5GT0A

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0A00
4NFTA 2IO5C 1S32A 4Z5TB 3A6ND 4J8UB 4YS3B 5B1MB 1TAFB 4WU9C 1M1AC 5B24C 1P3LA 3AFAC 1P3OA 3W97A 5B40D 3KWQA 1KX3B 5E5AC 5BO0B 5AV6C 4YM6C 4R8PB 3AZKC 2CV5B 2F8NK 3NQJA 4J8XD 5B31G 3UT9C 3WAAB 3R45B 4WU9D 4X23A 1ID3C 5BT1D 3MNNB 3REIC 1M1AA 5B24A 1BH9B 5GT3B 3AFAA 4YM6D 3AZKD 3O62B 2NQBB 4DRAA 5GXQC 5E5AA 3UT9D 1ID3D 5AV6A 3C1CC 4J8UA 3KUYB 4LD9C 3UTBB 3REID 3MNNC 1P3FC 1TAFA 1P34D 1P3AC 1P3PB 5B31B 4ZBJB 3B6GC 5B2JB 3LELC 3VH5T 3WTPC 2FJ7B 1EQZC 4J8WC 3WA9C 3MGRB 5JRGC 5AVCB 5BO0A 2CV5A 5GXQA 3VH6W 4LD9D 4Z2MH 5AV9B 3C1CA 1P3FD 3R45A 3WAAA 3REJC 1ZLAB 3B6GD 3LELD 5B32G 3WTPD 4LD9A 4JJNB 3MNNA 1R4VA 3X1UB 4J8WD 1P3AA 1P3IB 1BH9A 4HGAB 5B2IB 3LELA 3WTPA 5AVCC 1EQZA 3O62A 5B33C 2NQBA 4J8WA 4QLCB 3WA9A 5JRGA 3LJAB 3REJD 3MGSC 5AV8B 1ULYA 5GT0D 3UTBA 2NZDC 3UTAB 2F8NG 3MGQC 4KUDD 5B31A 5B2JA 3AZFC 5B33D 2FJ7A 3W98C 1F66C 3MGRA 5AVCA 3MGSD 5AV8C 3WKJC 3MGQD 1ZLAA 5DNMB 3AZFD 3W98D 1Q9CA 5AV5D 5CHLB 2NZDA 3X1UA 5B32C 1P3IA 1M18B 5F99C 4G91B 5CPKB 4QLCA 1F66A 1M19B 3WKJD 3AZLC 3REHC 5CPIB 3AZHC 5AV8A 3X1SC 3MVDB 3UTAA 5B32D 4XZQC 5AY8B 3VH6A 5DNND 3REKB 3AV1B 1P3GB 3AZLD 5F99A 3AZEB 2HIOB 3AZHD 4WZSB 3X1VC 3AN2C 4E45A 4AWLC 3MVDC 3REHA 3B6FB 3X1SA 4XZQA 5B1LC 3AV2D 1HQ3B 3KXBC 2F8NA 3AN2D 5CPKA 1AOIA 1M19A 1BH8B 5CPIA 3B6FC 3X1VA 5B0ZD 4EO5B 3MVDA 5B1LD 5AY8A 4Z66C 3KWQB 1HQ3C 3B0CW 3REKA 3AZIC 1U35D 1P3GA 3NQJB 3KXBA 3B0BA 2IO5B 4DRBA 4H9PB 5JA4B 3A6NC 5CPJC 3B6FA 4Z66D 3KSYA 4WU9B 1M1AB 5B24B 3RELC 3AZNC 3AFAB 3AZID 4ZUXD 1KX4D 5B40C 1HQ3A 5E5AB 5C3IC 3MGPC 5AV6B 4YM6B 3AZKB 4NE3A 5CPJD 1BH8A 4J8XC 3UT9B 1ID3B 3RELD 3AZND 4H9SC 3A6NA 2YFVA 3NQUA 5BT1C 5G49B 3LZ0C 3REIB 3TU4D 3MGPD 5GXQB 5B0YC 5B40A 3C1CB 4H9PA 5JA4A 4LD9B 3LZ0D 4J8XA 5BNXB 1P3FB 4WU9A 1P3AB 1P34C 3B6GB 3LELB 3WTPB 1EQZB 3AZGC 5B0YD 4J8WB 3WA9B 5JRGB 4YM6A 3AZKA 3UT9A 1ID3A 3REJB 1P3BC 3AZGD 5G49A 3REIA 3C1BD 4WU8C 1P34A 1KX5C 4H9OB 5B33B 1TZYC 4KGCC 1P3BD 3LZ1C 3MGSB 4Z5TD 3AZJC 2NZDB 5GT0C 5BNXA 5B1MD 4YS3D 3MGQB 5AVBC 4WU8D 1P3FA 1KX5D 2PYOC 3AZFB 3B6GA 4KUDC 3W98B 1TZYD 1F66B 4KGCD 1P3MC 3LZ1D 3AZJD 4R8PD 3WKJB 3B0DC 5AVBD 2PYOD 3REJA 2LY8A 5BS7C 3LZ1A 5GSUC 2JSSA 5AV5C 5GT0A 3AYWC 4KUDA 5B32B 3VH6T 5F99B 2AROC 1P3MD 4H9OA 5GT3D 5B33A 3AZLB 3REHB 4H9RB 3AZHB 3W96C 3MGSA 5GSUD 3X1SB 3KUYD 3AYWD 3MGQA 4XZQB 2AROD 5BS7A 3WTPE 3AZFA 1P3PD 1P3KC 2F8NB 5AV5A 3W98A 3X1TC 5DNNC 2AROA 2HUEC 4J8VC 3W96D 3AN2B 3X1VB 4G92C 4H9NA 3WKJA 4AWLB 5CP6C 1P3KD 5B0ZB 3X1TD 3W99C 4JJND 5B1LB 5B32A 3AV2C 3KXBB 4J8VD 5B2ID 3AZMC 1N1JB 5DNNA 3AZLA 5CP6D 4H9RA 3AZHA 3LJAD 4NE5A 3W99D 5B0ZC 2BYMB 4KHAB 4Z66B 3AZMD 3AZIB 1U35C 3AV2A 3AN2A 3A6NB 2YFVB 5CPJB 3NQUB 2L5AA 3RELB 5B0ZA 3AZNB 5DNMD 5B1LA 4ZUXC 5B40B 1M18D 1KX4C 5C3IB 3MGPB 1N1JA 1U35A 2F8NH 4J8XB 5BNVA 4E44A 3LZ0B 2BYMA 3TU4C 4KHAA 4Z66A 3AZIA 4Z2MG 1AOIC 4ZUXA 5B0YB 3AV1D 1KX4A 3AZED 2HIOD 5CPJA 1S32C 3B0CT 5FUGB 3RELA 3AZNA 1P34B 4XUJC 1AOID 3AZGB 1P3LC 3TU4A 1P3OC 3W97C 3MGPA 2BYKB 1A7WA 1S32D 4NE6A 1P3BB 4H9SA 4XUJD 1BFMA 4X23C 1P3LD 1JFIA 3LZ0A 1P3OD 4H9QB 4WU8B 1KX5B 3W97D 3C1BC 4XUJA 3V9RB 3KWQD 1WWSA 4CAYA 5B0YA 1TZYB 4KGCB 3VH5W 3LZ1B 3AZJB 4X23D 4Z5TC 2RVQC 5GT0B 4J8UC 4KUDB 1F1EA 4YS3C 5FUGA 5B1MC 2YFWB 5AVBB 2PYOB 4CSRB 1M1AD 5B24D 3AZGA 3AFAD 3C1BA 1HTAA 5E5AD 1P3MB 1KX3C 2BYKA 5AV6D 2RVQD 5KDMB 4R8PC 4J8UD 3B0DB 2CV5C 4UUZB 4WV4B 1P3BA 3WAAC 4Z5TA 5GSUB 5AV5B 3AYWB 4H9QA 5B1MA 4WU8A 4YS3A 1KX5A 2AROB 3V9RA 1KX3D 5GT3C 1TZYA 4H9NB 2CWEA 5GXQD 3O62C 2CV5D 4KGCA 2NQBC 1KX3A 3C1CD 3WAAD 3AZJA 3W96B 4R8PA 1H3OB 3KUYC 5AVBA 2PYOA 3MNND 2YFWA 3UTBC 4CSRA 1P3AD 1P3KB 1P3PC 3X1TB 5B31C 4M6BA 4ZBJC 5DNNB 5B2JC 1EQZD 3O62D 2FJ7C 2NQBD 3WA9D 5JRGD 2HUEB 3MGRC 5GT3A 4J8VB 1P3MA 4G92B 5KDMA 4UUZA 5CP6B 3UTBD 5AV9C 5GSUA 5B31D 3W99B 1ZLAC 5B2JD 3KUYA 3AYWA 4JJNC 2FJ7D 3AV2B 3X1UC 3VH5A 1P3PA 3MGRD 1P3IC 3AZMB 4HGAC 5B2IC 5AVCD 4QLCC 5AV9D 3W96A 3LJAC 1ZLAD 1H3OA 2NZDD 5AV9A 3X1UD 1P3KA 3UTAC 1P3ID 4WNNB 3X1TA 4JJNA 1U35B 1B6WA 4QLCD 1F66D 4J8VA 5B2IA 5BNVB 5AV8D 5CP6A 3UTAD 3LJAA 3W99A 5DNMC 4ZUXB 1KX4B 5F99D 3AZMA 1M18C 4G91C 5CPKC 1M19C 1B67A 3REHD 5CPIC 3X1SD 3TU4B 4XZQD 4WNNA 5DNMA 5AY8C 1AOIB 2F8ND 5CPKD 3REKC 1M19D 3AV1C 1P3GC 1M18A 3AZEC 2HIOC 5CPID 3X1VD 1S32B 1JFIB 3MVDD 5AY8D 4XUJB 4CAYB 1P3LB 3REKD 1P3OB 1P3GD 3W97B 3KXBD 1KU5A 3AV1A 3AZEA 2HIOA 3B6FD 4X23B 4EO5C 1WWIA 3C1BB 3KWQC 1HQ3D
