3LZ1A

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 2)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz1A00
3A6NA 5DNMA 5CPIA 2NZDA 5B0YA 3UTAC 1KX3D 3V9RB 3WTPB 2NQBA 3KUYA 3WKJD 5AY8A 5B40C 4Z5TC 3UT9D 3UTBD 1P3FD 1U35C 5B31B 1P34B 3AN2B 2CV5D 1M1AD 4LD9D 1P3MC 4YS3B 3MGSD 4NE3A 1EQZB 3X1UC 2FJ7D 3UTAB 3AZLD 3VH5W 4H9PA 3X1VA 5B40B 1S32B 3TU4C 4YM6A 4Z5TB 3MVDC 1KX4A 3MNNC 1U35B 4J8VD 3WA9D 3MGPD 5BNXB 3NQJB 1ZLAA 3AZIA 1ID3A 5AV6C 4J8WA 1P3MB 1M19C 3B6FC 3A6ND 5DNMD 5KDMB 5B0YD 4DRBA 3X1UB 2NZDD 2NQBD 5AY8D 5AVBD 3RELC 3TU4B 3V9RA 4ZUXA 1KX3C 3REHC 2JSSA 3WTPA 3MVDB 3MNNB 3WKJC 3B0DB 3UT9C 1P3FC 5B31G 1P34A 5AV6B 3AN2A 1M19B 3LJAC 1M1AC 3B6FB 4H9OB 4YS3A 1EQZA 3X1VD 4X23C 3AZKC 3RELB 2FJ7C 4YM6D 3W96D 3AZLC 3B6GD 5G49B 1KX3B 1KX4D 5B40A 3WKJB 4Z5TA 3AYWC 1WWIA 4HGAC 3UT9B 3AZID 1ID3D 1P3FB 3R45A 4J8WD 1U35A 5B32D 5BNXA 4J8VC 3WA9C 2BYKB 3NQJA 5DNND 1M1AB 1P3MA 4X23B 1P3PD 3X1UA 3C1CA 1HTAA 4Z2MG 4ZUXD 2FJ7B 3AZLB 3WTPD 3AV1C 5AVBC 2F8ND 4WU8D 3MVDA 3AYWB 4HGAB 3MNNA 1P34D 3WAAC 3MGQA 3AN2D 4J8VB 3WA9B 3MGPB 5GT0D 5GT3C 5B0ZC 4H9QB 4YS3D 1EQZD 4QLCD 3B6FA 4H9OA 4NFTA 5DNMB 2NZDB 5B0YB 3X1VC 5AY8B 5AVBB 3RELA 5G49A 3W96C 1KX3A 3REHA 3B6GC 1KX4C 1U35D 3WKJA 3WAAB 4J8XC 3UT9A 1F1EA 5GT3B 5B0ZB 5B32C 2BYKA 3LJAA 5DNNC 3X1UD 3C1CD 1M1AA 5F99D 1P3AC 4G91C 2AROD 3X1VB 4X23A 1P3PC 3AZKA 4ZUXC 3MVDD 3AZLA 3B6GB 3W96B 3MNND 1KX4B 3MGQD 4J8XB 4WU8C 2LY8A 3AYWA 5BT1C 3AZIB 1ID3B 4J8VA 5B32B 3WA9A 3B6FD 5DNNB 5GT0C 1P3AB 2F8NH 3O62C 1BH9B 4QLCC 3RELD 1P3PB 3REHD 4ZUXB 1N1JB 5AV9C 3AV1A 5AVBA 2F8NB 2BYMB 4WU8B 3WAAA 1P3BC 4KGCA 3LJAD 1P3KC 5GSUD 3LELA 1BH8B 5GT0B 5GT3A 5B0ZA 3O62B 4X23D 4QLCB 3C1CC 3AZKD 5B2JC 5F99C 4G92C 2AROC 5AV9B 1HQ3D 3W96A 3AYWD 3B6GA 3R45B 3MGQC 1P3BB 4J8XA 3C1BD 4E44A 1P3KB 5BNVB 5B32A 5B32G 2IO5C 5DNNA 1ULYA 3C1CB 5BO0B 5B2IC 1P3AA 5B2JB 4H9NA 5F99B 4G92B 1BH9A 2AROB 3AV1D 1P3PA 1N1JA 3AZGD 4M6BA 4WV4B 3WAAD 2F8NG 2BYMA 3MGQB 3MGRC 2F8NA 4KGCD 4WU8A 3LELD 5GT3D 5B0ZD 4H9RA 3KWQC 2IO5B 5GSUC 3REKC 1BH8A 5GT0A 3VH6W 3O62A 4QLCA 2HIOC 3REHB 5GXQD 5AV9A 1P3GD 4EO5C 1HQ3C 4J8XD 3MGRB 1KU5A 4ZBJC 3NQUB 2PYOD 1P3BA 1P3LD 3C1BC 4WNNB 1P3KA 