3LZ1A

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 2)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz1A00
3KXBB 3W96D 3LZ0A 4J8WD 3AZIB 4Z5TD 3TU4B 3W98D 3VH6A 1AOIC 5DNNA 3W99C 4KGCC 4JJNB 5B33D 3W97B 3AZGD 3X1UA 1TZYA 5F99A 5B0ZB 3UTBA 1M18B 1HQ3A 1F66A 4CAYA 5CPKB 2YFWA 3B6GA 1KX3B 4CSRA 5GT0A 3WA9B 5CPID 1P34B 2CV5A 3B0BA 5B32B 1KU5A 2LY8A 3VH6W 4QLCB 2PYOC 1P3PB 1P3GD 3WKJB 2YFVB 1P3ID 1U35D 5AVCD 3B0CT 1P3OA 4X23C 3AZMB 5DNMD 1ZLAA 3AZHC 1KX4D 1P3LB 3X1VD 5AV8A 5AVBD 4ZBJC 3LELD 3KWQA 4J8UB 2NZDB 5AV9B 3KUYB 1KX5D 4WNNA 1WWSA 3MGRA 3A6NB 3C1BC 3WAAC 4EO5B 1AOID 3AN2C 3W99D 5BNXB 3X1TC 4KGCD 4H9SC 4WZSB 3LZ0B 3B0DC 5AV6A 3MVDC 4WU9B 3AZFD 4AWLC 4ZUXC 5GSUA 3UT9A 4J8XC 5GXQC 5B24A 4YS3A 4DRBA 3X1UB 4NFTA 3O62A 4J8VD 1TZYB 4H9PB 3UTBB 2PYOD 2NQBB 1HQ3B 5GT3A 2HIOB 4E44A 1F66B 3B6GB 5E5AA 4CSRB 4X23D 5GT0B 4XZQA 5BT1C 3REJA 1P3KA 5B1MC 4Z66D 3B6FA 2IO5C 3AZJC 3NQUA 3WAAD 1P3OB 5BS7A 5JRGC 1ZLAB 5CHLB 5AV8B 3X1TD 3WTPC 5B1LA 3RELC 4WNNB 3MGPA 3MGRB 3MVDD 3W96A 4ZUXD 4J8WA 1S32C 2RVQC 4Z5TA 3MNND 4WV4B 4UUZA 1JFIA 3W98A 3C1CA 1EQZB 3X1SA 5C3IB 5B33A 3AZGA 2BYMA 4R8PC 4YM6C 3REIC 1P3AC 5B2JC 5BT1D 4YS3B 3AZED 3O62B 5CPIA 1N1JA 2AROB 1BH8B 5GT3B 3AZJD 2F8NG 1P3FC 2F8NH 3B0CW 5E5AB 1P3IA 5AVCA 1P3KB 5DNMA 3WTPD 3X1VA 5AVBA 3LELA 3RELD 3B6FB 3NQUB 3LZ1C 1KX5A 5B2ID 1P3BA 3REHB 5B31G 1S32D 5B40C 5B1LB 3MGQC 3AYWD 4WU8C 3W99A 3MGPB 5B0YA 1M19C 3MGSC 4J8WB 3UTAC 4Z5TB 4YM6D 1B67A 4UUZB 3AZFA 3AV1C 3C1CB 3REID 5KDMA 3X1SB 1P3AD 2FJ7D 1TAFA 1ID3C 5B33B 3AV2C 3AZGB 4J8VA 3KXBC 3AZIC 3TU4C 4X23A 5CPIB 2HUEB 3LZ1D 4JJNC 4Z66A 3W97C 2F8ND 3KSYA 1P3IB 5AVCB 3WAAA 5B40D 5CP6A 3REKB 1M18C 5B0ZC 5DNMB 3LJAA 3MGQD 3X1VB 5AVBB 3LELB 3X1TA 3AZLD 4WU8D 5CPKC 1KX5B 1KX3C 3WA9C 4XUJB 1P3BB 3UTAD 5B32C 3MVDA 1P3MD 3AV1D 4QLCC 5B31D 1P3PC 3MNNA 5B0YB 3R45A 3V9RA 3AZMC 1P3LC 4J8UC 1H3OA 5CPJA 5AV9C 4H9OA 5AY8B 3KUYC 3AZFB 3AFAB 2NZDC 4G91B 3A6NC 1TAFB 3TU4D 4EO5C 3AZEA 1WWIA 4J8VB 4HGAB 1M1AC 3W97D 3AZJA 1BH9A 3LZ0C 4WU9C 4NE5A 5DNNB 5B0ZD 1F1EA 4KUDA 5CPKD 1KX3D 4Z66B 4H9QA 5F99B 1TZYC 5CP6B 5B2IA 3UTBC 4QLCD 1A7WA 3LJAB 4CAYB 1HQ3C 1S32A 2HIOC 2YFWB 5AV5A 4Z2MH 3X1TB 1P3PD 1F66C 3AZHD 3AYWA 3B6GC 3AZMD 2CV5B 5GT0C 4J8UD 2NZDD 5AV9D 3C1BD 3MNNB 3A6ND 3REIA 1P3OC 3AN2D 2FJ7A 1ZLAC 4KHAA 3KWQB 5G49A 5CPJB 4H9OB 4LD9C 1M1AD 1R4VA 3LZ0D 3MGRC 4WU9D 4G92B 4J8XD 2JSSA 3AZEB 1EQZC 1HTAA 5GXQD 5C3IC 5AV6B 1BH9B 1TZYD 5GSUB 3UT9B 2F8NA 3UTBD 2NQBD 1HQ3D 2HIOD 4KUDB 5B24B 3VH5A 4WU8A 3MGQA 5GT0D 3AZLA 4YS3C 4H9QB 5B1MD 3O62C 5B2IB 2AROC 1S32B 5GT3C 5AV5B 3AV1A 1P3MA 5JRGD 1P3GA 5B31A 4XZQB 1U35A 3AYWB 5E5AC 3REJB 1ZLAD 4M6BA 1KX4A 1P3KC 4LD9D 3AZKC 3B6FC 3WTPE 3MGRD 3VH5W 2L5AA 2RVQD 5BS7C 2FJ7B 4KHAB 3REHC 3TU4A 1AOIA 5G49B 1EQZD 5B1LC 4KGCA 3MGPC 3W96B 4R8PD 4E45A 4J8WC 1JFIB 3W98B 4Z5TC 3C1CC 5B0ZA 5B2JD 3X1SC 3AZNC 5CPKA 2BYMB 3AZGC 2F8NB 1P3FD 2AROD 5FUGA 2PYOA 1P3PA 3MGQB 1Q9CA 5E5AD 3AZLB 3NQJA 3AZHA 1N1JB 1P3KD 5CPIC 3AZKD 4J8UA 5B32G 5AV9A 3AV1B 1P3MB 1P3GB 5B31B 3C1BA 1U35B 3REHD 3AN2A 3REKC 1KX4B 5DNMC 4H9SA 5BNXA 5AVBC 3X1VC 3LELC 1M19D 3MGSD 1P34C 1M1AA 1KX5C 4XUJC 1P3BC 4ZUXA 4WU9A 1AOIB 4J8XA 4NE3A 3C1CD 3W99B 3WKJC 4KGCB 3X1SD 1BFMA 1ID3D 3AZND 3AV2D 5GXQA 5B0YC 1ULYA 5BO0A 5AY8C 4H9PA 5KDMB 3KXBD 3AFAC 3AZFC 2NQBA 3VH5T 3AZID 2HIOA 4G91C 5B1MA 4JJND 5FUGB 4J8VC 2PYOB 4HGAC 4DRAA 3NQJB 5JRGA 4X23B 1M18D 3AZHB 3REKD 5DNNC 4ZBJB 4H9RA 3WTPA 3RELA 3WA9D 1P34D 4LD9A 4Z66C 3C1BB 4XUJD 3X1UC 5B32D 3WAAB 1P3BD 5F99C 4Z2MG 5CP6C 3AN2B 3WKJD 3LJAC 1EQZA 5B0YD 1P3LD 1M1AB 2CV5C 3B0DB 3MVDB 3KUYD 4R8PA 4AWLB 4ZUXB 5AY8D 4J8XB 4YM6A 3AFAD 3MNNC 2NQBC 1P3AA 3R45B 3V9RB 5GXQB 5B2JA 5AV8C 3KWQC 1H3OB 5BO0B 5CPJC 1P3FA 2AROA 1BH8A 2BYKA 4G92C 5DNND 3AZEC 5B1MB 2IO5B 3AZKA 3AZJB 3X1UD 5AV6C 3LZ1A 1B6WA 5JRGB 5F99D 5BNVA 5GSUC 5CP6D 3UT9C 5B40A 3LJAD 3REHA 1F66D 4H9RB 3WTPB 4KUDC 3B6GD 3RELB 5B24C 4LD9B 2CV5D 1M19A 3MGSA 5B2IC 3UTAA 3VH6T 4H9NA 5AV5C 1P3OD 4XZQC 3AYWC 1ID3A 5AV8D 3REJC 3AZNA 3KWQD 5JA4A 3AV2A 4R8PB 5CPJD 4YM6B 3REIB 3KXBA 1P3AB 5B2JB 3AZIA 2FJ7C 2CWEA 1P3FB 5AV6D 2BYKB 3W97A 4JJNA 3W96C 5GSUD 3UT9D 3W98C 1M18A 3REKA 4KUDD 5B24D 4YS3D 3AZKB 3LZ1B 1KX3A 3O62D 5B33C 3WA9A 1P34A 5BNVB 4XUJA 5B32A 5GT3D 5B40B 5AV5D 4QLCA 4WU8B 3WKJA 2YFVA 4XZQD 3REJD 3AZLC 1M19B 2F8NK 3AZMA 3MGSB 1P3LA 3B6FD 3UTAB 2HUEC 3KUYA 2NZDA 4H9NB 1P3MC 5AY8A 3AFAA 1P3GC 5B31C 3A6NA 1P3IC 1U35C 5AVCC 1ID3B 3AZNB 5JA4B 3AV2B 5B1LD 1KX4C 4NE6A 3MGPD