chains in the Genus database with same CATH superfamily
2DQNC 4NFTA 2IO5C 1S32A 4Z5TB 2JCHA 3A6ND 4J8UB 4YS3B 5B1MB 1TAFB 4WU9C 1M1AC 5B24C 1P3LA 3AFAC 1P3OA 3W97A 5B40D 3KWQA 1KX3B 5E5AC 5BO0B 5AV6C 4YM6C 4R8PB 3AZKC 2CV5B 2F8NK 3IP4C 3NQJA 4J8XD 5B31G 3UT9C 3WAAB 3R45B 4WU9D 4X23A 1ID3C 3KFUG 5BT1D 3MNNB 3REIC 1M1AA 5B24A 1BH9B 5GT3B 3AFAA 2Y2LA 4YM6D 3AZKD 3O62B 2NQBB 4DRAA 5GXQC 5E5AA 3UT9D 2UWXA 5AV6A 3C1CC 1ID3D 4J8UA 3KUYB 4LD9C 3UTBB 3REID 2F2AC 3MNNC 1P3FC 1TAFA 1P34D 1P3AC 1P3PB 5B31B 4ZBJB 3B6GC 5B2JB 3LELC 3VH5T 3WTPC 2FJ7B 1EQZC 4J8WC 3WA9C 3MGRB 5JRGC 5AVCB 5BO0A 2CV5A 5GXQA 3VH6W 4LD9D 4Z2MH 5AV9B 3C1CA 1P3FD 3R45A 3WAAA 3REJC 1ZLAB 3B6GD 3LELD 5B32G 3WTPD 4LD9A 4JJNB 3MNNA 1R4VA 3X1UB 4J8WD 2XD1A 1P3AA 1P3IB 1BH9A 4HGAB 5B2IB 3LELA 3WTPA 5AVCC 1EQZA 3O62A 5B33C 2NQBA 4J8WA 4QLCB 3WA9A 5JRGA 3LJAB 3REJD 3MGSC 5AV8B 1ULYA 5GT0D 3UTBA 2NZDC 3UTAB 2F8NG 3MGQC 4KUDD 5B31A 5B2JA 3AZFC 2Y2PA 5B33D 2FJ7A 3W98C 1F66C 3MGRA 5AVCA 3FDDA 3MGSD 5AV8C 3WKJC 3MGQD 3EPLA 1ZLAA 2J8PA 5DNMB 3AZFD 3W98D 1Q9CA 5AV5D 5CHLB 2NZDA 2ZY5A 3X1UA 5B32C 1P3IA 1M18B 5F99C 4G91B 5CPKB 4QLCA 1F66A 1M19B 3WKJD 3AZLC 2W8SA 3REHC 5CPIB 3AZHC 5AV8A 3X1SC 3MVDB 3UTAA 5B32D 4XZQC 5AY8B 3A1KA 3VH6A 5DNND 3REKB 3AV1B 1P3GB 3AZLD 5F99A 3AZEB 2HIOB 3AZHD 4WZSB 3X1VC 3AN2C 4E45A 4AWLC 3MVDC 3REHA 2Y2MA 3B6FB 1T3UA 3X1SA 4XZQA 5B1LC 3AV2D 1HQ3B 3KXBC 2F8NA 3AN2D 5CPKA 1AOIA 1M19A 1BH8B 3H0LC 5CPIA 3B6FC 3X1VA 5B0ZD 4EO5B 3MVDA 3P5JB 5B1LD 5AY8A 4Z66C 3KWQB 1HQ3C 3B0CW 3REKA 3AZIC 1U35D 1P3GA 3NQJB 3KXBA 3B0BA 2IO5B 4DRBA 4H9PB 5JA4B 3A6NC 5CPJC 3B6FA 4Z66D 3KSYA 4WU9B 1M1AB 5B24B 3RELC 3AZNC 3AFAB 3AZID 4ZUXD 1KX4D 5B40C 1HQ3A 5E5AB 5C3IC 3MGPC 4WJ3C 5AV6B 4YM6B 3AZKB 4NE3A 5CPJD 1BH8A 4J8XC 3UT9B 1ID3B 3RELD 3AZND 4H9SC 3A6NA 2YFVA 3NQUA 5BT1C 5G49B 3LZ0C 3REIB 3TU4D 3MGPD 5GXQB 5B0YC 5B40A 3C1CB 4H9PA 5JA4A 4LD9B 3EPKA 3LZ0D 4J8XA 5BNXB 1P3FB 4WU9A 1P3AB 1P34C 3B6GB 3LELB 3WTPB 1EQZB 3AZGC 5B0YD 4J8WB 3WA9B 1W2EA 5JRGB 4YM6A 3AZKA 2ZY3A 3UT9A 1ID3A 3REJB 1P3BC 3AZGD 5G49A 3REIA 3C1BD 4WU8C 2DF4C 1P34A 1KX5C 4H9OB 5B33B 3AL0C 1TZYC 4KGCC 1P3BD 1PZRA 3LZ1C 3MGSB 4Z5TD 3AZJC 3EPHA 2NZDB 5GT0C 5BNXA 5B1MD 4YS3D 3MGQB 5AVBC 4WU8D 1P3FA 1KX5D 2PYOC 3AZFB 3B6GA 2G5HC 4KUDC 3W98B 1TZYD 1F66B 4KGCD 1P3MC 3LZ1D 3AZJD 4R8PD 3WKJB 3B0DC 2Y2IA 5AVBD 3EPJA 2PYOD 3REJA 2LY8A 5BS7C 3LZ1A 5GSUC 2JSSA 5AV5C 5GT0A 3AYWC 4KUDA 5B32B 3VH6T 5F99B 2AROC 1P3MD 4H9OA 5GT3D 5B33A 3AZLB 2ZM5A 3REHB 4H9RB 3AZHB 3W96C 3MGSA 5GSUD 3X1SB 3KUYD 3AYWD 3MGQA 4XZQB 2AROD 5BS7A 3WTPE 3AZFA 1P3PD 1P3KC 2F8NB 5AV5A 3W98A 3X1TC 5DNNC 2AROA 2RIQA 2HUEC 4J8VC 4DQYB 3W96D 3AN2B 3X1VB 4G92C 4H9NA 3WKJA 4AWLB 5CP6C 1P3KD 5B0ZB 3X1TD 3W99C 4JJND 5B1LB 5B32A 3AV2C 3KXBB 4J8VD 2Y2KA 5B2ID 3AZMC 1N1JB 1Z2CB 5DNNA 2BG1A 3AZLA 5CP6D 4H9RA 3AZHA 3LJAD 4NE5A 3W99D 5B0ZC 2XD5A 2BYMB 4KHAB 4Z66B 3AZMD 3AZIB 1U35C 3AV2A 3AN2A 3A6NB 2YFVB 5CPJB 3NQUB 2L5AA 3RELB 5B0ZA 3AZNB 5DNMD 5B1LA 4ZUXC 2Y2QA 5B40B 1M18D 1KX4C 5C3IB 3MGPB 1N1JA 1U35A 2F8NH 4J8XB 5BNVA 4E44A 3LZ0B 2BYMA 3TU4C 4KHAA 4Z66A 3AZIA 4Z2MG 1AOIC 4ZUXA 5B0YB 3AV1D 1KX4A 3AZED 2HIOD 5CPJA 1S32C 2Y2OA 3B0CT 5FUGB 3RELA 3AZNA 1P34B 4XUJC 1AOID 3AZGB 1P3LC 3TU4A 1P3OC 3W97C 3MGPA 2BYKB 1A7WA 1S32D 3A1IA 3EG5B 4NE6A 1P3BB 4H9SA 4XUJD 1BFMA 4X23C 1P3LD 1JFIA 3LZ0A 1P3OD 4H9QB 4WU8B 1KX5B 3W97D 3C1BC 4XUJA 3V9RB 3KWQD 1WWSA 4CAYA 5B0YA 3H0MC 1TZYB 4KGCB 2ZY2A 3VH5W 3LZ1B 3AZJB 4X23D 4Z5TC 2RVQC 5GT0B 4J8UC 4KUDB 1F1EA 5FUGA 5B1MC 5AVBB 2YFWB 4YS3C 2PYOB 4CSRB 1M1AD 4UPKA 5B24D 3AZGA 3AFAD 3C1BA 1HTAA 5E5AD 1P3MB 1KX3C 2BYKA 5AV6D 2RVQD 5KDMB 4R8PC 4J8UD 3B0DB 2CV5C 4UUZB 4WV4B 1P3BA 3WAAC 4Z5TA 3H0RC 5GSUB 5AV5B 3AYWB 4H9QA 5B1MA 2JE5A 4WU8A 4YS3A 2AROB 1KX5A 3V9RA 1KX3D 5GT3C 1TZYA 4H9NB 2CWEA 5GXQD 3O62C 2CV5D 4KGCA 2NQBC 1KX3A 3C1CD 3WAAD 3AZJA 3W96B 4R8PA 1H3OB 3KUYC 5AVBA 2PYOA 3MNND 2YFWA 3UTBC 4CSRA 1P3AD 1P3KB 1P3PC 3X1TB 5B31C 4M6BA 4ZBJC 5DNNB 5B2JC 1EQZD 3O62D 2FJ7C 2NQBD 2G5IC 3WA9D 5JRGD 2HUEB 3MGRC 5GT3A 4J8VB 1P3MA 4G92B 5KDMA 2FFFB 4UUZA 5CP6B 3UTBD 2Y2NA 5AV9C 5GSUA 5B31D 3W99B 1ZLAC 5B2JD 3KUYA 3AYWA 4JJNC 2FJ7D 3AV2B 3X1UC 3VH5A 1P3PA 3MGRD 1P3IC 3AZMB 4HGAC 5B2IC 5AVCD 4QLCC 5AV9D 3W96A 3LJAC 1ZLAD 1H3OA 2NZDD 5AV9A 3X1UD 1P3KA 3UTAC 1P3ID 4WNNB 3X1TA 3F6TA 4JJNA 1U35B 1B6WA 4QLCD 1F66D 4J8VA 5B2IA 5BNVB 5AV8D 2VQRA 5CP6A 2ZY4A 3UTAD 3LJAA 3W99A 2Y2JA 5DNMC 4ZUXB 1KX4B 5F99D 3AZMA 1M18C 4G91C 5CPKC 1M19C 1B67A 3REHD 5CPIC 3X1SD 3TU4B 4XZQD 4WNNA 5DNMA 5AY8C 1AOIB 2F8ND 5CPKD 3REKC 1M19D 3AV1C 1P3GC 1M18A 3AZEC 2HIOC 5CPID 3X1VD 1S32B 1JFIB 3MVDD 5AY8D 4XUJB 4CAYB 1P3LB 3REKD 1P3OB 2Y2GA 1P3GD 3W97B 3KXBD 1KU5A 2Y2HA 3AV1A 3AZEA 2HIOA 3B6FD 4X23B 4EO5C 1WWIA 3C1BB 3KWQC 1HQ3D