3LJAB 5GSUB 1P3AD 5BNVA 5AV5D 2HIOB 5BO0A 3W99C 3AZKB 5B2JA 5F99A 1Q9CA 1M18A 2AROA 4NE6A 4EO5B 1HQ3B 1B67A 5BT1D 1F66C 4ZBJB 3AZGC 4KGCC 3AZED 3C1BB 3LELC 5CPKC 3REID 3O62D 4J8UC 3W99B 5B2IA 5AV9D 2RVQD 3AV1B 1WWSA 3AZFD 5GXQC 1F66B 1P3GC 3AZGB 1P3BD 3MGRA 4KGCB 1P3KD 3WTPE 3LELB 3X1TC 5CPKB 3NQUA 4UUZB 2PYOC 3KWQA 1P3LC 1A7WA 4WNNA 4J8UB 5GSUA 3REKA 5B2JD 5AV8D 1M18D 5JA4B 3VH6T 5AV5C 2HIOA 5CPJD 5GXQB 1P3GB 1HQ3A 3W98A 4R8PD 3X1TB 1P3IC 5E5AC 3AFAC 2PYOB 1P3LB 4NE5A 3C1BA 3AZEC 3B0BA 3AV2C 3LZ1C 5B2ID 4H9NB 3VH6A 5AVCC 3REIC 1P3OA 4G91B 4AWLC 3AZHD 5AV5B 3W99A 1KX5C 1TZYC 2RVQC 3MGRD 2L5AA 3W97D 3AZFC 5CHLB 5JRGC 4WU9C 1H3OB 1F66A 4KUDC 3AZGA 3KWQD 4H9RB 5E5AB 3AFAB 3AZNA 4Z66C 5C3IC 3AZEB 3REKD 5CPKA 4UUZA 3AV2B 4CAYA 3LZ1B 4XUJD 5AVCB 4J8UA 3REIB 4AWLB 3KXBC 2HIOD 3LZ0C 5AV8C 5B1MD 1M18C 5JA4A 1B6WA 5CP6D 1TZYB 5B1LC 1BFMA 3W98D 3AZFB 5GXQA 5JRGB 4WU9B 5CPJC 4KUDB 1S32C 1P3GA 5BS7C 4Z66B 5C3IB 4CSRB 3X1SC 3X1TA 4R8PC 5FUGB 1P3OD 2PYOA 1P3LA 3KXBB 3W99D 3LZ0B 3AZMC 5AV8B 1M18B 5B33D 3AZHC 5AV5A 5B24D 4XZQC 5B1LB 1F66D 5CPJB 3AZND 2YFWB 3AZJC 3W97C 2HUEC 3X1SB 5CPKD 1H3OA 1P3IA 4R8PB 5E5AA 3AFAA 3REJD 3B0DC 4Z2MH 4E45A 4J8UD 3AZEA 3AV2A 3LZ1A 3AZMB 5B2IB 2YFVA 4XUJC 5AVCA 3REIA 1AOIC 3AZHB 5CPID 4JJNC 4XZQB 5B1MC 1KX5A 3KUYD 1TZYA 5CP6C 3AZJB 3W97B 3W98C 2HUEB 3AZFA 5JRGA 3X1TD 4WU9A 4KUDA 3KWQB 1TAFB 4Z66A 4CSRA 3UTBC 4H9SC 5B31A 3REKB 5FUGA 3KSYA 1P3OC 4XUJB 2CV5C 1AOIB 3KXBA 3LZ0A 4LD9C 5AV8A 4JJNB 3MGSC 5B1MB 5B33C 3B0CT 5B24C 5B1LA 5CP6B 3UTAA 3W98B 5CPJA 1P3ID 2YFWA 5E5AD 3AFAD 3AZNC 1S32A 5BS7A 1ZLAD 3X1SA 3UTBB 3LZ1D 3AV2D 4R8PA 3REJC 3MGPC 5AVCD 1P3OB 4WZSB 2CV5B 3AZMA 4LD9B 1KX5D 3MGSB 1JFIB 3AZHA 5B33B 5CPIC 1TZYD 5KDMA 5DNMC 5B24B 5B0YC 3A6NC 4XZQA 2F8NK 2NZDC 1R4VA 5JRGD 4WU9D 3KUYC 5AY8C 4KUDD 2NQBC 3AZNB 3AZJA 3TU4A 3VH5T 4Z66D 3W97A 5B31D 4CAYB 1TAFA 3REJB 2CWEA 3KXBD 3LZ0D 5AV6A 1M19A 4XUJA 4DRAA 1AOIA 4KHAB 3A6NB 5CPIB 5B1LD 3UTAD 4JJNA 5B1MA 2NQBB 3KUYB 3VH5A 5B40D 1S32D 5CP6A 4Z5TD 4YM6C 3X1SD 1ZLAC 3UTBA 4H9SA 3AZIC 3AZMD 1P3FA 4J8WC 1P3MD 1ID3C 2CV5A 4LD9A 4XZQD 3MGSA 1JFIA 4H9PB 5B33A 5B24A 3TU4D 3AZJD 2FJ7A 4YM6B 3WTPC 1P3IB 1ZLAB 5B31C 5AV6D 1P34C 4J8WB 3REJA 3AN2C 2YFVB 3MGPA 1M19D 1AOID 4H9QA 4YS3C 4JJND 3B0CW 1EQZC 1KX5B 4KHAA
