3KUYD

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 39
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyD00
5GXQD 5DNMA 3AZLA 3AZKD 3V9RB 5BS7A 2F8NG 4H9NB 5DNMC 4ZBJB 3NQUB 1M1AA 3KXBB 1TZYC 3AZGC 4XZQC 4YM6B 2NZDB 2HIOC 4WZSB 4R8PC 3O62B 3KWQD 1M1AB 4XZQD 4EO5B 4H9NA 4J8WD 3V9RA 5CPJC 3AZKC 5B33A 1BH9A 5AV5A 4WU9C 1P3FC 4LD9B 5E5AD 3W97A 1KU5A 3MGQC 5B32D 3WTPE 3KXBD 1P3OA 3C1CC 3MGRA 3X1UC 3W99A 3X1SA 5F99D 4LD9C 5BNVB 3X1TA 1F66A 5G49B 1KX3D 4DRBA 2YFWA 1S32B 1M19A 3MGPB 5B2JB 3LZ1C 3REJC 3B6GC 3B6GA 5AV9D 3LZ1A 3UT9C 4Z2MG 4JJNA 1AOIB 1HQ3C 1HQ3A 3UTAD 4EO5C 4JJNC 2CWEA 5GSUB 2AROB 5B33B 1P3IB 5B32B 5GT0C 5B40D 3WA9A 3AZJC 2CV5B 4QLCB 2F8ND 5B33C 5GSUD 3C1BB 5E5AB 3RELB 4X23A 3TU4A 5AY8D 3UTAB 3LJAD 3NQUA 4R8PA 3MVDD 3O62D 3AZND 3AV2C 5AV8A 3REJB 3AZED 1TZYA 1P3PC 1P3PD 1P3AC 4YS3B 5B31B 1N1JB 3AZNC 3AV2D 3AV2B 4G92B 4X23D 1EQZB 3AZGA 3C1CB 3WAAB 2HUEC 3AZNA 2IO5B 5JRGA 3KXBA 1EQZC 4G92C 4ZUXA 1WWIA 2PYOB 3AZJD 2YFVA 4WU8A 1P3AB 4J8UA 2AROC 3AZFC 4KGCB 4J8XA 4YM6C 2NZDC 3UTAC 1P3ID 3LZ1D 2F8NK 1HQ3B 4Z66D 1P3KD 3LZ0A 3UT9B 3A6NB 3B0CT 4LD9D 3B6GB 3AZFD 5JA4A 3W96A 1P34B 1BH8A 5G49A 5B32C 3AN2B 3AZHD 4WU9D 1P3FD 3W99B 4J8UB 3X1UB 3W98A 5CPKA 3MGQD 4YS3A 4WU8B 3REHC 5AV8B 5CPJD 3REJA 2NQBD 3B6FB 1BH9B 4Z2MH 3X1VA 3AZKB 1ZLAB 5CPJB 2RVQD 2FJ7D 3AZEA 1TZYD 3C1CA 1P3MA 5B0ZC 3W97C 3O62C 2HIOD 2HIOB 3AZGD 3WA9B 3W98B 3REID 4J8WA 5GT3A 1BFMA 3UTBA 1H3OB 5GXQC 3LELA 4J8VC 5JRGD 4CAYB 5CPKC 3REKA 3B0CW 1TAFA 3AZIC 4H9SC 1Q9CA 4WU8D 3LZ0B 5B32G 3C1BA 1M1AC 5BO0B 3MGSC 3AFAD 3MNNC 3AZMD 3AV1A 5KDMB 3VH6W 5BS7C 3WA9D 4KGCA 3WTPB 3AZLC 5GXQA 3AZLD 1R4VA 5BNXB 1JFIB 3B6GD 3LELB 4J8XB 3X1TD 1F66D 1KX4D 5B0ZA 3AYWA 3KUYD 5JRGB 3WTPA 2HUEB 3AZID 4J8VD 4HGAC 2YFVB 3WAAA 5CPKD 2PYOA 2YFWB 1S32A 3REIB 4G91C 4E45A 5AVCB 5AV6A 5DNND 5B1MC 1TAFB 1P3BB 4Z5TB 2NQBA 4KUDC 5B31C 4YS3C 3AV1C 1P3OB 5B0ZD 5B24B 4H9PA 4H9OA 1P3BD 4CSRB 4NE3A 3RELD 2F8NA 4AWLB 2RVQC 5B31A 5CHLB 4Z5TA 2CV5D 2F8NB 5B1MA 2NQBC 4AWLC 5AV6C 5AY8A 3REIA 1KX4B 1KX5C 5DNMD 3UTAA 3LELD 4YM6A 3RELA 3AZHC 2NZDA 3R45A 3AYWC 5AVBC 1M18C 4G91B 1B67A 3AN2D 4NFTA 5B2IB 1AOIC 3AZMB 3LZ1B 5B2JC 4KGCD 5BT1C 5CP6C 2AROD 5AV5D 3LJAA 3WKJD 4H9SA 3UT9A 3R45B 3REKB 1B6WA 3MVDB 3MGQB 3VH6T 3W96C 1M19B 1KX4A 3W99D 4WU9B 1P3FB 5BO0A 1U35C 4LD9A 5CPIB 3AV2A 3UTBC 3X1SC 5GT3C 2PYOD 3LZ0C 1P34D 2JSSA 3AFAB 3VH5A 4Z66B 3UTBB 3AZFA 4R8PB 1P3KB 4ZUXB 1P3MC 4DRAA 4ZUXD 4UUZA 3AZKA 1P3BA 4ZBJC 3MVDC 4ZUXC 1P3MB 1P3AD 1EQZA 3X1VD 5B0YD 5AV9B 5C3IC 5B1LB 3LJAC 1P3MD 5CP6A 4WV4B 3X1SD 1ID3D 2FJ7A 4NE5A 5B2IC 1M19C 3W96B 5JA4B 5B33D 5B31G 3W96D 3B6FD 5AVBB 3UTBD 1M18B 5AV8D 1P3PA 5E5AA 5B40C 1ID3B 3AN2A 3W99C 4XUJD 3TU4C 3MGQA 5BT1D 5F99A 5AV9C 1P3LD 5AV5C 5B0YB 5B2JD 2AROA 3AZMA 3AZMC 3MGSD 1M1AD 4H9RA 5F99C 3C1BD 3VH6A 1KX3C 4QLCD 5AVBD 5KDMA 1M18D 3VH5T 5AVCC 3AZEB 3X1SB 3NQJA 1N1JA 3X1VB 3B0DB 1P3GA 1P3OD 5AV6D 5DNNA 3WAAC 3MGRD 3KWQC 4H9OB 4J8WB 1P3GB 3MGRC 3WAAD 2BYKB 5B1LA 1P3OC 4X23B 4R8PD 3AV1D 4WNNA 5B40B 1P3BC 4KUDB 3B0DC 1BH8B 4YS3D 3AZJA 5CPJA 3MGSB 1U35A 2F8NH 5B1LC 3LJAB 3VH5W 1P3LB 3C1BC 3KUYA 5CPID 3WTPD 5BNXA 4QLCC 1P3GC 3WKJB 5FUGA 1KX4C 1KX3B 1KX5B 5GSUA 3KWQB 1P3IC 5F99B 4YM6D 2NZDD 5B2JA 1JFIA 3WA9C 1P3LA 5BNVA 4JJNB 1AOIA 1F1EA 4J8XD 1WWSA 3AFAC 5B2ID 2L5AA 1H3OA 5CPIC 1ID3C 4Z5TD 5B1MB 3B6FC 4H9QA 1KX5A 5AVBA 1M18A 1M19D 4KHAA 3REIC 5AV9A 2FJ7B 3KSYA 4HGAB 3W97B 2BYMB 4H9PB 5B0YC 5AV5B 5CP6B 5C3IB 4NE6A 3TU4B 4UUZB 2HIOA 1ZLAC 3W97D 2LY8A 2FJ7C 2BYMA 4WNNB 3REHB 4KUDA 3AZLB 3REHD 1ZLAA 3MNNB 3AYWB 4XZQB 1TZYB 3REKD 4Z66A 4CSRA 3LZ0D 3AZFB 1P3KA 5B24A 3AZIB 5AVCD 5DNMB 1U35D 1P34C 5CPKB 4KHAB 3MVDA 5GT3D 2PYOC 4J8VB 2NQBB 3A6NC 5GXQB 5CPIA 2IO5C 1HTAA 1P34A 2CV5A 4KGCC 5B24D 5B24C 3WKJC 4Z66C 1P3KC 5B0ZB 1P3LC 4H9RB 3AZIA 3A6ND 3TU4D 4XUJA 5GT3B 4E44A 3MNNA 4XUJC 3C1CD 3MGSA 1U35B 1P3AA 1EQZD 5AV8C 3MGPA 3KUYB 3REKC 3AYWD 1KX5D 3X1TB 1F66B 4X23C 3LELC 3O62A 4J8VA 3AZHB 3AZNB 2CV5C 3MGRB 3AZJB 4J8WC 5GT0B 5AY8B 3B6FA 5DNNB 3X1VC 5GT0A 1A7WA 3AFAA 2BYKA 3AZEC 4H9QB 3RELC 3AZHA 3REHA 1ZLAD 4KUDD 5DNNC 5AY8C 5B31D 3MGPC 5B1MD 3NQJB 4Z5TC 5B32A 1P3IA 5GT0D 5AV6B 5AVCA 5GSUC 4J8UD 3W98C 3X1TC 1F66C 4QLCA 3KUYC 3X1UA 1KX3A 5B0YA 1S32D 3WKJA 4XUJB 4J8XC 3UT9D 4JJND 4WU9A 1P3FA 3AV1B 1HQ3D 5CP6D 1S32C 1P3GD 1ID3A 3A6NA 4WU8C 3REJD 3WTPC 1P3PB 4CAYA 3MNND 3X1UD 3W98D 4J8UC 5B1LD 1ULYA 3KXBC 3AZGB 5JRGC 1AOID 3AN2C 5E5AC 5B40A 3KWQA 4XZQA 3MGPD 3B0BA 5FUGB 4M6BA 5B2IA