chains in the Genus database with same CATH topology
2DQNC 4NFTA 2IO5C 1S32A 4Z5TB 2JCHA 3A6ND 4J8UB 4YS3B 5B1MB 1TAFB 4WU9C 1M1AC 5B24C 1P3LA 3AFAC 1P3OA 3W97A 5B40D 3KWQA 1KX3B 5E5AC 5BO0B 5AV6C 4YM6C 4R8PB 3AZKC 2CV5B 2F8NK 3IP4C 3NQJA 4J8XD 5B31G 3UT9C 3WAAB 3R45B 4WU9D 4X23A 1ID3C 3KFUG 5BT1D 3MNNB 3REIC 1M1AA 5B24A 1BH9B 5GT3B 3AFAA 2Y2LA 4YM6D 3AZKD 3O62B 2NQBB 4DRAA 5GXQC 5E5AA 3UT9D 2UWXA 5AV6A 3C1CC 1ID3D 4J8UA 3KUYB 4LD9C 3UTBB 3REID 2F2AC 3MNNC 1P3FC 1TAFA 1P34D 1P3AC 1P3PB 5B31B 4ZBJB 3B6GC 5B2JB 3LELC 3VH5T 3WTPC 2FJ7B 1EQZC 4J8WC 3WA9C 3MGRB 5JRGC 5AVCB 5BO0A 2CV5A 5GXQA 3VH6W 4LD9D 4Z2MH 5AV9B 3C1CA 1P3FD 3R45A 3WAAA 3REJC 1ZLAB 3B6GD 3LELD 5B32G 3WTPD 4LD9A 4JJNB 3MNNA 1R4VA 3X1UB 4J8WD 2XD1A 1P3AA 1P3IB 1BH9A 4HGAB 5B2IB 3LELA 3WTPA 5AVCC 1EQZA 3O62A 5B33C 2NQBA 4J8WA 4QLCB 3WA9A 5JRGA 3LJAB 3REJD 3MGSC 5AV8B 1ULYA 5GT0D 3UTBA 2NZDC 3UTAB 2F8NG 3MGQC 4KUDD 5B31A 5B2JA 3AZFC 2Y2PA 5B33D 2FJ7A 3W98C 1F66C 3MGRA 5AVCA 3FDDA 3MGSD 5AV8C 3WKJC 3MGQD 3EPLA 1ZLAA 2J8PA 5DNMB 3AZFD 3W98D 1Q9CA 5AV5D 5CHLB 2NZDA 2ZY5A 3X1UA 5B32C 1P3IA 1M18B 5F99C 4G91B 5CPKB 4QLCA 1F66A 1M19B 3WKJD 3AZLC 2W8SA 3REHC 5CPIB 3AZHC 5AV8A 3X1SC 3MVDB 3UTAA 5B32D 4XZQC 5AY8B 3A1KA 3VH6A 5DNND 3REKB 3AV1B 1P3GB 3AZLD 5F99A 3AZEB 2HIOB 3AZHD 4WZSB 3X1VC 3AN2C 4E45A 4AWLC 3MVDC 3REHA 2Y2MA 3B6FB 1T3UA 3X1SA 4XZQA 5B1LC 3AV2D 1HQ3B 3KXBC 2F8NA 3AN2D 5CPKA 1AOIA 1M19A 1BH8B 3H0LC 5CPIA 3B6FC 3X1VA 5B0ZD 4EO5B 3MVDA 3P5JB 5B1LD 5AY8A 4Z66C 3KWQB 1HQ3C 3B0CW 3REKA 3AZIC 1U35D 1P3GA 3NQJB 3KXBA 3B0BA 2IO5B 4DRBA 4H9PB 5JA4B 3A6NC 5CPJC 3B6FA 4Z66D 3KSYA 4WU9B 1M1AB 5B24B 3RELC 3AZNC 3AFAB 3AZID 4ZUXD 1KX4D 5B40C 1HQ3A 5E5AB 5C3IC 3MGPC 4WJ3C 5AV6B 4YM6B 3AZKB 4NE3A 5CPJD 1BH8A 4J8XC 3UT9B 1ID3B 3RELD 3AZND 4H9SC 3A6NA 2YFVA 3NQUA 5BT1C 5G49B 3LZ0C 3REIB 3TU4D 3MGPD 5GXQB 5B0YC 5B40A 3C1CB 4H9PA 5JA4A 4LD9B 3EPKA 3LZ0D 4J8XA 5BNXB 1P3FB 4WU9A 1P3AB 1P34C 3B6GB 3LELB 3WTPB 1EQZB 3AZGC 5B0YD 4J8WB 3WA9B 1W2EA 5JRGB 4YM6A 3AZKA 2ZY3A 3UT9A 1ID3A 3REJB 1P3BC 3AZGD 5G49A 3REIA 3C1BD 4WU8C 2DF4C 1P34A 1KX5C 4H9OB 5B33B 3AL0C 1TZYC 4KGCC 1P3BD 1PZRA 3LZ1C 3MGSB 4Z5TD 3AZJC 3EPHA 2NZDB 5GT0C 5BNXA 5B1MD 4YS3D 3MGQB 5AVBC 4WU8D 1P3FA 1KX5D 2PYOC 3AZFB 3B6GA 2G5HC 4KUDC 3W98B 1TZYD 1F66B 4KGCD 1P3MC 3LZ1D 3AZJD 4R8PD 3WKJB 3B0DC 2Y2IA 5AVBD 3EPJA 2PYOD 3REJA 2LY8A 5BS7C 3LZ1A 5GSUC 2JSSA 5AV5C 5GT0A 3AYWC 4KUDA 5B32B 3VH6T 5F99B 2AROC 1P3MD 4H9OA 5GT3D 5B33A 3AZLB 2ZM5A 3REHB 4H9RB 3AZHB 3W96C 3MGSA 5GSUD 3X1SB 3KUYD 3AYWD 3MGQA 4XZQB 2AROD 5BS7A 3WTPE 3AZFA 1P3PD 1P3KC 2F8NB 5AV5A 3W98A 3X1TC 5DNNC 2AROA 2RIQA 2HUEC 4J8VC 4DQYB 3W96D 3AN2B 3X1VB 4G92C 4H9NA 3WKJA 4AWLB 5CP6C 1P3KD 5B0ZB 3X1TD 3W99C 4JJND 5B1LB 5B32A 3AV2C 3KXBB 4J8VD 2Y2KA 5B2ID 3AZMC 1N1JB 1Z2CB 5DNNA 2BG1A 3AZLA 5CP6D 4H9RA 3AZHA 3LJAD 4NE5A 3W99D 5B0ZC 2XD5A 2BYMB 4KHAB 4Z66B 3AZMD 3AZIB 1U35C 3AV2A 3AN2A 3A6NB 2YFVB 5CPJB 3NQUB 2L5AA 3RELB 5B0ZA 3AZNB 5DNMD 5B1LA 4ZUXC 2Y2QA 5B40B 1M18D 1KX4C 5C3IB 3MGPB 1N1JA 1U35A 2F8NH 4J8XB 5BNVA 4E44A 3LZ0B 2BYMA 3TU4C 4KHAA 4Z66A 3AZIA 4Z2MG 1AOIC 4ZUXA 5B0YB 3AV1D 1KX4A 3AZED 2HIOD 5CPJA 1S32C 2Y2OA 3B0CT 5FUGB 3RELA 3AZNA 1P34B 4XUJC 1AOID 3AZGB 1P3LC 3TU4A 1P3OC 3W97C 3MGPA 2BYKB 1A7WA 1S32D 3A1IA 3EG5B 4NE6A 1P3BB 4H9SA 4XUJD 1BFMA 4X23C 1P3LD 1JFIA 3LZ0A 1P3OD 4H9QB 4WU8B 1KX5B 3W97D 3C1BC 4XUJA 3V9RB 3KWQD 1WWSA 4CAYA 5B0YA 3H0MC 1TZYB 4KGCB 2ZY2A 3VH5W 3LZ1B 3AZJB 4X23D 4Z5TC 2RVQC 5GT0B 4J8UC 4KUDB 1F1EA 5FUGA 5B1MC 5AVBB 2YFWB 4YS3C 2PYOB 4CSRB 1M1AD 4UPKA 5B24D 3AZGA 3AFAD 3C1BA 1HTAA 5E5AD 1P3MB 1KX3C 2BYKA 5AV6D 2RVQD 5KDMB 4R8PC 4J8UD 3B0DB 2CV5C 4UUZB 4WV4B 1P3BA 3WAAC 4Z5TA 3H0RC 5GSUB 5AV5B 3AYWB 4H9QA 5B1MA 2JE5A 4WU8A 4YS3A 2AROB 1KX5A 3V9RA 1KX3D 5GT3C 1TZYA 4H9NB 2CWEA 5GXQD 3O62C 2CV5D 4KGCA 2NQBC 1KX3A 3C1CD 3WAAD 3AZJA 3W96B 4R8PA 