chains in the Genus database with same CATH superfamily
3A6NA 5DNMA 5CPIA 2NZDA 5B0YA 3UTAC 1KX3D 3V9RB 3WTPB 2NQBA 3KUYA 3WKJD 5AY8A 5B40C 4Z5TC 3UT9D 3UTBD 1P3FD 2Y2GA 5B31B 1U35C 1P34B 3AN2B 2CV5D 1M1AD 4LD9D 1P3MC 4YS3B 3MGSD 4NE3A 1EQZB 3X1UC 2FJ7D 3UTAB 3AZLD 3VH5W 4H9PA 3X1VA 5B40B 1S32B 3TU4C 4YM6A 4Z5TB 3MVDC 1KX4A 3MNNC 1U35B 4J8VD 3WA9D 3MGPD 5BNXB 3NQJB 1ZLAA 3AZIA 1ID3A 5AV6C 4J8WA 1P3MB 1M19C 3B6FC 3A6ND 5DNMD 5KDMB 5B0YD 4DRBA 3X1UB 2NZDD 2NQBD 5AY8D 5AVBD 2DQNC 3RELC 3TU4B 3V9RA 4ZUXA 1KX3C 3REHC 2JSSA 3WTPA 3MVDB 3MNNB 3WKJC 3B0DB 3UT9C 1P3FC 1T3UA 5B31G 1P34A 5AV6B 3AN2A 1M19B 3LJAC 1M1AC 3B6FB 4H9OB 4YS3A 1EQZA 3X1VD 4X23C 3AZKC 3RELB 2FJ7C 4YM6D 3W96D 3AZLC 3B6GD 5G49B 1KX3B 1KX4D 2XD5A 5B40A 3WKJB 4Z5TA 3AYWC 1WWIA 4HGAC 3UT9B 3AZID 2Y2PA 1P3FB 3R45A 4J8WD 1U35A 5B32D 1ID3D 5BNXA 4J8VC 3WA9C 3H0MC 2BYKB 3NQJA 2ZY2A 5DNND 1M1AB 1P3MA 2Y2JA 4X23B 1P3PD 3X1UA 3C1CA 1HTAA 4Z2MG 4ZUXD 2FJ7B 3AZLB 3WTPD 3AV1C 5AVBC 2F8ND 4WU8D 3MVDA 3AYWB 4HGAB 3MNNA 1P34D 3WAAC 3MGQA 3AN2D 4J8VB 3WA9B 3MGPB 5GT0D 5GT3C 5B0ZC 4H9QB 4YS3D 1EQZD 2ZM5A 4QLCD 3B6FA 4H9OA 4NFTA 5DNMB 2J8PA 2NZDB 5B0YB 3X1VC 5AY8B 5AVBB 3RELA 3F6TA 5G49A 3W96C 4DQYB 3REHA 1KX3A 2Y2HA 1KX4C 3B6GC 1U35D 3WKJA 3WAAB 4J8XC 3UT9A 1F1EA 3EPLA 5GT3B 5B0ZB 5B32C 2BYKA 3LJAA 5DNNC 3H0LC 3X1UD 3C1CD 1M1AA 5F99D 1P3AC 3EG5B 4G91C 2AROD 3X1VB 4X23A 1P3PC 3AZKA 4ZUXC 3MVDD 3AZLA 3B6GB 3W96B 3MNND 1KX4B 2Y2IA 3MGQD 4J8XB 4WU8C 2LY8A 3AYWA 5BT1C 3AZIB 3A1KA 1ID3B 4J8VA 5B32B 3WA9A 3B6FD 5DNNB 5GT0C 1P3AB 2F8NH 3O62C 1BH9B 4QLCC 3RELD 1P3PB 3REHD 4ZUXB 1N1JB 5AV9C 3AV1A 5AVBA 2F8NB 2BYMB 2F2AC 4WU8B 2Y2KA 3WAAA 1P3BC 4KGCA 3LJAD 1P3KC 5GSUD 3LELA 1BH8B 5GT0B 5GT3A 5B0ZA 3O62B 4X23D 4QLCB 3C1CC 3AZKD 5B2JC 5F99C 4G92C 2AROC 5AV9B 1HQ3D 3W96A 3AYWD 3B6GA 3R45B 3MGQC 1P3BB 4J8XA 3C1BD 4E44A 1W2EA 1P3KB 5BNVB 5B32A 5B32G 2IO5C 5DNNA 1ULYA 3EPHA 3C1CB 5BO0B 5B2IC 1P3AA 5B2JB 2XD1A 4H9NA 5F99B 4G92B 1BH9A 2AROB 3AV1D 1P3PA 1N1JA 3AZGD 2W8SA 4M6BA 4WV4B 3WAAD 2F8NG 2BYMA 3MGQB 3FDDA 3MGRC 2F8NA 4KGCD 4WU8A 