5GT0A

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0A00
3AZKB 3AV1B 4H9NA 1ULYA 4WU8D 3AZEA 3LZ0B 1P3IB 2NZDA 5BT1C 3B0DC 1TZYA 1ID3D 4NFTA 3REID 3KWQD 2PYOC 3B6FB 3VH6A 4G92C 3KUYD 3B0DB 4Z66C 3VH6T 2PYOB 1M1AA 4G92B 1M18A 4XUJD 4LD9D 4J8VA 4Z5TD 3RELA 5B31G 5B0YD 4QLCC 3AV2C 4XZQD 4J8UA 4H9RA 5B33D 4NE6A 3REKD 3AZGA 5DNMD 5B32A 4KUDC 5CHLB 3AV2B 3WKJA 1JFIB 3W98C 3W96C 2JSSA 4UUZA 4H9QA 5F99C 3MGPA 3X1UA 4KUDB 5AV6A 3W99D 1P3GA 4ZUXA 3W98B 5F99B 3W96B 5AV8A 3AZJA 3KXBC 3AZHB 5DNNB 5KDMB 3WAAB 3KXBB 1M18C 4J8WD 3AFAA 5B2IA 1P3FA 1P3OC 1BH8A 1BH9A 2BYKA 3REHD 1P34C 5CP6B 4NE5A 5B2JB 3REIA 1P3OB 5GT0B 5AVCA 1P34B 1N1JB 5B32G 5G49A 3X1UC 5B1LD 4YM6B 3LELC 3AZKD 5AV6C 3VH6W 2AROC 1WWSA 5FUGB 1P3PD 1B67A 3LELB 2AROB 3UT9C 4DRAA 1P3BA 3B6GB 3B6FD 3W97C 4E44A 3REJB 3UT9B 5B0YA 3AZFA 3W97B 4NE3A 2NQBB 4XZQA 3B0CT 3MGQB 4WU8C 5CPKA 1HQ3A 3REIC 1ID3C 4X23A 3KWQC 4WU8B 3W99A 4JJNA 3KUYC 1ID3B 3KWQB 2FJ7A 4LD9C 3VH5A 4XUJC 3AZND 4HGAC 3VH5T 3C1CD 4Z5TC 4LD9B 4XUJB 1P3IC 4HGAB 5AV5A 5GSUB 3X1TA 5CPJA 3MVDB 3AZHD 5DNND 3NQUA 4KHAB 4XZQC 3WAAD 2IO5B 3REKC 5B33C 1KX5A 5DNMC 2F8NA 3WTPB 5B33B 3REKB 5DNMB 3AZKA 3AV1A 3W99C 3UTAA 4CSRB 3LZ0A 1P3IA 4R8PB 5CP6D 3MGRB 5B2JD 5GT0D 3B6FA 4J8WC 4H9PB 1P3AD 3UTBD 2PYOA 5GXQB 4YM6D 1P3MD 3LJAB 4Z66A 1ZLAB 3REHC 3B0CW 3AYWD 3B6GD 1U35D 3REHB 2HIOD 3REJD 2YFVA 5BS7A 5C3IC 5B1LC 3WTPE 3LZ1D 3AZKC 2F8NG 2NQBD 3V9RA 2L5AA 3MGQD 3TU4B 1P3PC 1P3KB 3AV2A 5B1LB 1JFIA 5JA4B 1P3PB 4KUDA 3B6FC 3W98A 2YFWB 3W96A 5F99A 2CWEA 3O62B 3AZHA 5DNNA 5KDMA 3WAAA 5B1MD 3A6NB 3KXBA 3X1SD 3C1BD 1EQZD 2HUEC 5GSUD 5AV9B 3MVDD 5BS7C 2HUEB 5CP6A 4CAYB 1P3OA 5GT0A 3AZNC 1P34A 3WTPD 1N1JA 3C1CC 4WU9D 2F8NH 3AZNB 3AZMD 4KGCD 3C1CB 3AZHC 3LELA 5DNNC 4R8PD 3MGRD 2AROA 3WAAC 3WA9B 5E5AB 3B6GA 3UT9A 5GXQD 3W97A 2NQBA 3LJAD 1ZLAD 1F66D 5CP6C 5B2JC 5BNVB 5GT0C 4WU8A 1P3AC 3UTBC 1ID3A 3KWQA 4YM6C 1P3MC 3KUYA 1P3AB 3UTBB 4H9OB 3TU4D 1P3KD 3AZLD 5CPID 1P3MB 4LD9A 4XUJA 3AYWC 1U35C 3B6GC 5GSUA 1P3LD 2HIOC 3REJC 3MVDA 4Z5TA 3O62D 1KX3D 4KHAA 3LZ1C 3AYWB 1U35B 2NQBC 2HIOB 3A6ND 3MGQC 5B24B 4J8XB 1HTAA 3LZ1B 5B33A 3REKA 3AZIB 5DNMA 3R45B 5AV9D 4CSRA 4R8PA 3MGRA 5AY8D 5B1MC 5B0ZD 3X1SC 4H9PA 3C1BC 1EQZC 3NQJB 5B1MB 5GXQA 1KX4B 4ZUXB 3X1SB 5GSUC 4J8WA 2CV5D 3MNNB 3C1BB 1ZLAA 1EQZB 5AVBD 3MVDC 2IO5C 3WA9D 5E5AD 5JRGD 3REHA 3WTPC 4YS3C 4WU9C 1F1EA 3AZMC 3X1VD 5B40B 4KGCC 3TU4A 4YS3B 1P3KA 4WU9B 5B1LA 4R8PC 4G91C 5JA4A 3MGRC 1AOID 3AZMB 5B31D 1P3PA 4KGCB 2YFWA 4G91B 5G49B 3O62A 5GXQC 3LJAC 3AZED 3A6NA 1ZLAC 2NZDD 1F66C 1TZYD 2RVQD 1F66B 3MGSB 1M19B 1M1AD 4CAYA 4J8VD 3TU4C 5B24D 4AWLC 1P3KC 4J8XD 3AZLC 5CPIC 3AZID 1BFMA 2BYMB 4AWLB 3AZNA 3AZLB 1S32B 3RELD 5CPIB 1P3LC 3C1CA 2LY8A 3O62C 2FJ7B 1KX3C 4J8UD 3AZGD 3VH5W 5B32D 1P3LB 3WA9A 3A6NC 3WKJD 1KX3B 3MGPD 1P3GD 1KX4D 4ZUXD 5AV8D 3AZJD 5AV9C 3MNND 4WNNB 1WWIA 5AY8C 5B0ZC 5AY8B 3AFAD 5GT3B 5B2JA 5B2ID 1P3FD 5B0ZB 3UTAB 3AN2B 2CV5C 1P3AA 3UTBA 5B40D 4H9OA 1KU5A 4YS3D 5AVBC 1TAFB 4YM6A 2CV5B 1P3MA 1H3OB 5AVCD 5FUGA 5E5AC 3WA9C 5JRGC 5AVBB 4Z2MG 3AYWA 5JRGB 1U35A 4Z66B 2HIOA 3X1VC 3REJA 5B24A 1Q9CA 4J8XA 3LZ1A 1AOIC 5BO0B 3AZIA 3X1VB 1P3BD 5B31C 3MGQA 3R45A 2YFVB 3MGSD 5BNXB 1M19D 4H9SC 3AZFD 1AOIB 5B31B 3V9RB 3AZEC 4QLCB 2NZDC 5CPKD 4H9NB 1TZYC 1HQ3D 4X23D 2RVQC 3NQJA 3AZEB 5B1MA 1KX4A 2NZDB 4JJND 3X1SA 1TZYB 1S32D 4ZBJC 3MNNA 3C1BA 1EQZA 1M1AC 2FJ7D 2F8NK 4ZBJB 4J8VC 1M1AB 5B24C 1A7WA 4J8XC 4Z2MH 1M18B 3AZIC 4J8VB 5AV5D 3X1TD 5CPJD 3RELC 5B40A 3WTPA 4YS3A 4WU9A 4J8UC 3B0BA 3AZGC 1KX5D 5B32C 3RELB 3AZMA 4KGCA 2F8ND 1R4VA 3WKJC 3MGPC 4J8UB 4H9RB 3AZGB 5GT3D 5B32B 3AV1D 1P3GC 1KX4C 4ZUXC 3WKJB 3UTAD 3MGPB 4UUZB 5AV8C 3KSYA 4H9QB 3AZJC 3MNNC 3LZ0D 3X1UB 3AN2D 1P3ID 5AV6B 1P3GB 5AV8B 3LJAA 3AZJB 5BT1D 1F66A 2PYOD 3MGSA 1M19A 3AFAC 5B2IC 1P3FC 4Z66D 3AFAB 5B40C 5B2IB 1P3FB 1BH8B 1BH9B 2BYKB 5AVCC 2BYMA 4WV4B 3AZLA 3REIB 5CPIA 1S32A 5AVCB 3KUYB 1P3LA 3AV2D 4QLCD 1KX3A 4KUDD 1P3BC 4WZSB 3W98D 5F99D 3W96D 3MGSC 4WNNA 4Z5TB 5B0YC 3AZFC 1P3BB 1M19C 4E45A 5AV9A 3KXBD 5B0YB 3AZFB 5CPKC 4XZQB 4EO5C 1HQ3C 5AY8A 4X23C 5GT3A 1M18D 5B0ZA 5CPKB 4JJNC 4EO5B 3AN2A 1HQ3B 1S32C 4X23B 2FJ7C 1P3OD 1TAFA 3W99B 4JJNB 2CV5A 1B6WA 1H3OA 1P34D 5AVBA 4DRBA 5E5AA 5AV5C 4J8WB 5JRGA 3X1TC 5CPJC 3X1UD 3LELD 5AV6D 5AV5B 2AROD 1KX5C 3X1TB 5CPJB 5BO0A 3X1VA 3NQUB 3UT9D 5BNXA 1KX5B 5GT3C 1AOIA 5BNVA 3AV1C 5B31A 3W97D 2F8NB 4M6BA 3UTAC 3AN2C 4H9SA 5C3IB 3LZ0C 4QLCA