chains in the Genus database with same CATH superfamily
3KXBB 3W96D 3LZ0A 4J8WD 3AZIB 4Z5TD 3TU4B 3W98D 3VH6A 1AOIC 5DNNA 3W99C 4KGCC 4JJNB 5B33D 3W97B 3AZGD 3X1UA 1TZYA 5F99A 5B0ZB 3UTBA 1M18B 1HQ3A 1F66A 4CAYA 5CPKB 2YFWA 3B6GA 1KX3B 4CSRA 5GT0A 3WA9B 2Y2GA 5CPID 1P34B 2CV5A 2Y2IA 3B0BA 5B32B 1KU5A 2LY8A 3VH6W 4QLCB 2PYOC 1P3PB 1P3GD 3WKJB 2YFVB 1P3ID 1U35D 2Y2LA 5AVCD 3B0CT 1P3OA 3P5JB 4X23C 3AZMB 5DNMD 1ZLAA 3AZHC 1KX4D 1P3LB 3X1VD 5AV8A 5AVBD 4ZBJC 3LELD 3KWQA 4J8UB 2NZDB 5AV9B 3KUYB 1KX5D 4WNNA 1WWSA 3MGRA 3A6NB 2FFFB 3C1BC 3WAAC 4EO5B 3KFUG 1AOID 3AN2C 3W99D 5BNXB 3X1TC 4KGCD 4H9SC 2ZM5A 3A1KA 4WZSB 3LZ0B 2Y2PA 3B0DC 5AV6A 3AL0C 3MVDC 4WU9B 3AZFD 4AWLC 4ZUXC 5GSUA 3UT9A 4J8XC 5GXQC 5B24A 4YS3A 4DRBA 3X1UB 4NFTA 3O62A 4J8VD 1TZYB 2JCHA 2Y2OA 4H9PB 3UTBB 2PYOD 2NQBB 1HQ3B 5GT3A 2HIOB 4E44A 1F66B 3B6GB 5E5AA 4CSRB 4X23D 5GT0B 4XZQA 5BT1C 3REJA 1P3KA 5B1MC 4Z66D 3B6FA 2IO5C 3AZJC 3NQUA 3WAAD 1P3OB 2VQRA 5BS7A 5JRGC 1ZLAB 5CHLB 5AV8B 3X1TD 3H0LC 3WTPC 5B1LA 3RELC 4WNNB 3MGPA 3MGRB 3MVDD 3W96A 4ZUXD 4J8WA 1S32C 2RVQC 4Z5TA 3MNND 4WV4B 4UUZA 1JFIA 3W98A 3C1CA 1EQZB 3H0RC 3X1SA 2BG1A 5C3IB 5B33A 3AZGA 2BYMA 4R8PC 4YM6C 3REIC 1P3AC 5B2JC 5BT1D 4YS3B 3AZED 3O62B 5CPIA 1N1JA 2AROB 1BH8B 2Y2HA 5GT3B 3AZJD 1P3FC 2F8NG 2F8NH 3B0CW 5E5AB 1P3IA 5AVCA 1P3KB 5DNMA 3WTPD 3X1VA 5AVBA 3LELA 3RELD 3B6FB 3NQUB 3LZ1C 1KX5A 5B2ID 1P3BA 3REHB 5B31G 1S32D 5B40C 1W2EA 2F2AC 5B1LB 3MGQC 3AYWD 4WU8C 3W99A 3MGPB 5B0YA 1M19C 3MGSC 2JE5A 4J8WB 3UTAC 4Z5TB 4YM6D 1B67A 4UUZB 3AZFA 3AV1C 3C1CB 3REID 5KDMA 3X1SB 1P3AD 2FJ7D 1TAFA 1ID3C 5B33B 3AV2C 3AZGB 2XD1A 4J8VA 3KXBC 3AZIC 3TU4C 4X23A 5CPIB 1PZRA 2HUEB 3LZ1D 4JJNC 4Z66A 3W97C 2F8ND 3KSYA 2ZY2A 1P3IB 5AVCB 3WAAA 5B40D 5CP6A 3REKB 1M18C 1T3UA 3EG5B 5B0ZC 3LJAA 5DNMB 3MGQD 3X1VB 5AVBB 3LELB 3X1TA 3AZLD 4WU8D 5CPKC 1KX5B 1KX3C 4UPKA 2ZY4A 3WA9C 4XUJB 1P3BB 3UTAD 5B32C 3MVDA 1P3MD 3AV1D 4QLCC 5B31D 1P3PC 3MNNA 5B0YB 3R45A 3V9RA 3AZMC 1P3LC 4J8UC 1H3OA 5CPJA 5AV9C 5AY8B 4H9OA 3KUYC 3AZFB 3AFAB 2NZDC 3IP4C 4G91B 3A6NC 1TAFB 3TU4D 4EO5C 3AZEA 1WWIA 4J8VB 4HGAB 1M1AC 3W97D 3AZJA 1BH9A 3LZ0C 4WU9C 4NE5A 5DNNB 5B0ZD 1F1EA 4KUDA 5CPKD 1KX3D 4Z66B 4H9QA 5F99B 1TZYC 5CP6B 5B2IA 3UTBC 4QLCD 1A7WA 3LJAB 4CAYB 1HQ3C 1S32A 2HIOC 2YFWB 5AV5A 4Z2MH 3X1TB 1Z2CB 1P3PD 1F66C 3AZHD 3AYWA 3B6GC 3AZMD 2CV5B 5GT0C 4J8UD 2NZDD 5AV9D 3H0MC 3C1BD 3MNNB 3A6ND 3REIA 1P3OC 3AN2D 2FJ7A 1ZLAC 4KHAA 3KWQB 5G49A 5CPJB 4H9OB 4LD9C 1M1AD 1R4VA 3LZ0D 3MGRC 4WU9D 4G92B 4J8XD 2JSSA 3AZEB 1EQZC 1HTAA 5GXQD 5C3IC 5AV6B 1BH9B 1TZYD 5GSUB 3UT9B 2F8NA 3FDDA 3UTBD 2NQBD 1HQ3D 2J8PA 2HIOD 4KUDB 5B24B 3VH5A 4WU8A 3MGQA 5GT0D 3AZLA 4YS3C 4H9QB 5B1MD 3O62C 5B2IB 2AROC 1S32B 5GT3C 5AV5B 3AV1A 1P3MA 5JRGD 1P3GA 5B31A 4XZQB 1U35A 3AYWB 5E5AC 3REJB 1ZLAD 4M6BA 1KX4A 1P3KC 4LD9D 3AZKC 3B6FC 3WTPE 3MGRD 3VH5W 2L5AA 2RVQD 5BS7C 2FJ7B 4KHAB 3REHC 3TU4A 3A1IA 1AOIA 5G49B 1EQZD 5B1LC 4KGCA 2RIQA 3MGPC 3W96B 4R8PD 4E45A 4J8WC 1JFIB 3W98B 4Z5TC 3EPJA 3C1CC 5B0ZA 5B2JD 3X1SC 3AZNC 5CPKA 2BYMB 3AZGC 2F8NB 1P3FD 2AROD 5FUGA 2PYOA 4DQYB 1P3PA 3MGQB 1Q9CA 5E5AD 3AZLB 3NQJA 2W8SA 3AZHA 1N1JB 2XD5A 1P3KD 5CPIC 3EPHA 3AZKD 4J8UA 5B32G 5AV9A 3AV1B 1P3MB 1P3GB 5B31B 3C1BA 1U35B 3REHD 3AN2A 3REKC 1KX4B 5DNMC 4H9SA 5BNXA 5AVBC 3X1VC 3LELC 1M19D 3MGSD 1P34C 1M1AA 1KX5C 4XUJC 1P3BC 4ZUXA 4WU9A 1AOIB 4J8XA 4NE3A 3C1CD 3W99B 3WKJC 4KGCB 3X1SD 1BFMA 1ID3D 3AZND 3AV2D 5GXQA 4WJ3C 5B0YC 1ULYA 5BO0A 5AY8C 4H9PA 5KDMB 3KXBD 3AFAC 3AZFC 2NQBA 3VH5T 3AZID 2HIOA 4G91C 5B1MA 4JJND 5FUGB 4J8VC 2PYOB 4HGAC 4DRAA 3NQJB 5JRGA 4X23B 1M18D 3AZHB 3REKD 2Y2NA 5DNNC 4ZBJB 4H9RA 3WTPA 3RELA 3WA9D 1P34D 4LD9A 4Z66C 3C1BB 4XUJD 3X1UC 5B32D 2Y2QA 3WAAB 1P3BD 5F99C 4Z2MG 5CP6C 3AN2B 3WKJD 3LJAC 2UWXA 1EQZA 5B0YD 3EPLA 1P3LD 2CV5C 3B0DB 1M1AB 3MVDB 3KUYD 4R8PA 4AWLB 4ZUXB 5AY8D 4J8XB 4YM6A 3AFAD 2ZY3A 3MNNC 2NQBC 1P3AA 3R45B 3V9RB 5GXQB 5B2JA 2Y2KA 5AV8C 3KWQC 1H3OB 5BO0B 5CPJC 1P3FA 2AROA 1BH8A 2BYKA 4G92C 5DNND 3AZEC 5B1MB 2IO5B 3AZKA 3AZJB 3X1UD 5AV6C 3LZ1A 1B6WA 5JRGB 5F99D 5BNVA 5GSUC 5CP6D 3UT9C 5B40A 3LJAD 3REHA 2ZY5A 4H9RB 3WTPB 1F66D 4KUDC 3B6GD 3RELB 5B24C 4LD9B 2CV5D 1M19A 3MGSA 5B2IC 3UTAA 3VH6T 4H9NA 3EPKA 5AV5C 1P3OD 4XZQC 3AYWC 1ID3A 5AV8D 3REJC 3AZNA 3KWQD 5JA4A 3AV2A 4R8PB 5CPJD 2Y2MA 2G5IC 4YM6B 2G5HC 3REIB 3KXBA 1P3AB 3F6TA 5B2JB 3AZIA 2FJ7C 2CWEA 1P3FB 5AV6D 2BYKB 3W97A 4JJNA 3W96C 5GSUD 3UT9D 3W98C 1M18A 3REKA 4KUDD 5B24D 4YS3D 3AZKB 3LZ1B 1KX3A 3O62D 5B33C 3WA9A 1P34A 5BNVB 4XUJA 5B32A 5GT3D 5B40B 5AV5D 4QLCA 4WU8B 3WKJA 2YFVA 4XZQD 3REJD 3AZLC 1M19B 2F8NK 3AZMA 3MGSB 1P3LA 2DQNC 3B6FD 3UTAB 2HUEC 3KUYA 2NZDA 4H9NB 1P3MC 5AY8A 2DF4C 3AFAA 1P3GC 5B31C 3A6NA 1P3IC 1U35C 5AVCC 1ID3B 3AZNB 2Y2JA 5JA4B 3AV2B 5B1LD 1KX4C 4NE6A 3MGPD
