;  1HQ3 A;  4CSR B;  3MGR C;  1M1A B;  4XUJ B;  3MNN A;  3X1S B;  5DNM A;  3REH C;  5B31 G;  3A6N A;  3AV2 D;  3AYW C;  5GT3 A;  3W99 A;  2HUE B;  3AN2 D;  5B32 G;  4JJN D;  4H9O B;  1KX3 D;  5AV6 B;  1P3M A;  1P3P B;  5AY8 C;  4R8P A;  3AZI D;  1ID3 A;  3B0C W;  3AV1 D;  1S32 B;  3LJA A;  5AVC D;  2BYM A;  4WNN B;  4KUD B;  1KX4 A;  4H9P B;  1P3F B;  5JRG B;  2JSS A;  5B32 D;  5BNV B;  4Z66 B;  1EQZ B;  2NZD C;  1KX5 D;  4WU8 B;  1N1J A;  3NQJ B;  5BS7 A;  3AZG C;  5B1L A;  2F8N D;  2ARO C;  5AV5 A;  5CPJ C;  3C1B D;  4J8X C;  4J8U D;  3AZM B;  4YM6 C;  3R45 A;  3MGQ A;  3UTA C;  4J8W D;  5G49 A;  5AV8 C;  3WA9 D;  4XZQ D;  1P3O B;  3REL C;  5AVB C;  1ZLA A;  3MGR D;  3VH6 W;  3WTP C;  5JA4 B;  1P3I B;  5B0Y A;  3REH D;  5B1M A; 
#chains in the Genus database with same CATH topology
 3UTB C;  4X23 B;  4M6B A;  3AYW D;  2NQB C;  3B6G B;  4WU9 B;  3REI B;  3AZE B;  4DQY B;  4E45 A;  4LD9 C;  4KGC D;  1F66 B;  4Z2M H;  5KDM B;  5AY8 D;  1ULY A;  3WAA C;  4JJN A;  3B0C T;  3KXB B;  3O62 D;  3AZF B;  1KX3 A;  5B0Z B;  3AV1 A;  1H3O A;  3AZH D;  3W97 C;  2Y2M A;  5AVC A;  3X1T B;  3F6T A;  2NZD D;  4Z2M G;  2CWE A;  3AZN B;  5F99 B;  3MGP C;  3AZG D;  5B32 A;  5CPJ D;  3LZ1 A;  1KX5 A;  3AZL D;  4J8X D;  2F8N A;  3AZJ C;  4H9N A;  5CHL B;  3LZ0 C;  4G91 B;  4YM6 D;  1P3A C;  3UTA D;  5GXQ C;  3C1C D;  5GSU B;  2BYK A;  5CP6 B;  4J8U A;  5B33 B;  3REL D;  1HQ3 D;  5AVB D;  3MNN B;  5CPI C;  4J8W A;  4KHA B;  3WTP D;  3W98 C;  3WA9 A;  3VH6 T;  4XZQ A;  3WTP E;  3X1V B;  1P3K B;  3W99 B;  3MGR A;  3UTB D;  4QLC C;  1AOI C;  1P34 C;  2NQB D;  5BNX A;  3REH A;  5B24 C;  2IO5 B;  4ZUX C;  3AYW A;  2LY8 A;  3VH5 W;  3MGS B;  1ID3 B;  4R8P D;  1P3B C;  2BYM B;  3WAA D;  3UT9 C;  3LEL B;  2Y2I A;  5AV9 B;  5B31 C;  3AFA B;  2YFV B;  2Y2Q A;  5AY8 A;  3B0D C;  3W97 D;  3O62 A;  1HTA A;  3REJ C;  2FJ7 B;  1M19 D;  1M1A C;  3KWQ B;  4NE3 A;  4XUJ C;  3X1S C;  1P3L B;  2NZD A;  2CV5 B;  3AZG A;  3AZJ D;  5GT0 B;  2ARO A;  2ZY5 A;  3LZ0 D;  3IP4 C;  5BO0 B;  5CPJ A;  1P3A D;  3A1I A;  2HUE C;  4ZBJ B;  5GXQ D;  5B2I B;  4J8X A;  3AZL A;  