chains in the Genus database with same CATH superfamily
3AZKB 3AV1B 4H9NA 1ULYA 4WU8D 3AZEA 3LZ0B 2DF4C 1P3IB 5BT1C 2NZDA 3B0DC 1TZYA 1ID3D 4NFTA 3REID 3KWQD 2PYOC 3B6FB 3VH6A 4G92C 3KUYD 3B0DB 4Z66C 3VH6T 2PYOB 1M1AA 4G92B 1M18A 4XUJD 4LD9D 2FFFB 4J8VA 4Z5TD 3RELA 5B31G 5B0YD 4QLCC 3AV2C 4XZQD 4J8UA 4H9RA 5B33D 4NE6A 3REKD 3AZGA 5DNMD 5B32A 4KUDC 5CHLB 3AV2B 3WKJA 1JFIB 3W98C 3W96C 2JSSA 4UUZA 4H9QA 5F99C 3MGPA 3X1UA 4KUDB 5AV6A 3W99D 1P3GA 4ZUXA 3W98B 5F99B 3W96B 5AV8A 3AZJA 3KXBC 3AZHB 5DNNB 3EPLA 5KDMB 3WAAB 3KXBB 1M18C 2G5IC 4J8WD 3AFAA 5B2IA 1P3FA 1P3OC 1BH8A 1BH9A 2BYKA 3REHD 1P34C 5CP6B 3H0MC 4NE5A 5B2JB 3REIA 1P3OB 5GT0B 5AVCA 1P34B 2VQRA 1N1JB 5B32G 3EPKA 5G49A 3X1UC 5B1LD 4YM6B 3LELC 3AZKD 5AV6C 3VH6W 2AROC 1WWSA 5FUGB 1P3PD 1B67A 3LELB 2Y2LA 3LZ0C 2AROB 3UT9C 2RIQA 4DRAA 1P3BA 3B6GB 3B6FD 3W97C 4E44A 3REJB 3UT9B 5B0YA 2G5HC 3AZFA 3W97B 4NE3A 2NQBB 4XZQA 3B0CT 3MGQB 4WU8C 5CPKA 1HQ3A 3REIC 1ID3C 4X23A 3KWQC 4WU8B 3W99A 4JJNA 3KUYC 3F6TA 1ID3B 3KWQB 2FJ7A 4LD9C 3VH5A 4XUJC 3AZND 2W8SA 4HGAC 3VH5T 3C1CD 4Z5TC 4LD9B 4XUJB 1P3IC 4HGAB 5AV5A 2ZY2A 5GSUB 3X1TA 5CPJA 3MVDB 3AZHD 5DNND 3NQUA 4KHAB 1Z2CB 4XZQC 3WAAD 2IO5B 3REKC 5B33C 1KX5A 5DNMC 4DQYB 2F8NA 3WTPB 5B33B 3REKB 5DNMB 3AZKA 3AV1A 3W99C 3UTAA 4CSRB 3LZ0A 1P3IA 4R8PB 5CP6D 3MGRB 2F2AC 5B2JD 5GT0D 3B6FA 4J8WC 4H9PB 1P3AD 3EPHA 3UTBD 2PYOA 5GXQB 4YM6D 1P3MD 3LJAB 4Z66A 1ZLAB 3REHC 3B0CW 3AYWD 3B6GD 1U35D 3REHB 2HIOD 3REJD 2YFVA 5BS7A 5C3IC 5B1LC 3WTPE 3LZ1D 3AZKC 2F8NG 2NQBD 3V9RA 2L5AA 3MGQD 3TU4B 1P3PC 1P3KB 3AV2A 3P5JB 5B1LB 1JFIA 5JA4B 1P3PB 4KUDA 3B6FC 3W98A 2YFWB 3W96A 5F99A 2CWEA 3O62B 3AZHA 5DNNA 3IP4C 5KDMA 3WAAA 5B1MD 3A6NB 3KXBA 3X1SD 3C1BD 1EQZD 2HUEC 5GSUD 5AV9B 3MVDD 5BS7C 2HUEB 2XD5A 5CP6A 4CAYB 1P3OA 5GT0A 3AZNC 1P34A 3WTPD 1N1JA 3C1CC 4WU9D 2F8NH 3AZNB 3AZMD 4KGCD 3C1CB 3AZHC 3LELA 5DNNC 4R8PD 3MGRD 2AROA 3WAAC 3WA9B 5E5AB 3B6GA 3UT9A 5GXQD 3W97A 2NQBA 3LJAD 1ZLAD 1F66D 2Y2QA 5CP6C 5B2JC 5BNVB 5GT0C 4WU8A 1P3AC 3UTBC 1ID3A 3KWQA 4YM6C 1P3MC 3KUYA 1P3AB 3UTBB 4H9OB 3TU4D 1P3KD 3AZLD 5CPID 1P3MB 4LD9A 4XUJA 3AYWC 1U35C 3B6GC 5GSUA 1P3LD 2HIOC 3REJC 3MVDA 4Z5TA 3O62D 1KX3D 4KHAA 3LZ1C 3AYWB 1U35B 2NQBC 2HIOB 3A6ND 3MGQC 5B24B 4J8XB 1HTAA 3LZ1B 5B33A 3REKA 2XD1A 3AZIB 5DNMA 3R45B 5AV9D 4CSRA 4R8PA 3MGRA 5AY8D 5B1MC 5B0ZD 3X1SC 4H9PA 3C1BC 1EQZC 3NQJB 5B1MB 5GXQA 1KX4B 4ZUXB 3X1SB 5GSUC 4J8WA 2CV5D 2ZY3A 3MNNB 3C1BB 1ZLAA 1EQZB 5AVBD 3MVDC 2IO5C 3WA9D 5E5AD 5JRGD 3REHA 3WTPC 4YS3C 4WU9C 1F1EA 3AZMC 3X1VD 5B40B 4KGCC 3TU4A 4YS3B 1P3KA 4WU9B 5B1LA 2Y2GA 4R8PC 4G91C 5JA4A 3MGRC 1AOID 3AZMB 5B31D 1P3PA 4KGCB 2JCHA 2YFWA 4G91B 5G49B 3O62A 5GXQC 3LJAC 3AZED 3A6NA 1ZLAC 2NZDD 1F66C 1TZYD 2RVQD 2BG1A 1F66B 3MGSB 1M19B 1M1AD 4CAYA 3H0LC 2ZY5A 4J8VD 3TU4C 5B24D 4AWLC 1P3KC 4J8XD 3AZLC 5CPIC 2JE5A 3AZID 1BFMA 2BYMB 4AWLB 3AZNA 3AZLB 1S32B 3RELD 5CPIB 1P3LC 3C1CA 2Y2JA 2LY8A 2UWXA 3O62C 1KX3C 2FJ7B 4J8UD 3AZGD 3VH5W 5B32D 1P3LB 3WA9A 3A6NC 3WKJD 1KX3B 3MGPD 3KFUG 1P3GD 1KX4D 4ZUXD 5AV8D 3AZJD 5AV9C 1W2EA 4WNNB 1WWIA 3MNND 5AY8C 4UPKA 5B0ZC 3H0RC 5AY8B 2ZM5A 3AFAD 5GT3B 5B2JA 5B2ID 1P3FD 5B0ZB 3UTAB 3AN2B 2CV5C 1P3AA 3UTBA 5B40D 4H9OA 1KU5A 4YS3D 2Y2KA 5AVBC 1TAFB 4YM6A 2CV5B 1P3MA 3A1KA 1H3OB 5AVCD 5FUGA 5E5AC 3WA9C 5JRGC 5AVBB 1T3UA 4Z2MG 3AYWA 5JRGB 1U35A 4Z66B 2HIOA 3X1VC 3REJA 4WJ3C 5B24A 1Q9CA 4J8XA 3LZ1A 1AOIC 5BO0B 3AZIA 3X1VB 1P3BD 5B31C 3MGQA 3R45A 2YFVB 3MGSD 5BNXB 1M19D 4H9SC 3AZFD 1AOIB 5B31B 3V9RB 3AZEC 4QLCB 2NZDC 5CPKD 3EPJA 4H9NB 1TZYC 1HQ3D 4X23D 2RVQC 3NQJA 3AZEB 5B1MA 1KX4A 2NZDB 4JJND 3X1SA 1TZYB 1S32D 4ZBJC 3MNNA 3C1BA 1EQZA 1M1AC 2FJ7D 2F8NK 4ZBJB 2Y2OA 4J8VC 1M1AB 5B24C 1A7WA 4J8XC 4Z2MH 1M18B 3AZIC 4J8VB 5AV5D 3X1TD 5CPJD 3RELC 5B40A 3WTPA 4YS3A 4WU9A 4J8UC 3B0BA 3AZGC 1KX5D 5B32C 3RELB 3AZMA 4KGCA 1PZRA 2F8ND 1R4VA 3WKJC 3MGPC 4J8UB 4H9RB 3AZGB 5GT3D 5B32B 3AV1D 1P3GC 1KX4C 4ZUXC 3WKJB 2ZY4A 3UTAD 3MGPB 4UUZB 5AV8C 3KSYA 4H9QB 3AZJC 3MNNC 3LZ0D 3X1UB 3AN2D 1P3ID 5AV6B 1P3GB 5AV8B 3LJAA 3AZJB 5BT1D 2Y2NA 1F66A 2PYOD 3MGSA 1M19A 3AFAC 5B2IC 1P3FC 3FDDA 4Z66D 3AFAB 5B40C 5B2IB 1P3FB 1BH8B 3EG5B 1BH9B 2BYKB 5AVCC 2BYMA 4WV4B 3AZLA 3REIB 5CPIA 1S32A 5AVCB 3KUYB 1P3LA 3AV2D 4QLCD 1KX3A 2DQNC 4KUDD 1P3BC 2Y2HA 4WZSB 3W98D 5F99D 3W96D 2Y2MA 3MGSC 4WNNA 4Z5TB 5B0YC 3AZFC 1P3BB 1M19C 2Y2PA 4E45A 5AV9A 3KXBD 5B0YB 3AZFB 5CPKC 4XZQB 4EO5C 1HQ3C 5AY8A 4X23C 5GT3A 1M18D 5B0ZA 5CPKB 4JJNC 4EO5B 3AN2A 1HQ3B 1S32C 4X23B 2FJ7C 1P3OD 1TAFA 3W99B 4JJNB 2CV5A 1B6WA 2J8PA 1H3OA 1P34D 5AVBA 4DRBA 5E5AA 5AV5C 4J8WB 2Y2IA 5JRGA 3AL0C 3X1TC 5CPJC 3X1UD 3LELD 5AV6D 5AV5B 2AROD 1KX5C 3X1TB 5CPJB 5BO0A 3X1VA 3NQUB 3UT9D 5BNXA 1KX5B 5GT3C 1AOIA 5BNVA 3AV1C 5B31A 3W97D 2F8NB 4M6BA 3UTAC 3AN2C 4H9SA 5C3IB 3A1IA 4QLCA