1H3OB 3KUYC 5AVBA 2PYOA 3MNND 2YFWA 3UTBC 4CSRA 1P3AD 1P3KB 1P3PC 3X1TB 5B31C 4M6BA 4ZBJC 5DNNB 5B2JC 1EQZD 3O62D 2FJ7C 2NQBD 2G5IC 3WA9D 5JRGD 2HUEB 3MGRC 5GT3A 4J8VB 1P3MA 4G92B 5KDMA 2FFFB 4UUZA 5CP6B 3UTBD 2Y2NA 5AV9C 5GSUA 5B31D 3W99B 1ZLAC 5B2JD 3KUYA 3AYWA 4JJNC 2FJ7D 3AV2B 3X1UC 3VH5A 1P3PA 3MGRD 1P3IC 3AZMB 4HGAC 5B2IC 5AVCD 4QLCC 5AV9D 3W96A 3LJAC 1ZLAD 1H3OA 2NZDD 5AV9A 3X1UD 1P3KA 3UTAC 1P3ID 4WNNB 3X1TA 3F6TA 4JJNA 1U35B 1B6WA 4QLCD 1F66D 4J8VA 5B2IA 5BNVB 5AV8D 2VQRA 5CP6A 2ZY4A 3UTAD 3LJAA 3W99A 2Y2JA 5DNMC 4ZUXB 1KX4B 5F99D 3AZMA 1M18C 4G91C 5CPKC 1M19C 1B67A 3REHD 5CPIC 3X1SD 3TU4B 4XZQD 4WNNA 5DNMA 5AY8C 1AOIB 2F8ND 5CPKD 3REKC 1M19D 3AV1C 1P3GC 1M18A 3AZEC 2HIOC 5CPID 3X1VD 1S32B 1JFIB 3MVDD 5AY8D 4XUJB 4CAYB 1P3LB 3REKD 1P3OB 2Y2GA 1P3GD 3W97B 3KXBD 1KU5A 2Y2HA 3AV1A 3AZEA 2HIOA 3B6FD 4X23B 4EO5C 1WWIA 3C1BB 3KWQC 1HQ3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFT A;  2IO5 C;  1S32 A;  4Z5T B;  3A6N D;  4J8U B;  4YS3 B;  5B1M B;  1TAF B;  4WU9 C;  1M1A C;  5B24 C;  1P3L A;  3AFA C;  1P3O A;  3W97 A;  5B40 D;  3KWQ A;  1KX3 B;  5E5A C;  5BO0 B;  5AV6 C;  4YM6 C;  4R8P B;  3AZK C;  2CV5 B;  2F8N K;  3NQJ A;  4J8X D;  5B31 G;  3UT9 C;  3WAA B;  3R45 B;  4WU9 D;  4X23 A;  1ID3 C;  5BT1 D;  3MNN B;  3REI C;  1M1A A;  5B24 A;  1BH9 B;  5GT3 B;  3AFA A;  4YM6 D;  3AZK D;  3O62 B;  2NQB B;  4DRA A;  5GXQ C;  5E5A A;  3UT9 D;  1ID3 D;  5AV6 A;  3C1C C;  4J8U A;  3KUY B;  4LD9 C;  3UTB B;  3REI D;  3MNN C;  1P3F C;  1TAF A;  1P34 D;  1P3A C;  1P3P B;  5B31 B;  4ZBJ B;  3B6G C;  5B2J B;  3LEL C;  3VH5 T;  3WTP C;  2FJ7 B;  1EQZ C;  4J8W C;  3WA9 C;  3MGR B;  5JRG C;  5AVC B;  5BO0 A;  2CV5 A;  5GXQ A;  3VH6 W;  4LD9 D;  4Z2M H;  5AV9 B;  3C1C A;  1P3F D;  3R45 A;  3WAA A;  3REJ C;  1ZLA B;  3B6G D;  3LEL D;  5B32 G;  3WTP D;  4LD9 A;  4JJN B;  3MNN A;  1R4V A;  3X1U B;  4J8W D;  1P3A A;  1P3I B;  1BH9 A;  4HGA B;  5B2I B;  3LEL A;  3WTP A;  5AVC C;  1EQZ A;  3O62 A;  5B33 C;  2NQB A;  4J8W A;  4QLC B;  3WA9 A;  5JRG A;  3LJA B;  3REJ D;  3MGS C;  5AV8 B;  1ULY A;  5GT0 D;  3UTB A;  2NZD C;  3UTA B;  2F8N G;  3MGQ C;  4KUD D;  5B31 A;  5B2J A;  3AZF C;  5B33 D;  2FJ7 A;  3W98 C;  1F66 C;  3MGR A;  5AVC A;  3MGS D;  5AV8 C;  3WKJ C;  3MGQ D;  1ZLA A;  5DNM B;  3AZF D;  3W98 D;  1Q9C A;  5AV5 D;  5CHL B;  2NZD A;  3X1U A;  5B32 C;  1P3I A;  1M18 B;  5F99 C;  4G91 B;  5CPK B;  4QLC A;  1F66 A;  1M19 B;  3WKJ D;  3AZL C;  3REH C;  5CPI B;  3AZH C;  5AV8 A;  3X1S C;  3MVD B;  3UTA A;  5B32 D;  4XZQ C;  5AY8 B;  3VH6 A;  5DNN D;  3REK B;  3AV1 B;  1P3G B;  3AZL D;  5F99 A;  3AZE B;  2HIO B;  3AZH D;  4WZS B;  3X1V C;  3AN2 C;  4E45 A;  4AWL C;  3MVD C;  3REH A;  3B6F B;  3X1S A;  4XZQ A;  5B1L C;  3AV2 D;  1HQ3 B;  3KXB C;  2F8N A;  3AN2 D;  5CPK A;  1AOI A;  1M19 A;  1BH8 B;  5CPI A;  3B6F C;  3X1V A;  5B0Z D;  4EO5 B;  3MVD A;  5B1L D;  5AY8 A;  4Z66 C;  3KWQ B;  1HQ3 C;  3B0C W;  3REK A;  3AZI C;  1U35 D;  1P3G A;  3NQJ B;  3KXB A;  3B0B A;  2IO5 B;  4DRB A;  4H9P B;  5JA4 B;  3A6N C;  5CPJ C;  3B6F A;  4Z66 D;  3KSY A;  4WU9 B;  1M1A B;  5B24 B;  3REL C;  3AZN C;  3AFA B;  3AZI D;  4ZUX D;  1KX4 D;  5B40 C;  1HQ3 A;  5E5A B;  5C3I C;  3MGP C;  5AV6 B;  4YM6 B;  3AZK B;  4NE3 A;  5CPJ D;  1BH8 A;  4J8X C;  3UT9 B;  1ID3 B;  3REL D;  3AZN D;  4H9S C;  3A6N A;  2YFV A;  3NQU A;  5BT1 C;  5G49 B;  3LZ0 C;  3REI B;  3TU4 D;  3MGP D;  5GXQ B;  5B0Y C;  5B40 A;  3C1C B;  4H9P A;  5JA4 A;  4LD9 B;  3LZ0 D;  4J8X A;  5BNX B;  1P3F B;  4WU9 A;  1P3A B;  1P34 C;  3B6G B;  3LEL B;  3WTP B;  1EQZ B;  3AZG C;  5B0Y D;  4J8W B;  3WA9 B;  5JRG B;  4YM6 A;  3AZK A;  3UT9 A;  1ID3 A;  3REJ B;  1P3B C;  3AZG D;  5G49 A;  3REI A;  3C1B D;  4WU8 C;  1P34 A;  1KX5 C;  4H9O B;  5B33 B;  1TZY C;  4KGC C;  1P3B D;  3LZ1 C;  3MGS B;  4Z5T D;  3AZJ C;  2NZD B;  5GT0 C;  5BNX A;  5B1M D;  4YS3 D;  3MGQ B;  5AVB C;  4WU8 D;  1P3F A;  1KX5 D;  2PYO C;  3AZF B;  3B6G A;  4KUD C;  3W98 B;  1TZY D;  1F66 B;  4KGC D;  1P3M C;  3LZ1 D;  3AZJ D;  4R8P D;  3WKJ B;  3B0D C;  5AVB D;  2PYO D;  3REJ A;  2LY8 A;  5BS7 C;  3LZ1 A;  5GSU C;  2JSS A;  5AV5 C;  5GT0 A;  3AYW C;  4KUD A;  5B32 B;  3VH6 T;  5F99 B;  2ARO C;  1P3M D;  4H9O A;  5GT3 D;  5B33 A;  3AZL B;  3REH B;  4H9R B;  3AZH B;  3W96 C;  3MGS A;  5GSU