chains in the Genus database with same CATH topology
3KXBB 3W96D 3LZ0A 4J8WD 3AZIB 4Z5TD 3TU4B 3W98D 3VH6A 1AOIC 5DNNA 3W99C 4KGCC 4JJNB 5B33D 3W97B 3AZGD 3X1UA 1TZYA 5F99A 5B0ZB 3UTBA 1M18B 1HQ3A 1F66A 4CAYA 5CPKB 2YFWA 3B6GA 1KX3B 4CSRA 5GT0A 3WA9B 2Y2GA 5CPID 1P34B 2CV5A 2Y2IA 3B0BA 5B32B 1KU5A 2LY8A 3VH6W 4QLCB 2PYOC 1P3PB 1P3GD 3WKJB 2YFVB 1P3ID 1U35D 2Y2LA 5AVCD 3B0CT 1P3OA 3P5JB 4X23C 3AZMB 5DNMD 1ZLAA 3AZHC 1KX4D 1P3LB 3X1VD 5AV8A 5AVBD 4ZBJC 3LELD 3KWQA 4J8UB 2NZDB 5AV9B 3KUYB 1KX5D 4WNNA 1WWSA 3MGRA 3A6NB 2FFFB 3C1BC 3WAAC 4EO5B 3KFUG 1AOID 3AN2C 3W99D 5BNXB 3X1TC 4KGCD 4H9SC 2ZM5A 3A1KA 4WZSB 3LZ0B 2Y2PA 3B0DC 5AV6A 3AL0C 3MVDC 4WU9B 3AZFD 4AWLC 4ZUXC 5GSUA 3UT9A 4J8XC 5GXQC 5B24A 4YS3A 4DRBA 3X1UB 4NFTA 3O62A 4J8VD 1TZYB 2JCHA 2Y2OA 4H9PB 3UTBB 2PYOD 2NQBB 1HQ3B 5GT3A 2HIOB 4E44A 1F66B 3B6GB 5E5AA 4CSRB 4X23D 5GT0B 4XZQA 5BT1C 3REJA 1P3KA 5B1MC 4Z66D 3B6FA 2IO5C 3AZJC 3NQUA 3WAAD 1P3OB 2VQRA 5BS7A 5JRGC 1ZLAB 5CHLB 5AV8B 3X1TD 3H0LC 3WTPC 5B1LA 3RELC 4WNNB 3MGPA 3MGRB 3MVDD 3W96A 4ZUXD 4J8WA 1S32C 2RVQC 4Z5TA 3MNND 4WV4B 4UUZA 1JFIA 3W98A 3C1CA 1EQZB 3H0RC 3X1SA 2BG1A 5C3IB 5B33A 3AZGA 2BYMA 4R8PC 4YM6C 3REIC 1P3AC 5B2JC 5BT1D 4YS3B 3AZED 3O62B 5CPIA 1N1JA 2AROB 1BH8B 2Y2HA 5GT3B 3AZJD 1P3FC 2F8NG 2F8NH 3B0CW 5E5AB 1P3IA 5AVCA 1P3KB 5DNMA 3WTPD 3X1VA 5AVBA 3LELA 3RELD 3B6FB 3NQUB 3LZ1C 1KX5A 5B2ID 1P3BA 3REHB 5B31G 1S32D 5B40C 1W2EA 2F2AC 5B1LB 3MGQC 3AYWD 4WU8C 3W99A 3MGPB 5B0YA 1M19C 3MGSC 2JE5A 4J8WB 3UTAC 4Z5TB 4YM6D 1B67A 4UUZB 3AZFA 3AV1C 3C1CB 3REID 5KDMA 3X1SB 1P3AD 2FJ7D 1TAFA 1ID3C 5B33B 3AV2C 3AZGB 2XD1A 4J8VA 3KXBC 3AZIC 3TU4C 4X23A 5CPIB 1PZRA 2HUEB 3LZ1D 4JJNC 4Z66A 3W97C 2F8ND 3KSYA 2ZY2A 1P3IB 5AVCB 3WAAA 5B40D 5CP6A 3REKB 1M18C 1T3UA 3EG5B 5B0ZC 3LJAA 5DNMB 3MGQD 3X1VB 5AVBB 3LELB 3X1TA 3AZLD 4WU8D 5CPKC 1KX5B 1KX3C 4UPKA 2ZY4A 3WA9C 4XUJB 1P3BB 3UTAD 5B32C 3MVDA 1P3MD 3AV1D 4QLCC 5B31D 1P3PC 3MNNA 5B0YB 3R45A 3V9RA 3AZMC 1P3LC 4J8UC 1H3OA 5CPJA 5AV9C 5AY8B 4H9OA 3KUYC 3AZFB 3AFAB 2NZDC 3IP4C 4G91B 3A6NC 1TAFB 3TU4D 4EO5C 3AZEA 1WWIA 4J8VB 4HGAB 1M1AC 3W97D 3AZJA 1BH9A 3LZ0C 4WU9C 4NE5A 5DNNB 5B0ZD 1F1EA 4KUDA 5CPKD 1KX3D 4Z66B 4H9QA 5F99B 1TZYC 5CP6B 5B2IA 3UTBC 4QLCD 1A7WA 3LJAB 4CAYB 1HQ3C 1S32A 2HIOC 2YFWB 5AV5A 4Z2MH 3X1TB 1Z2CB 1P3PD 1F66C 3AZHD 3AYWA 3B6GC 3AZMD 2CV5B 5GT0C 4J8UD 2NZDD 5AV9D 3H0MC 3C1BD 3MNNB 3A6ND 3REIA 1P3OC 3AN2D 2FJ7A 1ZLAC 4KHAA 3KWQB 5G49A 5CPJB 4H9OB 4LD9C 1M1AD 1R4VA 3LZ0D 3MGRC 4WU9D 4G92B 4J8XD 2JSSA 3AZEB 1EQZC 1HTAA 5GXQD 5C3IC 5AV6B 1BH9B 1TZYD 5GSUB 3UT9B 2F8NA 3FDDA 3UTBD 2NQBD 1HQ3D 2J8PA 2HIOD 4KUDB 5B24B 3VH5A 4WU8A 3MGQA 5GT0D 3AZLA 4YS3C 4H9QB 5B1MD 3O62C 5B2IB 2AROC 1S32B 5GT3C 5AV5B 3AV1A 1P3MA 5JRGD 1P3GA 5B31A 4XZQB 1U35A 3AYWB 5E5AC 3REJB 1ZLAD 4M6BA 1KX4A 1P3KC 4LD9D 3AZKC 3B6FC 3WTPE 3MGRD 3VH5W 2L5AA 2RVQD 5BS7C 2FJ7B 4KHAB 3REHC 3TU4A 3A1IA 1AOIA 5G49B 1EQZD 5B1LC 4KGCA 2RIQA 3MGPC 3W96B 4R8PD 4E45A 4J8WC 1JFIB 3W98B 4Z5TC 3EPJA 3C1CC 5B0ZA 5B2JD 3X1SC 3AZNC 5CPKA 2BYMB 3AZGC 2F8NB 1P3FD 2AROD 5FUGA 2PYOA 4DQYB 1P3PA 3MGQB 1Q9CA 5E5AD 3AZLB 3NQJA 2W8SA 3AZHA 1N1JB 2XD5A 1P3KD 5CPIC 3EPHA 3AZKD 4J8UA 5B32G 5AV9A 3AV1B 1P3MB 1P3GB 5B31B 3C1BA 1U35B 3REHD 3AN2A 3REKC 1KX4B 5DNMC 4H9SA 5BNXA 5AVBC 3X1VC 3LELC 1M19D 3MGSD 1P34C 1M1AA 1KX5C 4XUJC 1P3BC 4ZUXA 4WU9A 1AOIB 4J8XA 4NE3A 3C1CD 3W99B 3WKJC 4KGCB 3X1SD 1BFMA 1ID3D 3AZND 3AV2D 5GXQA 4WJ3C 5B0YC 1ULYA 5BO0A 5AY8C 4H9PA 5KDMB 3KXBD 3AFAC 3AZFC 2NQBA 3VH5T 3AZID 2HIOA 4G91C 5B1MA 4JJND 5FUGB 4J8VC 2PYOB 4HGAC 4DRAA 3NQJB 5JRGA 4X23B 1M18D 3AZHB 3REKD 2Y2NA 5DNNC 4ZBJB 4H9RA 3WTPA 3RELA 3WA9D 1P34D 4LD9A 4Z66C 3C1BB 4XUJD 3X1UC 5B32D 2Y2QA 3WAAB 1P3BD 5F99C 4Z2MG 5CP6C 3AN2B 3WKJD 3LJAC 2UWXA 1EQZA 5B0YD 3EPLA 1P3LD 2CV5C 3B0DB 1M1AB 3MVDB 3KUYD 4R8PA 4AWLB 4ZUXB 5AY8D 