chains in the Genus database with same CATH topology
3AZKB 3AV1B 4H9NA 1ULYA 4WU8D 3AZEA 3LZ0B 2DF4C 1P3IB 5BT1C 2NZDA 3B0DC 1TZYA 1ID3D 4NFTA 3REID 3KWQD 2PYOC 3B6FB 3VH6A 4G92C 3KUYD 3B0DB 4Z66C 3VH6T 2PYOB 1M1AA 4G92B 1M18A 4XUJD 4LD9D 2FFFB 4J8VA 4Z5TD 3RELA 5B31G 5B0YD 4QLCC 3AV2C 4XZQD 4J8UA 4H9RA 5B33D 4NE6A 3REKD 3AZGA 5DNMD 5B32A 4KUDC 5CHLB 3AV2B 3WKJA 1JFIB 3W98C 3W96C 2JSSA 4UUZA 4H9QA 5F99C 3MGPA 3X1UA 4KUDB 5AV6A 3W99D 1P3GA 4ZUXA 3W98B 5F99B 3W96B 5AV8A 3AZJA 3KXBC 3AZHB 5DNNB 3EPLA 5KDMB 3WAAB 3KXBB 1M18C 2G5IC 4J8WD 3AFAA 5B2IA 1P3FA 1P3OC 1BH8A 1BH9A 2BYKA 3REHD 1P34C 5CP6B 3H0MC 4NE5A 5B2JB 3REIA 1P3OB 5GT0B 5AVCA 1P34B 2VQRA 1N1JB 5B32G 3EPKA 5G49A 3X1UC 5B1LD 4YM6B 3LELC 3AZKD 5AV6C 3VH6W 2AROC 1WWSA 5FUGB 1P3PD 1B67A 3LELB 2Y2LA 3LZ0C 2AROB 3UT9C 2RIQA 4DRAA 1P3BA 3B6GB 3B6FD 3W97C 4E44A 3REJB 3UT9B 5B0YA 2G5HC 3AZFA 3W97B 4NE3A 2NQBB 4XZQA 3B0CT 3MGQB 4WU8C 5CPKA 1HQ3A 3REIC 1ID3C 4X23A 3KWQC 4WU8B 3W99A 4JJNA 3KUYC 3F6TA 1ID3B 3KWQB 2FJ7A 4LD9C 3VH5A 4XUJC 3AZND 2W8SA 4HGAC 3VH5T 3C1CD 4Z5TC 4LD9B 4XUJB 1P3IC 4HGAB 5AV5A 2ZY2A 5GSUB 3X1TA 5CPJA 3MVDB 3AZHD 5DNND 3NQUA 4KHAB 1Z2CB 4XZQC 3WAAD 2IO5B 3REKC 5B33C 1KX5A 5DNMC 4DQYB 2F8NA 3WTPB 5B33B 3REKB 5DNMB 3AZKA 3AV1A 3W99C 3UTAA 4CSRB 3LZ0A 1P3IA 4R8PB 5CP6D 3MGRB 2F2AC 5B2JD 5GT0D 3B6FA 4J8WC 4H9PB 1P3AD 3EPHA 3UTBD 2PYOA 5GXQB 4YM6D 1P3MD 3LJAB 4Z66A 1ZLAB 3REHC 3B0CW 3AYWD 3B6GD 1U35D 3REHB 2HIOD 3REJD 2YFVA 5BS7A 5C3IC 5B1LC 3WTPE 3LZ1D 3AZKC 2F8NG 2NQBD 3V9RA 2L5AA 3MGQD 3TU4B 1P3PC 1P3KB 3AV2A 3P5JB 5B1LB 1JFIA 5JA4B 1P3PB 4KUDA 3B6FC 3W98A 2YFWB 3W96A 5F99A 2CWEA 3O62B 3AZHA 5DNNA 3IP4C 5KDMA 3WAAA 5B1MD 3A6NB 3KXBA 3X1SD 3C1BD 1EQZD 2HUEC 5GSUD 5AV9B 3MVDD 5BS7C 2HUEB 2XD5A 5CP6A 4CAYB 1P3OA 5GT0A 3AZNC 1P34A 3WTPD 1N1JA 3C1CC 4WU9D 2F8NH 3AZNB 3AZMD 4KGCD 3C1CB 3AZHC 3LELA 5DNNC 4R8PD 3MGRD 2AROA 3WAAC 3WA9B 5E5AB 3B6GA 3UT9A 5GXQD 3W97A 2NQBA 3LJAD 1ZLAD 1F66D 2Y2QA 5CP6C 5B2JC 5BNVB 5GT0C 4WU8A 1P3AC 3UTBC 1ID3A 3KWQA 4YM6C 1P3MC 3KUYA 1P3AB 3UTBB 4H9OB 3TU4D 1P3KD 3AZLD 5CPID 1P3MB 4LD9A 4XUJA 3AYWC 1U35C 3B6GC 5GSUA 1P3LD 2HIOC 3REJC 3MVDA 4Z5TA 3O62D 1KX3D 4KHAA 3LZ1C 3AYWB 1U35B 2NQBC 2HIOB 3A6ND 3MGQC 5B24B 4J8XB 1HTAA 3LZ1B 5B33A 3REKA 2XD1A 3AZIB 5DNMA 3R45B 5AV9D 4CSRA 4R8PA 3MGRA 5AY8D 5B1MC 5B0ZD 3X1SC 4H9PA 3C1BC 1EQZC 3NQJB 5B1MB 5GXQA 1KX4B 4ZUXB 3X1SB 5GSUC 4J8WA 2CV5D 2ZY3A 3MNNB 3C1BB 1ZLAA 1EQZB 5AVBD 3MVDC 2IO5C 3WA9D 5E5AD 5JRGD 3REHA 3WTPC 4YS3C 4WU9C 1F1EA 3AZMC 3X1VD 5B40B 4KGCC 3TU4A 4YS3B 1P3KA 4WU9B 5B1LA 2Y2GA 4R8PC 4G91C 5JA4A 3MGRC 1AOID 3AZMB 5B31D 1P3PA 4KGCB 2JCHA 2YFWA 4G91B 5G49B 3O62A 5GXQC 3LJAC 3AZED 3A6NA 1ZLAC 2NZDD 1F66C 1TZYD 2RVQD 2BG1A 1F66B 3MGSB 1M19B 1M1AD 4CAYA 3H0LC 2ZY5A 4J8VD 3TU4C 5B24D 4AWLC 1P3KC 4J8XD 3AZLC 5CPIC 2JE5A 3AZID 1BFMA 2BYMB 4AWLB 3AZNA 3AZLB 1S32B 3RELD 5CPIB 1P3LC 3C1CA 2Y2JA 2LY8A 2UWXA 3O62C 1KX3C 2FJ7B 4J8UD 3AZGD 3VH5W 5B32D 1P3LB 3WA9A 3A6NC 3WKJD 1KX3B 3MGPD 3KFUG 1P3GD 1KX4D 4ZUXD 5AV8D 3AZJD 5AV9C 1W2EA 4WNNB 1WWIA 3MNND 5AY8C 4UPKA 5B0ZC 3H0RC 5AY8B 2ZM5A 3AFAD 5GT3B 5B2JA 5B2ID 1P3FD 5B0ZB 3UTAB 3AN2B 2CV5C 1P3AA 3UTBA 5B40D 4H9OA 1KU5A 4YS3D 2Y2KA 5AVBC 1TAFB 4YM6A 2CV5B 1P3MA 3A1KA 1H3OB 5AVCD 5FUGA 5E5AC 3WA9C 5JRGC 5AVBB 1T3UA 4Z2MG 3AYWA 5JRGB 1U35A 4Z66B 2HIOA 3X1VC 3REJA 4WJ3C 5B24A 1Q9CA 4J8XA 3LZ1A 1AOIC 5BO0B 3AZIA 3X1VB 1P3BD 5B31C 3MGQA 3R45A 2YFVB 3MGSD 5BNXB 1M19D 4H9SC 3AZFD 1AOIB 5B31B 3V9RB 3AZEC 4QLCB 2NZDC 5CPKD 3EPJA 4H9NB 1TZYC 1HQ3D 4X23D 2RVQC 3NQJA 3AZEB 5B1MA 1KX4A 2NZDB 4JJND 3X1SA 1TZYB 1S32D 4ZBJC 3MNNA 3C1BA 1EQZA 1M1AC 2FJ7D 2F8NK 4ZBJB 2Y2OA 4J8VC 1M1AB 5B24C 1A7WA 4J8XC 4Z2MH 1M18B 3AZIC 4J8VB 5AV5D 3X1TD 5CPJD 3RELC 5B40A 3WTPA 4YS3A 4WU9A 4J8UC 3B0BA 3AZGC 1KX5D 5B32C 3RELB 3AZMA 4KGCA 1PZRA 2F8ND 1R4VA 3WKJC 3MGPC 4J8UB 4H9RB 3AZGB 5GT3D 