chains in the Genus database with same CATH superfamily
5GXQD 2W8SA 5DNMA 3AZLA 3AZKD 3V9RB 5BS7A 2F8NG 4H9NB 5DNMC 4ZBJB 3NQUB 1M1AA 3KXBB 1TZYC 3AZGC 1PZRA 4XZQC 4YM6B 2NZDB 2HIOC 2Y2HA 4WZSB 4R8PC 3O62B 3KWQD 1M1AB 4XZQD 4EO5B 4H9NA 4J8WD 3V9RA 5CPJC 3AZKC 5B33A 1BH9A 5AV5A 4WU9C 1P3FC 4LD9B 5E5AD 3W97A 1KU5A 3MGQC 5B32D 3WTPE 3KXBD 1P3OA 3C1CC 3MGRA 3X1UC 3W99A 3X1SA 5F99D 4LD9C 5BNVB 3X1TA 1F66A 5G49B 1KX3D 3H0LC 4DRBA 2YFWA 1S32B 3A1IA 1M19A 3MGPB 5B2JB 3LZ1C 3REJC 3B6GC 3B6GA 5AV9D 3LZ1A 3UT9C 4Z2MG 4JJNA 1AOIB 1HQ3C 1HQ3A 3UTAD 4EO5C 2Y2MA 4JJNC 2CWEA 5GSUB 2AROB 5B33B 1P3IB 5B32B 5GT0C 5B40D 3WA9A 3AZJC 2CV5B 4QLCB 3FDDA 2F8ND 5B33C 5GSUD 3C1BB 5E5AB 3RELB 4X23A 3TU4A 5AY8D 3UTAB 2Y2IA 3LJAD 3NQUA 4R8PA 3MVDD 3O62D 3AZND 3EPKA 5AV8A 3REJB 3AZED 1TZYA 3AV2C 1P3PC 1P3AC 4YS3B 1P3PD 5B31B 1N1JB 3AZNC 3AV2D 3AV2B 4G92B 4X23D 1EQZB 3AZGA 3C1CB 3WAAB 2HUEC 3AL0C 1W2EA 3AZNA 2IO5B 5JRGA 3KXBA 1EQZC 4G92C 4ZUXA 1WWIA 2PYOB 3AZJD 4UPKA 1Z2CB 2YFVA 4WU8A 1P3AB 4J8UA 2AROC 3AZFC 4KGCB 4J8XA 4YM6C 2NZDC 3UTAC 1P3ID 3LZ1D 2F8NK 1HQ3B 4Z66D 1P3KD 3LZ0A 3UT9B 3A6NB 3B0CT 4LD9D 3B6GB 3AZFD 5JA4A 3W96A 1P34B 2UWXA 1BH8A 2ZM5A 5G49A 5B32C 3AN2B 3AZHD 4WU9D 1P3FD 3W99B 4J8UB 2Y2JA 3X1UB 3W98A 5CPKA 3MGQD 3EG5B 4YS3A 4WU8B 3REHC 5AV8B 5CPJD 3REJA 2NQBD 3B6FB 1BH9B 4Z2MH 3X1VA 2DF4C 3AZKB 1ZLAB 5CPJB 2RVQD 2FJ7D 3AZEA 1TZYD 3C1CA 1P3MA 3A1KA 5B0ZC 3W97C 3O62C 2HIOD 2HIOB 3AZGD 3WA9B 3W98B 3REID 2BG1A 4J8WA 5GT3A 1BFMA 3UTBA 1H3OB 2ZY5A 5GXQC 3LELA 4J8VC 5JRGD 2Y2QA 4CAYB 5CPKC 3REKA 3B0CW 1TAFA 3AZIC 4H9SC 1Q9CA 4WU8D 3LZ0B 5B32G 3C1BA 1M1AC 5BO0B 3MGSC 3AFAD 3MNNC 3AZMD 3AV1A 5KDMB 3VH6W 5BS7C 3WA9D 4KGCA 3WTPB 3AZLC 5GXQA 3AZLD 1R4VA 5BNXB 1JFIB 3B6GD 3LELB 4J8XB 3X1TD 1F66D 1KX4D 5B0ZA 3AYWA 3KUYD 5JRGB 3WTPA 2HUEB 3AZID 4J8VD 4HGAC 2YFVB 3WAAA 2Y2PA 5CPKD 2YFWB 1S32A 2PYOA 3REIB 4G91C 4E45A 5AVCB 5AV6A 3F6TA 5DNND 5B1MC 1TAFB 1P3BB 4Z5TB 2NQBA 4KUDC 5B31C 4YS3C 3AV1C 1P3OB 2ZY3A 5B0ZD 5B24B 4H9PA 4H9OA 1P3BD 4CSRB 4NE3A 3RELD 2F8NA 4AWLB 2RVQC 5B31A 5CHLB 3KFUG 4Z5TA 2CV5D 2F8NB 5B1MA 2NQBC 4AWLC 5AV6C 5AY8A 3REIA 1KX4B 1KX5C 5DNMD 3UTAA 3LELD 4YM6A 3RELA 3AZHC 2NZDA 3R45A 3AYWC 5AVBC 1M18C 1B67A 4G91B 3AN2D 4NFTA 5B2IB 1AOIC 3AZMB 3LZ1B 5B2JC 4KGCD 2G5HC 5BT1C 5CP6C 2AROD 5AV5D 3LJAA 3WKJD 4H9SA 3UT9A 3R45B 2FFFB 3REKB 1B6WA 3MVDB 3MGQB 3VH6T 3W96C 1M19B 1KX4A 3W99D 4WU9B 1P3FB 5BO0A 1U35C 4LD9A 5CPIB 3AV2A 3UTBC 3X1SC 5GT3C 2PYOD 3LZ0C 1P34D 2JSSA 3AFAB 3VH5A 4WJ3C 4Z66B 3UTBB 3AZFA 4R8PB 1P3KB 4ZUXB 1P3MC 4DRAA 4ZUXD 2ZY2A 4UUZA 3AZKA 1T3UA 1P3BA 4ZBJC 3MVDC 2RIQA 4ZUXC 1P3MB 1P3AD 1EQZA 3X1VD 5B0YD 5AV9B 5C3IC 5B1LB 3LJAC 1P3MD 5CP6A 4WV4B 3X1SD 1ID3D 2FJ7A 4NE5A 5B2IC 1M19C 3W96B 5JA4B 5B33D 5B31G 3W96D 3B6FD 5AVBB 3UTBD 2JE5A 1M18B 5AV8D 1P3PA 5E5AA 5B40C 1ID3B 3AN2A 3W99C 4XUJD 3TU4C 3MGQA 5BT1D 5F99A 5AV9C 1P3LD 5AV5C 5B0YB 5B2JD 2AROA 2Y2KA 3AZMA 3AZMC 3MGSD 1M1AD 4H9RA 5F99C 3C1BD 2XD1A 3VH6A 1KX3C 4QLCD 2Y2LA 5AVBD 5KDMA 1M18D 3VH5T 5AVCC 3AZEB 3X1SB 3NQJA 1N1JA 3X1VB 3B0DB 1P3GA 1P3OD 5AV6D 5DNNA 3WAAC 3MGRD 3KWQC 4H9OB 4J8WB 1P3GB 3MGRC 3WAAD 2BYKB 5B1LA 1P3OC 4X23B 4R8PD 3AV1D 4WNNA 5B40B 1P3BC 4KUDB 3B0DC 1BH8B 4YS3D 3AZJA 5CPJA 2F2AC 3MGSB 1U35A 2F8NH 5B1LC 3LJAB 3VH5W 1P3LB 3C1BC 3KUYA 5CPID 3WTPD 5BNXA 4QLCC 1P3GC 3WKJB 5FUGA 1KX4C 1KX3B 1KX5B 5GSUA 3KWQB 1P3IC 5F99B 4YM6D 2NZDD 5B2JA 1JFIA 3WA9C 1P3LA 5BNVA 4JJNB 1AOIA 1F1EA 4J8XD 2JCHA 2ZY4A 2Y2NA 1WWSA 3AFAC 2Y2OA 5B2ID 3H0MC 2L5AA 1H3OA 5CPIC 1ID3C 4Z5TD 5B1MB 3B6FC 4H9QA 1KX5A 5AVBA 1M18A 1M19D 4KHAA 3REIC 5AV9A 2FJ7B 3KSYA 4HGAB 3W97B 2BYMB 3H0RC 4H9PB 5B0YC 5AV5B 5CP6B 5C3IB 4NE6A 3TU4B 4UUZB 2HIOA 1ZLAC 3W97D 3IP4C 3EPLA 2LY8A 2FJ7C 2BYMA 4WNNB 3REHB 4KUDA 3AZLB 3REHD 1ZLAA 3MNNB 3AYWB 4XZQB 1TZYB 3REKD 4Z66A 4CSRA 3LZ0D 3AZFB 1P3KA 5B24A 3AZIB 2Y2GA 5AVCD 5DNMB 1U35D 1P34C 5CPKB 4KHAB 3MVDA 5GT3D 2PYOC 4J8VB 2NQBB 3A6NC 5GXQB 5CPIA 2IO5C 1HTAA 1P34A 2CV5A 2XD5A 3EPJA 4KGCC 5B24D 5B24C 3WKJC 4Z66C 1P3KC 5B0ZB 1P3LC 4H9RB 3AZIA 3EPHA 3A6ND 3TU4D 4XUJA 5GT3B 4E44A 3MNNA 4XUJC 3C1CD 3MGSA 1U35B 1P3AA 1EQZD 5AV8C 3MGPA 3KUYB 3REKC 3AYWD 1KX5D 3X1TB 1F66B 3P5JB 4X23C 3LELC 3O62A 4J8VA 3AZHB 3AZNB 2CV5C 3MGRB 3AZJB 4J8WC 5GT0B 4DQYB 5AY8B 3B6FA 5DNNB 3X1VC 2J8PA 5GT0A 1A7WA 3AFAA 2BYKA 3AZEC 4H9QB 3RELC 3AZHA 3REHA 1ZLAD 4KUDD 5DNNC 5AY8C 5B31D 3MGPC 5B1MD 3NQJB 4Z5TC 5B32A 1P3IA 5GT0D 5AV6B 5AVCA 5GSUC 4J8UD 3W98C 3X1TC 1F66C 4QLCA 3KUYC 3X1UA 2VQRA 1KX3A 5B0YA 1S32D 3WKJA 4XUJB 2G5IC 4J8XC 3UT9D 4JJND 4WU9A 1P3FA 3AV1B 1HQ3D 5CP6D 1S32C 1P3GD 1ID3A 3A6NA 4WU8C 3REJD 3WTPC 1P3PB 4CAYA 3MNND 3X1UD 3W98D 4J8UC 5B1LD 1ULYA 3KXBC 3AZGB 5JRGC 1AOID 3AN2C 5E5AC 5B40A 3KWQA 4XZQA 2DQNC 3MGPD 3B0BA 5FUGB 4M6BA 5B2IA