4J8XB 4YM6A 3AFAD 2ZY3A 3MNNC 2NQBC 1P3AA 3R45B 3V9RB 5GXQB 5B2JA 2Y2KA 5AV8C 3KWQC 1H3OB 5BO0B 5CPJC 1P3FA 2AROA 1BH8A 2BYKA 4G92C 5DNND 3AZEC 5B1MB 2IO5B 3AZKA 3AZJB 3X1UD 5AV6C 3LZ1A 1B6WA 5JRGB 5F99D 5BNVA 5GSUC 5CP6D 3UT9C 5B40A 3LJAD 3REHA 2ZY5A 4H9RB 3WTPB 1F66D 4KUDC 3B6GD 3RELB 5B24C 4LD9B 2CV5D 1M19A 3MGSA 5B2IC 3UTAA 3VH6T 4H9NA 3EPKA 5AV5C 1P3OD 4XZQC 3AYWC 1ID3A 5AV8D 3REJC 3AZNA 3KWQD 5JA4A 3AV2A 4R8PB 5CPJD 2Y2MA 2G5IC 4YM6B 2G5HC 3REIB 3KXBA 1P3AB 3F6TA 5B2JB 3AZIA 2FJ7C 2CWEA 1P3FB 5AV6D 2BYKB 3W97A 4JJNA 3W96C 5GSUD 3UT9D 3W98C 1M18A 3REKA 4KUDD 5B24D 4YS3D 3AZKB 3LZ1B 1KX3A 3O62D 5B33C 3WA9A 1P34A 5BNVB 4XUJA 5B32A 5GT3D 5B40B 5AV5D 4QLCA 4WU8B 3WKJA 2YFVA 4XZQD 3REJD 3AZLC 1M19B 2F8NK 3AZMA 3MGSB 1P3LA 2DQNC 3B6FD 3UTAB 2HUEC 3KUYA 2NZDA 4H9NB 1P3MC 5AY8A 2DF4C 3AFAA 1P3GC 5B31C 3A6NA 1P3IC 1U35C 5AVCC 1ID3B 3AZNB 2Y2JA 5JA4B 3AV2B 5B1LD 1KX4C 4NE6A 3MGPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXB B;  3W96 D;  3LZ0 A;  4J8W D;  3AZI B;  4Z5T D;  3TU4 B;  3W98 D;  3VH6 A;  1AOI C;  5DNN A;  3W99 C;  4KGC C;  4JJN B;  5B33 D;  3W97 B;  3AZG D;  3X1U A;  1TZY A;  5F99 A;  5B0Z B;  3UTB A;  1M18 B;  1HQ3 A;  1F66 A;  4CAY A;  5CPK B;  2YFW A;  3B6G A;  1KX3 B;  4CSR A;  5GT0 A;  3WA9 B;  5CPI D;  1P34 B;  2CV5 A;  3B0B A;  5B32 B;  1KU5 A;  2LY8 A;  3VH6 W;  4QLC B;  2PYO C;  1P3P B;  1P3G D;  3WKJ B;  2YFV B;  1P3I D;  1U35 D;  5AVC D;  3B0C T;  1P3O A;  4X23 C;  3AZM B;  5DNM D;  1ZLA A;  3AZH C;  1KX4 D;  1P3L B;  3X1V D;  5AV8 A;  5AVB D;  4ZBJ C;  3LEL D;  3KWQ A;  4J8U B;  2NZD B;  5AV9 B;  3KUY B;  1KX5 D;  4WNN A;  1WWS A;  3MGR A;  3A6N B;  3C1B C;  3WAA C;  4EO5 B;  1AOI D;  3AN2 C;  3W99 D;  5BNX B;  3X1T C;  4KGC D;  4H9S C;  4WZS B;  3LZ0 B;  3B0D C;  5AV6 A;  3MVD C;  4WU9 B;  3AZF D;  4AWL C;  4ZUX C;  5GSU A;  3UT9 A;  4J8X C;  5GXQ C;  5B24 A;  4YS3 A;  4DRB A;  3X1U B;  4NFT A;  3O62 A;  4J8V D;  1TZY B;  4H9P B;  3UTB B;  2PYO D;  2NQB B;  1HQ3 B;  5GT3 A;  2HIO B;  4E44 A;  1F66 B;  3B6G B;  5E5A A;  4CSR B;  4X23 D;  5GT0 B;  4XZQ A;  5BT1 C;  3REJ A;  1P3K A;  5B1M C;  4Z66 D;  3B6F A;  2IO5 C;  3AZJ C;  3NQU A;  3WAA D;  1P3O B;  5BS7 A;  5JRG C;  1ZLA B;  5CHL B;  5AV8 B;  3X1T D;  3WTP C;  5B1L A;  3REL C;  4WNN B;  3MGP A;  3MGR B;  3MVD D;  3W96 A;  4ZUX D;  4J8W A;  1S32 C;  2RVQ C;  4Z5T A;  3MNN D;  4WV4 B;  4UUZ A;  1JFI A;  3W98 A;  3C1C A;  1EQZ B;  3X1S A;  5C3I B;  5B33 A;  3AZG A;  2BYM A;  4R8P C;  4YM6 C;  3REI C;  1P3A C;  5B2J C;  5BT1 D;  4YS3 B;  3AZE D;  3O62 B;  5CPI A;  1N1J A;  2ARO B;  1BH8 B;  5GT3 B;  3AZJ D;  2F8N G;  1P3F C;  2F8N H;  3B0C W;  5E5A B;  1P3I A;  5AVC A;  1P3K B;  5DNM A;  3WTP D;  3X1V A;  5AVB A;  3LEL A;  3REL D;  3B6F B;  3NQU B;  3LZ1 C;  1KX5 A;  5B2I D;  1P3B A;  3REH B;  5B31 G;  1S32 D;  5B40 C;  5B1L B;  3MGQ C;  3AYW D;  4WU8 C;  3W99 A;  3MGP B;  5B0Y A;  1M19 C;  3MGS C;  4J8W B;  3UTA C;  4Z5T B;  4YM6 D;  1B67 A;  4UUZ B;  3AZF A;  3AV1 C;  3C1C B;  3REI D;  5KDM A;  3X1S B;  1P3A D;  2FJ7 D;  1TAF A;  1ID3 C;  5B33 B;  3AV2 C;  3AZG B;  4J8V A;  3KXB C;  3AZI C;  3TU4 C;  4X23 A;  5CPI B;  2HUE B;  3LZ1 D;  4JJN C;  4Z66 A;  3W97 C;  2F8N D;  3KSY A;  1P3I B;  5AVC B;  3WAA A;  5B40 D;  5CP6 A;  3REK B;  1M18 C;  5B0Z C;  5DNM B;  3LJA A;  3MGQ D;  3X1V B;  5AVB B;  3LEL B;  3X1T A;  3AZL D;  4WU8 D;  5CPK C;  1KX5 B;  1KX3 C;  3WA9 C;  4XUJ B;  1P3B B;  3UTA D;  5B32 C;  3MVD A;  1P3M D;  3AV1 D;  4QLC C;  5B31 D;  1P3P C;  3MNN A;  5B0Y B;  3R45 A;  3V9R A;  3AZM C;  1P3L C;  4J8U C;  1H3O A;  5CPJ A;  5AV9 C;  4H9O A;  5AY8 B;  3KUY C;  3AZF B;  3AFA B;  2NZD C;  4G91 B;  3A6N C;  1TAF B;  3TU4 D;  4EO5 C;  3AZE A;  1WWI A;  4J8V B;  4HGA B;  1M1A C;  3W97 D;  3AZJ A;  1BH9 A;  3LZ0 C;  4WU9 C;  4NE5 A;  5DNN B;  5B0Z D;  1F1E A;  4KUD A;  5CPK D;  1KX3 D;  4Z66 B;  4H9Q A;  5F99 B;  1TZY C;  5CP6 B;  5B2I A;  3UTB C;  4QLC D;  1A7W A;  3LJA B;  4CAY B;  1HQ3 C;  1S32 A;  2HIO C;  2YFW B;  5AV5 A;  4Z2M H;  3X1T B;  1P3P D;  1F66 C;  3AZH D;  3AYW A;  3B6G C;  3AZM D;  2CV5 B;  5GT0 C;  4J8U D;  2NZD D;  5AV9 D;  3C1B D;  3MNN B;  3A6N D;  3REI A;  1P3O C;  3AN2 D;  2FJ7 A;  1ZLA C;  4KHA A;  3KWQ B;  5G49 A;  5CPJ B;  4H9O B;  4LD9 C;  1M1A D;  1R4V A;  3LZ0 D;  3MGR C;  4WU9 D;  