5B32B 3AV1D 1P3GC 1KX4C 4ZUXC 3WKJB 2ZY4A 3UTAD 3MGPB 4UUZB 5AV8C 3KSYA 4H9QB 3AZJC 3MNNC 3LZ0D 3X1UB 3AN2D 1P3ID 5AV6B 1P3GB 5AV8B 3LJAA 3AZJB 5BT1D 2Y2NA 1F66A 2PYOD 3MGSA 1M19A 3AFAC 5B2IC 1P3FC 3FDDA 4Z66D 3AFAB 5B40C 5B2IB 1P3FB 1BH8B 3EG5B 1BH9B 2BYKB 5AVCC 2BYMA 4WV4B 3AZLA 3REIB 5CPIA 1S32A 5AVCB 3KUYB 1P3LA 3AV2D 4QLCD 1KX3A 2DQNC 4KUDD 1P3BC 2Y2HA 4WZSB 3W98D 5F99D 3W96D 2Y2MA 3MGSC 4WNNA 4Z5TB 5B0YC 3AZFC 1P3BB 1M19C 2Y2PA 4E45A 5AV9A 3KXBD 5B0YB 3AZFB 5CPKC 4XZQB 4EO5C 1HQ3C 5AY8A 4X23C 5GT3A 1M18D 5B0ZA 5CPKB 4JJNC 4EO5B 3AN2A 1HQ3B 1S32C 4X23B 2FJ7C 1P3OD 1TAFA 3W99B 4JJNB 2CV5A 1B6WA 2J8PA 1H3OA 1P34D 5AVBA 4DRBA 5E5AA 5AV5C 4J8WB 2Y2IA 5JRGA 3AL0C 3X1TC 5CPJC 3X1UD 3LELD 5AV6D 5AV5B 2AROD 1KX5C 3X1TB 5CPJB 5BO0A 3X1VA 3NQUB 3UT9D 5BNXA 1KX5B 5GT3C 1AOIA 5BNVA 3AV1C 5B31A 3W97D 2F8NB 4M6BA 3UTAC 3AN2C 4H9SA 5C3IB 3A1IA 4QLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK B;  3AV1 B;  4H9N A;  1ULY A;  4WU8 D;  3AZE A;  3LZ0 B;  1P3I B;  2NZD A;  5BT1 C;  3B0D C;  1TZY A;  1ID3 D;  4NFT A;  3REI D;  3KWQ D;  2PYO C;  3B6F B;  3VH6 A;  4G92 C;  3KUY D;  3B0D B;  4Z66 C;  3VH6 T;  2PYO B;  1M1A A;  4G92 B;  1M18 A;  4XUJ D;  4LD9 D;  4J8V A;  4Z5T D;  3REL A;  5B31 G;  5B0Y D;  4QLC C;  3AV2 C;  4XZQ D;  4J8U A;  4H9R A;  5B33 D;  4NE6 A;  3REK D;  3AZG A;  5DNM D;  5B32 A;  4KUD C;  5CHL B;  3AV2 B;  3WKJ A;  1JFI B;  3W98 C;  3W96 C;  2JSS A;  4UUZ A;  4H9Q A;  5F99 C;  3MGP A;  3X1U A;  4KUD B;  5AV6 A;  3W99 D;  1P3G A;  4ZUX A;  3W98 B;  5F99 B;  3W96 B;  5AV8 A;  3AZJ A;  3KXB C;  3AZH B;  5DNN B;  5KDM B;  3WAA B;  3KXB B;  1M18 C;  4J8W D;  3AFA A;  5B2I A;  1P3F A;  1P3O C;  1BH8 A;  1BH9 A;  2BYK A;  3REH D;  1P34 C;  5CP6 B;  4NE5 A;  5B2J B;  3REI A;  1P3O B;  5GT0 B;  5AVC A;  1P34 B;  1N1J B;  5B32 G;  5G49 A;  3X1U C;  5B1L D;  4YM6 B;  3LEL C;  3AZK D;  5AV6 C;  3VH6 W;  2ARO C;  1WWS A;  5FUG B;  1P3P D;  1B67 A;  3LEL B;  2ARO B;  3UT9 C;  4DRA A;  1P3B A;  3B6G B;  3B6F D;  3W97 C;  4E44 A;  3REJ B;  3UT9 B;  5B0Y A;  3AZF A;  3W97 B;  4NE3 A;  2NQB B;  4XZQ A;  3B0C T;  3MGQ B;  4WU8 C;  5CPK A;  1HQ3 A;  3REI C;  1ID3 C;  4X23 A;  3KWQ C;  4WU8 B;  3W99 A;  4JJN A;  3KUY C;  1ID3 B;  3KWQ B;  2FJ7 A;  4LD9 C;  3VH5 A;  4XUJ C;  3AZN D;  4HGA C;  3VH5 T;  3C1C D;  4Z5T C;  4LD9 B;  4XUJ B;  1P3I C;  4HGA B;  5AV5 A;  5GSU B;  3X1T A;  5CPJ A;  3MVD B;  3AZH D;  5DNN D;  3NQU A;  4KHA B;  4XZQ C;  3WAA D;  2IO5 B;  3REK C;  5B33 C;  1KX5 A;  5DNM C;  2F8N A;  3WTP B;  5B33 B;  3REK B;  5DNM B;  3AZK A;  3AV1 A;  3W99 C;  3UTA A;  4CSR B;  3LZ0 A;  1P3I A;  4R8P B;  5CP6 D;  3MGR B;  5B2J D;  5GT0 D;  3B6F A;  4J8W C;  4H9P B;  1P3A D;  3UTB D;  2PYO A;  5GXQ B;  4YM6 D;  1P3M D;  3LJA B;  4Z66 A;  1ZLA B;  3REH C;  3B0C W;  3AYW D;  3B6G D;  1U35 D;  3REH B;  2HIO D;  3REJ D;  2YFV A;  5BS7 A;  5C3I C;  5B1L C;  3WTP E;  3LZ1 D;  3AZK C;  2F8N G;  2NQB D;  3V9R A;  2L5A A;  3MGQ D;  3TU4 B;  1P3P C;  1P3K B;  3AV2 A;  5B1L B;  1JFI A;  5JA4 B;  1P3P B;  4KUD A;  3B6F C;  3W98 A;  2YFW B;  3W96 A;  5F99 A;  2CWE A;  3O62 B;  3AZH A;  5DNN A;  5KDM A;  3WAA A;  5B1M D;  3A6N B;  3KXB A;  3X1S D;  3C1B D;  1EQZ D;  2HUE C;  5GSU D;  5AV9 B;  3MVD D;  5BS7 C;  2HUE B;  5CP6 A;  4CAY B;  1P3O A;  5GT0 A;  3AZN C;  1P34 A;  3WTP D;  1N1J A;  3C1C C;  4WU9 D;  2F8N H;  3AZN B;  3AZM D;  4KGC D;  3C1C B;  3AZH C;  3LEL A;  5DNN C;  4R8P D;  3MGR D;  2ARO A;  3WAA C;  3WA9 B;  5E5A B;  3B6G A;  3UT9 A;  5GXQ D;  3W97 A;  2NQB A;  3LJA D;  1ZLA D;  1F66 D;  5CP6 C;  5B2J C;  5BNV B;  5GT0 C;  4WU8 A;  1P3A C;  3UTB C;  1ID3 A;  3KWQ A;  4YM6 C;  1P3M C;  3KUY A;  1P3A B;  3UTB B;  4H9O B;  3TU4 D;  1P3K D;  3AZL D;  5CPI D;  1P3M B;  4LD9 A;  4XUJ A;  3AYW C;  1U35 C;  3B6G C;  5GSU A;  1P3L D;  2HIO C;  3REJ C;  3MVD A;  4Z5T A;  3O62 D;  1KX3 D;  4KHA A;  3LZ1 C;  3AYW B;  1U35 B;  2NQB C;  2HIO B;  3A6N D;  3MGQ C;  5B24 B;  4J8X B;  1HTA A;  3LZ1 B;  5B33 A;  3REK A;  3AZI B;  5DNM A;  3R45 B;  5AV9 D;  4CSR A;  4R8P A;  3MGR A;  5AY8 D;  5B1M C;  5B0Z D;  3X1S C;  4H9P A;  3C1B C;  1EQZ C;  3NQJ B;  5B1M B;  5GXQ A;  1KX4 B;  4ZUX B;  3X1S B;  5GSU C;  4J8W A;  2CV5 D;  3MNN B;  3C1B B;  1ZLA A;  1EQZ B;  5AVB D;  3MVD C;  2IO5 C;  3WA9 D;  5E5A D;  5JRG