D;  3X1S B;  3KUY D;  3AYW D;  3MGQ A;  4XZQ B;  2ARO D;  5BS7 A;  3WTP E;  3AZF A;  1P3P D;  1P3K C;  2F8N B;  5AV5 A;  3W98 A;  3X1T C;  5DNN C;  2ARO A;  2HUE C;  4J8V C;  3W96 D;  3AN2 B;  3X1V B;  4G92 C;  4H9N A;  3WKJ A;  4AWL B;  5CP6 C;  1P3K D;  5B0Z B;  3X1T D;  3W99 C;  4JJN D;  5B1L B;  5B32 A;  3AV2 C;  3KXB B;  4J8V D;  5B2I D;  3AZM C;  1N1J B;  5DNN A;  3AZL A;  5CP6 D;  4H9R A;  3AZH A;  3LJA D;  4NE5 A;  3W99 D;  5B0Z C;  2BYM B;  4KHA B;  4Z66 B;  3AZM D;  3AZI B;  1U35 C;  3AV2 A;  3AN2 A;  3A6N B;  2YFV B;  5CPJ B;  3NQU B;  2L5A A;  3REL B;  5B0Z A;  3AZN B;  5DNM D;  5B1L A;  4ZUX C;  5B40 B;  1M18 D;  1KX4 C;  5C3I B;  3MGP B;  1N1J A;  1U35 A;  2F8N H;  4J8X B;  5BNV A;  4E44 A;  3LZ0 B;  2BYM A;  3TU4 C;  4KHA A;  4Z66 A;  3AZI A;  4Z2M G;  1AOI C;  4ZUX A;  5B0Y B;  3AV1 D;  1KX4 A;  3AZE D;  2HIO D;  5CPJ A;  1S32 C;  3B0C T;  5FUG B;  3REL A;  3AZN A;  1P34 B;  4XUJ C;  1AOI D;  3AZG B;  1P3L C;  3TU4 A;  1P3O C;  3W97 C;  3MGP A;  2BYK B;  1A7W A;  1S32 D;  4NE6 A;  1P3B B;  4H9S A;  4XUJ D;  1BFM A;  4X23 C;  1P3L D;  1JFI A;  3LZ0 A;  1P3O D;  4H9Q B;  4WU8 B;  1KX5 B;  3W97 D;  3C1B C;  4XUJ A;  3V9R B;  3KWQ D;  1WWS A;  4CAY A;  5B0Y A;  1TZY B;  4KGC B;  3VH5 W;  3LZ1 B;  3AZJ B;  4X23 D;  4Z5T C;  2RVQ C;  5GT0 B;  4J8U C;  4KUD B;  1F1E A;  4YS3 C;  5FUG A;  5B1M C;  2YFW B;  5AVB B;  2PYO B;  4CSR B;  1M1A D;  5B24 D;  3AZG A;  3AFA D;  3C1B A;  1HTA A;  5E5A D;  1P3M B;  1KX3 C;  2BYK A;  5AV6 D;  2RVQ D;  5KDM B;  4R8P C;  4J8U D;  3B0D B;  2CV5 C;  4UUZ B;  4WV4 B;  1P3B A;  3WAA C;  4Z5T A;  5GSU B;  5AV5 B;  3AYW B;  4H9Q A;  5B1M A;  4WU8 A;  4YS3 A;  1KX5 A;  2ARO B;  3V9R A;  1KX3 D;  5GT3 C;  1TZY A;  4H9N B;  2CWE A;  5GXQ D;  3O62 C;  2CV5 D;  4KGC A;  2NQB C;  1KX3 A;  3C1C D;  3WAA D;  3AZJ A;  3W96 B;  4R8P A;  1H3O B;  3KUY C;  5AVB A;  2PYO A;  3MNN D;  2YFW A;  3UTB C;  4CSR A;  1P3A D;  1P3K B;  1P3P C;  3X1T B;  5B31 C;  4M6B A;  4ZBJ C;  5DNN B;  5B2J C;  1EQZ D;  3O62 D;  2FJ7 C;  2NQB D;  3WA9 D;  5JRG D;  2HUE B;  3MGR C;  5GT3 A;  4J8V B;  1P3M A;  4G92 B;  5KDM A;  4UUZ A;  5CP6 B;  3UTB D;  5AV9 C;  5GSU A;  5B31 D;  3W99 B;  1ZLA C;  5B2J D;  3KUY A;  3AYW A;  4JJN C;  2FJ7 D;  3AV2 B;  3X1U C;  3VH5 A;  1P3P A;  3MGR D;  1P3I C;  3AZM B;  4HGA C;  5B2I C;  5AVC D;  4QLC C;  5AV9 D;  3W96 A;  3LJA C;  1ZLA D;  1H3O A;  2NZD D;  5AV9 A;  3X1U D;  1P3K A;  3UTA C;  1P3I D;  4WNN B;  3X1T A;  4JJN A;  1U35 B;  1B6W A;  4QLC D;  1F66 D;  4J8V A;  5B2I A;  5BNV B;  5AV8 D;  5CP6 A;  3UTA D;  3LJA A;  3W99 A;  5DNM C;  4ZUX B;  1KX4 B;  5F99 D;  3AZM A;  1M18 C;  4G91 C;  5CPK C;  1M19 C;  1B67 A;  3REH D;  5CPI C;  3X1S D;  3TU4 B;  4XZQ D;  4WNN A;  5DNM A;  5AY8 C;  1AOI B;  2F8N D;  5CPK D;  3REK C;  1M19 D;  3AV1 C;  1P3G C;  1M18 A;  3AZE C;  2HIO C;  5CPI D;  3X1V D;  1S32 B;  1JFI B;  3MVD D;  5AY8 D;  4XUJ B;  4CAY B;  1P3L B;  3REK D;  1P3O B;  1P3G D;  3W97 B;  3KXB D;  1KU5 A;  3AV1 A;  3AZE A;  2HIO A;  3B6F D;  4X23 B;  4EO5 C;  1WWI A;  3C1B B;  3KWQ C;  1HQ3 D; 
#chains in the Genus database with same CATH topology
 2DQN C;  4NFT A;  2IO5 C;  1S32 A;  4Z5T B;  2JCH A;  3A6N D;  4J8U B;  4YS3 B;  5B1M B;  1TAF B;  4WU9 C;  1M1A C;  5B24 C;  1P3L A;  3AFA C;  1P3O A;  3W97 A;  5B40 D;  3KWQ A;  1KX3 B;  5E5A C;  5BO0 B;  5AV6 C;  4YM6 C;  4R8P B;  3AZK C;  2CV5 B;  2F8N K;  3IP4 C;  3NQJ A;  4J8X D;  5B31 G;  3UT9 C;  3WAA B;  3R45 B;  4WU9 D;  4X23 A;  1ID3 C;  3KFU G;  5BT1 D;  3MNN B;  3REI C;  1M1A A;  5B24 A;  1BH9 B;  5GT3 B;  3AFA A;  2Y2L A;  4YM6 D;  3AZK D;  3O62 B;  2NQB B;  4DRA A;  5GXQ C;  5E5A A;  3UT9 D;  2UWX A;  5AV6 A;  3C1C C;  1ID3 D;  4J8U A;  3KUY B;  4LD9 C;  3UTB B;  3REI D;  2F2A C;  3MNN C;  1P3F C;  1TAF A;  1P34 D;  1P3A C;  1P3P B;  5B31 B;  4ZBJ B;  3B6G C;  5B2J B;  3LEL C;  3VH5 T;  3WTP C;  2FJ7 B;  1EQZ C;  4J8W C;  3WA9 C;  3MGR B;  5JRG C;  5AVC B;  5BO0 A;  2CV5 A;  5GXQ A;  3VH6 W;  4LD9 D;  4Z2M H;  5AV9 B;  3C1C A;  1P3F D;  3R45 A;  3WAA A;  3REJ C;  1ZLA B;  3B6G D;  3LEL D;  5B32 G;  3WTP D;  4LD9 A;  4JJN B;  3MNN A;  1R4V A;  3X1U B;  4J8W D;  2XD1 A;  1P3A A;  1P3I B;  1BH9 A;  4HGA B;  5B2I B;  3LEL A;  3WTP A;  5AVC C;  1EQZ A;  3O62 A;  5B33 C;  2NQB A;  4J8W A;  