3LELD 5GT3D 5B0ZD 4H9RA 3KWQC 2IO5B 2JCHA 5GSUC 1BH8A 2DF4C 5GT0A 3REKC 3VH6W 3O62A 2G5IC 4QLCA 2HIOC 3REHB 5GXQD 5AV9A 1P3GD 4EO5C 1HQ3C 4J8XD 3MGRB 1KU5A 4ZBJC 3NQUB 2PYOD 1P3BA 1P3LD 3C1BC 4WNNB 1P3KA 3LJAB 5GSUB 1P3AD 5BNVA 5AV5D 2HIOB 5BO0A 3W99C 3AZKB 5B2JA 5F99A 1Q9CA 1M18A 2AROA 4NE6A 4EO5B 1HQ3B 1B67A 5BT1D 1F66C 4ZBJB 3AZGC 4KGCC 3H0RC 3AZED 3C1BB 3LELC 5CPKC 1PZRA 3REID 3O62D 4J8UC 3W99B 5B2IA 3EPKA 5AV9D 2RVQD 3AV1B 1WWSA 3AZFD 5GXQC 1F66B 1P3GC 3AZGB 1P3BD 3MGRA 4KGCB 1P3KD 3WTPE 3LELB 3X1TC 5CPKB 3NQUA 4UUZB 2PYOC 3KWQA 1P3LC 1A7WA 4WNNA 4J8UB 5GSUA 3REKA 5B2JD 5AV8D 2Y2MA 1M18D 5JA4B 3KFUG 3VH6T 5AV5C 2HIOA 1Z2CB 2RIQA 2BG1A 5CPJD 5GXQB 1P3GB 1HQ3A 2Y2OA 3W98A 4R8PD 3X1TB 1P3IC 5E5AC 3AFAC 2PYOB 1P3LB 4NE5A 3C1BA 3AZEC 3B0BA 3AV2C 3LZ1C 2VQRA 5B2ID 4H9NB 3VH6A 5AVCC 3REIC 1P3OA 4G91B 4AWLC 3AZHD 5AV5B 3W99A 1KX5C 1TZYC 2RVQC 2Y2LA 3MGRD 2L5AA 3W97D 3AZFC 5CHLB 5JRGC 4WU9C 1H3OB 1F66A 4KUDC 3AZGA 3KWQD 4H9RB 5E5AB 3AFAB 3AZNA 4Z66C 5C3IC 3AZEB 3REKD 5CPKA 4UUZA 2UWXA 4CAYA 3LZ1B 3AV2B 4XUJD 5AVCB 4J8UA 3REIB 4AWLB 3KXBC 2HIOD 3LZ0C 5AV8C 5B1MD 1M18C 5JA4A 1B6WA 5CP6D 1TZYB 5B1LC 1BFMA 3W98D 3P5JB 3AZFB 5GXQA 5JRGB 4WU9B 5CPJC 4KUDB 1S32C 1P3GA 5BS7C 2Y2QA 4Z66B 5C3IB 4CSRB 3X1SC 3X1TA 4R8PC 5FUGB 1P3OD 2PYOA 3EPJA 1P3LA 2Y2NA 3KXBB 3W99D 3LZ0B 3AZMC 2JE5A 5AV8B 1M18B 5B33D 3AZHC 5AV5A 5B24D 4XZQC 5B1LB 1F66D 5CPJB 3AZND 2YFWB 3AZJC 3W97C 2HUEC 3X1SB 5CPKD 1H3OA 1P3IA 4R8PB 5E5AA 3AFAA 3REJD 3B0DC 4Z2MH 4E45A 4J8UD 3AZEA 3AV2A 3LZ1A 3AZMB 5B2IB 2G5HC 2YFVA 3A1IA 4XUJC 5AVCA 3REIA 1AOIC 3AZHB 5CPID 4JJNC 4XZQB 5B1MC 1KX5A 3KUYD 1TZYA 5CP6C 3AZJB 3W97B 3W98C 2HUEB 3AZFA 5JRGA 3X1TD 4WU9A 4KUDA 3KWQB 1TAFB 4Z66A 4CSRA 3UTBC 4H9SC 5B31A 3REKB 2ZY3A 5FUGA 3KSYA 1P3OC 4XUJB 2CV5C 1AOIB 3KXBA 3LZ0A 4LD9C 5AV8A 4JJNB 3MGSC 5B1MB 5B33C 3B0CT 5B24C 5B1LA 5CP6B 3UTAA 3AL0C 3W98B 5CPJA 1P3ID 2YFWA 5E5AD 3AFAD 3AZNC 1S32A 5BS7A 1ZLAD 3X1SA 3UTBB 3LZ1D 3AV2D 4R8PA 3REJC 3MGPC 5AVCD 1P3OB 4WZSB 2CV5B 3AZMA 4LD9B 1KX5D 3MGSB 3IP4C 1JFIB 3AZHA 5B33B 5CPIC 1TZYD 5KDMA 5DNMC 5B24B 5B0YC 3A6NC 4XZQA 2F8NK 2NZDC 4UPKA 1R4VA 5JRGD 4WU9D 3KUYC 5AY8C 4KUDD 2NQBC 3AZNB 