D;  3REH A;  3WTP C;  4YS3 C;  4WU9 C;  1F1E A;  3AZM C;  3X1V D;  5B40 B;  4KGC C;  3TU4 A;  4YS3 B;  1P3K A;  4WU9 B;  5B1L A;  4R8P C;  4G91 C;  5JA4 A;  3MGR C;  1AOI D;  3AZM B;  5B31 D;  1P3P A;  4KGC B;  2YFW A;  4G91 B;  5G49 B;  3O62 A;  5GXQ C;  3LJA C;  3AZE D;  3A6N A;  1ZLA C;  2NZD D;  1F66 C;  1TZY D;  2RVQ D;  1F66 B;  3MGS B;  1M19 B;  1M1A D;  4CAY A;  4J8V D;  3TU4 C;  5B24 D;  4AWL C;  1P3K C;  4J8X D;  3AZL C;  5CPI C;  3AZI D;  1BFM A;  2BYM B;  4AWL B;  3AZN A;  3AZL B;  1S32 B;  3REL D;  5CPI B;  1P3L C;  3C1C A;  2LY8 A;  3O62 C;  2FJ7 B;  1KX3 C;  4J8U D;  3AZG D;  3VH5 W;  5B32 D;  1P3L B;  3WA9 A;  3A6N C;  3WKJ D;  1KX3 B;  3MGP D;  1P3G D;  1KX4 D;  4ZUX D;  5AV8 D;  3AZJ D;  5AV9 C;  3MNN D;  4WNN B;  1WWI A;  5AY8 C;  5B0Z C;  5AY8 B;  3AFA D;  5GT3 B;  5B2J A;  5B2I D;  1P3F D;  5B0Z B;  3UTA B;  3AN2 B;  2CV5 C;  1P3A A;  3UTB A;  5B40 D;  4H9O A;  1KU5 A;  4YS3 D;  5AVB C;  1TAF B;  4YM6 A;  2CV5 B;  1P3M A;  1H3O B;  5AVC D;  5FUG A;  5E5A C;  3WA9 C;  5JRG C;  5AVB B;  4Z2M G;  3AYW A;  5JRG B;  1U35 A;  4Z66 B;  2HIO A;  3X1V C;  3REJ A;  5B24 A;  1Q9C A;  4J8X A;  3LZ1 A;  1AOI C;  5BO0 B;  3AZI A;  3X1V B;  1P3B D;  5B31 C;  3MGQ A;  3R45 A;  2YFV B;  3MGS D;  5BNX B;  1M19 D;  4H9S C;  3AZF D;  1AOI B;  5B31 B;  3V9R B;  3AZE C;  4QLC B;  2NZD C;  5CPK D;  4H9N B;  1TZY C;  1HQ3 D;  4X23 D;  2RVQ C;  3NQJ A;  3AZE B;  5B1M A;  1KX4 A;  2NZD B;  4JJN D;  3X1S A;  1TZY B;  1S32 D;  4ZBJ C;  3MNN A;  3C1B A;  1EQZ A;  1M1A C;  2FJ7 D;  2F8N K;  4ZBJ B;  4J8V C;  1M1A B;  5B24 C;  1A7W A;  4J8X C;  4Z2M H;  1M18 B;  3AZI C;  4J8V B;  5AV5 D;  3X1T D;  5CPJ D;  3REL C;  5B40 A;  3WTP A;  4YS3 A;  4WU9 A;  4J8U C;  3B0B A;  3AZG C;  1KX5 D;  5B32 C;  3REL B;  3AZM A;  4KGC A;  2F8N D;  1R4V A;  3WKJ C;  3MGP C;  4J8U B;  4H9R B;  3AZG B;  5GT3 D;  5B32 B;  3AV1 D;  1P3G C;  1KX4 C;  4ZUX C;  3WKJ B;  3UTA D;  3MGP B;  4UUZ B;  5AV8 C;  3KSY A;  4H9Q B;  3AZJ C;  3MNN C;  3LZ0 D;  3X1U B;  3AN2 D;  1P3I D;  5AV6 B;  1P3G B;  5AV8 B;  3LJA A;  3AZJ B;  5BT1 D;  1F66 A;  2PYO D;  3MGS A;  1M19 A;  3AFA C;  5B2I C;  1P3F C;  4Z66 D;  3AFA B;  5B40 C;  5B2I B;  1P3F B;  1BH8 B;  1BH9 B;  2BYK B;  5AVC C;  2BYM A;  4WV4 B;  3AZL A;  3REI B;  5CPI A;  1S32 A;  5AVC B;  3KUY B;  1P3L A;  3AV2 D;  4QLC D;  1KX3 A;  4KUD D;  1P3B C;  4WZS B;  3W98 D;  5F99 D;  3W96 D;  3MGS C;  4WNN A;  4Z5T B;  5B0Y C;  3AZF C;  1P3B B;  1M19 C;  4E45 A;  5AV9 A;  3KXB D;  5B0Y B;  3AZF B;  5CPK C;  4XZQ B;  4EO5 C;  1HQ3 C;  5AY8 A;  4X23 C;  5GT3 A;  1M18 D;  5B0Z A;  5CPK B;  4JJN C;  4EO5 B;  3AN2 A;  1HQ3 B;  1S32 C;  4X23 B;  2FJ7 C;  1P3O D;  1TAF A;  3W99 B;  4JJN B;  2CV5 A;  1B6W A;  1H3O A;  1P34 D;  5AVB A;  4DRB A;  5E5A A;  5AV5 C;  4J8W B;  5JRG A;  3X1T C;  5CPJ C;  3X1U D;  3LEL D;  5AV6 D;  5AV5 B;  2ARO D;  1KX5 C;  3X1T B;  5CPJ B;  5BO0 A;  3X1V A;  3NQU B;  3UT9 D;  5BNX A;  1KX5 B;  5GT3 C;  1AOI A;  5BNV A;  3AV1 C;  5B31 A;  3W97 D;  2F8N B;  4M6B A;  3UTA C;  3AN2 C;  4H9S A;  5C3I B;  3LZ0 C;  4QLC A; 
#chains in the Genus database with same CATH topology
 3AZK B;  3AV1 B;  4H9N A;  1ULY A;  4WU8 D;  3AZE A;  3LZ0 B;  2DF4 C;  1P3I B;  5BT1 C;  2NZD A;  3B0D C;  1TZY A;  1ID3 D;  4NFT A;  3REI D;  3KWQ D;  2PYO C;  3B6F B;  3VH6 A;  4G92 C;  3KUY D;  3B0D B;  4Z66 C;  3VH6 T;  2PYO B;  1M1A A;  4G92 B;  1M18 A;  4XUJ D;  4LD9 D;  2FFF B;  4J8V A;  4Z5T D;  3REL A;  5B31 G;  5B0Y D;  4QLC C;  3AV2 C;  4XZQ D;  4J8U A;  4H9R A;  5B33 D;  4NE6 A;  3REK D;  3AZG A;  5DNM D;  5B32 A;  4KUD C;  5CHL B;  3AV2 B;  3WKJ A;  1JFI B;  3W98 C;  3W96 C;  2JSS A;  4UUZ A;  4H9Q A;  5F99 C;  3MGP A;  3X1U A;  4KUD B;  5AV6 A;  3W99 D;  1P3G A;  4ZUX A;  3W98 B;  5F99 B;  3W96 B;  5AV8 A;  3AZJ A;  3KXB C;  3AZH B;  5DNN B;  3EPL A;  5KDM B;  3WAA B;  3KXB B;  1M18 C;  2G5I C;  4J8W D;  3AFA A;  5B2I A;  1P3F A;  1P3O C;  1BH8 A;  1BH9 A;  2BYK A;  3REH D;  1P34 C;  5CP6 B;  3H0M C;  4NE5 A;  5B2J B;  3REI A;  1P3O B;  5GT0 B;  5AVC A;  1P34 B;  2VQR A;  1N1J B;  5B32 G;  3EPK A;  5G49 A;  3X1U C;  5B1L D;  4YM6 B;  3LEL C;  3AZK D;  5AV6 C;  3VH6 W;  2ARO C;  1WWS A;  5FUG B;  1P3P D;  1B67 A;  3LEL B;  2Y2L A;  3LZ0 C;  2ARO B;  3UT9 C;  2RIQ A;  4DRA A;  1P3B A;  