4G92 B;  4J8X D;  2JSS A;  3AZE B;  1EQZ C;  1HTA A;  5GXQ D;  5C3I C;  5AV6 B;  1BH9 B;  1TZY D;  5GSU B;  3UT9 B;  2F8N A;  3UTB D;  2NQB D;  1HQ3 D;  2HIO D;  4KUD B;  5B24 B;  3VH5 A;  4WU8 A;  3MGQ A;  5GT0 D;  3AZL A;  4YS3 C;  4H9Q B;  5B1M D;  3O62 C;  5B2I B;  2ARO C;  1S32 B;  5GT3 C;  5AV5 B;  3AV1 A;  1P3M A;  5JRG D;  1P3G A;  5B31 A;  4XZQ B;  1U35 A;  3AYW B;  5E5A C;  3REJ B;  1ZLA D;  4M6B A;  1KX4 A;  1P3K C;  4LD9 D;  3AZK C;  3B6F C;  3WTP E;  3MGR D;  3VH5 W;  2L5A A;  2RVQ D;  5BS7 C;  2FJ7 B;  4KHA B;  3REH C;  3TU4 A;  1AOI A;  5G49 B;  1EQZ D;  5B1L C;  4KGC A;  3MGP C;  3W96 B;  4R8P D;  4E45 A;  4J8W C;  1JFI B;  3W98 B;  4Z5T C;  3C1C C;  5B0Z A;  5B2J D;  3X1S C;  3AZN C;  5CPK A;  2BYM B;  3AZG C;  2F8N B;  1P3F D;  2ARO D;  5FUG A;  2PYO A;  1P3P A;  3MGQ B;  1Q9C A;  5E5A D;  3AZL B;  3NQJ A;  3AZH A;  1N1J B;  1P3K D;  5CPI C;  3AZK D;  4J8U A;  5B32 G;  5AV9 A;  3AV1 B;  1P3M B;  1P3G B;  5B31 B;  3C1B A;  1U35 B;  3REH D;  3AN2 A;  3REK C;  1KX4 B;  5DNM C;  4H9S A;  5BNX A;  5AVB C;  3X1V C;  3LEL C;  1M19 D;  3MGS D;  1P34 C;  1M1A A;  1KX5 C;  4XUJ C;  1P3B C;  4ZUX A;  4WU9 A;  1AOI B;  4J8X A;  4NE3 A;  3C1C D;  3W99 B;  3WKJ C;  4KGC B;  3X1S D;  1BFM A;  1ID3 D;  3AZN D;  3AV2 D;  5GXQ A;  5B0Y C;  1ULY A;  5BO0 A;  5AY8 C;  4H9P A;  5KDM B;  3KXB D;  3AFA C;  3AZF C;  2NQB A;  3VH5 T;  3AZI D;  2HIO A;  4G91 C;  5B1M A;  4JJN D;  5FUG B;  4J8V C;  2PYO B;  4HGA C;  4DRA A;  3NQJ B;  5JRG A;  4X23 B;  1M18 D;  3AZH B;  3REK D;  5DNN C;  4ZBJ B;  4H9R A;  3WTP A;  3REL A;  3WA9 D;  1P34 D;  4LD9 A;  4Z66 C;  3C1B B;  4XUJ D;  3X1U C;  5B32 D;  3WAA B;  1P3B D;  5F99 C;  4Z2M G;  5CP6 C;  3AN2 B;  3WKJ D;  3LJA C;  1EQZ A;  5B0Y D;  1P3L D;  1M1A B;  2CV5 C;  3B0D B;  3MVD B;  3KUY D;  4R8P A;  4AWL B;  4ZUX B;  5AY8 D;  4J8X B;  4YM6 A;  3AFA D;  3MNN C;  2NQB C;  1P3A A;  3R45 B;  3V9R B;  5GXQ B;  5B2J A;  5AV8 C;  3KWQ C;  1H3O B;  5BO0 B;  5CPJ C;  1P3F A;  2ARO A;  1BH8 A;  2BYK A;  4G92 C;  5DNN D;  3AZE C;  5B1M B;  2IO5 B;  3AZK A;  3AZJ B;  3X1U D;  5AV6 C;  3LZ1 A;  1B6W A;  5JRG B;  5F99 D;  5BNV A;  5GSU C;  5CP6 D;  3UT9 C;  5B40 A;  3LJA D;  3REH A;  1F66 D;  4H9R B;  3WTP B;  4KUD C;  3B6G D;  3REL B;  5B24 C;  4LD9 B;  2CV5 D;  1M19 A;  3MGS A;  5B2I C;  3UTA A;  3VH6 T;  4H9N A;  5AV5 C;  1P3O D;  4XZQ C;  3AYW C;  1ID3 A;  5AV8 D;  3REJ C;  3AZN A;  3KWQ D;  5JA4 A;  3AV2 A;  4R8P B;  5CPJ D;  4YM6 B;  3REI B;  3KXB A;  1P3A B;  5B2J B;  3AZI A;  2FJ7 C;  2CWE A;  1P3F B;  5AV6 D;  2BYK B;  3W97 A;  4JJN A;  3W96 C;  5GSU D;  3UT9 D;  3W98 C;  1M18 A;  3REK A;  4KUD D;  5B24 D;  4YS3 D;  3AZK B;  3LZ1 B;  1KX3 A;  3O62 D;  5B33 C;  3WA9 A;  1P34 A;  5BNV B;  4XUJ A;  5B32 A;  5GT3 D;  5B40 B;  5AV5 D;  4QLC A;  4WU8 B;  3WKJ A;  2YFV A;  4XZQ D;  3REJ D;  3AZL C;  1M19 B;  2F8N K;  3AZM A;  3MGS B;  1P3L A;  3B6F D;  3UTA B;  2HUE C;  3KUY A;  2NZD A;  4H9N B;  1P3M C;  5AY8 A;  3AFA A;  1P3G C;  5B31 C;  3A6N A;  1P3I C;  1U35 C;  5AVC C;  1ID3 B;  3AZN B;  5JA4 B;  3AV2 B;  5B1L D;  1KX4 C;  4NE6 A;  3MGP D; 
#chains in the Genus database with same CATH topology
 3KXB B;  3W96 D;  3LZ0 A;  4J8W D;  3AZI B;  4Z5T D;  3TU4 B;  3W98 D;  3VH6 A;  1AOI C;  5DNN A;  3W99 C;  4KGC C;  4JJN B;  5B33 D;  3W97 B;  3AZG D;  3X1U A;  1TZY A;  5F99 A;  5B0Z B;  3UTB A;  1M18 B;  1HQ3 A;  1F66 A;  4CAY A;  5CPK B;  2YFW A;  3B6G A;  1KX3 B;  4CSR A;  5GT0 A;  3WA9 B;  2Y2G A;  5CPI D;  1P34 B;  2CV5 A;  2Y2I A;  3B0B A;  5B32 B;  1KU5 A;  2LY8 A;  3VH6 W;  4QLC B;  2PYO C;  1P3P B;  1P3G D;  3WKJ B;  2YFV B;  1P3I D;  1U35 D;  2Y2L A;  5AVC D;  3B0C T;  1P3O A;  3P5J B;  4X23 C;  3AZM B;  5DNM D;  1ZLA A;  3AZH C;  1KX4 D;  1P3L B;  3X1V D;  5AV8 A;  5AVB D;  4ZBJ C;  3LEL D;  3KWQ A;  4J8U B;  2NZD B;  5AV9 B;  3KUY B;  1KX5 D;  4WNN A;  1WWS A;  3MGR A;  3A6N B;  2FFF B;  3C1B C;  3WAA C;  4EO5 B;  3KFU G;  1AOI D;  3AN2 C;  3W99 D;  5BNX B;  3X1T C;  4KGC D;  4H9S C;  2ZM5 A;  3A1K A;  4WZS B;  3LZ0 B;  2Y2P A;  3B0D C;  5AV6 A;  3AL0 C;  3MVD C;  4WU9 B;  3AZF D;  4AWL C;  4ZUX C;  5GSU A;  3UT9 A;  4J8X C;  5GXQ C;  5B24 A;  4YS3 A;  4DRB A;  3X1U B;  4NFT A;  3O62 A;  4J8V D;  1TZY B;  2JCH A;  2Y2O A;  4H9P B;  3UTB B;  2PYO D;  2NQB B;  1HQ3 