4QLC B;  3WA9 A;  5JRG A;  3LJA B;  3REJ D;  3MGS C;  5AV8 B;  1ULY A;  5GT0 D;  3UTB A;  2NZD C;  3UTA B;  2F8N G;  3MGQ C;  4KUD D;  5B31 A;  5B2J A;  3AZF C;  2Y2P A;  5B33 D;  2FJ7 A;  3W98 C;  1F66 C;  3MGR A;  5AVC A;  3FDD A;  3MGS D;  5AV8 C;  3WKJ C;  3MGQ D;  3EPL A;  1ZLA A;  2J8P A;  5DNM B;  3AZF D;  3W98 D;  1Q9C A;  5AV5 D;  5CHL B;  2NZD A;  2ZY5 A;  3X1U A;  5B32 C;  1P3I A;  1M18 B;  5F99 C;  4G91 B;  5CPK B;  4QLC A;  1F66 A;  1M19 B;  3WKJ D;  3AZL C;  2W8S A;  3REH C;  5CPI B;  3AZH C;  5AV8 A;  3X1S C;  3MVD B;  3UTA A;  5B32 D;  4XZQ C;  5AY8 B;  3A1K A;  3VH6 A;  5DNN D;  3REK B;  3AV1 B;  1P3G B;  3AZL D;  5F99 A;  3AZE B;  2HIO B;  3AZH D;  4WZS B;  3X1V C;  3AN2 C;  4E45 A;  4AWL C;  3MVD C;  3REH A;  2Y2M A;  3B6F B;  1T3U A;  3X1S A;  4XZQ A;  5B1L C;  3AV2 D;  1HQ3 B;  3KXB C;  2F8N A;  3AN2 D;  5CPK A;  1AOI A;  1M19 A;  1BH8 B;  3H0L C;  5CPI A;  3B6F C;  3X1V A;  5B0Z D;  4EO5 B;  3MVD A;  3P5J B;  5B1L D;  5AY8 A;  4Z66 C;  3KWQ B;  1HQ3 C;  3B0C W;  3REK A;  3AZI C;  1U35 D;  1P3G A;  3NQJ B;  3KXB A;  3B0B A;  2IO5 B;  4DRB A;  4H9P B;  5JA4 B;  3A6N C;  5CPJ C;  3B6F A;  4Z66 D;  3KSY A;  4WU9 B;  1M1A B;  5B24 B;  3REL C;  3AZN C;  3AFA B;  3AZI D;  4ZUX D;  1KX4 D;  5B40 C;  1HQ3 A;  5E5A B;  5C3I C;  3MGP C;  4WJ3 C;  5AV6 B;  4YM6 B;  3AZK B;  4NE3 A;  5CPJ D;  1BH8 A;  4J8X C;  3UT9 B;  1ID3 B;  3REL D;  3AZN D;  4H9S C;  3A6N A;  2YFV A;  3NQU A;  5BT1 C;  5G49 B;  3LZ0 C;  3REI B;  3TU4 D;  3MGP D;  5GXQ B;  5B0Y C;  5B40 A;  3C1C B;  4H9P A;  5JA4 A;  4LD9 B;  3EPK A;  3LZ0 D;  4J8X A;  5BNX B;  1P3F B;  4WU9 A;  1P3A B;  1P34 C;  3B6G B;  3LEL B;  3WTP B;  1EQZ B;  3AZG C;  5B0Y D;  4J8W B;  3WA9 B;  1W2E A;  5JRG B;  4YM6 A;  3AZK A;  2ZY3 A;  3UT9 A;  1ID3 A;  3REJ B;  1P3B C;  3AZG D;  5G49 A;  3REI A;  3C1B D;  4WU8 C;  2DF4 C;  1P34 A;  1KX5 C;  4H9O B;  5B33 B;  3AL0 C;  1TZY C;  4KGC C;  1P3B D;  1PZR A;  3LZ1 C;  3MGS B;  4Z5T D;  3AZJ C;  3EPH A;  2NZD B;  5GT0 C;  5BNX A;  5B1M D;  4YS3 D;  3MGQ B;  5AVB C;  4WU8 D;  1P3F A;  1KX5 D;  2PYO C;  3AZF B;  3B6G A;  2G5H C;  4KUD C;  3W98 B;  1TZY D;  1F66 B;  4KGC D;  1P3M C;  3LZ1 D;  3AZJ D;  4R8P D;  3WKJ B;  3B0D C;  2Y2I A;  5AVB D;  3EPJ A;  2PYO D;  3REJ A;  2LY8 A;  5BS7 C;  3LZ1 A;  5GSU C;  2JSS A;  5AV5 C;  5GT0 A;  3AYW C;  4KUD A;  5B32 B;  3VH6 T;  5F99 B;  2ARO C;  1P3M D;  4H9O A;  5GT3 D;  5B33 A;  3AZL B;  2ZM5 A;  3REH B;  4H9R B;  3AZH B;  3W96 C;  3MGS A;  5GSU D;  3X1S B;  3KUY D;  3AYW D;  3MGQ A;  4XZQ B;  2ARO D;  5BS7 A;  3WTP E;  3AZF A;  1P3P D;  1P3K C;  2F8N B;  5AV5 A;  3W98 A;  3X1T C;  5DNN C;  2ARO A;  2RIQ A;  2HUE C;  4J8V C;  4DQY B;  3W96 D;  3AN2 B;  3X1V B;  4G92 C;  4H9N A;  3WKJ A;  4AWL B;  5CP6 C;  1P3K D;  5B0Z B;  3X1T D;  3W99 C;  4JJN D;  5B1L B;  5B32 A;  3AV2 C;  3KXB B;  4J8V D;  2Y2K A;  5B2I D;  3AZM C;  1N1J B;  1Z2C B;  5DNN A;  2BG1 A;  3AZL A;  5CP6 D;  4H9R A;  3AZH A;  3LJA D;  4NE5 A;  3W99 D;  5B0Z C;  2XD5 A;  2BYM B;  4KHA B;  4Z66 B;  3AZM D;  3AZI B;  1U35 C;  3AV2 A;  3AN2 A;  3A6N B;  2YFV B;  5CPJ B;  3NQU B;  2L5A A;  3REL B;  5B0Z A;  3AZN B;  5DNM D;  5B1L A;  4ZUX C;  2Y2Q A;  5B40 B;  1M18 D;  1KX4 C;  5C3I B;  3MGP B;  1N1J A;  1U35 A;  2F8N H;  4J8X B;  5BNV A;  4E44 A;  3LZ0 B;  2BYM A;  3TU4 C;  4KHA A;  4Z66 A;  3AZI A;  4Z2M G;  1AOI C;  4ZUX A;  5B0Y B;  3AV1 D;  1KX4 A;  3AZE D;  2HIO D;  5CPJ A;  1S32 C;  2Y2O A;  3B0C T;  5FUG B;  3REL A;  3AZN A;  1P34 B;  4XUJ C;  1AOI D;  3AZG B;  1P3L C;  3TU4 A;  1P3O C;  3W97 C;  3MGP A;  2BYK B;  1A7W A;  1S32 D;  3A1I A;  3EG5 B;  4NE6 A;  1P3B B;  4H9S A;  4XUJ D;  1BFM A;  4X23 C;  1P3L D;  1JFI A;  3LZ0 A;  1P3O D;  4H9Q B;  4WU8 B;  1KX5 B;  3W97 D;  3C1B C;  4XUJ A;  3V9R B;  3KWQ D;  1WWS A;  4CAY A;  5B0Y A;  3H0M C;  1TZY B;  4KGC B;  2ZY2 A;  3VH5 W;  3LZ1 B;  3AZJ B;  4X23 D;  4Z5T C;  2RVQ C;  5GT0 B;  4J8U C;  4KUD B;  1F1E A;  5FUG A;  5B1M C;  5AVB B;  2YFW B;  4YS3 C;  2PYO B;  4CSR B;  1M1A D;  4UPK A;  5B24 D;  3AZG A;  3AFA D;  3C1B A;  1HTA A;  5E5A D;  1P3M B;  1KX3 C;  2BYK A;  5AV6 D;  2RVQ D;  5KDM B;  4R8P C;  4J8U D;  3B0D B;  2CV5 C;  4UUZ B;  4WV4 B;  1P3B A;  3WAA C;  4Z5T A;  3H0R C;  5GSU B;  5AV5 B;  3AYW B;  4H9Q A;  5B1M A;  2JE5 