3B6G B;  3B6F D;  3W97 C;  4E44 A;  3REJ B;  3UT9 B;  5B0Y A;  2G5H C;  3AZF A;  3W97 B;  4NE3 A;  2NQB B;  4XZQ A;  3B0C T;  3MGQ B;  4WU8 C;  5CPK A;  1HQ3 A;  3REI C;  1ID3 C;  4X23 A;  3KWQ C;  4WU8 B;  3W99 A;  4JJN A;  3KUY C;  3F6T A;  1ID3 B;  3KWQ B;  2FJ7 A;  4LD9 C;  3VH5 A;  4XUJ C;  3AZN D;  2W8S A;  4HGA C;  3VH5 T;  3C1C D;  4Z5T C;  4LD9 B;  4XUJ B;  1P3I C;  4HGA B;  5AV5 A;  2ZY2 A;  5GSU B;  3X1T A;  5CPJ A;  3MVD B;  3AZH D;  5DNN D;  3NQU A;  4KHA B;  1Z2C B;  4XZQ C;  3WAA D;  2IO5 B;  3REK C;  5B33 C;  1KX5 A;  5DNM C;  4DQY B;  2F8N A;  3WTP B;  5B33 B;  3REK B;  5DNM B;  3AZK A;  3AV1 A;  3W99 C;  3UTA A;  4CSR B;  3LZ0 A;  1P3I A;  4R8P B;  5CP6 D;  3MGR B;  2F2A C;  5B2J D;  5GT0 D;  3B6F A;  4J8W C;  4H9P B;  1P3A D;  3EPH A;  3UTB D;  2PYO A;  5GXQ B;  4YM6 D;  1P3M D;  3LJA B;  4Z66 A;  1ZLA B;  3REH C;  3B0C W;  3AYW D;  3B6G D;  1U35 D;  3REH B;  2HIO D;  3REJ D;  2YFV A;  5BS7 A;  5C3I C;  5B1L C;  3WTP E;  3LZ1 D;  3AZK C;  2F8N G;  2NQB D;  3V9R A;  2L5A A;  3MGQ D;  3TU4 B;  1P3P C;  1P3K B;  3AV2 A;  3P5J B;  5B1L B;  1JFI A;  5JA4 B;  1P3P B;  4KUD A;  3B6F C;  3W98 A;  2YFW B;  3W96 A;  5F99 A;  2CWE A;  3O62 B;  3AZH A;  5DNN A;  3IP4 C;  5KDM A;  3WAA A;  5B1M D;  3A6N B;  3KXB A;  3X1S D;  3C1B D;  1EQZ D;  2HUE C;  5GSU D;  5AV9 B;  3MVD D;  5BS7 C;  2HUE B;  2XD5 A;  5CP6 A;  4CAY B;  1P3O A;  5GT0 A;  3AZN C;  1P34 A;  3WTP D;  1N1J A;  3C1C C;  4WU9 D;  2F8N H;  3AZN B;  3AZM D;  4KGC D;  3C1C B;  3AZH C;  3LEL A;  5DNN C;  4R8P D;  3MGR D;  2ARO A;  3WAA C;  3WA9 B;  5E5A B;  3B6G A;  3UT9 A;  5GXQ D;  3W97 A;  2NQB A;  3LJA D;  1ZLA D;  1F66 D;  2Y2Q A;  5CP6 C;  5B2J C;  5BNV B;  5GT0 C;  4WU8 A;  1P3A C;  3UTB C;  1ID3 A;  3KWQ A;  4YM6 C;  1P3M C;  3KUY A;  1P3A B;  3UTB B;  4H9O B;  3TU4 D;  1P3K D;  3AZL D;  5CPI D;  1P3M B;  4LD9 A;  4XUJ A;  3AYW C;  1U35 C;  3B6G C;  5GSU A;  1P3L D;  2HIO C;  3REJ C;  3MVD A;  4Z5T A;  3O62 D;  1KX3 D;  4KHA A;  3LZ1 C;  3AYW B;  1U35 B;  2NQB C;  2HIO B;  3A6N D;  3MGQ C;  5B24 B;  4J8X B;  1HTA A;  3LZ1 B;  5B33 A;  3REK A;  2XD1 A;  3AZI B;  5DNM A;  3R45 B;  5AV9 D;  4CSR A;  4R8P A;  3MGR A;  5AY8 D;  5B1M C;  5B0Z D;  3X1S C;  4H9P A;  3C1B C;  1EQZ C;  3NQJ B;  5B1M B;  5GXQ A;  1KX4 B;  4ZUX B;  3X1S B;  5GSU C;  4J8W A;  2CV5 D;  2ZY3 A;  3MNN B;  3C1B B;  1ZLA A;  1EQZ B;  5AVB D;  3MVD C;  2IO5 C;  3WA9 D;  5E5A D;  5JRG D;  3REH A;  3WTP C;  4YS3 C;  4WU9 C;  1F1E A;  3AZM C;  3X1V D;  5B40 B;  4KGC C;  3TU4 A;  4YS3 B;  1P3K A;  4WU9 B;  5B1L A;  2Y2G A;  4R8P C;  4G91 C;  5JA4 A;  3MGR C;  1AOI D;  3AZM B;  5B31 D;  1P3P A;  4KGC B;  2JCH A;  2YFW A;  4G91 B;  5G49 B;  3O62 A;  5GXQ C;  3LJA C;  3AZE D;  3A6N A;  1ZLA C;  2NZD D;  1F66 C;  1TZY D;  2RVQ D;  2BG1 A;  1F66 B;  3MGS B;  1M19 B;  1M1A D;  4CAY A;  3H0L C;  2ZY5 A;  4J8V D;  3TU4 C;  5B24 D;  4AWL C;  1P3K C;  4J8X D;  3AZL C;  5CPI C;  2JE5 A;  3AZI D;  1BFM A;  2BYM B;  4AWL B;  3AZN A;  3AZL B;  1S32 B;  3REL D;  5CPI B;  1P3L C;  3C1C A;  2Y2J A;  2LY8 A;  2UWX A;  3O62 C;  1KX3 C;  2FJ7 B;  4J8U D;  3AZG D;  3VH5 W;  5B32 D;  1P3L B;  3WA9 A;  3A6N C;  3WKJ D;  1KX3 B;  3MGP D;  3KFU G;  1P3G D;  1KX4 D;  4ZUX D;  5AV8 D;  3AZJ D;  5AV9 C;  1W2E A;  4WNN B;  1WWI A;  3MNN D;  5AY8 C;  4UPK A;  5B0Z C;  3H0R C;  5AY8 B;  2ZM5 A;  3AFA D;  5GT3 B;  5B2J A;  5B2I D;  1P3F D;  5B0Z B;  3UTA B;  3AN2 B;  2CV5 C;  1P3A A;  3UTB A;  5B40 D;  4H9O A;  1KU5 A;  4YS3 D;  2Y2K A;  5AVB C;  1TAF B;  4YM6 A;  2CV5 B;  1P3M A;  3A1K A;  1H3O B;  5AVC D;  5FUG A;  5E5A C;  3WA9 C;  5JRG C;  5AVB B;  1T3U A;  4Z2M G;  3AYW A;  5JRG B;  1U35 A;  4Z66 B;  2HIO A;  3X1V C;  3REJ A;  4WJ3 C;  5B24 A;  1Q9C A;  4J8X A;  3LZ1 A;  1AOI C;  5BO0 B;  3AZI A;  3X1V B;  1P3B D;  5B31 C;  3MGQ A;  3R45 A;  2YFV B;  3MGS D;  5BNX B;  1M19 D;  4H9S C;  3AZF D;  1AOI B;  5B31 B;  3V9R B;  3AZE C;  4QLC B;  2NZD C;  5CPK D;  3EPJ A;  4H9N B;  1TZY C;  1HQ3 D;  4X23 D;  2RVQ C;  3NQJ A;  3AZE B;  5B1M A;  1KX4 A;  2NZD B;  4JJN D;  3X1S A;  1TZY B;  1S32 D;  4ZBJ C;  3MNN A;  3C1B A;  1EQZ A;  1M1A C;  2FJ7 D;  2F8N K;  4ZBJ B;  2Y2O A;  4J8V C;  1M1A B;  5B24 C;  1A7W A;  4J8X C;  4Z2M H;  1M18 B;  3AZI C;  4J8V B;  5AV5 D;  3X1T D;  5CPJ D;  3REL