B;  5GT3 A;  2HIO B;  4E44 A;  1F66 B;  3B6G B;  5E5A A;  4CSR B;  4X23 D;  5GT0 B;  4XZQ A;  5BT1 C;  3REJ A;  1P3K A;  5B1M C;  4Z66 D;  3B6F A;  2IO5 C;  3AZJ C;  3NQU A;  3WAA D;  1P3O B;  2VQR A;  5BS7 A;  5JRG C;  1ZLA B;  5CHL B;  5AV8 B;  3X1T D;  3H0L C;  3WTP C;  5B1L A;  3REL C;  4WNN B;  3MGP A;  3MGR B;  3MVD D;  3W96 A;  4ZUX D;  4J8W A;  1S32 C;  2RVQ C;  4Z5T A;  3MNN D;  4WV4 B;  4UUZ A;  1JFI A;  3W98 A;  3C1C A;  1EQZ B;  3H0R C;  3X1S A;  2BG1 A;  5C3I B;  5B33 A;  3AZG A;  2BYM A;  4R8P C;  4YM6 C;  3REI C;  1P3A C;  5B2J C;  5BT1 D;  4YS3 B;  3AZE D;  3O62 B;  5CPI A;  1N1J A;  2ARO B;  1BH8 B;  2Y2H A;  5GT3 B;  3AZJ D;  1P3F C;  2F8N G;  2F8N H;  3B0C W;  5E5A B;  1P3I A;  5AVC A;  1P3K B;  5DNM A;  3WTP D;  3X1V A;  5AVB A;  3LEL A;  3REL D;  3B6F B;  3NQU B;  3LZ1 C;  1KX5 A;  5B2I D;  1P3B A;  3REH B;  5B31 G;  1S32 D;  5B40 C;  1W2E A;  2F2A C;  5B1L B;  3MGQ C;  3AYW D;  4WU8 C;  3W99 A;  3MGP B;  5B0Y A;  1M19 C;  3MGS C;  2JE5 A;  4J8W B;  3UTA C;  4Z5T B;  4YM6 D;  1B67 A;  4UUZ B;  3AZF A;  3AV1 C;  3C1C B;  3REI D;  5KDM A;  3X1S B;  1P3A D;  2FJ7 D;  1TAF A;  1ID3 C;  5B33 B;  3AV2 C;  3AZG B;  2XD1 A;  4J8V A;  3KXB C;  3AZI C;  3TU4 C;  4X23 A;  5CPI B;  1PZR A;  2HUE B;  3LZ1 D;  4JJN C;  4Z66 A;  3W97 C;  2F8N D;  3KSY A;  2ZY2 A;  1P3I B;  5AVC B;  3WAA A;  5B40 D;  5CP6 A;  3REK B;  1M18 C;  1T3U A;  3EG5 B;  5B0Z C;  3LJA A;  5DNM B;  3MGQ D;  3X1V B;  5AVB B;  3LEL B;  3X1T A;  3AZL D;  4WU8 D;  5CPK C;  1KX5 B;  1KX3 C;  4UPK A;  2ZY4 A;  3WA9 C;  4XUJ B;  1P3B B;  3UTA D;  5B32 C;  3MVD A;  1P3M D;  3AV1 D;  4QLC C;  5B31 D;  1P3P C;  3MNN A;  5B0Y B;  3R45 A;  3V9R A;  3AZM C;  1P3L C;  4J8U C;  1H3O A;  5CPJ A;  5AV9 C;  5AY8 B;  4H9O A;  3KUY C;  3AZF B;  3AFA B;  2NZD C;  3IP4 C;  4G91 B;  3A6N C;  1TAF B;  3TU4 D;  4EO5 C;  3AZE A;  1WWI A;  4J8V B;  4HGA B;  1M1A C;  3W97 D;  3AZJ A;  1BH9 A;  3LZ0 C;  4WU9 C;  4NE5 A;  5DNN B;  5B0Z D;  1F1E A;  4KUD A;  5CPK D;  1KX3 D;  4Z66 B;  4H9Q A;  5F99 B;  1TZY C;  5CP6 B;  5B2I A;  3UTB C;  4QLC D;  1A7W A;  3LJA B;  4CAY B;  1HQ3 C;  1S32 A;  2HIO C;  2YFW B;  5AV5 A;  4Z2M H;  3X1T B;  1Z2C B;  1P3P D;  1F66 C;  3AZH D;  3AYW A;  3B6G C;  3AZM D;  2CV5 B;  5GT0 C;  4J8U D;  2NZD D;  5AV9 D;  3H0M C;  3C1B D;  3MNN B;  3A6N D;  3REI A;  1P3O C;  3AN2 D;  2FJ7 A;  1ZLA C;  4KHA A;  3KWQ B;  5G49 A;  5CPJ B;  4H9O B;  4LD9 C;  1M1A D;  1R4V A;  3LZ0 D;  3MGR C;  4WU9 D;  4G92 B;  4J8X D;  2JSS A;  3AZE B;  1EQZ C;  1HTA A;  5GXQ D;  5C3I C;  5AV6 B;  1BH9 B;  1TZY D;  5GSU B;  3UT9 B;  2F8N A;  3FDD A;  3UTB D;  2NQB D;  1HQ3 D;  2J8P A;  2HIO D;  4KUD B;  5B24 B;  3VH5 A;  4WU8 A;  3MGQ A;  5GT0 D;  3AZL A;  4YS3 C;  4H9Q B;  5B1M D;  3O62 C;  5B2I B;  2ARO C;  1S32 B;  5GT3 C;  5AV5 B;  3AV1 A;  1P3M A;  5JRG D;  1P3G A;  5B31 A;  4XZQ B;  1U35 A;  3AYW B;  5E5A C;  3REJ B;  1ZLA D;  4M6B A;  1KX4 A;  1P3K C;  4LD9 D;  3AZK C;  3B6F C;  3WTP E;  3MGR D;  3VH5 W;  2L5A A;  2RVQ D;  5BS7 C;  2FJ7 B;  4KHA B;  3REH C;  3TU4 A;  3A1I A;  1AOI A;  5G49 B;  1EQZ D;  5B1L C;  4KGC A;  2RIQ A;  3MGP C;  3W96 B;  4R8P D;  4E45 A;  4J8W C;  1JFI B;  3W98 B;  4Z5T C;  3EPJ A;  3C1C C;  5B0Z A;  5B2J D;  3X1S C;  3AZN C;  5CPK A;  2BYM B;  3AZG C;  2F8N B;  1P3F D;  2ARO D;  5FUG A;  2PYO A;  4DQY B;  1P3P A;  3MGQ B;  1Q9C A;  5E5A D;  3AZL B;  3NQJ A;  2W8S A;  3AZH A;  1N1J B;  2XD5 A;  1P3K D;  5CPI C;  3EPH A;  3AZK D;  4J8U A;  5B32 G;  5AV9 A;  3AV1 B;  1P3M B;  1P3G B;  5B31 B;  3C1B A;  1U35 B;  3REH D;  3AN2 A;  3REK C;  1KX4 B;  5DNM C;  4H9S A;  5BNX A;  5AVB C;  3X1V C;  3LEL C;  1M19 D;  3MGS D;  1P34 C;  1M1A A;  1KX5 C;  4XUJ C;  1P3B C;  4ZUX A;  4WU9 A;  1AOI B;  4J8X A;  4NE3 A;  3C1C D;  3W99 B;  3WKJ C;  4KGC B;  3X1S D;  1BFM A;  1ID3 D;  3AZN D;  3AV2 D;  5GXQ A;  4WJ3 C;  5B0Y C;  1ULY A;  5BO0 A;  5AY8 C;  4H9P A;  5KDM B;  3KXB D;  3AFA C;  3AZF C;  2NQB A;  3VH5 T;  3AZI D;  2HIO A;  4G91 C;  5B1M A;  4JJN D;  5FUG B;  4J8V C;  2PYO B;  4HGA C;  4DRA A;  3NQJ B;  5JRG A;  4X23 B;  1M18 D;  3AZH B;  3REK D;  2Y2N A;  5DNN C;  4ZBJ B;  4H9R A;  3WTP A;  3REL A;  3WA9 D;  1P34 D;  4LD9 A;  4Z66 C;  3C1B B;  4XUJ D;  3X1U C;  5B32 D;  2Y2Q A;  3WAA B;  1P3B D;  5F99 C;  4Z2M G;  5CP6 C;  