4YS3 B;  1TZY B;  1BFM A;  5DNN B;  2G5I C;  4YM6 A;  3UTA A;  5B1M B;  5AV8 A;  3W98 D;  2HIO B;  5AV6 C;  1P3P C;  4H9R A;  3B6F B;  3REL A;  1S32 C;  5AVB A;  4QLC D;  3REK B;  4KUD C;  1AOI D;  3WTP A;  3AV2 B;  1P34 D;  1P3F C;  4H9Q A;  5JRG C;  5B24 D;  3UTB A;  1EQZ C;  4Z66 C;  4ZUX D;  2NQB A;  1WWS A;  3AN2 B;  3VH5 T;  4NE6 A;  4NFT A;  3TU4 B;  4WU8 C;  3WKJ C;  1P3B D;  4LD9 A;  3UT9 D;  3AZI B;  1H3O B;  4Z5T B;  5B31 D;  3H0L C;  5AVC B;  3AZM C;  1P3G B;  3WAA A;  3REJ D;  1P3O C;  2ZM5 A;  3W97 A;  4XUJ D;  1P3I C;  3LZ1 D;  2Y2L A;  3X1S D;  4AWL B;  4WZS B;  4J8V B;  1M19 A;  3MGP A;  4X23 C;  3C1B B;  3B6G C;  2BYK B;  3X1U B;  3AZE C;  1U35 B;  3KUY C;  3AZJ A;  2PYO B;  3LZ0 A;  4J8W B;  3V9R A;  1P3A A;  5GXQ A;  1F66 C;  5AV6 D;  1P3P D;  1S32 D;  3NQU A;  3KXB C;  3AZF C;  4KUD D;  1BH9 A;  3W98 A;  3VH6 A;  4QLC A;  1EQZ D;  4Z66 D;  1AOI A;  1BH8 A;  3X1T C;  1P34 A;  4WU8 D;  5B24 A;  4KGC B;  3WKJ D;  5BT1 C;  1TAF B;  4ZUX A;  4HGA C;  5AY8 B;  5C3I B;  2UWX A;  2BG1 A;  3O62 B;  1P3B A;  2DQN C;  3UT9 A;  1R4V A;  5GSU C;  3AZH B;  5B31 A;  5CP6 C;  5CPK C;  1P3O D;  5B33 C;  5FUG A;  3MNN C;  5B2J C;  1P3I D;  5B40 B;  1M18 B;  3REJ A;  3AZG B;  1JFI B;  3X1V C;  5E5A B;  1P3K C;  4CSR A;  4X23 D;  3AZK B;  2ARO D;  3EPJ A;  4G92 B;  1M1A A;  4XUJ A;  3AZL B;  3X1S A;  3MVD B;  3W96 B;  3AZE D;  4CAY B;  3KUY D;  2RVQ C;  3C1C B;  3MGS C;  1F66 D;  5AV8 D;  1HQ3 B;  2Y2K A;  3LEL C;  3KXB D;  5DNM B;  3AZF D;  5AV9 C;  3A6N B;  5AV6 A;  3AFA C;  1P3P A;  5GT3 B;  1S32 A;  4KUD A;  3EG5 B;  2RIQ A;  4WNN A;  2YFW A;  4H9P A;  1P3F A;  4UUZ A;  2FJ7 C;  5JRG A;  4EO5 B;  5BT1 D;  1EQZ A;  4Z66 A;  3KWQ C;  4LD9 D;  1P3M B;  1P3L C;  4R8P B;  4WU8 A;  2CV5 C;  3NQJ A;  3WAA B;  3WKJ A;  3LJA B;  5GT0 C;  3VH5 A;  1KX4 B;  2JE5 A;  5B2I C;  5GSU D;  4YS3 C;  1TZY C;  5CPK D;  5DNN C;  5B33 D;  4DRA A;  3AZM A;  5B2J D;  1N1J B;  1M19 B;  2DF4 C;  2HIO C;  5B1L B;  3B6F C;  1P3O A;  5AV5 B;  3X1V D;  3MGP D;  1P3K D;  3REK C;  1P3I A;  3AV2 C;  4DRB A;  3R45 B;  4X23 A;  3MGQ B;  5G49 B;  3B6G