C;  5B40 A;  3WTP A;  4YS3 A;  4WU9 A;  4J8U C;  3B0B A;  3AZG C;  1KX5 D;  5B32 C;  3REL B;  3AZM A;  4KGC A;  1PZR A;  2F8N D;  1R4V A;  3WKJ C;  3MGP C;  4J8U B;  4H9R B;  3AZG B;  5GT3 D;  5B32 B;  3AV1 D;  1P3G C;  1KX4 C;  4ZUX C;  3WKJ B;  2ZY4 A;  3UTA D;  3MGP B;  4UUZ B;  5AV8 C;  3KSY A;  4H9Q B;  3AZJ C;  3MNN C;  3LZ0 D;  3X1U B;  3AN2 D;  1P3I D;  5AV6 B;  1P3G B;  5AV8 B;  3LJA A;  3AZJ B;  5BT1 D;  2Y2N A;  1F66 A;  2PYO D;  3MGS A;  1M19 A;  3AFA C;  5B2I C;  1P3F C;  3FDD A;  4Z66 D;  3AFA B;  5B40 C;  5B2I B;  1P3F B;  1BH8 B;  3EG5 B;  1BH9 B;  2BYK B;  5AVC C;  2BYM A;  4WV4 B;  3AZL A;  3REI B;  5CPI A;  1S32 A;  5AVC B;  3KUY B;  1P3L A;  3AV2 D;  4QLC D;  1KX3 A;  2DQN C;  4KUD D;  1P3B C;  2Y2H A;  4WZS B;  3W98 D;  5F99 D;  3W96 D;  2Y2M A;  3MGS C;  4WNN A;  4Z5T B;  5B0Y C;  3AZF C;  1P3B B;  1M19 C;  2Y2P A;  4E45 A;  5AV9 A;  3KXB D;  5B0Y B;  3AZF B;  5CPK C;  4XZQ B;  4EO5 C;  1HQ3 C;  5AY8 A;  4X23 C;  5GT3 A;  1M18 D;  5B0Z A;  5CPK B;  4JJN C;  4EO5 B;  3AN2 A;  1HQ3 B;  1S32 C;  4X23 B;  2FJ7 C;  1P3O D;  1TAF A;  3W99 B;  4JJN B;  2CV5 A;  1B6W A;  2J8P A;  1H3O A;  1P34 D;  5AVB A;  4DRB A;  5E5A A;  5AV5 C;  4J8W B;  2Y2I A;  5JRG A;  3AL0 C;  3X1T C;  5CPJ C;  3X1U D;  3LEL D;  5AV6 D;  5AV5 B;  2ARO D;  1KX5 C;  3X1T B;  5CPJ B;  5BO0 A;  3X1V A;  3NQU B;  3UT9 D;  5BNX A;  1KX5 B;  5GT3 C;  1AOI A;  5BNV A;  3AV1 C;  5B31 A;  3W97 D;  2F8N B;  4M6B A;  3UTA C;  3AN2 C;  4H9S A;  5C3I B;  3A1I A;  4QLC A; 
#chains in the Genus database with same CATH homology
 3AZK B;  3AV1 B;  4H9N A;  1ULY A;  4WU8 D;  3AZE A;  3LZ0 B;  2DF4 C;  1P3I B;  5BT1 C;  2NZD A;  3B0D C;  1TZY A;  1ID3 D;  4NFT A;  3REI D;  3KWQ D;  2PYO C;  3B6F B;  3VH6 A;  4G92 C;  3KUY D;  3B0D B;  4Z66 C;  3VH6 T;  2PYO B;  1M1A A;  4G92 B;  1M18 A;  4XUJ D;  4LD9 D;  2FFF B;  4J8V A;  4Z5T D;  3REL A;  5B31 G;  5B0Y D;  4QLC C;  3AV2 C;  4XZQ D;  4J8U A;  4H9R A;  5B33 D;  4NE6 A;  3REK D;  3AZG A;  5DNM D;  5B32 A;  4KUD C;  5CHL B;  3AV2 B;  3WKJ A;  1JFI B;  3W98 C;  3W96 C;  2JSS A;  4UUZ A;  4H9Q A;  5F99 C;  3MGP A;  3X1U A;  4KUD B;  5AV6 A;  3W99 D;  1P3G A;  4ZUX A;  3W98 B;  5F99 B;  3W96 B;  5AV8 A;  3AZJ A;  3KXB C;  3AZH B;  5DNN B;  3EPL A;  5KDM B;  3WAA B;  3KXB B;  1M18 C;  2G5I C;  4J8W D;  3AFA A;  5B2I A;  1P3F A;  1P3O C;  1BH8 A;  1BH9 A;  2BYK A;  3REH D;  1P34 C;  5CP6 B;  3H0M C;  4NE5 A;  5B2J B;  3REI A;  1P3O B;  5GT0 B;  5AVC A;  1P34 B;  2VQR A;  1N1J B;  5B32 G;  3EPK A;  5G49 A;  3X1U C;  5B1L D;  4YM6 B;  3LEL C;  3AZK D;  5AV6 C;  3VH6 W;  2ARO C;  1WWS A;  5FUG B;  1P3P D;  1B67 A;  3LEL B;  2Y2L A;  3LZ0 C;  2ARO B;  3UT9 C;  2RIQ A;  4DRA A;  1P3B A;  3B6G B;  3B6F D;  3W97 C;  4E44 A;  3REJ B;  3UT9 B;  5B0Y A;  2G5H C;  3AZF A;  3W97 B;  4NE3 A;  2NQB B;  4XZQ A;  3B0C T;  3MGQ B;  4WU8 C;  5CPK A;  1HQ3 A;  3REI C;  1ID3 C;  4X23 A;  3KWQ C;  4WU8 B;  3W99 A;  4JJN A;  3KUY C;  3F6T A;  1ID3 B;  3KWQ B;  2FJ7 A;  4LD9 C;  3VH5 A;  4XUJ C;  3AZN D;  2W8S A;  4HGA C;  3VH5 T;  3C1C D;  4Z5T C;  4LD9 B;  4XUJ B;  1P3I C;  4HGA B;  5AV5 A;  2ZY2 A;  5GSU B;  3X1T A;  5CPJ A;  3MVD B;  3AZH D;  5DNN D;  3NQU A;  4KHA B;  1Z2C B;  4XZQ C;  3WAA D;  2IO5 B;  3REK C;  5B33 C;  1KX5 A;  5DNM C;  4DQY B;  2F8N A;  3WTP B;  5B33 B;  3REK B;  5DNM B;  3AZK A;  3AV1 A;  3W99 C;  3UTA A;  4CSR B;  3LZ0 A;  1P3I A;  4R8P B;  5CP6 D;  3MGR B;  2F2A C;  5B2J D;  5GT0 D;  3B6F A;  4J8W C;  4H9P B;  1P3A D;  3EPH A;  3UTB D;  2PYO A;  5GXQ B;  4YM6 D;  1P3M D;  3LJA B;  4Z66 A;  1ZLA B;  3REH C;  3B0C W;  3AYW D;  3B6G D;  1U35 D;  3REH B;  2HIO D;  3REJ D;  2YFV A;  5BS7 A;  5C3I C;  5B1L C;  3WTP E;  3LZ1 D;  3AZK C;  2F8N G;  2NQB D;  3V9R A;  2L5A A;  3MGQ D;  3TU4 B;  1P3P C;  1P3K B;  3AV2 A;  3P5J B;  5B1L B;  1JFI A;  5JA4 B;  1P3P B;  4KUD A;  3B6F C;  3W98 A;  2YFW B;  3W96 A;  5F99 A;  2CWE A;  3O62 B;  3AZH A;  5DNN A;  3IP4 C;  5KDM A;  3WAA A;  5B1M D;  3A6N B;  3KXB A;  3X1S D;  3C1B D;  1EQZ D;  2HUE C;  5GSU D;  5AV9 B;  3MVD D;  5BS7 C;  2HUE B;  2XD5 A;  5CP6 A;  4CAY B;  1P3O A;  5GT0 A;  3AZN C;  1P34 A;  3WTP D;  1N1J A;  3C1C C;  4WU9 D;  2F8N H;  3AZN B;  3AZM D;  4KGC D;  3C1C B;  3AZH C;  3LEL A;  5DNN C;  4R8P D;  3MGR D;  2ARO A;  