3AN2 B;  3WKJ D;  3LJA C;  2UWX A;  1EQZ A;  5B0Y D;  3EPL A;  1P3L D;  2CV5 C;  3B0D B;  1M1A B;  3MVD B;  3KUY D;  4R8P A;  4AWL B;  4ZUX B;  5AY8 D;  4J8X B;  4YM6 A;  3AFA D;  2ZY3 A;  3MNN C;  2NQB C;  1P3A A;  3R45 B;  3V9R B;  5GXQ B;  5B2J A;  2Y2K A;  5AV8 C;  3KWQ C;  1H3O B;  5BO0 B;  5CPJ C;  1P3F A;  2ARO A;  1BH8 A;  2BYK A;  4G92 C;  5DNN D;  3AZE C;  5B1M B;  2IO5 B;  3AZK A;  3AZJ B;  3X1U D;  5AV6 C;  3LZ1 A;  1B6W A;  5JRG B;  5F99 D;  5BNV A;  5GSU C;  5CP6 D;  3UT9 C;  5B40 A;  3LJA D;  3REH A;  2ZY5 A;  4H9R B;  3WTP B;  1F66 D;  4KUD C;  3B6G D;  3REL B;  5B24 C;  4LD9 B;  2CV5 D;  1M19 A;  3MGS A;  5B2I C;  3UTA A;  3VH6 T;  4H9N A;  3EPK A;  5AV5 C;  1P3O D;  4XZQ C;  3AYW C;  1ID3 A;  5AV8 D;  3REJ C;  3AZN A;  3KWQ D;  5JA4 A;  3AV2 A;  4R8P B;  5CPJ D;  2Y2M A;  2G5I C;  4YM6 B;  2G5H C;  3REI B;  3KXB A;  1P3A B;  3F6T A;  5B2J B;  3AZI A;  2FJ7 C;  2CWE A;  1P3F B;  5AV6 D;  2BYK B;  3W97 A;  4JJN A;  3W96 C;  5GSU D;  3UT9 D;  3W98 C;  1M18 A;  3REK A;  4KUD D;  5B24 D;  4YS3 D;  3AZK B;  3LZ1 B;  1KX3 A;  3O62 D;  5B33 C;  3WA9 A;  1P34 A;  5BNV B;  4XUJ A;  5B32 A;  5GT3 D;  5B40 B;  5AV5 D;  4QLC A;  4WU8 B;  3WKJ A;  2YFV A;  4XZQ D;  3REJ D;  3AZL C;  1M19 B;  2F8N K;  3AZM A;  3MGS B;  1P3L A;  2DQN C;  3B6F D;  3UTA B;  2HUE C;  3KUY A;  2NZD A;  4H9N B;  1P3M C;  5AY8 A;  2DF4 C;  3AFA A;  1P3G C;  5B31 C;  3A6N A;  1P3I C;  1U35 C;  5AVC C;  1ID3 B;  3AZN B;  2Y2J A;  5JA4 B;  3AV2 B;  5B1L D;  1KX4 C;  4NE6 A;  3MGP D; 
#chains in the Genus database with same CATH homology
 3KXB B;  3W96 D;  3LZ0 A;  4J8W D;  3AZI B;  4Z5T D;  3TU4 B;  3W98 D;  3VH6 A;  1AOI C;  5DNN A;  3W99 C;  4KGC C;  4JJN B;  5B33 D;  3W97 B;  3AZG D;  3X1U A;  1TZY A;  5F99 A;  5B0Z B;  3UTB A;  1M18 B;  1HQ3 A;  1F66 A;  4CAY A;  5CPK B;  2YFW A;  3B6G A;  1KX3 B;  4CSR A;  5GT0 A;  3WA9 B;  2Y2G A;  5CPI D;  1P34 B;  2CV5 A;  2Y2I A;  3B0B A;  5B32 B;  1KU5 A;  2LY8 A;  3VH6 W;  4QLC B;  2PYO C;  1P3P B;  1P3G D;  3WKJ B;  2YFV B;  1P3I D;  1U35 D;  2Y2L A;  5AVC D;  3B0C T;  1P3O A;  3P5J B;  4X23 C;  3AZM B;  5DNM D;  1ZLA A;  3AZH C;  1KX4 D;  1P3L B;  3X1V D;  5AV8 A;  5AVB D;  4ZBJ C;  3LEL D;  3KWQ A;  4J8U B;  2NZD B;  5AV9 B;  3KUY B;  1KX5 D;  4WNN A;  1WWS A;  3MGR A;  3A6N B;  2FFF B;  3C1B C;  3WAA C;  4EO5 B;  3KFU G;  1AOI D;  3AN2 C;  3W99 D;  5BNX B;  3X1T C;  4KGC D;  4H9S C;  2ZM5 A;  3A1K A;  4WZS B;  3LZ0 B;  2Y2P A;  3B0D C;  5AV6 A;  3AL0 C;  3MVD C;  4WU9 B;  3AZF D;  4AWL C;  4ZUX C;  5GSU A;  3UT9 A;  4J8X C;  5GXQ C;  5B24 A;  4YS3 A;  4DRB A;  3X1U B;  4NFT A;  3O62 A;  4J8V D;  1TZY B;  2JCH A;  2Y2O A;  4H9P B;  3UTB B;  2PYO D;  2NQB B;  1HQ3 B;  5GT3 A;  2HIO B;  4E44 A;  1F66 B;  3B6G B;  5E5A A;  4CSR B;  4X23 D;  5GT0 B;  4XZQ A;  5BT1 C;  3REJ A;  1P3K A;  5B1M C;  4Z66 D;  3B6F A;  2IO5 C;  3AZJ C;  3NQU A;  3WAA D;  1P3O B;  2VQR A;  5BS7 A;  5JRG C;  1ZLA B;  5CHL B;  5AV8 B;  3X1T D;  3H0L C;  3WTP C;  5B1L A;  3REL C;  4WNN B;  3MGP A;  3MGR B;  3MVD D;  3W96 A;  4ZUX D;  4J8W A;  1S32 C;  2RVQ C;  4Z5T A;  3MNN D;  4WV4 B;  4UUZ A;  1JFI A;  3W98 A;  3C1C A;  1EQZ B;  3H0R C;  3X1S A;  2BG1 A;  5C3I B;  5B33 A;  3AZG A;  2BYM A;  4R8P C;  4YM6 C;  3REI C;  1P3A C;  5B2J C;  5BT1 D;  4YS3 B;  3AZE D;  3O62 B;  5CPI A;  1N1J A;  2ARO B;  1BH8 B;  2Y2H A;  5GT3 B;  3AZJ D;  1P3F C;  2F8N G;  2F8N H;  3B0C W;  5E5A B;  1P3I A;  5AVC A;  1P3K B;  5DNM A;  3WTP D;  3X1V A;  5AVB A;  3LEL A;  3REL D;  3B6F B;  3NQU B;  3LZ1 C;  1KX5 A;  5B2I D;  1P3B A;  3REH B;  5B31 G;  1S32 D;  5B40 C;  1W2E A;  2F2A C;  5B1L B;  3MGQ C;  3AYW D;  4WU8 C;  3W99 A;  3MGP B;  5B0Y A;  1M19 C;  3MGS C;  2JE5 A;  4J8W B;  3UTA C;  4Z5T B;  4YM6 D;  1B67 A;  4UUZ B;  3AZF A;  3AV1 C;  3C1C B;  3REI D;  5KDM A;  3X1S B;  1P3A D;  2FJ7 D;  1TAF A;  1ID3 C;  5B33 B;  3AV2 C;  3AZG B;  2XD1 A;  4J8V A;  3KXB C;  3AZI C;  3TU4 C;  4X23 A;  5CPI B;  1PZR A;  2HUE B;  3LZ1 D;  4JJN C;  4Z66 A;  3W97 C;  2F8N D;  3KSY A;  2ZY2 A;  1P3I B;  5AVC B;  3WAA A;  5B40 D;  5CP6 A;  3REK B;  1M18 C;  1T3U A;  3EG5 B;  5B0Z C;  3LJA A;  5DNM B;  3MGQ D;  3X1V B;  5AVB B;  3LEL B;  3X1T A;  3AZL D;  4WU8 D;  5CPK C;  1KX5 B;  1KX3 C;  4UPK A;  2ZY4 A;  3WA9 C;  4XUJ B;  1P3B B;  