3AZJA 3TU4A 3VH5T 4Z66D 3W97A 5B31D 4CAYB 1TAFA 3REJB 2CWEA 2FFFB 3KXBD 3LZ0D 5AV6A 1M19A 4XUJA 4DRAA 1AOIA 4KHAB 3A6NB 5CPIB 5B1LD 3UTAD 4JJNA 5B1MA 2NQBB 3KUYB 3VH5A 5B40D 1S32D 5CP6A 4Z5TD 4YM6C 3X1SD 1ZLAC 3UTBA 4H9SA 3AZIC 3AZMD 1P3FA 4J8WC 1P3MD 1ID3C 2CV5A 4LD9A 4XZQD 4WJ3C 3MGSA 1JFIA 4H9PB 5B33A 5B24A 3TU4D 3AZJD 2FJ7A 4YM6B 3WTPC 1P3IB 2ZY4A 1ZLAB 5B31C 5AV6D 1P34C 4J8WB 3REJA 3AN2C 2YFVB 3MGPA 1M19D 2ZY5A 1AOID 4H9QA 4YS3C 4JJND 3B0CW 1EQZC 1KX5B 4KHAA
chains in the Genus database with same CATH topology
3A6NA 5DNMA 5CPIA 2NZDA 5B0YA 3UTAC 1KX3D 3V9RB 3WTPB 2NQBA 3KUYA 3WKJD 5AY8A 5B40C 4Z5TC 3UT9D 3UTBD 1P3FD 2Y2GA 5B31B 1U35C 1P34B 3AN2B 2CV5D 1M1AD 4LD9D 1P3MC 4YS3B 3MGSD 4NE3A 1EQZB 3X1UC 2FJ7D 3UTAB 3AZLD 3VH5W 4H9PA 3X1VA 5B40B 1S32B 3TU4C 4YM6A 4Z5TB 3MVDC 1KX4A 3MNNC 1U35B 4J8VD 3WA9D 3MGPD 5BNXB 3NQJB 1ZLAA 3AZIA 1ID3A 5AV6C 4J8WA 1P3MB 1M19C 3B6FC 3A6ND 5DNMD 5KDMB 5B0YD 4DRBA 3X1UB 2NZDD 2NQBD 5AY8D 5AVBD 2DQNC 3RELC 3TU4B 3V9RA 4ZUXA 1KX3C 3REHC 2JSSA 3WTPA 3MVDB 3MNNB 3WKJC 3B0DB 3UT9C 1P3FC 1T3UA 5B31G 1P34A 5AV6B 3AN2A 1M19B 3LJAC 1M1AC 3B6FB 4H9OB 4YS3A 1EQZA 3X1VD 4X23C 3AZKC 3RELB 2FJ7C 4YM6D 3W96D 3AZLC 3B6GD 5G49B 1KX3B 1KX4D 2XD5A 5B40A 3WKJB 4Z5TA 3AYWC 1WWIA 4HGAC 3UT9B 3AZID 2Y2PA 1P3FB 3R45A 4J8WD 1U35A 5B32D 1ID3D 5BNXA 4J8VC 3WA9C 3H0MC 2BYKB 3NQJA 2ZY2A 5DNND 1M1AB 1P3MA 2Y2JA 4X23B 1P3PD 3X1UA 3C1CA 1HTAA 4Z2MG 4ZUXD 2FJ7B 3AZLB 3WTPD 3AV1C 5AVBC 2F8ND 4WU8D 3MVDA 3AYWB 4HGAB 3MNNA 1P34D 3WAAC 3MGQA 3AN2D 4J8VB 3WA9B 3MGPB 5GT0D 5GT3C 5B0ZC 4H9QB 4YS3D 1EQZD 2ZM5A 4QLCD 3B6FA 4H9OA 4NFTA 5DNMB 2J8PA 2NZDB 5B0YB 3X1VC 5AY8B 5AVBB 3RELA 3F6TA 5G49A 3W96C 4DQYB 3REHA 1KX3A 2Y2HA 1KX4C 3B6GC 1U35D 3WKJA 3WAAB 4J8XC 3UT9A 1F1EA 3EPLA 5GT3B 5B0ZB 5B32C 2BYKA 3LJAA 5DNNC 3H0LC 3X1UD 3C1CD 1M1AA 5F99D 1P3AC 3EG5B 4G91C 2AROD 3X1VB 4X23A 1P3PC 3AZKA 4ZUXC 3MVDD 3AZLA 3B6GB 3W96B 3MNND 1KX4B 2Y2IA 3MGQD 4J8XB 4WU8C 2LY8A 3AYWA 5BT1C 3AZIB 3A1KA 1ID3B 4J8VA 5B32B 3WA9A 3B6FD 5DNNB 5GT0C 1P3AB 2F8NH 3O62C 1BH9B 4QLCC 3RELD 1P3PB 3REHD 4ZUXB 1N1JB 5AV9C 3AV1A 5AVBA 2F8NB 2BYMB 2F2AC 4WU8B 2Y2KA 3WAAA 1P3BC 4KGCA 3LJAD 1P3KC 5GSUD 3LELA 