A;  3AN2 C;  3AZE A;  3TU4 C;  3KUY A;  1ZLA B;  5CPI D;  5B0Y B;  3AZI C;  1F66 A;  5AV9 D;  5KDM A;  4Z5T C;  3AFA D;  5AVC C;  1P3G C;  1AOI B;  3KXB A;  3AZF A;  2J8P A;  2FJ7 D;  3P5J B;  3KWQ D;  3X1T A;  1P3L D;  4AWL C;  4J8V C;  4NE5 A;  4JJN B;  3C1B C;  1KX3 B;  5B31 B;  3X1U C;  1U35 C;  3AV1 B;  4YS3 D;  2PYO C;  3KFU G;  4J8W C;  1TZY D;  5DNN D;  2G5H C;  2FFF B;  5GSU A;  2L5A A;  5B32 B;  5CP6 A;  5CPK A;  3B6F D;  1T3U A;  5B33 A;  2F8N K;  3LZ1 B;  1M1A D;  5B2J A;  3REK D;  1KX5 B;  4KHA A;  2F8N H;  2F8N B;  4H9N B;  3X1V A;  1P3K A;  4UPK A;  4WU9 C;  3REI C;  4J8U B;  3TU4 D;  4KGC C;  2ZY2 A;  2Y2N A;  3WA9 B;  3MGS A;  4XZQ B;  5C3I C;  2F8N G;  4Z5T D;  3MGR B;  3O62 C;  1A7W A;  1P3G D;  4H9S C;  2YFW B;  5CPI A;  3LEL A;  4UUZ B;  5BNX B;  5AV9 A;  3REH B;  3AZH C;  3AFA A;  2YFV A;  1P3F D;  5JRG D;  3AYW B;  5B0Z C;  5B40 C;  1M18 C;  2XD5 A;  3WKJ B;  2FJ7 A;  3AZN C;  4J8V D;  5F99 C;  5E5A C;  3AZK C;  4G92 C;  3EPH A;  3KWQ A;  3AZL C;  3MVD C;  1P3L A;  3X1U D;  2CV5 A;  3W96 C;  1U35 D;  1B6W A;  1Q9C A;  5GT0 A;  2PYO D;  2Y2J A;  4G91 C;  5BO0 A;  3C1C C;  3AZM D;  5B2I A;  4YS3 A;  1HQ3 C;  1TZY A;  5DNN A;  2NZD B;  5DNM C;  3A6N C;  3AL0 C;  2HIO A;  2ARO B;  3B6F A;  5GT3 C;  5CPJ B;  3W99 C;  3FDD A;  3REK A;  4J8X B;  3KUY B;  3AV2 A;  3B6G D;  4WU9 D;  3REI D;  4EO5 C;  4YM6 B;  3UTA B;  2IO5 C;  5AV8 B;  1P3M C;  1ID3 C;  4R8P C;  4H9R B;  3AN2 A;  3REL B;  3TU4 A;  5AVB B;  3LJA C;  3WTP B;  4H9O A;  1KX4 C;  4H9Q B;  3AZI A;  4Z5T A;  3UTB B;  5B0Z D;  1P3G A;  2NQB B;  1M19 C;  5B40 D;  1M18 D;  5BS7 C;  3X1T D;  5B1L C;  3AZN D;  5AV5 C;  4LD9 B;  5F99 D;  5E5A D;  3AZK D;  5BNV A;  4HGA B;  3MVD D;  3W96 D;  4J8V A;  3MGQ C;  3C1B A;  3X1U A;  4ZBJ C;  5CPK B;  1U35 A;  1ZLA C;  3W97 B;  5CP6 D;  2PYO A;  1F1E A;  5B2J B;  3MNN D;  5DNM D;  5B0Y C;  5B1M C;  3A6N D;  3MGP B;  1W2E A;  5GT3 D;  3W99 D;  5JA4 A;  3AZJ B;  3H0M C;  3LZ0 B;  3V9R B;  1P3A B;  2RVQ D;  5GXQ B;  4E44 A;  4WJ3 C;  2XD1 A;  4WU9 A;  3MGS D;  1P3M D;  3REI A;  1ID3 D;  1B67 A;  2Y2O A;  4JJN C;  4KGC