chains in the Genus database with same CATH topology
5GXQD 2W8SA 5DNMA 3AZLA 3AZKD 3V9RB 5BS7A 2F8NG 4H9NB 5DNMC 4ZBJB 3NQUB 1M1AA 3KXBB 1TZYC 3AZGC 1PZRA 4XZQC 4YM6B 2NZDB 2HIOC 2Y2HA 4WZSB 4R8PC 3O62B 3KWQD 1M1AB 4XZQD 4EO5B 4H9NA 4J8WD 3V9RA 5CPJC 3AZKC 5B33A 1BH9A 5AV5A 4WU9C 1P3FC 4LD9B 5E5AD 3W97A 1KU5A 3MGQC 5B32D 3WTPE 3KXBD 1P3OA 3C1CC 3MGRA 3X1UC 3W99A 3X1SA 5F99D 4LD9C 5BNVB 3X1TA 1F66A 5G49B 1KX3D 3H0LC 4DRBA 2YFWA 1S32B 3A1IA 1M19A 3MGPB 5B2JB 3LZ1C 3REJC 3B6GC 3B6GA 5AV9D 3LZ1A 3UT9C 4Z2MG 4JJNA 1AOIB 1HQ3C 1HQ3A 3UTAD 4EO5C 2Y2MA 4JJNC 2CWEA 5GSUB 2AROB 5B33B 1P3IB 5B32B 5GT0C 5B40D 3WA9A 3AZJC 2CV5B 4QLCB 3FDDA 2F8ND 5B33C 5GSUD 3C1BB 5E5AB 3RELB 4X23A 3TU4A 5AY8D 3UTAB 2Y2IA 3LJAD 3NQUA 4R8PA 3MVDD 3O62D 3AZND 3EPKA 5AV8A 3REJB 3AZED 1TZYA 3AV2C 1P3PC 1P3AC 4YS3B 1P3PD 5B31B 1N1JB 3AZNC 3AV2D 3AV2B 4G92B 4X23D 1EQZB 3AZGA 3C1CB 3WAAB 2HUEC 3AL0C 1W2EA 3AZNA 2IO5B 5JRGA 3KXBA 1EQZC 4G92C 4ZUXA 1WWIA 2PYOB 3AZJD 4UPKA 1Z2CB 2YFVA 4WU8A 1P3AB 4J8UA 2AROC 3AZFC 4KGCB 4J8XA 4YM6C 2NZDC 3UTAC 1P3ID 3LZ1D 2F8NK 1HQ3B 4Z66D 1P3KD 3LZ0A 3UT9B 3A6NB 3B0CT 4LD9D 3B6GB 3AZFD 5JA4A 3W96A 1P34B 2UWXA 1BH8A 2ZM5A 5G49A 5B32C 3AN2B 3AZHD 4WU9D 1P3FD 3W99B 4J8UB 2Y2JA 3X1UB 3W98A 5CPKA 3MGQD 3EG5B 4YS3A 4WU8B 3REHC 5AV8B 5CPJD 3REJA 2NQBD 3B6FB 1BH9B 4Z2MH 3X1VA 2DF4C 3AZKB 1ZLAB 5CPJB 2RVQD 2FJ7D 3AZEA 1TZYD 3C1CA 1P3MA 3A1KA 5B0ZC 3W97C 3O62C 2HIOD 2HIOB 3AZGD 3WA9B 3W98B 3REID 2BG1A 4J8WA 5GT3A 1BFMA 3UTBA 1H3OB 2ZY5A 5GXQC 3LELA 4J8VC 5JRGD 2Y2QA 4CAYB 5CPKC 3REKA 3B0CW 1TAFA 3AZIC 4H9SC 1Q9CA 4WU8D 3LZ0B 5B32G 3C1BA 1M1AC 5BO0B 3MGSC 3AFAD 3MNNC 3AZMD 3AV1A 5KDMB 3VH6W 5BS7C 3WA9D 4KGCA 3WTPB 3AZLC 5GXQA 3AZLD 1R4VA 5BNXB 1JFIB 3B6GD 3LELB 4J8XB 3X1TD 1F66D 1KX4D 5B0ZA 3AYWA 3KUYD 5JRGB 3WTPA 2HUEB 3AZID 4J8VD 4HGAC 2YFVB 3WAAA 2Y2PA 5CPKD 2YFWB 1S32A 2PYOA 3REIB 4G91C 4E45A 5AVCB 5AV6A 3F6TA 5DNND 5B1MC 1TAFB 1P3BB 4Z5TB 2NQBA 4KUDC 5B31C 4YS3C 3AV1C 1P3OB 2ZY3A 5B0ZD 5B24B 4H9PA 4H9OA 1P3BD 4CSRB 4NE3A 3RELD 2F8NA 4AWLB 2RVQC 5B31A 5CHLB 3KFUG 4Z5TA 2CV5D 2F8NB 5B1MA 2NQBC 4AWLC 5AV6C 5AY8A 3REIA 1KX4B 1KX5C 5DNMD 3UTAA 3LELD 4YM6A 3RELA 3AZHC 2NZDA 3R45A 3AYWC 5AVBC 1M18C 1B67A 4G91B 3AN2D 4NFTA 5B2IB 1AOIC 3AZMB 3LZ1B 5B2JC 4KGCD 2G5HC 5BT1C 5CP6C 2AROD 5AV5D 3LJAA 3WKJD 4H9SA 3UT9A 3R45B 2FFFB 3REKB 1B6WA 3MVDB 3MGQB 3VH6T 3W96C 1M19B 1KX4A 3W99D 4WU9B 1P3FB 5BO0A 1U35C 4LD9A 5CPIB 3AV2A 3UTBC 3X1SC 5GT3C 2PYOD 3LZ0C 1P34D 2JSSA 3AFAB 3VH5A 4WJ3C 4Z66B 3UTBB 3AZFA 4R8PB 1P3KB 4ZUXB 1P3MC 4DRAA 4ZUXD 2ZY2A 4UUZA 3AZKA 1T3UA 1P3BA 4ZBJC 3MVDC 2RIQA 4ZUXC 1P3MB 1P3AD 1EQZA 3X1VD 5B0YD 5AV9B 5C3IC 5B1LB 3LJAC 1P3MD 5CP6A 4WV4B 3X1SD 1ID3D 2FJ7A 4NE5A 5B2IC 1M19C 3W96B 5JA4B 5B33D 5B31G 3W96D 3B6FD 5AVBB 3UTBD 2JE5A 1M18B 5AV8D 1P3PA 5E5AA 5B40C 1ID3B 3AN2A 3W99C 4XUJD 3TU4C 3MGQA 5BT1D 5F99A 5AV9C 1P3LD 5AV5C 5B0YB 5B2JD 2AROA 2Y2KA 3AZMA 3AZMC 3MGSD 1M1AD 4H9RA 5F99C 3C1BD 2XD1A 3VH6A 1KX3C 4QLCD 2Y2LA 5AVBD 5KDMA 1M18D 3VH5T 5AVCC 3AZEB 3X1SB 3NQJA 1N1JA 3X1VB 3B0DB 1P3GA 1P3OD 5AV6D 5DNNA 3WAAC 3MGRD 3KWQC 4H9OB 4J8WB 1P3GB 3MGRC 3WAAD 2BYKB 5B1LA 1P3OC 4X23B 4R8PD 3AV1D 4WNNA 5B40B 1P3BC 4KUDB 3B0DC 1BH8B 4YS3D 3AZJA 5CPJA 2F2AC 3MGSB 1U35A 2F8NH 5B1LC 3LJAB 3VH5W 1P3LB 3C1BC 3KUYA 5CPID 3WTPD 5BNXA 4QLCC 1P3GC 3WKJB 5FUGA 1KX4C 1KX3B 1KX5B 5GSUA 3KWQB 1P3IC 5F99B 4YM6D 2NZDD 5B2JA 1JFIA 3WA9C 1P3LA 5BNVA 4JJNB 1AOIA 1F1EA 4J8XD 2JCHA 2ZY4A 2Y2NA 1WWSA 3AFAC 2Y2OA 5B2ID 3H0MC 2L5AA 1H3OA 5CPIC 1ID3C 4Z5TD 5B1MB 3B6FC 4H9QA 1KX5A 5AVBA 1M18A 1M19D 4KHAA 3REIC 5AV9A 2FJ7B 3KSYA 4HGAB 3W97B 2BYMB 3H0RC 4H9PB 5B0YC 5AV5B 5CP6B 5C3IB 4NE6A 3TU4B 4UUZB 2HIOA 1ZLAC 3W97D 3IP4C 3EPLA 2LY8A 2FJ7C 2BYMA 4WNNB 3REHB 4KUDA 3AZLB 3REHD 1ZLAA 3MNNB 3AYWB 4XZQB 1TZYB 3REKD 4Z66A 4CSRA 3LZ0D 3AZFB 1P3KA 