1BH8B 5GT0B 5GT3A 5B0ZA 3O62B 4X23D 4QLCB 3C1CC 3AZKD 5B2JC 5F99C 4G92C 2AROC 5AV9B 1HQ3D 3W96A 3AYWD 3B6GA 3R45B 3MGQC 1P3BB 4J8XA 3C1BD 4E44A 1W2EA 1P3KB 5BNVB 5B32A 5B32G 2IO5C 5DNNA 1ULYA 3EPHA 3C1CB 5BO0B 5B2IC 1P3AA 5B2JB 2XD1A 4H9NA 5F99B 4G92B 1BH9A 2AROB 3AV1D 1P3PA 1N1JA 3AZGD 2W8SA 4M6BA 4WV4B 3WAAD 2F8NG 2BYMA 3MGQB 3FDDA 3MGRC 2F8NA 4KGCD 4WU8A 3LELD 5GT3D 5B0ZD 4H9RA 3KWQC 2IO5B 2JCHA 5GSUC 1BH8A 2DF4C 5GT0A 3REKC 3VH6W 3O62A 2G5IC 4QLCA 2HIOC 3REHB 5GXQD 5AV9A 1P3GD 4EO5C 1HQ3C 4J8XD 3MGRB 1KU5A 4ZBJC 3NQUB 2PYOD 1P3BA 1P3LD 3C1BC 4WNNB 1P3KA 3LJAB 5GSUB 1P3AD 5BNVA 5AV5D 2HIOB 5BO0A 3W99C 3AZKB 5B2JA 5F99A 1Q9CA 1M18A 2AROA 4NE6A 4EO5B 1HQ3B 1B67A 5BT1D 1F66C 4ZBJB 3AZGC 4KGCC 3H0RC 3AZED 3C1BB 3LELC 5CPKC 1PZRA 3REID 3O62D 4J8UC 3W99B 5B2IA 3EPKA 5AV9D 2RVQD 3AV1B 1WWSA 3AZFD 5GXQC 1F66B 1P3GC 3AZGB 1P3BD 3MGRA 4KGCB 1P3KD 3WTPE 3LELB 3X1TC 5CPKB 3NQUA 4UUZB 2PYOC 3KWQA 1P3LC 1A7WA 4WNNA 4J8UB 5GSUA 3REKA 5B2JD 5AV8D 2Y2MA 1M18D 5JA4B 3KFUG 3VH6T 5AV5C 2HIOA 1Z2CB 2RIQA 2BG1A 5CPJD 5GXQB 1P3GB 1HQ3A 2Y2OA 3W98A 4R8PD 3X1TB 1P3IC 5E5AC 3AFAC 2PYOB 1P3LB 4NE5A 3C1BA 3AZEC 3B0BA 3AV2C 3LZ1C 2VQRA 5B2ID 4H9NB 3VH6A 5AVCC 3REIC 1P3OA 4G91B 4AWLC 3AZHD 5AV5B 3W99A 1KX5C 1TZYC 2RVQC 2Y2LA 3MGRD 2L5AA 3W97D 3AZFC 5CHLB 5JRGC 4WU9C 1H3OB 1F66A 4KUDC 3AZGA 3KWQD 4H9RB 5E5AB 3AFAB 3AZNA 4Z66C 5C3IC 3AZEB 3REKD 5CPKA 4UUZA 2UWXA 4CAYA 3LZ1B 3AV2B 4XUJD 5AVCB 4J8UA 3REIB 4AWLB 3KXBC 2HIOD 3LZ0C 5AV8C 5B1MD 1M18C 5JA4A 1B6WA 5CP6D 1TZYB 5B1LC 1BFMA 3W98D 3P5JB 3AZFB 5GXQA 5JRGB 4WU9B 5CPJC 4KUDB 1S32C 1P3GA 5BS7C 2Y2QA 4Z66B 5C3IB 4CSRB 3X1SC 3X1TA 4R8PC 5FUGB 1P3OD 2PYOA 3EPJA 1P3LA 2Y2NA 3KXBB 3W99D 3LZ0B 3AZMC 2JE5A 5AV8B 1M18B 5B33D 3AZHC 5AV5A 5B24D 4XZQC 5B1LB 1F66D 5CPJB 3AZND 2YFWB 3AZJC 3W97C 2HUEC 3X1SB 5CPKD 1H3OA 1P3IA 4R8PB 5E5AA 3AFAA 3REJD 3B0DC 4Z2MH 4E45A 4J8UD 3AZEA 3AV2A 3LZ1A 3AZMB 5B2IB 2G5HC 2YFVA 3A1IA 4XUJC 5AVCA 3REIA 1AOIC 3AZHB 5CPID 4JJNC 4XZQB 5B1MC 1KX5A 3KUYD 1TZYA 5CP6C 3AZJB 3W97B 3W98C 2HUEB 3AZFA 5JRGA 3X1TD 4WU9A 4KUDA 3KWQB 1TAFB 4Z66A 4CSRA 3UTBC 4H9SC 5B31A 3REKB 2ZY3A 5FUGA 3KSYA 1P3OC 4XUJB 2CV5C 1AOIB 3KXBA 3LZ0A 