A;  3LJA D;  1TAF A;  3NQU B;  5CPI B;  1BH9 B;  3W98 B;  1KX3 C;  3LEL D;  1KX4 D;  3AV1 C;  3KSY A;  4QLC B;  1Z2C B;  1BH8 B;  4H9S A;  1P34 B;  5B24 B;  3AZH A;  5B32 C;  5B1L D;  4ZUX B;  5AV5 D;  5B0Z A;  3LZ1 C;  4WV4 B;  1KX5 C;  2VQR A;  5B40 A;  1M18 A;  1WWI A;  1KU5 A;  1JFI A;  2CV5 D;  3AZN A;  1P3B B;  5F99 A;  5E5A A;  3EPL A;  5GT0 D;  3MGQ D;  3UT9 B;  3AZK A;  3MVD A;  3W96 A;  5B2I D;  3B0D B;  4J8U C;  5FUG B;  4CAY A;  1ZLA D;  3B0B A;  3C1C A;  3WA9 C;  3REJ B;  4XZQ C;  5B0Y D;  5B1M D;  2HIO D;  1HQ3 A;  4CSR B;  3MGR C;  1M1A B;  4XUJ B;  3MNN A;  3X1S B;  1PZR A;  5DNM A;  3REH C;  5B31 G;  3A6N A;  3AV2 D;  3AYW C;  5GT3 A;  2F2A C;  3W99 A;  2HUE B;  2ZY3 A;  3AN2 D;  5B32 G;  4JJN D;  4H9O B;  1KX3 D;  5AV6 B;  1P3M A;  1P3P B;  2Y2G A;  5AY8 C;  4R8P A;  3AZI D;  1ID3 A;  3B0C W;  3AV1 D;  1S32 B;  3LJA A;  5AVC D;  2BYM A;  4WNN B;  4KUD B;  3H0R C;  2Y2H A;  1KX4 A;  4H9P B;  1P3F B;  3EPK A;  5JRG B;  2JSS A;  5B32 D;  2JCH A;  5BNV B;  4Z66 B;  1EQZ B;  2ZY4 A;  2NZD C;  1KX5 D;  4WU8 B;  1N1J A;  3NQJ B;  5BS7 A;  3AZG C;  5B1L A;  2F8N D;  2ARO C;  5AV5 A;  5CPJ C;  3C1B D;  4J8X C;  2W8S A;  4J8U D;  3AZM B;  2Y2P A;  4YM6 C;  3R45 A;  3MGQ A;  3UTA C;  4J8W D;  5G49 A;  5AV8 C;  3WA9 D;  4XZQ D;  1P3O B;  3A1K A;  3REL C;  5AVB C;  1ZLA A;  3MGR D;  3VH6 W;  5JA4 B;  3WTP C;  1P3I B;  5B0Y A;  3REH D;  5B1M A; 
#chains in the Genus database with same CATH homology
 3UTB C;  4X23 B;  4M6B A;  3AYW D;  2NQB C;  3B6G B;  4WU9 B;  3REI B;  3AZE B;  4DQY B;  4E45 A;  4LD9 C;  4KGC D;  1F66 B;  4Z2M H;  5KDM B;  5AY8 D;  1ULY A;  3WAA C;  4JJN A;  3B0C T;  3KXB B;  3O62 D;  3AZF B;  1KX3 A;  5B0Z B;  3AV1 A;  1H3O A;  3AZH D;  3W97 C;  2Y2M A;  5AVC A;  3X1T B;  3F6T A;  2NZD D;  4Z2M G;  2CWE A;  3AZN B;  5F99 B;  3MGP C;  3AZG D;  5B32 A;  5CPJ D;  3LZ1 A;  1KX5 A;  3AZL D;  4J8X D;  2F8N A;  3AZJ C;  4H9N A;  5CHL B;  3LZ0 C;  4G91 B;  4YM6 D;  1P3A C;  3UTA D;  5GXQ C;  3C1C D;  5GSU B;  2BYK A;  5CP6 B;  4J8U A;  5B33 B;  3REL D;  1HQ3 D;  5AVB D;  3MNN B;  5CPI C;  4J8W A;  4KHA B;  