5B24A 3AZIB 2Y2GA 5AVCD 5DNMB 1U35D 1P34C 5CPKB 4KHAB 3MVDA 5GT3D 2PYOC 4J8VB 2NQBB 3A6NC 5GXQB 5CPIA 2IO5C 1HTAA 1P34A 2CV5A 2XD5A 3EPJA 4KGCC 5B24D 5B24C 3WKJC 4Z66C 1P3KC 5B0ZB 1P3LC 4H9RB 3AZIA 3EPHA 3A6ND 3TU4D 4XUJA 5GT3B 4E44A 3MNNA 4XUJC 3C1CD 3MGSA 1U35B 1P3AA 1EQZD 5AV8C 3MGPA 3KUYB 3REKC 3AYWD 1KX5D 3X1TB 1F66B 3P5JB 4X23C 3LELC 3O62A 4J8VA 3AZHB 3AZNB 2CV5C 3MGRB 3AZJB 4J8WC 5GT0B 4DQYB 5AY8B 3B6FA 5DNNB 3X1VC 2J8PA 5GT0A 1A7WA 3AFAA 2BYKA 3AZEC 4H9QB 3RELC 3AZHA 3REHA 1ZLAD 4KUDD 5DNNC 5AY8C 5B31D 3MGPC 5B1MD 3NQJB 4Z5TC 5B32A 1P3IA 5GT0D 5AV6B 5AVCA 5GSUC 4J8UD 3W98C 3X1TC 1F66C 4QLCA 3KUYC 3X1UA 2VQRA 1KX3A 5B0YA 1S32D 3WKJA 4XUJB 2G5IC 4J8XC 3UT9D 4JJND 4WU9A 1P3FA 3AV1B 1HQ3D 5CP6D 1S32C 1P3GD 1ID3A 3A6NA 4WU8C 3REJD 3WTPC 1P3PB 4CAYA 3MNND 3X1UD 3W98D 4J8UC 5B1LD 1ULYA 3KXBC 3AZGB 5JRGC 1AOID 3AN2C 5E5AC 5B40A 3KWQA 4XZQA 2DQNC 3MGPD 3B0BA 5FUGB 4M6BA 5B2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ D;  5DNM A;  3AZL A;  3AZK D;  3V9R B;  5BS7 A;  2F8N G;  4H9N B;  5DNM C;  4ZBJ B;  3NQU B;  1M1A A;  3KXB B;  1TZY C;  3AZG C;  4XZQ C;  4YM6 B;  2NZD B;  2HIO C;  4WZS B;  4R8P C;  3O62 B;  3KWQ D;  1M1A B;  4XZQ D;  4EO5 B;  4H9N A;  4J8W D;  3V9R A;  5CPJ C;  3AZK C;  5B33 A;  1BH9 A;  5AV5 A;  4WU9 C;  1P3F C;  4LD9 B;  5E5A D;  3W97 A;  1KU5 A;  3MGQ C;  5B32 D;  3WTP E;  3KXB D;  1P3O A;  3C1C C;  3MGR A;  3X1U C;  3W99 A;  3X1S A;  5F99 D;  4LD9 C;  5BNV B;  3X1T A;  1F66 A;  5G49 B;  1KX3 D;  4DRB A;  2YFW A;  1S32 B;  1M19 A;  3MGP B;  5B2J B;  3LZ1 C;  3REJ C;  3B6G C;  3B6G A;  5AV9 D;  3LZ1 A;  3UT9 C;  4Z2M G;  4JJN A;  1AOI B;  1HQ3 C;  1HQ3 A;  3UTA D;  4EO5 C;  4JJN C;  2CWE A;  5GSU B;  2ARO B;  5B33 B;  1P3I B;  5B32 B;  5GT0 C;  5B40 D;  3WA9 A;  3AZJ C;  2CV5 B;  4QLC B;  2F8N D;  5B33 C;  5GSU D;  3C1B B;  5E5A B;  3REL B;  4X23 A;  3TU4 A;  5AY8 D;  3UTA B;  3LJA D;  3NQU A;  4R8P A;  3MVD D;  3O62 D;  3AZN D;  3AV2 C;  5AV8 A;  3REJ B;  3AZE D;  1TZY A;  1P3P C;  1P3P D;  1P3A C;  4YS3 B;  5B31 B;  1N1J B;  3AZN C;  3AV2 D;  3AV2 B;  4G92 B;  4X23 D;  1EQZ B;  3AZG A;  3C1C B;  3WAA B;  2HUE C;  3AZN A;  2IO5 B;  5JRG A;  3KXB A;  1EQZ C;  4G92 C;  4ZUX A;  1WWI A;  2PYO B;  3AZJ D;  2YFV A;  4WU8 A;  1P3A B;  4J8U A;  2ARO C;  3AZF C;  4KGC B;  4J8X A;  4YM6 C;  2NZD C;  3UTA C;  1P3I D;  3LZ1 D;  2F8N K;  1HQ3 B;  4Z66 D;  1P3K D;  3LZ0 A;  3UT9 B;  3A6N B;  3B0C T;  4LD9 D;  3B6G B;  3AZF D;  5JA4 A;  3W96 A;  1P34 B;  1BH8 A;  5G49 A;  5B32 C;  3AN2 B;  3AZH D;  4WU9 D;  1P3F D;  3W99 B;  4J8U B;  3X1U B;  3W98 A;  5CPK A;  3MGQ D;  4YS3 A;  4WU8 B;  3REH C;  5AV8 B;  5CPJ D;  3REJ A;  2NQB D;  3B6F B;  1BH9 B;  4Z2M H;  3X1V A;  3AZK B;  1ZLA B;  5CPJ B;  2RVQ D;  2FJ7 D;  3AZE A;  1TZY D;  3C1C A;  1P3M A;  5B0Z C;  3W97 C;  3O62 C;  2HIO D;  2HIO B;  3AZG D;  3WA9 B;  3W98 B;  3REI D;  4J8W A;  5GT3 A;  1BFM A;  3UTB A;  1H3O B;  5GXQ C;  3LEL A;  4J8V C;  5JRG D;  4CAY B;  5CPK C;  3REK A;  3B0C W;  1TAF A;  3AZI C;  4H9S C;  1Q9C A;  4WU8 D;  3LZ0 B;  5B32 G;  3C1B A;  1M1A C;  5BO0 B;  3MGS C;  3AFA D;  3MNN C;  3AZM D;  3AV1 A;  5KDM B;  3VH6 W;  5BS7 C;  3WA9 D;  4KGC A;  3WTP B;  3AZL C;  5GXQ A;  3AZL D;  1R4V A;  5BNX B;  1JFI B;  3B6G D;  3LEL B;  4J8X B;  3X1T D;  1F66 D;  1KX4 D;  5B0Z A;  3AYW A;  3KUY D;  5JRG B;  3WTP A;  2HUE B;  3AZI D;  4J8V D;  4HGA C;  2YFV B;  3WAA A;  5CPK D;  2PYO A;  2YFW B;  1S32 A;  3REI B;  4G91 C;  4E45 A;  5AVC B;  5AV6 A;  5DNN D;  5B1M C;  1TAF B;  1P3B B;  4Z5T B;  2NQB A;  4KUD C;  5B31 C;  4YS3 C;  3AV1 C;  1P3O B;  5B0Z D;  5B24 B;  4H9P A;  4H9O A;  1P3B D;  4CSR B;  4NE3 A;  3REL D;  2F8N A;  4AWL B;  2RVQ C;  5B31 A;  5CHL B;  4Z5T A;  2CV5 D;  2F8N B;  5B1M A;  2NQB C;  4AWL C;  5AV6 C;  5AY8 A;  3REI A;  1KX4 B;  1KX5 C;  5DNM D;  3UTA A;  3LEL D;  4YM6 A;  3REL A;  3AZH C;  2NZD A;  3R45 A;  3AYW C;  5AVB C;  1M18 C;  4G91 B;  1B67 A;  3AN2 D;  4NFT A;  5B2I B;  1AOI C;  3AZM B;  3LZ1 B;  5B2J C;  4KGC D;  5BT1 C;  5CP6 C;  2ARO D;  5AV5 D;  3LJA A;  3WKJ D;  4H9S A;  3UT9 A;  3R45 B;  3REK B;  1B6W A;  3MVD B;  3MGQ B;  3VH6 T;  3W96 C;  1M19 B;  1KX4 A;  3W99 D;  4WU9 B;  1P3F B;  5BO0 A;  1U35 C;  4LD9 A;  5CPI B;  3AV2 A;  3UTB C;  3X1S C;  5GT3 C;  2PYO D;  3LZ0 C;  1P34 D;  2JSS