A;  4WU8 A;  4YS3 A;  2ARO B;  1KX5 A;  3V9R A;  1KX3 D;  5GT3 C;  1TZY A;  4H9N B;  2CWE A;  5GXQ D;  3O62 C;  2CV5 D;  4KGC A;  2NQB C;  1KX3 A;  3C1C D;  3WAA D;  3AZJ A;  3W96 B;  4R8P A;  1H3O B;  3KUY C;  5AVB A;  2PYO A;  3MNN D;  2YFW A;  3UTB C;  4CSR A;  1P3A D;  1P3K B;  1P3P C;  3X1T B;  5B31 C;  4M6B A;  4ZBJ C;  5DNN B;  5B2J C;  1EQZ D;  3O62 D;  2FJ7 C;  2NQB D;  2G5I C;  3WA9 D;  5JRG D;  2HUE B;  3MGR C;  5GT3 A;  4J8V B;  1P3M A;  4G92 B;  5KDM A;  2FFF B;  4UUZ A;  5CP6 B;  3UTB D;  2Y2N A;  5AV9 C;  5GSU A;  5B31 D;  3W99 B;  1ZLA C;  5B2J D;  3KUY A;  3AYW A;  4JJN C;  2FJ7 D;  3AV2 B;  3X1U C;  3VH5 A;  1P3P A;  3MGR D;  1P3I C;  3AZM B;  4HGA C;  5B2I C;  5AVC D;  4QLC C;  5AV9 D;  3W96 A;  3LJA C;  1ZLA D;  1H3O A;  2NZD D;  5AV9 A;  3X1U D;  1P3K A;  3UTA C;  1P3I D;  4WNN B;  3X1T A;  3F6T A;  4JJN A;  1U35 B;  1B6W A;  4QLC D;  1F66 D;  4J8V A;  5B2I A;  5BNV B;  5AV8 D;  2VQR A;  5CP6 A;  2ZY4 A;  3UTA D;  3LJA A;  3W99 A;  2Y2J A;  5DNM C;  4ZUX B;  1KX4 B;  5F99 D;  3AZM A;  1M18 C;  4G91 C;  5CPK C;  1M19 C;  1B67 A;  3REH D;  5CPI C;  3X1S D;  3TU4 B;  4XZQ D;  4WNN A;  5DNM A;  5AY8 C;  1AOI B;  2F8N D;  5CPK D;  3REK C;  1M19 D;  3AV1 C;  1P3G C;  1M18 A;  3AZE C;  2HIO C;  5CPI D;  3X1V D;  1S32 B;  1JFI B;  3MVD D;  5AY8 D;  4XUJ B;  4CAY B;  1P3L B;  3REK D;  1P3O B;  2Y2G A;  1P3G D;  3W97 B;  3KXB D;  1KU5 A;  2Y2H A;  3AV1 A;  3AZE A;  2HIO A;  3B6F D;  4X23 B;  4EO5 C;  1WWI A;  3C1B B;  3KWQ C;  1HQ3 D; 
#chains in the Genus database with same CATH homology
 2DQN C;  4NFT A;  2IO5 C;  1S32 A;  4Z5T B;  2JCH A;  3A6N D;  4J8U B;  4YS3 B;  5B1M B;  1TAF B;  4WU9 C;  1M1A C;  5B24 C;  1P3L A;  3AFA C;  1P3O A;  3W97 A;  5B40 D;  3KWQ A;  1KX3 B;  5E5A C;  5BO0 B;  5AV6 C;  4YM6 C;  4R8P B;  3AZK C;  2CV5 B;  2F8N K;  3IP4 C;  3NQJ A;  4J8X D;  5B31 G;  3UT9 C;  3WAA B;  3R45 B;  4WU9 D;  4X23 A;  1ID3 C;  3KFU G;  5BT1 D;  3MNN B;  3REI C;  1M1A A;  5B24 A;  1BH9 B;  5GT3 B;  3AFA A;  2Y2L A;  4YM6 D;  3AZK D;  3O62 B;  2NQB B;  4DRA A;  5GXQ C;  5E5A A;  3UT9 D;  2UWX A;  5AV6 A;  3C1C C;  1ID3 D;  4J8U A;  3KUY B;  4LD9 C;  3UTB B;  3REI D;  2F2A C;  3MNN C;  1P3F C;  1TAF A;  1P34 D;  1P3A C;  1P3P B;  5B31 B;  4ZBJ B;  3B6G C;  5B2J B;  3LEL C;  3VH5 T;  3WTP C;  2FJ7 B;  1EQZ C;  4J8W C;  3WA9 C;  3MGR B;  5JRG C;  5AVC B;  5BO0 A;  2CV5 A;  5GXQ A;  3VH6 W;  4LD9 D;  4Z2M H;  5AV9 B;  3C1C A;  1P3F D;  3R45 A;  3WAA A;  3REJ C;  1ZLA B;  3B6G D;  3LEL D;  5B32 G;  3WTP D;  4LD9 A;  4JJN B;  3MNN A;  1R4V A;  3X1U B;  4J8W D;  2XD1 A;  1P3A A;  1P3I B;  1BH9 A;  4HGA B;  5B2I B;  3LEL A;  3WTP A;  5AVC C;  1EQZ A;  3O62 A;  5B33 C;  2NQB A;  4J8W A;  4QLC B;  3WA9 A;  5JRG A;  3LJA B;  3REJ D;  3MGS C;  5AV8 B;  1ULY A;  5GT0 D;  3UTB A;  2NZD C;  3UTA B;  2F8N G;  3MGQ C;  4KUD D;  5B31 A;  5B2J A;  3AZF C;  2Y2P A;  5B33 D;  2FJ7 A;  3W98 C;  1F66 C;  3MGR A;  5AVC A;  3FDD A;  3MGS D;  5AV8 C;  3WKJ C;  3MGQ D;  3EPL A;  1ZLA A;  2J8P A;  5DNM B;  3AZF D;  3W98 D;  1Q9C A;  5AV5 D;  5CHL B;  2NZD A;  2ZY5 A;  3X1U A;  5B32 C;  1P3I A;  1M18 B;  5F99 C;  4G91 B;  5CPK B;  4QLC A;  1F66 A;  1M19 B;  3WKJ D;  3AZL C;  2W8S A;  3REH C;  5CPI B;  3AZH C;  5AV8 A;  3X1S C;  3MVD B;  3UTA A;  5B32 D;  4XZQ C;  5AY8 B;  3A1K A;  3VH6 A;  5DNN D;  3REK B;  3AV1 B;  1P3G B;  3AZL D;  5F99 A;  3AZE B;  2HIO B;  3AZH D;  4WZS B;  3X1V C;  3AN2 C;  4E45 A;  4AWL C;  3MVD C;  3REH A;  2Y2M A;  3B6F B;  1T3U A;  3X1S A;  4XZQ A;  5B1L C;  3AV2 D;  1HQ3 B;  3KXB C;  2F8N A;  3AN2 D;  5CPK A;  1AOI A;  1M19 A;  1BH8 B;  3H0L C;  5CPI A;  3B6F C;  3X1V A;  5B0Z D;  4EO5 B;  3MVD A;  3P5J B;  5B1L D;  5AY8 A;  4Z66 C;  3KWQ B;  1HQ3 C;  3B0C W;  3REK A;  3AZI C;  1U35 D;  1P3G A;  3NQJ B;  3KXB A;  3B0B A;  2IO5 B;  4DRB A;  4H9P B;  5JA4 B;  3A6N C;  5CPJ C;  3B6F A;  4Z66 D;  3KSY A;  4WU9 B;  1M1A B;  5B24 B;  3REL C;  3AZN C;  3AFA B;  3AZI D;  4ZUX D;  1KX4 D;  5B40 C;  1HQ3 A;  5E5A B;  5C3I C;  3MGP C;  4WJ3 C;  5AV6 B;  4YM6 B;  3AZK B;  4NE3 A;  5CPJ D;  1BH8 A;  4J8X C;  3UT9 B;  1ID3 B;  3REL D;  3AZN D;  4H9S C;  3A6N A;  2YFV A;  3NQU A;  5BT1 C;  5G49 B;  3LZ0 C;  3REI B;  3TU4 D;  3MGP D;  5GXQ B;  5B0Y C;  5B40 A;  3C1C B;  4H9P A;  5JA4 A;  