3WTP D;  3W98 C;  3WA9 A;  3VH6 T;  4XZQ A;  3WTP E;  3X1V B;  1P3K B;  3W99 B;  3MGR A;  3UTB D;  4QLC C;  1AOI C;  1P34 C;  2NQB D;  5BNX A;  3REH A;  5B24 C;  2IO5 B;  4ZUX C;  3AYW A;  2LY8 A;  3VH5 W;  3MGS B;  1ID3 B;  4R8P D;  1P3B C;  2BYM B;  3WAA D;  3UT9 C;  3LEL B;  2Y2I A;  5AV9 B;  5B31 C;  3AFA B;  2YFV B;  2Y2Q A;  5AY8 A;  3B0D C;  3W97 D;  3O62 A;  1HTA A;  3REJ C;  2FJ7 B;  1M19 D;  1M1A C;  3KWQ B;  4NE3 A;  4XUJ C;  3X1S C;  1P3L B;  2NZD A;  2CV5 B;  3AZG A;  3AZJ D;  5GT0 B;  2ARO A;  2ZY5 A;  3LZ0 D;  3IP4 C;  5BO0 B;  5CPJ A;  1P3A D;  3A1I A;  2HUE C;  4ZBJ B;  5GXQ D;  5B2I B;  4J8X A;  3AZL A;  4YS3 B;  1TZY B;  1BFM A;  5DNN B;  2G5I C;  4YM6 A;  3UTA A;  5B1M B;  5AV8 A;  3W98 D;  2HIO B;  5AV6 C;  1P3P C;  4H9R A;  3B6F B;  3REL A;  1S32 C;  5AVB A;  4QLC D;  3REK B;  4KUD C;  1AOI D;  3WTP A;  3AV2 B;  1P34 D;  1P3F C;  4H9Q A;  5JRG C;  5B24 D;  3UTB A;  1EQZ C;  4Z66 C;  4ZUX D;  2NQB A;  1WWS A;  3AN2 B;  3VH5 T;  4NE6 A;  4NFT A;  3TU4 B;  4WU8 C;  3WKJ C;  1P3B D;  4LD9 A;  3UT9 D;  3AZI B;  1H3O B;  4Z5T B;  5B31 D;  3H0L C;  5AVC B;  3AZM C;  1P3G B;  3WAA A;  3REJ D;  1P3O C;  2ZM5 A;  3W97 A;  4XUJ D;  1P3I C;  3LZ1 D;  2Y2L A;  3X1S D;  4AWL B;  4WZS B;  4J8V B;  1M19 A;  3MGP A;  4X23 C;  3C1B B;  3B6G C;  2BYK B;  3X1U B;  3AZE C;  1U35 B;  3KUY C;  3AZJ A;  2PYO B;  3LZ0 A;  4J8W B;  3V9R A;  1P3A A;  5GXQ A;  1F66 C;  5AV6 D;  1P3P D;  1S32 D;  3NQU A;  3KXB C;  3AZF C;  4KUD D;  1BH9 A;  3W98 A;  3VH6 A;  4QLC A;  1EQZ D;  4Z66 D;  1AOI A;  1BH8 A;  3X1T C;  1P34 A;  4WU8 D;  5B24 A;  4KGC B;  3WKJ D;  5BT1 C;  1TAF B;  4ZUX A;  4HGA C;  5AY8 B;  5C3I B;  2UWX A;  2BG1 A;  3O62 B;  1P3B A;  2DQN C;  3UT9 A;  1R4V A;  5GSU C;  3AZH B;  5B31 A;  5CP6 C;  5CPK C;  1P3O D;  5B33 C;  5FUG A;  3MNN C;  5B2J C;  1P3I D;  5B40 B;  1M18 B;  3REJ A;  3AZG B;  1JFI B;  3X1V C;  5E5A B;  1P3K C;  4CSR A;  4X23 D;  3AZK B;  2ARO D;  3EPJ A;  4G92 B;  1M1A A;  4XUJ A;  3AZL B;  3X1S A;  3MVD B;  3W96 B;  3AZE D;  4CAY B;  3KUY D;  2RVQ C;  3C1C B;  3MGS C;  1F66 D;  5AV8 D;  1HQ3 B;  2Y2K