A;  3AFA B;  3VH5 A;  4Z66 B;  3UTB B;  3AZF A;  4R8P B;  1P3K B;  4ZUX B;  1P3M C;  4DRA A;  4ZUX D;  4UUZ A;  3AZK A;  1P3B A;  4ZBJ C;  3MVD C;  4ZUX C;  1P3M B;  1P3A D;  1EQZ A;  3X1V D;  5B0Y D;  5AV9 B;  5C3I C;  5B1L B;  3LJA C;  1P3M D;  5CP6 A;  4WV4 B;  3X1S D;  1ID3 D;  2FJ7 A;  4NE5 A;  5B2I C;  1M19 C;  3W96 B;  5JA4 B;  5B33 D;  5B31 G;  3W96 D;  3B6F D;  5AVB B;  3UTB D;  1M18 B;  5AV8 D;  1P3P A;  5E5A A;  5B40 C;  1ID3 B;  3AN2 A;  3W99 C;  4XUJ D;  3TU4 C;  3MGQ A;  5BT1 D;  5F99 A;  5AV9 C;  1P3L D;  5AV5 C;  5B0Y B;  5B2J D;  2ARO A;  3AZM A;  3AZM C;  3MGS D;  1M1A D;  4H9R A;  5F99 C;  3C1B D;  3VH6 A;  1KX3 C;  4QLC D;  5AVB D;  5KDM A;  1M18 D;  3VH5 T;  5AVC C;  3AZE B;  3X1S B;  3NQJ A;  1N1J A;  3X1V B;  3B0D B;  1P3G A;  1P3O D;  5AV6 D;  5DNN A;  3WAA C;  3MGR D;  3KWQ C;  4H9O B;  4J8W B;  1P3G B;  3MGR C;  3WAA D;  2BYK B;  5B1L A;  1P3O C;  4X23 B;  4R8P D;  3AV1 D;  4WNN A;  5B40 B;  1P3B C;  4KUD B;  3B0D C;  1BH8 B;  4YS3 D;  3AZJ A;  5CPJ A;  3MGS B;  1U35 A;  2F8N H;  5B1L C;  3LJA B;  3VH5 W;  1P3L B;  3C1B C;  3KUY A;  5CPI D;  3WTP D;  5BNX A;  4QLC C;  1P3G C;  3WKJ B;  5FUG A;  1KX4 C;  1KX3 B;  1KX5 B;  5GSU A;  3KWQ B;  1P3I C;  5F99 B;  4YM6 D;  2NZD D;  5B2J A;  1JFI A;  3WA9 C;  1P3L A;  5BNV A;  4JJN B;  1AOI A;  1F1E A;  4J8X D;  1WWS A;  3AFA C;  5B2I D;  2L5A A;  1H3O A;  5CPI C;  1ID3 C;  4Z5T D;  5B1M B;  3B6F C;  4H9Q A;  1KX5 A;  5AVB A;  1M18 A;  1M19 D;  4KHA A;  3REI C;  5AV9 A;  2FJ7 B;  3KSY A;  4HGA B;  3W97 B;  2BYM B;  4H9P B;  5B0Y C;  5AV5 B;  5CP6 B;  5C3I B;  4NE6 A;  3TU4 B;  4UUZ B;  2HIO A;  1ZLA C;  3W97 D;  2LY8 A;  2FJ7 C;  2BYM A;  4WNN B;  3REH B;  4KUD A;  3AZL B;  3REH D;  1ZLA A;  3MNN B;  3AYW B;  4XZQ B;  1TZY B;  3REK D;  4Z66 A;  4CSR A;  3LZ0 D;  3AZF B;  1P3K A;  5B24 A;  3AZI B;  5AVC D;  5DNM B;  1U35 D;  1P34 C;  5CPK B;  4KHA B;  3MVD A;  5GT3 D;  2PYO C;  4J8V B;  2NQB B;  3A6N C;  5GXQ B;  5CPI A;  2IO5 C;  1HTA A;  1P34 A;  2CV5 A;  4KGC C;  5B24 D;  5B24 C;  3WKJ C;  4Z66 C;  1P3K C;  5B0Z B;  1P3L C;  4H9R B;  3AZI A;  3A6N D;  3TU4 D;  4XUJ A;  5GT3 B;  4E44 A;  3MNN A;  4XUJ C;  3C1C D;  3MGS A;  1U35 B;  1P3A A;  1EQZ D;  5AV8 C;  3MGP A;  3KUY B;  3REK C;  3AYW D;  1KX5 D;  3X1T B;  1F66 B;  4X23 C;  3LEL C;  3O62 A;  4J8V A;  3AZH B;  3AZN B;  2CV5 C;  3MGR B;  3AZJ B;  4J8W C;  5GT0 B;  5AY8 B;  3B6F A;  5DNN B;  3X1V C;  5GT0 A;  1A7W A;  3AFA A;  2BYK A;  3AZE C;  4H9Q B;  3REL C;  3AZH A;  3REH A;  1ZLA D;  4KUD D;  5DNN C;  5AY8 C;  5B31 D;  3MGP C;  5B1M D;  3NQJ B;  4Z5T C;  5B32 A;  1P3I A;  5GT0 D;  5AV6 B;  5AVC A;  5GSU C;  4J8U D;  3W98 C;  3X1T C;  1F66 C;  4QLC A;  3KUY C;  3X1U A;  1KX3 A;  5B0Y A;  1S32 D;  3WKJ A;  4XUJ B;  4J8X C;  3UT9 D;  4JJN D;  4WU9 A;  1P3F A;  3AV1 B;  1HQ3 D;  5CP6 D;  1S32 C;  1P3G D;  1ID3 A;  3A6N A;  4WU8 C;  3REJ D;  3WTP C;  1P3P B;  4CAY A;  3MNN D;  3X1U D;  3W98 D;  4J8U C;  5B1L D;  1ULY A;  3KXB C;  3AZG B;  5JRG C;  1AOI D;  3AN2 C;  5E5A C;  5B40 A;  3KWQ A;  4XZQ A;  3MGP D;  3B0B A;  5FUG B;  4M6B A;  5B2I A; 
#chains in the Genus database with same CATH topology
 5GXQ D;  2W8S A;  5DNM A;  3AZL A;  3AZK D;  3V9R B;  5BS7 A;  2F8N G;  4H9N B;  5DNM C;  4ZBJ B;  3NQU B;  1M1A A;  3KXB B;  1TZY C;  3AZG C;  1PZR A;  4XZQ C;  4YM6 B;  2NZD B;  2HIO C;  2Y2H A;  4WZS B;  4R8P C;  3O62 B;  3KWQ D;  1M1A B;  4XZQ D;  4EO5 B;  4H9N A;  4J8W D;  3V9R A;  5CPJ C;  3AZK C;  5B33 A;  1BH9 A;  5AV5 A;  4WU9 C;  1P3F C;  4LD9 B;  5E5A D;  3W97 A;  1KU5 A;  3MGQ C;  5B32 D;  3WTP E;  3KXB D;  1P3O A;  3C1C C;  3MGR A;  3X1U C;  3W99 A;  3X1S A;  5F99 D;  4LD9 C;  5BNV B;  3X1T A;  1F66 A;  5G49 B;  1KX3 D;  3H0L C;  4DRB A;  2YFW A;  1S32 B;  3A1I A;  1M19 A;  3MGP B;  5B2J B;  3LZ1 C;  3REJ C;  3B6G C;  3B6G A;  5AV9 D;  3LZ1 A;  3UT9 C;  4Z2M G;  4JJN A;  1AOI B;  1HQ3 C;  1HQ3 A;  3UTA D;  4EO5 C;  2Y2M A;  4JJN C;  2CWE A;  5GSU B;  2ARO B;  5B33 B;  1P3I B;  5B32 B;  5GT0 C;  5B40 D;  3WA9 A;  3AZJ C;  2CV5 B;  4QLC B;  3FDD A;  2F8N D;  5B33 C;  5GSU D;  3C1B B;  5E5A B;  3REL B;  4X23 A;  3TU4 A;  5AY8 D;  3UTA B;  2Y2I A;  3LJA D;  3NQU A;  4R8P A;  3MVD D;  3O62 D;  3AZN D;  3EPK A;  5AV8 A;  3REJ B;  3AZE D;  1TZY A;  3AV2 C;  1P3P C;  1P3A