4LD9 B;  3EPK A;  3LZ0 D;  4J8X A;  5BNX B;  1P3F B;  4WU9 A;  1P3A B;  1P34 C;  3B6G B;  3LEL B;  3WTP B;  1EQZ B;  3AZG C;  5B0Y D;  4J8W B;  3WA9 B;  1W2E A;  5JRG B;  4YM6 A;  3AZK A;  2ZY3 A;  3UT9 A;  1ID3 A;  3REJ B;  1P3B C;  3AZG D;  5G49 A;  3REI A;  3C1B D;  4WU8 C;  2DF4 C;  1P34 A;  1KX5 C;  4H9O B;  5B33 B;  3AL0 C;  1TZY C;  4KGC C;  1P3B D;  1PZR A;  3LZ1 C;  3MGS B;  4Z5T D;  3AZJ C;  3EPH A;  2NZD B;  5GT0 C;  5BNX A;  5B1M D;  4YS3 D;  3MGQ B;  5AVB C;  4WU8 D;  1P3F A;  1KX5 D;  2PYO C;  3AZF B;  3B6G A;  2G5H C;  4KUD C;  3W98 B;  1TZY D;  1F66 B;  4KGC D;  1P3M C;  3LZ1 D;  3AZJ D;  4R8P D;  3WKJ B;  3B0D C;  2Y2I A;  5AVB D;  3EPJ A;  2PYO D;  3REJ A;  2LY8 A;  5BS7 C;  3LZ1 A;  5GSU C;  2JSS A;  5AV5 C;  5GT0 A;  3AYW C;  4KUD A;  5B32 B;  3VH6 T;  5F99 B;  2ARO C;  1P3M D;  4H9O A;  5GT3 D;  5B33 A;  3AZL B;  2ZM5 A;  3REH B;  4H9R B;  3AZH B;  3W96 C;  3MGS A;  5GSU D;  3X1S B;  3KUY D;  3AYW D;  3MGQ A;  4XZQ B;  2ARO D;  5BS7 A;  3WTP E;  3AZF A;  1P3P D;  1P3K C;  2F8N B;  5AV5 A;  3W98 A;  3X1T C;  5DNN C;  2ARO A;  2RIQ A;  2HUE C;  4J8V C;  4DQY B;  3W96 D;  3AN2 B;  3X1V B;  4G92 C;  4H9N A;  3WKJ A;  4AWL B;  5CP6 C;  1P3K D;  5B0Z B;  3X1T D;  3W99 C;  4JJN D;  5B1L B;  5B32 A;  3AV2 C;  3KXB B;  4J8V D;  2Y2K A;  5B2I D;  3AZM C;  1N1J B;  1Z2C B;  5DNN A;  2BG1 A;  3AZL A;  5CP6 D;  4H9R A;  3AZH A;  3LJA D;  4NE5 A;  3W99 D;  5B0Z C;  2XD5 A;  2BYM B;  4KHA B;  4Z66 B;  3AZM D;  3AZI B;  1U35 C;  3AV2 A;  3AN2 A;  3A6N B;  2YFV B;  5CPJ B;  3NQU B;  2L5A A;  3REL B;  5B0Z A;  3AZN B;  5DNM D;  5B1L A;  4ZUX C;  2Y2Q A;  5B40 B;  1M18 D;  1KX4 C;  5C3I B;  3MGP B;  1N1J A;  1U35 A;  2F8N H;  4J8X B;  5BNV A;  4E44 A;  3LZ0 B;  2BYM A;  3TU4 C;  4KHA A;  4Z66 A;  3AZI A;  4Z2M G;  1AOI C;  4ZUX A;  5B0Y B;  3AV1 D;  1KX4 A;  3AZE D;  2HIO D;  5CPJ A;  1S32 C;  2Y2O A;  3B0C T;  5FUG B;  3REL A;  3AZN A;  1P34 B;  4XUJ C;  1AOI D;  3AZG B;  1P3L C;  3TU4 A;  1P3O C;  3W97 C;  3MGP A;  2BYK B;  1A7W A;  1S32 D;  3A1I A;  3EG5 B;  4NE6 A;  1P3B B;  4H9S A;  4XUJ D;  1BFM A;  4X23 C;  1P3L D;  1JFI A;  3LZ0 A;  1P3O D;  4H9Q B;  4WU8 B;  1KX5 B;  3W97 D;  3C1B C;  4XUJ A;  3V9R B;  3KWQ D;  1WWS A;  4CAY A;  5B0Y A;  3H0M C;  1TZY B;  4KGC B;  2ZY2 A;  3VH5 W;  3LZ1 B;  3AZJ B;  4X23 D;  4Z5T C;  2RVQ C;  5GT0 B;  4J8U C;  4KUD B;  1F1E A;  5FUG A;  5B1M C;  5AVB B;  2YFW B;  4YS3 C;  2PYO B;  4CSR B;  1M1A D;  4UPK A;  5B24 D;  3AZG A;  3AFA D;  3C1B A;  1HTA A;  5E5A D;  1P3M B;  1KX3 C;  2BYK A;  5AV6 D;  2RVQ D;  5KDM B;  4R8P C;  4J8U D;  3B0D B;  2CV5 C;  4UUZ B;  4WV4 B;  1P3B A;  3WAA C;  4Z5T A;  3H0R C;  5GSU B;  5AV5 B;  3AYW B;  4H9Q A;  5B1M A;  2JE5 A;  4WU8 A;  4YS3 A;  2ARO B;  1KX5 A;  3V9R A;  1KX3 D;  5GT3 C;  1TZY A;  4H9N B;  2CWE A;  5GXQ D;  3O62 C;  2CV5 D;  4KGC A;  2NQB C;  1KX3 A;  3C1C D;  3WAA D;  3AZJ A;  3W96 B;  4R8P A;  1H3O B;  3KUY C;  5AVB A;  2PYO A;  3MNN D;  2YFW A;  3UTB C;  4CSR A;  1P3A D;  1P3K B;  1P3P C;  3X1T B;  5B31 C;  4M6B A;  4ZBJ C;  5DNN B;  5B2J C;  1EQZ D;  3O62 D;  2FJ7 C;  2NQB D;  2G5I C;  3WA9 D;  5JRG D;  2HUE B;  3MGR C;  5GT3 A;  4J8V B;  1P3M A;  4G92 B;  5KDM A;  2FFF B;  4UUZ A;  5CP6 B;  3UTB D;  2Y2N A;  5AV9 C;  5GSU A;  5B31 D;  3W99 B;  1ZLA C;  5B2J D;  3KUY A;  3AYW A;  4JJN C;  2FJ7 D;  3AV2 B;  3X1U C;  3VH5 A;  1P3P A;  3MGR D;  1P3I C;  3AZM B;  4HGA C;  5B2I C;  5AVC D;  4QLC C;  5AV9 D;  3W96 A;  3LJA C;  1ZLA D;  1H3O A;  2NZD D;  5AV9 A;  3X1U D;  1P3K A;  3UTA C;  1P3I D;  4WNN B;  3X1T A;  3F6T A;  4JJN A;  1U35 B;  1B6W A;  4QLC D;  1F66 D;  4J8V A;  5B2I A;  5BNV B;  5AV8 D;  2VQR A;  5CP6 A;  2ZY4 A;  3UTA D;  3LJA A;  3W99 A;  2Y2J A;  5DNM C;  4ZUX B;  1KX4 B;  5F99 D;  3AZM A;  1M18 C;  4G91 C;  5CPK C;  1M19 C;  1B67 A;  3REH D;  5CPI C;  3X1S D;  3TU4 B;  4XZQ D;  4WNN A;  5DNM A;  5AY8 C;  1AOI B;  2F8N D;  5CPK D;  3REK C;  1M19 D;  3AV1 C;  1P3G C;  1M18 A;  3AZE C;  2HIO C;  5CPI D;  3X1V D;  1S32 B;  1JFI B;  3MVD D;  5AY8 D;  4XUJ B;  4CAY B;  1P3L B;  3REK D;  1P3O B;  2Y2G A;  1P3G D;  3W97 B;  3KXB D;  1KU5 A;  2Y2H A;  3AV1 A;  3AZE A;  2HIO A;  3B6F D;  4X23 B;  4EO5 C;  1WWI A;  3C1B B;  3KWQ C;  1HQ3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...