3UTA D;  5B32 C;  3MVD A;  1P3M D;  3AV1 D;  4QLC C;  5B31 D;  1P3P C;  3MNN A;  5B0Y B;  3R45 A;  3V9R A;  3AZM C;  1P3L C;  4J8U C;  1H3O A;  5CPJ A;  5AV9 C;  5AY8 B;  4H9O A;  3KUY C;  3AZF B;  3AFA B;  2NZD C;  3IP4 C;  4G91 B;  3A6N C;  1TAF B;  3TU4 D;  4EO5 C;  3AZE A;  1WWI A;  4J8V B;  4HGA B;  1M1A C;  3W97 D;  3AZJ A;  1BH9 A;  3LZ0 C;  4WU9 C;  4NE5 A;  5DNN B;  5B0Z D;  1F1E A;  4KUD A;  5CPK D;  1KX3 D;  4Z66 B;  4H9Q A;  5F99 B;  1TZY C;  5CP6 B;  5B2I A;  3UTB C;  4QLC D;  1A7W A;  3LJA B;  4CAY B;  1HQ3 C;  1S32 A;  2HIO C;  2YFW B;  5AV5 A;  4Z2M H;  3X1T B;  1Z2C B;  1P3P D;  1F66 C;  3AZH D;  3AYW A;  3B6G C;  3AZM D;  2CV5 B;  5GT0 C;  4J8U D;  2NZD D;  5AV9 D;  3H0M C;  3C1B D;  3MNN B;  3A6N D;  3REI A;  1P3O C;  3AN2 D;  2FJ7 A;  1ZLA C;  4KHA A;  3KWQ B;  5G49 A;  5CPJ B;  4H9O B;  4LD9 C;  1M1A D;  1R4V A;  3LZ0 D;  3MGR C;  4WU9 D;  4G92 B;  4J8X D;  2JSS A;  3AZE B;  1EQZ C;  1HTA A;  5GXQ D;  5C3I C;  5AV6 B;  1BH9 B;  1TZY D;  5GSU B;  3UT9 B;  2F8N A;  3FDD A;  3UTB D;  2NQB D;  1HQ3 D;  2J8P A;  2HIO D;  4KUD B;  5B24 B;  3VH5 A;  4WU8 A;  3MGQ A;  5GT0 D;  3AZL A;  4YS3 C;  4H9Q B;  5B1M D;  3O62 C;  5B2I B;  2ARO C;  1S32 B;  5GT3 C;  5AV5 B;  3AV1 A;  1P3M A;  5JRG D;  1P3G A;  5B31 A;  4XZQ B;  1U35 A;  3AYW B;  5E5A C;  3REJ B;  1ZLA D;  4M6B A;  1KX4 A;  1P3K C;  4LD9 D;  3AZK C;  3B6F C;  3WTP E;  3MGR D;  3VH5 W;  2L5A A;  2RVQ D;  5BS7 C;  2FJ7 B;  4KHA B;  3REH C;  3TU4 A;  3A1I A;  1AOI A;  5G49 B;  1EQZ D;  5B1L C;  4KGC A;  2RIQ A;  3MGP C;  3W96 B;  4R8P D;  4E45 A;  4J8W C;  1JFI B;  3W98 B;  4Z5T C;  3EPJ A;  3C1C C;  5B0Z A;  5B2J D;  3X1S C;  3AZN C;  5CPK A;  2BYM B;  3AZG C;  2F8N B;  1P3F D;  2ARO D;  5FUG A;  2PYO A;  4DQY B;  1P3P A;  3MGQ B;  1Q9C A;  5E5A D;  3AZL B;  3NQJ A;  2W8S A;  3AZH A;  1N1J B;  2XD5 A;  1P3K D;  5CPI C;  3EPH A;  3AZK D;  4J8U A;  5B32 G;  5AV9 A;  3AV1 B;  1P3M B;  1P3G B;  5B31 B;  3C1B A;  1U35 B;  3REH D;  3AN2 A;  3REK C;  1KX4 B;  5DNM C;  4H9S A;  5BNX A;  5AVB C;  3X1V C;  3LEL C;  1M19 D;  3MGS D;  1P34 C;  1M1A A;  1KX5 C;  4XUJ C;  1P3B C;  4ZUX A;  4WU9 A;  1AOI B;  4J8X A;  4NE3 A;  3C1C D;  3W99 B;  3WKJ C;  4KGC B;  3X1S D;  1BFM A;  1ID3 D;  3AZN D;  3AV2 D;  5GXQ A;  4WJ3 C;  5B0Y C;  1ULY A;  5BO0 A;  5AY8 C;  4H9P A;  5KDM B;  3KXB D;  3AFA C;  3AZF C;  2NQB A;  3VH5 T;  3AZI D;  2HIO A;  4G91 C;  5B1M A;  4JJN D;  5FUG B;  4J8V C;  2PYO B;  4HGA C;  4DRA A;  3NQJ B;  5JRG A;  4X23 B;  1M18 D;  3AZH B;  3REK D;  2Y2N A;  5DNN C;  4ZBJ B;  4H9R A;  3WTP A;  3REL A;  3WA9 D;  1P34 D;  4LD9 A;  4Z66 C;  3C1B B;  4XUJ D;  3X1U C;  5B32 D;  2Y2Q A;  3WAA B;  1P3B D;  5F99 C;  4Z2M G;  5CP6 C;  3AN2 B;  3WKJ D;  3LJA C;  2UWX A;  1EQZ A;  5B0Y D;  3EPL A;  1P3L D;  2CV5 C;  3B0D B;  1M1A B;  3MVD B;  3KUY D;  4R8P A;  4AWL B;  4ZUX B;  5AY8 D;  4J8X B;  4YM6 A;  3AFA D;  2ZY3 A;  3MNN C;  2NQB C;  1P3A A;  3R45 B;  3V9R B;  5GXQ B;  5B2J A;  2Y2K A;  5AV8 C;  3KWQ C;  1H3O B;  5BO0 B;  5CPJ C;  1P3F A;  2ARO A;  1BH8 A;  2BYK A;  4G92 C;  5DNN D;  3AZE C;  5B1M B;  2IO5 B;  3AZK A;  3AZJ B;  3X1U D;  5AV6 C;  3LZ1 A;  1B6W A;  5JRG B;  5F99 D;  5BNV A;  5GSU C;  5CP6 D;  3UT9 C;  5B40 A;  3LJA D;  3REH A;  2ZY5 A;  4H9R B;  3WTP B;  1F66 D;  4KUD C;  3B6G D;  3REL B;  5B24 C;  4LD9 B;  2CV5 D;  1M19 A;  3MGS A;  5B2I C;  3UTA A;  3VH6 T;  4H9N A;  3EPK A;  5AV5 C;  1P3O D;  4XZQ C;  3AYW C;  1ID3 A;  5AV8 D;  3REJ C;  3AZN A;  3KWQ D;  5JA4 A;  3AV2 A;  4R8P B;  5CPJ D;  2Y2M A;  2G5I C;  4YM6 B;  2G5H C;  3REI B;  3KXB A;  1P3A B;  3F6T A;  5B2J B;  3AZI A;  2FJ7 C;  2CWE A;  1P3F B;  5AV6 D;  2BYK B;  3W97 A;  4JJN A;  3W96 C;  5GSU D;  3UT9 D;  3W98 C;  1M18 A;  3REK A;  4KUD D;  5B24 D;  4YS3 D;  3AZK B;  3LZ1 B;  1KX3 A;  3O62 D;  5B33 C;  3WA9 A;  1P34 A;  5BNV B;  4XUJ A;  5B32 A;  5GT3 D;  5B40 B;  5AV5 D;  4QLC A;  4WU8 B;  3WKJ A;  2YFV A;  4XZQ D;  3REJ D;  3AZL C;  1M19 B;  2F8N K;  3AZM A;  3MGS B;  1P3L A;  2DQN C;  3B6F D;  3UTA B;  2HUE C;  3KUY A;  2NZD A;  4H9N B;  1P3M C;  5AY8 A;  2DF4 C;  3AFA A;  1P3G C;  5B31 C;  3A6N A;  1P3I C;  1U35 C;  5AVC C;  1ID3 B;  3AZN B;  2Y2J A;  5JA4 B;  3AV2 B;  5B1L D;  1KX4 C;  4NE6 A;  3MGP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...