C;  4YS3 B;  1P3P D;  5B31 B;  1N1J B;  3AZN C;  3AV2 D;  3AV2 B;  4G92 B;  4X23 D;  1EQZ B;  3AZG A;  3C1C B;  3WAA B;  2HUE C;  3AL0 C;  1W2E A;  3AZN A;  2IO5 B;  5JRG A;  3KXB A;  1EQZ C;  4G92 C;  4ZUX A;  1WWI A;  2PYO B;  3AZJ D;  4UPK A;  1Z2C B;  2YFV A;  4WU8 A;  1P3A B;  4J8U A;  2ARO C;  3AZF C;  4KGC B;  4J8X A;  4YM6 C;  2NZD C;  3UTA C;  1P3I D;  3LZ1 D;  2F8N K;  1HQ3 B;  4Z66 D;  1P3K D;  3LZ0 A;  3UT9 B;  3A6N B;  3B0C T;  4LD9 D;  3B6G B;  3AZF D;  5JA4 A;  3W96 A;  1P34 B;  2UWX A;  1BH8 A;  2ZM5 A;  5G49 A;  5B32 C;  3AN2 B;  3AZH D;  4WU9 D;  1P3F D;  3W99 B;  4J8U B;  2Y2J A;  3X1U B;  3W98 A;  5CPK A;  3MGQ D;  3EG5 B;  4YS3 A;  4WU8 B;  3REH C;  5AV8 B;  5CPJ D;  3REJ A;  2NQB D;  3B6F B;  1BH9 B;  4Z2M H;  3X1V A;  2DF4 C;  3AZK B;  1ZLA B;  5CPJ B;  2RVQ D;  2FJ7 D;  3AZE A;  1TZY D;  3C1C A;  1P3M A;  3A1K A;  5B0Z C;  3W97 C;  3O62 C;  2HIO D;  2HIO B;  3AZG D;  3WA9 B;  3W98 B;  3REI D;  2BG1 A;  4J8W A;  5GT3 A;  1BFM A;  3UTB A;  1H3O B;  2ZY5 A;  5GXQ C;  3LEL A;  4J8V C;  5JRG D;  2Y2Q A;  4CAY B;  5CPK C;  3REK A;  3B0C W;  1TAF A;  3AZI C;  4H9S C;  1Q9C A;  4WU8 D;  3LZ0 B;  5B32 G;  3C1B A;  1M1A C;  5BO0 B;  3MGS C;  3AFA D;  3MNN C;  3AZM D;  3AV1 A;  5KDM B;  3VH6 W;  5BS7 C;  3WA9 D;  4KGC A;  3WTP B;  3AZL C;  5GXQ A;  3AZL D;  1R4V A;  5BNX B;  1JFI B;  3B6G D;  3LEL B;  4J8X B;  3X1T D;  1F66 D;  1KX4 D;  5B0Z A;  3AYW A;  3KUY D;  5JRG B;  3WTP A;  2HUE B;  3AZI D;  4J8V D;  4HGA C;  2YFV B;  3WAA A;  2Y2P A;  5CPK D;  2YFW B;  1S32 A;  2PYO A;  3REI B;  4G91 C;  4E45 A;  5AVC B;  5AV6 A;  3F6T A;  5DNN D;  5B1M C;  1TAF B;  1P3B B;  4Z5T B;  2NQB A;  4KUD C;  5B31 C;  4YS3 C;  3AV1 C;  1P3O B;  2ZY3 A;  5B0Z D;  5B24 B;  4H9P A;  4H9O A;  1P3B D;  4CSR B;  4NE3 A;  3REL D;  2F8N A;  4AWL B;  2RVQ C;  5B31 A;  5CHL B;  3KFU G;  4Z5T A;  2CV5 D;  2F8N B;  5B1M A;  2NQB C;  4AWL C;  5AV6 C;  5AY8 A;  3REI A;  1KX4 B;  1KX5 C;  5DNM D;  3UTA A;  3LEL D;  4YM6 A;  3REL A;  3AZH C;  2NZD A;  3R45 A;  3AYW C;  5AVB C;  1M18 C;  1B67 A;  4G91 B;  3AN2 D;  4NFT A;  5B2I B;  1AOI C;  3AZM B;  3LZ1 B;  5B2J C;  4KGC D;  2G5H C;  5BT1 C;  5CP6 C;  2ARO D;  5AV5 D;  3LJA A;  3WKJ D;  4H9S A;  3UT9 A;  3R45 B;  2FFF B;  3REK B;  1B6W A;  3MVD B;  3MGQ B;  3VH6 T;  3W96 C;  1M19 B;  1KX4 A;  3W99 D;  4WU9 B;  1P3F B;  5BO0 A;  1U35 C;  4LD9 A;  5CPI B;  3AV2 A;  3UTB C;  3X1S C;  5GT3 C;  2PYO D;  3LZ0 C;  1P34 D;  2JSS A;  3AFA B;  3VH5 A;  4WJ3 C;  4Z66 B;  3UTB B;  3AZF A;  4R8P B;  1P3K B;  4ZUX B;  1P3M C;  4DRA A;  4ZUX D;  2ZY2 A;  4UUZ A;  3AZK A;  1T3U A;  1P3B A;  4ZBJ C;  3MVD C;  2RIQ A;  4ZUX C;  1P3M B;  1P3A D;  1EQZ A;  3X1V D;  5B0Y D;  5AV9 B;  5C3I C;  5B1L B;  3LJA C;  1P3M D;  5CP6 A;  4WV4 B;  3X1S D;  1ID3 D;  2FJ7 A;  4NE5 A;  5B2I C;  1M19 C;  3W96 B;  5JA4 B;  5B33 D;  5B31 G;  3W96 D;  3B6F D;  5AVB B;  3UTB D;  2JE5 A;  1M18 B;  5AV8 D;  1P3P A;  5E5A A;  5B40 C;  1ID3 B;  3AN2 A;  3W99 C;  4XUJ D;  3TU4 C;  3MGQ A;  5BT1 D;  5F99 A;  5AV9 C;  1P3L D;  5AV5 C;  5B0Y B;  5B2J D;  2ARO A;  2Y2K A;  3AZM A;  3AZM C;  3MGS D;  1M1A D;  4H9R A;  5F99 C;  3C1B D;  2XD1 A;  3VH6 A;  1KX3 C;  4QLC D;  2Y2L A;  5AVB D;  5KDM A;  1M18 D;  3VH5 T;  5AVC C;  3AZE B;  3X1S B;  3NQJ A;  1N1J A;  3X1V B;  3B0D B;  1P3G A;  1P3O D;  5AV6 D;  5DNN A;  3WAA C;  3MGR D;  3KWQ C;  4H9O B;  4J8W B;  1P3G B;  3MGR C;  3WAA D;  2BYK B;  5B1L A;  1P3O C;  4X23 B;  4R8P D;  3AV1 D;  4WNN A;  5B40 B;  1P3B C;  4KUD B;  3B0D C;  1BH8 B;  4YS3 D;  3AZJ A;  5CPJ A;  2F2A C;  3MGS B;  1U35 A;  2F8N H;  5B1L C;  3LJA B;  3VH5 W;  1P3L B;  3C1B C;  3KUY A;  5CPI D;  3WTP D;  5BNX A;  4QLC C;  1P3G C;  3WKJ B;  5FUG A;  1KX4 C;  1KX3 B;  1KX5 B;  5GSU A;  3KWQ B;  1P3I C;  5F99 B;  4YM6 D;  2NZD D;  5B2J A;  1JFI A;  3WA9 C;  1P3L A;  5BNV A;  4JJN B;  1AOI A;  1F1E A;  4J8X D;  2JCH A;  2ZY4 A;  2Y2N A;  1WWS A;  3AFA C;  2Y2O A;  5B2I D;  3H0M C;  2L5A A;  1H3O A;  5CPI C;  1ID3 C;  4Z5T D;  5B1M B;  3B6F C;  4H9Q A;  1KX5 A;  5AVB A;  1M18 A;  1M19 D;  4KHA A;  3REI C;  5AV9 A;  2FJ7 B;  3KSY A;  4HGA B;  3W97 B;  2BYM B;  3H0R C;  4H9P B;  5B0Y C;  5AV5 B;  5CP6 B;  5C3I B;  4NE6 A;  3TU4 B;  4UUZ B;  2HIO A;  1ZLA C;  3W97 D;  3IP4 C;  3EPL A;  2LY8 A;  2FJ7 C;  