3WAA C;  3WA9 B;  5E5A B;  3B6G A;  3UT9 A;  5GXQ D;  3W97 A;  2NQB A;  3LJA D;  1ZLA D;  1F66 D;  2Y2Q A;  5CP6 C;  5B2J C;  5BNV B;  5GT0 C;  4WU8 A;  1P3A C;  3UTB C;  1ID3 A;  3KWQ A;  4YM6 C;  1P3M C;  3KUY A;  1P3A B;  3UTB B;  4H9O B;  3TU4 D;  1P3K D;  3AZL D;  5CPI D;  1P3M B;  4LD9 A;  4XUJ A;  3AYW C;  1U35 C;  3B6G C;  5GSU A;  1P3L D;  2HIO C;  3REJ C;  3MVD A;  4Z5T A;  3O62 D;  1KX3 D;  4KHA A;  3LZ1 C;  3AYW B;  1U35 B;  2NQB C;  2HIO B;  3A6N D;  3MGQ C;  5B24 B;  4J8X B;  1HTA A;  3LZ1 B;  5B33 A;  3REK A;  2XD1 A;  3AZI B;  5DNM A;  3R45 B;  5AV9 D;  4CSR A;  4R8P A;  3MGR A;  5AY8 D;  5B1M C;  5B0Z D;  3X1S C;  4H9P A;  3C1B C;  1EQZ C;  3NQJ B;  5B1M B;  5GXQ A;  1KX4 B;  4ZUX B;  3X1S B;  5GSU C;  4J8W A;  2CV5 D;  2ZY3 A;  3MNN B;  3C1B B;  1ZLA A;  1EQZ B;  5AVB D;  3MVD C;  2IO5 C;  3WA9 D;  5E5A D;  5JRG D;  3REH A;  3WTP C;  4YS3 C;  4WU9 C;  1F1E A;  3AZM C;  3X1V D;  5B40 B;  4KGC C;  3TU4 A;  4YS3 B;  1P3K A;  4WU9 B;  5B1L A;  2Y2G A;  4R8P C;  4G91 C;  5JA4 A;  3MGR C;  1AOI D;  3AZM B;  5B31 D;  1P3P A;  4KGC B;  2JCH A;  2YFW A;  4G91 B;  5G49 B;  3O62 A;  5GXQ C;  3LJA C;  3AZE D;  3A6N A;  1ZLA C;  2NZD D;  1F66 C;  1TZY D;  2RVQ D;  2BG1 A;  1F66 B;  3MGS B;  1M19 B;  1M1A D;  4CAY A;  3H0L C;  2ZY5 A;  4J8V D;  3TU4 C;  5B24 D;  4AWL C;  1P3K C;  4J8X D;  3AZL C;  5CPI C;  2JE5 A;  3AZI D;  1BFM A;  2BYM B;  4AWL B;  3AZN A;  3AZL B;  1S32 B;  3REL D;  5CPI B;  1P3L C;  3C1C A;  2Y2J A;  2LY8 A;  2UWX A;  3O62 C;  1KX3 C;  2FJ7 B;  4J8U D;  3AZG D;  3VH5 W;  5B32 D;  1P3L B;  3WA9 A;  3A6N C;  3WKJ D;  1KX3 B;  3MGP D;  3KFU G;  1P3G D;  1KX4 D;  4ZUX D;  5AV8 D;  3AZJ D;  5AV9 C;  1W2E A;  4WNN B;  1WWI A;  3MNN D;  5AY8 C;  4UPK A;  5B0Z C;  3H0R C;  5AY8 B;  2ZM5 A;  3AFA D;  5GT3 B;  5B2J A;  5B2I D;  1P3F D;  5B0Z B;  3UTA B;  3AN2 B;  2CV5 C;  1P3A A;  3UTB A;  5B40 D;  4H9O A;  1KU5 A;  4YS3 D;  2Y2K A;  5AVB C;  1TAF B;  4YM6 A;  2CV5 B;  1P3M A;  3A1K A;  1H3O B;  5AVC D;  5FUG A;  5E5A C;  3WA9 C;  5JRG C;  5AVB B;  1T3U A;  4Z2M G;  3AYW A;  5JRG B;  1U35 A;  4Z66 B;  2HIO A;  3X1V C;  3REJ A;  4WJ3 C;  5B24 A;  1Q9C A;  4J8X A;  3LZ1 A;  1AOI C;  5BO0 B;  3AZI A;  3X1V B;  1P3B D;  5B31 C;  3MGQ A;  3R45 A;  2YFV B;  3MGS D;  5BNX B;  1M19 D;  4H9S C;  3AZF D;  1AOI B;  5B31 B;  3V9R B;  3AZE C;  4QLC B;  2NZD C;  5CPK D;  3EPJ A;  4H9N B;  1TZY C;  1HQ3 D;  4X23 D;  2RVQ C;  3NQJ A;  3AZE B;  5B1M A;  1KX4 A;  2NZD B;  4JJN D;  3X1S A;  1TZY B;  1S32 D;  4ZBJ C;  3MNN A;  3C1B A;  1EQZ A;  1M1A C;  2FJ7 D;  2F8N K;  4ZBJ B;  2Y2O A;  4J8V C;  1M1A B;  5B24 C;  1A7W A;  4J8X C;  4Z2M H;  1M18 B;  3AZI C;  4J8V B;  5AV5 D;  3X1T D;  5CPJ D;  3REL C;  5B40 A;  3WTP A;  4YS3 A;  4WU9 A;  4J8U C;  3B0B A;  3AZG C;  1KX5 D;  5B32 C;  3REL B;  3AZM A;  4KGC A;  1PZR A;  2F8N D;  1R4V A;  3WKJ C;  3MGP C;  4J8U B;  4H9R B;  3AZG B;  5GT3 D;  5B32 B;  3AV1 D;  1P3G C;  1KX4 C;  4ZUX C;  3WKJ B;  2ZY4 A;  3UTA D;  3MGP B;  4UUZ B;  5AV8 C;  3KSY A;  4H9Q B;  3AZJ C;  3MNN C;  3LZ0 D;  3X1U B;  3AN2 D;  1P3I D;  5AV6 B;  1P3G B;  5AV8 B;  3LJA A;  3AZJ B;  5BT1 D;  2Y2N A;  1F66 A;  2PYO D;  3MGS A;  1M19 A;  3AFA C;  5B2I C;  1P3F C;  3FDD A;  4Z66 D;  3AFA B;  5B40 C;  5B2I B;  1P3F B;  1BH8 B;  3EG5 B;  1BH9 B;  2BYK B;  5AVC C;  2BYM A;  4WV4 B;  3AZL A;  3REI B;  5CPI A;  1S32 A;  5AVC B;  3KUY B;  1P3L A;  3AV2 D;  4QLC D;  1KX3 A;  2DQN C;  4KUD D;  1P3B C;  2Y2H A;  4WZS B;  3W98 D;  5F99 D;  3W96 D;  2Y2M A;  3MGS C;  4WNN A;  4Z5T B;  5B0Y C;  3AZF C;  1P3B B;  1M19 C;  2Y2P A;  4E45 A;  5AV9 A;  3KXB D;  5B0Y B;  3AZF B;  5CPK C;  4XZQ B;  4EO5 C;  1HQ3 C;  5AY8 A;  4X23 C;  5GT3 A;  1M18 D;  5B0Z A;  5CPK B;  4JJN C;  4EO5 B;  3AN2 A;  1HQ3 B;  1S32 C;  4X23 B;  2FJ7 C;  1P3O D;  1TAF A;  3W99 B;  4JJN B;  2CV5 A;  1B6W A;  2J8P A;  1H3O A;  1P34 D;  5AVB A;  4DRB A;  5E5A A;  5AV5 C;  4J8W B;  2Y2I A;  5JRG A;  3AL0 C;  3X1T C;  5CPJ C;  3X1U D;  3LEL D;  5AV6 D;  5AV5 B;  2ARO D;  1KX5 C;  3X1T B;  5CPJ B;  5BO0 A;  3X1V A;  3NQU B;  3UT9 D;  5BNX A;  1KX5 B;  5GT3 C;  1AOI A;  5BNV A;  3AV1 C;  5B31 A;  3W97 D;  2F8N B;  4M6B A;  3UTA C;  3AN2 C;  4H9S A;  5C3I B;  3A1I A;  4QLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...