A;  3LEL C;  3KXB D;  5DNM B;  3AZF D;  5AV9 C;  3A6N B;  5AV6 A;  3AFA C;  1P3P A;  5GT3 B;  1S32 A;  4KUD A;  3EG5 B;  2RIQ A;  4WNN A;  2YFW A;  4H9P A;  1P3F A;  4UUZ A;  2FJ7 C;  5JRG A;  4EO5 B;  5BT1 D;  1EQZ A;  4Z66 A;  3KWQ C;  4LD9 D;  1P3M B;  1P3L C;  4R8P B;  4WU8 A;  2CV5 C;  3NQJ A;  3WAA B;  3WKJ A;  3LJA B;  5GT0 C;  3VH5 A;  1KX4 B;  2JE5 A;  5B2I C;  5GSU D;  4YS3 C;  1TZY C;  5CPK D;  5DNN C;  5B33 D;  4DRA A;  3AZM A;  5B2J D;  1N1J B;  1M19 B;  2DF4 C;  2HIO C;  5B1L B;  3B6F C;  1P3O A;  5AV5 B;  3X1V D;  3MGP D;  1P3K D;  3REK C;  1P3I A;  3AV2 C;  4DRB A;  3R45 B;  4X23 A;  3MGQ B;  5G49 B;  3B6G A;  3AN2 C;  3AZE A;  3TU4 C;  3KUY A;  1ZLA B;  5CPI D;  5B0Y B;  3AZI C;  1F66 A;  5AV9 D;  5KDM A;  4Z5T C;  3AFA D;  5AVC C;  1P3G C;  1AOI B;  3KXB A;  3AZF A;  2J8P A;  2FJ7 D;  3P5J B;  3KWQ D;  3X1T A;  1P3L D;  4AWL C;  4J8V C;  4NE5 A;  4JJN B;  3C1B C;  1KX3 B;  5B31 B;  3X1U C;  1U35 C;  3AV1 B;  4YS3 D;  2PYO C;  3KFU G;  4J8W C;  1TZY D;  5DNN D;  2G5H C;  2FFF B;  5GSU A;  2L5A A;  5B32 B;  5CP6 A;  5CPK A;  3B6F D;  1T3U A;  5B33 A;  2F8N K;  3LZ1 B;  1M1A D;  5B2J A;  3REK D;  1KX5 B;  4KHA A;  2F8N H;  2F8N B;  4H9N B;  3X1V A;  1P3K A;  4UPK A;  4WU9 C;  3REI C;  4J8U B;  3TU4 D;  4KGC C;  2ZY2 A;  2Y2N A;  3WA9 B;  3MGS A;  4XZQ B;  5C3I C;  2F8N G;  4Z5T D;  3MGR B;  3O62 C;  1A7W A;  1P3G D;  4H9S C;  2YFW B;  5CPI A;  3LEL A;  4UUZ B;  5BNX B;  5AV9 A;  3REH B;  3AZH C;  3AFA A;  2YFV A;  1P3F D;  5JRG D;  3AYW B;  5B0Z C;  5B40 C;  1M18 C;  2XD5 A;  3WKJ B;  2FJ7 A;  3AZN C;  4J8V D;  5F99 C;  5E5A C;  3AZK C;  4G92 C;  3EPH A;  3KWQ A;  3AZL C;  3MVD C;  1P3L A;  3X1U D;  2CV5 A;  3W96 C;  1U35 D;  1B6W A;  1Q9C A;  5GT0 A;  2PYO D;  2Y2J A;  4G91 C;  5BO0 A;  3C1C C;  3AZM D;  5B2I A;  4YS3 A;  1HQ3 C;  1TZY A;  5DNN A;  2NZD B;  5DNM C;  3A6N C;  3AL0 C;  2HIO A;  2ARO B;  3B6F A;  5GT3 C;  5CPJ B;  3W99 C;  3FDD A;  3REK A;  4J8X B;  3KUY B;  3AV2 A;  3B6G D;  4WU9 D;  3REI D;  4EO5 C;  4YM6 B;  3UTA B;  2IO5 C;  5AV8 B;  1P3M C;  1ID3 C;  4R8P C;  4H9R B;  3AN2 A;  3REL B;  