2BYM A;  4WNN B;  3REH B;  4KUD A;  3AZL B;  3REH D;  1ZLA A;  3MNN B;  3AYW B;  4XZQ B;  1TZY B;  3REK D;  4Z66 A;  4CSR A;  3LZ0 D;  3AZF B;  1P3K A;  5B24 A;  3AZI B;  2Y2G A;  5AVC D;  5DNM B;  1U35 D;  1P34 C;  5CPK B;  4KHA B;  3MVD A;  5GT3 D;  2PYO C;  4J8V B;  2NQB B;  3A6N C;  5GXQ B;  5CPI A;  2IO5 C;  1HTA A;  1P34 A;  2CV5 A;  2XD5 A;  3EPJ A;  4KGC C;  5B24 D;  5B24 C;  3WKJ C;  4Z66 C;  1P3K C;  5B0Z B;  1P3L C;  4H9R B;  3AZI A;  3EPH A;  3A6N D;  3TU4 D;  4XUJ A;  5GT3 B;  4E44 A;  3MNN A;  4XUJ C;  3C1C D;  3MGS A;  1U35 B;  1P3A A;  1EQZ D;  5AV8 C;  3MGP A;  3KUY B;  3REK C;  3AYW D;  1KX5 D;  3X1T B;  1F66 B;  3P5J B;  4X23 C;  3LEL C;  3O62 A;  4J8V A;  3AZH B;  3AZN B;  2CV5 C;  3MGR B;  3AZJ B;  4J8W C;  5GT0 B;  4DQY B;  5AY8 B;  3B6F A;  5DNN B;  3X1V C;  2J8P A;  5GT0 A;  1A7W A;  3AFA A;  2BYK A;  3AZE C;  4H9Q B;  3REL C;  3AZH A;  3REH A;  1ZLA D;  4KUD D;  5DNN C;  5AY8 C;  5B31 D;  3MGP C;  5B1M D;  3NQJ B;  4Z5T C;  5B32 A;  1P3I A;  5GT0 D;  5AV6 B;  5AVC A;  5GSU C;  4J8U D;  3W98 C;  3X1T C;  1F66 C;  4QLC A;  3KUY C;  3X1U A;  2VQR A;  1KX3 A;  5B0Y A;  1S32 D;  3WKJ A;  4XUJ B;  2G5I C;  4J8X C;  3UT9 D;  4JJN D;  4WU9 A;  1P3F A;  3AV1 B;  1HQ3 D;  5CP6 D;  1S32 C;  1P3G D;  1ID3 A;  3A6N A;  4WU8 C;  3REJ D;  3WTP C;  1P3P B;  4CAY A;  3MNN D;  3X1U D;  3W98 D;  4J8U C;  5B1L D;  1ULY A;  3KXB C;  3AZG B;  5JRG C;  1AOI D;  3AN2 C;  5E5A C;  5B40 A;  3KWQ A;  4XZQ A;  2DQN C;  3MGP D;  3B0B A;  5FUG B;  4M6B A;  5B2I A; 
#chains in the Genus database with same CATH homology
 5GXQ D;  2W8S A;  5DNM A;  3AZL A;  3AZK D;  3V9R B;  5BS7 A;  2F8N G;  4H9N B;  5DNM C;  4ZBJ B;  3NQU B;  1M1A A;  3KXB B;  1TZY C;  3AZG C;  1PZR A;  4XZQ C;  4YM6 B;  2NZD B;  2HIO C;  2Y2H A;  4WZS B;  4R8P C;  3O62 B;  3KWQ D;  1M1A B;  4XZQ D;  4EO5 B;  4H9N A;  4J8W D;  3V9R A;  5CPJ C;  3AZK C;  5B33 A;  1BH9 A;  5AV5 A;  4WU9 C;  1P3F C;  4LD9 B;  5E5A D;  3W97 A;  1KU5 A;  3MGQ C;  5B32 D;  3WTP E;  3KXB D;  1P3O A;  3C1C C;  3MGR A;  3X1U C;  3W99 A;  3X1S A;  5F99 D;  4LD9 C;  5BNV B;  3X1T A;  1F66 A;  5G49 B;  1KX3 D;  3H0L C;  4DRB A;  2YFW A;  1S32 B;  3A1I A;  1M19 A;  3MGP B;  5B2J B;  3LZ1 C;  3REJ C;  3B6G C;  3B6G A;  5AV9 D;  3LZ1 A;  3UT9 C;  4Z2M G;  4JJN A;  1AOI B;  1HQ3 C;  1HQ3 A;  3UTA D;  4EO5 C;  2Y2M A;  4JJN C;  2CWE A;  5GSU B;  2ARO B;  5B33 B;  1P3I B;  5B32 B;  5GT0 C;  5B40 D;  3WA9 A;  3AZJ C;  2CV5 B;  4QLC B;  3FDD A;  2F8N D;  5B33 C;  5GSU D;  3C1B B;  5E5A B;  3REL B;  4X23 A;  3TU4 A;  5AY8 D;  3UTA B;  2Y2I A;  3LJA D;  3NQU A;  4R8P A;  3MVD D;  3O62 D;  3AZN D;  3EPK A;  5AV8 A;  3REJ B;  3AZE D;  1TZY A;  3AV2 C;  1P3P C;  1P3A C;  4YS3 B;  1P3P D;  5B31 B;  1N1J B;  3AZN C;  3AV2 D;  3AV2 B;  4G92 B;  4X23 D;  1EQZ B;  3AZG A;  3C1C B;  3WAA B;  2HUE C;  3AL0 C;  1W2E A;  3AZN A;  2IO5 B;  5JRG A;  3KXB A;  1EQZ C;  4G92 C;  4ZUX A;  1WWI A;  2PYO B;  3AZJ D;  4UPK A;  1Z2C B;  2YFV A;  4WU8 A;  1P3A B;  4J8U A;  2ARO C;  3AZF C;  4KGC B;  4J8X A;  4YM6 C;  2NZD C;  3UTA C;  1P3I D;  3LZ1 D;  2F8N K;  1HQ3 B;  4Z66 D;  1P3K D;  3LZ0 A;  3UT9 B;  3A6N B;  3B0C T;  4LD9 D;  3B6G B;  3AZF D;  5JA4 A;  3W96 A;  1P34 B;  2UWX A;  1BH8 A;  2ZM5 A;  5G49 A;  5B32 C;  3AN2 B;  3AZH D;  4WU9 D;  1P3F D;  3W99 B;  4J8U B;  2Y2J A;  3X1U B;  3W98 A;  5CPK A;  3MGQ D;  3EG5 B;  4YS3 A;  4WU8 B;  3REH C;  5AV8 B;  5CPJ D;  3REJ A;  2NQB D;  3B6F B;  1BH9 B;  4Z2M H;  3X1V A;  2DF4 C;  3AZK B;  1ZLA B;  5CPJ B;  2RVQ D;  2FJ7 D;  3AZE A;  1TZY D;  3C1C A;  1P3M A;  3A1K A;  5B0Z C;  3W97 C;  3O62 C;  2HIO D;  2HIO B;  3AZG D;  3WA9 B;  3W98 B;  3REI D;  2BG1 A;  4J8W A;  5GT3 A;  1BFM A;  3UTB A;  1H3O B;  2ZY5 A;  5GXQ C;  3LEL A;  4J8V C;  5JRG D;  2Y2Q A;  4CAY B;  5CPK C;  3REK A;  3B0C W;  1TAF A;  3AZI C;  4H9S C;  1Q9C A;  4WU8 D;  3LZ0 B;  5B32 G;  3C1B A;  1M1A C;  5BO0 B;  3MGS C;  3AFA D;  3MNN C;  3AZM D;  3AV1 A;  5KDM B;  3VH6 W;  5BS7 C;  3WA9 D;  4KGC A;  3WTP B;  3AZL C;  5GXQ A;  3AZL D;  1R4V A;  5BNX B;  1JFI B;  3B6G D;  3LEL B;  4J8X B;  3X1T D;  1F66 D;  1KX4 D;  5B0Z A;  3AYW A;  3KUY D;  5JRG B;  3WTP A;  2HUE B;  3AZI D;  4J8V D;  4HGA C;  2YFV B;  3WAA A;  2Y2P A;  5CPK D;  2YFW B;  1S32 A;  2PYO A;  3REI B;  4G91 C;  