4LD9C 5AV8A 4JJNB 3MGSC 5B1MB 5B33C 3B0CT 5B24C 5B1LA 5CP6B 3UTAA 3AL0C 3W98B 5CPJA 1P3ID 2YFWA 5E5AD 3AFAD 3AZNC 1S32A 5BS7A 1ZLAD 3X1SA 3UTBB 3LZ1D 3AV2D 4R8PA 3REJC 3MGPC 5AVCD 1P3OB 4WZSB 2CV5B 3AZMA 4LD9B 1KX5D 3MGSB 3IP4C 1JFIB 3AZHA 5B33B 5CPIC 1TZYD 5KDMA 5DNMC 5B24B 5B0YC 3A6NC 4XZQA 2F8NK 2NZDC 4UPKA 1R4VA 5JRGD 4WU9D 3KUYC 5AY8C 4KUDD 2NQBC 3AZNB 3AZJA 3TU4A 3VH5T 4Z66D 3W97A 5B31D 4CAYB 1TAFA 3REJB 2CWEA 2FFFB 3KXBD 3LZ0D 5AV6A 1M19A 4XUJA 4DRAA 1AOIA 4KHAB 3A6NB 5CPIB 5B1LD 3UTAD 4JJNA 5B1MA 2NQBB 3KUYB 3VH5A 5B40D 1S32D 5CP6A 4Z5TD 4YM6C 3X1SD 1ZLAC 3UTBA 4H9SA 3AZIC 3AZMD 1P3FA 4J8WC 1P3MD 1ID3C 2CV5A 4LD9A 4XZQD 4WJ3C 3MGSA 1JFIA 4H9PB 5B33A 5B24A 3TU4D 3AZJD 2FJ7A 4YM6B 3WTPC 1P3IB 2ZY4A 1ZLAB 5B31C 5AV6D 1P34C 4J8WB 3REJA 3AN2C 2YFVB 3MGPA 1M19D 2ZY5A 1AOID 4H9QA 4YS3C 4JJND 3B0CW 1EQZC 1KX5B 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N A;  5DNM A;  5CPI A;  2NZD A;  5B0Y A;  3UTA C;  1KX3 D;  3V9R B;  3WTP B;  2NQB A;  3KUY A;  3WKJ D;  5AY8 A;  5B40 C;  4Z5T C;  3UT9 D;  3UTB D;  1P3F D;  1U35 C;  5B31 B;  1P34 B;  3AN2 B;  2CV5 D;  1M1A D;  4LD9 D;  1P3M C;  4YS3 B;  3MGS D;  4NE3 A;  1EQZ B;  3X1U C;  2FJ7 D;  3UTA B;  3AZL D;  3VH5 W;  4H9P A;  3X1V A;  5B40 B;  1S32 B;  3TU4 C;  4YM6 A;  4Z5T B;  3MVD C;  1KX4 A;  3MNN C;  1U35 B;  4J8V D;  3WA9 D;  3MGP D;  5BNX B;  3NQJ B;  1ZLA A;  3AZI A;  1ID3 A;  5AV6 C;  4J8W A;  1P3M B;  1M19 C;  3B6F C;  3A6N D;  5DNM D;  5KDM B;  5B0Y D;  4DRB A;  3X1U B;  2NZD D;  2NQB D;  5AY8 D;  5AVB D;  3REL C;  3TU4 B;  3V9R A;  4ZUX A;  1KX3 C;  3REH C;  2JSS A;  3WTP A;  3MVD B;  3MNN B;  3WKJ C;  3B0D B;  3UT9 C;  1P3F C;  5B31 G;  1P34 A;  5AV6 B;  3AN2 A;  1M19 B;  3LJA C;  1M1A C;  3B6F B;  4H9O B;  4YS3 A;  1EQZ A;  3X1V D;  4X23 C;  3AZK C;  3REL B;  2FJ7 C;  4YM6 D;  3W96 D;  3AZL C;  3B6G D;  5G49 B;  1KX3 B;  1KX4 D;  5B40 A;  3WKJ B;  4Z5T A;  3AYW C;  1WWI A;  4HGA C;  3UT9 B;  3AZI D;  1ID3 D;  1P3F B;  3R45 A;  4J8W D;  1U35 A;  5B32 D;  5BNX A;  4J8V C;  3WA9 C;  2BYK B;  3NQJ A;  5DNN D;  1M1A B;  1P3M A;  4X23 B;  1P3P D;  3X1U A;  3C1C A;  1HTA A;  4Z2M G;  4ZUX D;  2FJ7 B;  