3TU4 A;  5AVB B;  3LJA C;  3WTP B;  4H9O A;  1KX4 C;  4H9Q B;  3AZI A;  4Z5T A;  3UTB B;  5B0Z D;  1P3G A;  2NQB B;  1M19 C;  5B40 D;  1M18 D;  5BS7 C;  3X1T D;  5B1L C;  3AZN D;  5AV5 C;  4LD9 B;  5F99 D;  5E5A D;  3AZK D;  5BNV A;  4HGA B;  3MVD D;  3W96 D;  4J8V A;  3MGQ C;  3C1B A;  3X1U A;  4ZBJ C;  5CPK B;  1U35 A;  1ZLA C;  3W97 B;  5CP6 D;  2PYO A;  1F1E A;  5B2J B;  3MNN D;  5DNM D;  5B0Y C;  5B1M C;  3A6N D;  3MGP B;  1W2E A;  5GT3 D;  3W99 D;  5JA4 A;  3AZJ B;  3H0M C;  3LZ0 B;  3V9R B;  1P3A B;  2RVQ D;  5GXQ B;  4E44 A;  4WJ3 C;  2XD1 A;  4WU9 A;  3MGS D;  1P3M D;  3REI A;  1ID3 D;  1B67 A;  2Y2O A;  4JJN C;  4KGC A;  3LJA D;  1TAF A;  3NQU B;  5CPI B;  1BH9 B;  3W98 B;  1KX3 C;  3LEL D;  1KX4 D;  3AV1 C;  3KSY A;  4QLC B;  1Z2C B;  1BH8 B;  4H9S A;  1P34 B;  5B24 B;  3AZH A;  5B32 C;  5B1L D;  4ZUX B;  5AV5 D;  5B0Z A;  3LZ1 C;  4WV4 B;  1KX5 C;  2VQR A;  5B40 A;  1M18 A;  1WWI A;  1KU5 A;  1JFI A;  2CV5 D;  3AZN A;  1P3B B;  5F99 A;  5E5A A;  3EPL A;  5GT0 D;  3MGQ D;  3UT9 B;  3AZK A;  3MVD A;  3W96 A;  5B2I D;  3B0D B;  4J8U C;  5FUG B;  4CAY A;  1ZLA D;  3B0B A;  3C1C A;  3WA9 C;  3REJ B;  4XZQ C;  5B0Y D;  5B1M D;  2HIO D;  1HQ3 A;  4CSR B;  3MGR C;  1M1A B;  4XUJ B;  3MNN A;  3X1S B;  1PZR A;  5DNM A;  3REH C;  5B31 G;  3A6N A;  3AV2 D;  3AYW C;  5GT3 A;  2F2A C;  3W99 A;  2HUE B;  2ZY3 A;  3AN2 D;  5B32 G;  4JJN D;  4H9O B;  1KX3 D;  5AV6 B;  1P3M A;  1P3P B;  2Y2G A;  5AY8 C;  4R8P A;  3AZI D;  1ID3 A;  3B0C W;  3AV1 D;  1S32 B;  3LJA A;  5AVC D;  2BYM A;  4WNN B;  4KUD B;  3H0R C;  2Y2H A;  1KX4 A;  4H9P B;  1P3F B;  3EPK A;  5JRG B;  2JSS A;  5B32 D;  2JCH A;  5BNV B;  4Z66 B;  1EQZ B;  2ZY4 A;  2NZD C;  1KX5 D;  4WU8 B;  1N1J A;  3NQJ B;  5BS7 A;  3AZG C;  5B1L A;  2F8N D;  2ARO C;  5AV5 A;  5CPJ C;  3C1B D;  4J8X C;  2W8S A;  4J8U D;  3AZM B;  2Y2P A;  4YM6 C;  3R45 A;  3MGQ A;  3UTA C;  4J8W D;  5G49 A;  5AV8 C;  3WA9 D;  4XZQ D;  1P3O B;  3A1K A;  3REL C;  5AVB C;  1ZLA A;  3MGR D;  3VH6 W;  5JA4 B;  3WTP C;  1P3I B;  5B0Y A;  3REH D;  5B1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...