4E45 A;  5AVC B;  5AV6 A;  3F6T A;  5DNN D;  5B1M C;  1TAF B;  1P3B B;  4Z5T B;  2NQB A;  4KUD C;  5B31 C;  4YS3 C;  3AV1 C;  1P3O B;  2ZY3 A;  5B0Z D;  5B24 B;  4H9P A;  4H9O A;  1P3B D;  4CSR B;  4NE3 A;  3REL D;  2F8N A;  4AWL B;  2RVQ C;  5B31 A;  5CHL B;  3KFU G;  4Z5T A;  2CV5 D;  2F8N B;  5B1M A;  2NQB C;  4AWL C;  5AV6 C;  5AY8 A;  3REI A;  1KX4 B;  1KX5 C;  5DNM D;  3UTA A;  3LEL D;  4YM6 A;  3REL A;  3AZH C;  2NZD A;  3R45 A;  3AYW C;  5AVB C;  1M18 C;  1B67 A;  4G91 B;  3AN2 D;  4NFT A;  5B2I B;  1AOI C;  3AZM B;  3LZ1 B;  5B2J C;  4KGC D;  2G5H C;  5BT1 C;  5CP6 C;  2ARO D;  5AV5 D;  3LJA A;  3WKJ D;  4H9S A;  3UT9 A;  3R45 B;  2FFF B;  3REK B;  1B6W A;  3MVD B;  3MGQ B;  3VH6 T;  3W96 C;  1M19 B;  1KX4 A;  3W99 D;  4WU9 B;  1P3F B;  5BO0 A;  1U35 C;  4LD9 A;  5CPI B;  3AV2 A;  3UTB C;  3X1S C;  5GT3 C;  2PYO D;  3LZ0 C;  1P34 D;  2JSS A;  3AFA B;  3VH5 A;  4WJ3 C;  4Z66 B;  3UTB B;  3AZF A;  4R8P B;  1P3K B;  4ZUX B;  1P3M C;  4DRA A;  4ZUX D;  2ZY2 A;  4UUZ A;  3AZK A;  1T3U A;  1P3B A;  4ZBJ C;  3MVD C;  2RIQ A;  4ZUX C;  1P3M B;  1P3A D;  1EQZ A;  3X1V D;  5B0Y D;  5AV9 B;  5C3I C;  5B1L B;  3LJA C;  1P3M D;  5CP6 A;  4WV4 B;  3X1S D;  1ID3 D;  2FJ7 A;  4NE5 A;  5B2I C;  1M19 C;  3W96 B;  5JA4 B;  5B33 D;  5B31 G;  3W96 D;  3B6F D;  5AVB B;  3UTB D;  2JE5 A;  1M18 B;  5AV8 D;  1P3P A;  5E5A A;  5B40 C;  1ID3 B;  3AN2 A;  3W99 C;  4XUJ D;  3TU4 C;  3MGQ A;  5BT1 D;  5F99 A;  5AV9 C;  1P3L D;  5AV5 C;  5B0Y B;  5B2J D;  2ARO A;  2Y2K A;  3AZM A;  3AZM C;  3MGS D;  1M1A D;  4H9R A;  5F99 C;  3C1B D;  2XD1 A;  3VH6 A;  1KX3 C;  4QLC D;  2Y2L A;  5AVB D;  5KDM A;  1M18 D;  3VH5 T;  5AVC C;  3AZE B;  3X1S B;  3NQJ A;  1N1J A;  3X1V B;  3B0D B;  1P3G A;  1P3O D;  5AV6 D;  5DNN A;  3WAA C;  3MGR D;  3KWQ C;  4H9O B;  4J8W B;  1P3G B;  3MGR C;  3WAA D;  2BYK B;  5B1L A;  1P3O C;  4X23 B;  4R8P D;  3AV1 D;  4WNN A;  5B40 B;  1P3B C;  4KUD B;  3B0D C;  1BH8 B;  4YS3 D;  3AZJ A;  5CPJ A;  2F2A C;  3MGS B;  1U35 A;  2F8N H;  5B1L C;  3LJA B;  3VH5 W;  1P3L B;  3C1B C;  3KUY A;  5CPI D;  3WTP D;  5BNX A;  4QLC C;  1P3G C;  3WKJ B;  5FUG A;  1KX4 C;  1KX3 B;  1KX5 B;  5GSU A;  3KWQ B;  1P3I C;  5F99 B;  4YM6 D;  2NZD D;  5B2J A;  1JFI A;  3WA9 C;  1P3L A;  5BNV A;  4JJN B;  1AOI A;  1F1E A;  4J8X D;  2JCH A;  2ZY4 A;  2Y2N A;  1WWS A;  3AFA C;  2Y2O A;  5B2I D;  3H0M C;  2L5A A;  1H3O A;  5CPI C;  1ID3 C;  4Z5T D;  5B1M B;  3B6F C;  4H9Q A;  1KX5 A;  5AVB A;  1M18 A;  1M19 D;  4KHA A;  3REI C;  5AV9 A;  2FJ7 B;  3KSY A;  4HGA B;  3W97 B;  2BYM B;  3H0R C;  4H9P B;  5B0Y C;  5AV5 B;  5CP6 B;  5C3I B;  4NE6 A;  3TU4 B;  4UUZ B;  2HIO A;  1ZLA C;  3W97 D;  3IP4 C;  3EPL A;  2LY8 A;  2FJ7 C;  2BYM A;  4WNN B;  3REH B;  4KUD A;  3AZL B;  3REH D;  1ZLA A;  3MNN B;  3AYW B;  4XZQ B;  1TZY B;  3REK D;  4Z66 A;  4CSR A;  3LZ0 D;  3AZF B;  1P3K A;  5B24 A;  3AZI B;  2Y2G A;  5AVC D;  5DNM B;  1U35 D;  1P34 C;  5CPK B;  4KHA B;  3MVD A;  5GT3 D;  2PYO C;  4J8V B;  2NQB B;  3A6N C;  5GXQ B;  5CPI A;  2IO5 C;  1HTA A;  1P34 A;  2CV5 A;  2XD5 A;  3EPJ A;  4KGC C;  5B24 D;  5B24 C;  3WKJ C;  4Z66 C;  1P3K C;  5B0Z B;  1P3L C;  4H9R B;  3AZI A;  3EPH A;  3A6N D;  3TU4 D;  4XUJ A;  5GT3 B;  4E44 A;  3MNN A;  4XUJ C;  3C1C D;  3MGS A;  1U35 B;  1P3A A;  1EQZ D;  5AV8 C;  3MGP A;  3KUY B;  3REK C;  3AYW D;  1KX5 D;  3X1T B;  1F66 B;  3P5J B;  4X23 C;  3LEL C;  3O62 A;  4J8V A;  3AZH B;  3AZN B;  2CV5 C;  3MGR B;  3AZJ B;  4J8W C;  5GT0 B;  4DQY B;  5AY8 B;  3B6F A;  5DNN B;  3X1V C;  2J8P A;  5GT0 A;  1A7W A;  3AFA A;  2BYK A;  3AZE C;  4H9Q B;  3REL C;  3AZH A;  3REH A;  1ZLA D;  4KUD D;  5DNN C;  5AY8 C;  5B31 D;  3MGP C;  5B1M D;  3NQJ B;  4Z5T C;  5B32 A;  1P3I A;  5GT0 D;  5AV6 B;  5AVC A;  5GSU C;  4J8U D;  3W98 C;  3X1T C;  1F66 C;  4QLC A;  3KUY C;  3X1U A;  2VQR A;  1KX3 A;  5B0Y A;  1S32 D;  3WKJ A;  4XUJ B;  2G5I C;  4J8X C;  3UT9 D;  4JJN D;  4WU9 A;  1P3F A;  3AV1 B;  1HQ3 D;  5CP6 D;  1S32 C;  1P3G D;  1ID3 A;  3A6N A;  4WU8 C;  3REJ D;  3WTP C;  1P3P B;  4CAY A;  3MNN D;  3X1U D;  3W98 D;  4J8U C;  5B1L D;  1ULY A;  3KXB C;  3AZG B;  5JRG C;  1AOI D;  3AN2 C;  5E5A C;  5B40 A;  3KWQ A;  4XZQ A;  2DQN C;  3MGP D;  3B0B A;  5FUG B;  4M6B A;  5B2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...