3AZL B;  3WTP D;  3AV1 C;  5AVB C;  2F8N D;  4WU8 D;  3MVD A;  3AYW B;  4HGA B;  3MNN A;  1P34 D;  3WAA C;  3MGQ A;  3AN2 D;  4J8V B;  3WA9 B;  3MGP B;  5GT0 D;  5GT3 C;  5B0Z C;  4H9Q B;  4YS3 D;  1EQZ D;  4QLC D;  3B6F A;  4H9O A;  4NFT A;  5DNM B;  2NZD B;  5B0Y B;  3X1V C;  5AY8 B;  5AVB B;  3REL A;  5G49 A;  3W96 C;  1KX3 A;  3REH A;  3B6G C;  1KX4 C;  1U35 D;  3WKJ A;  3WAA B;  4J8X C;  3UT9 A;  1F1E A;  5GT3 B;  5B0Z B;  5B32 C;  2BYK A;  3LJA A;  5DNN C;  3X1U D;  3C1C D;  1M1A A;  5F99 D;  1P3A C;  4G91 C;  2ARO D;  3X1V B;  4X23 A;  1P3P C;  3AZK A;  4ZUX C;  3MVD D;  3AZL A;  3B6G B;  3W96 B;  3MNN D;  1KX4 B;  3MGQ D;  4J8X B;  4WU8 C;  2LY8 A;  3AYW A;  5BT1 C;  3AZI B;  1ID3 B;  4J8V A;  5B32 B;  3WA9 A;  3B6F D;  5DNN B;  5GT0 C;  1P3A B;  2F8N H;  3O62 C;  1BH9 B;  4QLC C;  3REL D;  1P3P B;  3REH D;  4ZUX B;  1N1J B;  5AV9 C;  3AV1 A;  5AVB A;  2F8N B;  2BYM B;  4WU8 B;  3WAA A;  1P3B C;  4KGC A;  3LJA D;  1P3K C;  5GSU D;  3LEL A;  1BH8 B;  5GT0 B;  5GT3 A;  5B0Z A;  3O62 B;  4X23 D;  4QLC B;  3C1C C;  3AZK D;  5B2J C;  5F99 C;  4G92 C;  2ARO C;  5AV9 B;  1HQ3 D;  3W96 A;  3AYW D;  3B6G A;  3R45 B;  3MGQ C;  1P3B B;  4J8X A;  3C1B D;  4E44 A;  1P3K B;  5BNV B;  5B32 A;  5B32 G;  2IO5 C;  5DNN A;  1ULY A;  3C1C B;  5BO0 B;  5B2I C;  1P3A A;  5B2J B;  4H9N A;  5F99 B;  4G92 B;  1BH9 A;  2ARO B;  3AV1 D;  1P3P A;  1N1J A;  3AZG D;  4M6B A;  4WV4 B;  3WAA D;  2F8N G;  2BYM A;  3MGQ B;  3MGR C;  2F8N A;  4KGC D;  4WU8 A;  3LEL D;  5GT3 D;  5B0Z D;  4H9R A;  3KWQ C;  2IO5 B;  5GSU C;  3REK C;  1BH8 A;  5GT0 A;  3VH6 W;  3O62 A;  4QLC A;  2HIO C;  3REH B;  5GXQ D;  5AV9 A;  1P3G D;  4EO5 C;  1HQ3 C;  4J8X D;  3MGR B;  1KU5 A;  4ZBJ C;  3NQU B;  2PYO D;  1P3B A;  1P3L D;  3C1B C;  4WNN B;  1P3K A;  3LJA B;  5GSU B;  1P3A D;  5BNV A;  5AV5 D;  2HIO B;  5BO0 A;  3W99 C;  3AZK B;  5B2J A;  5F99 A;  1Q9C A;  1M18 A;  2ARO A;  4NE6 A;  4EO5 B;  1HQ3 B;  1B67 A;  5BT1 D;  1F66 C;  4ZBJ B;  3AZG C;  4KGC C;  3AZE D;  3C1B B;  3LEL C;  5CPK C;  3REI D;  3O62 D;  4J8U C;  3W99 B;  5B2I A;  5AV9 D;  2RVQ D;  3AV1 B;  1WWS A;  3AZF D;  5GXQ C;  1F66 B;  1P3G C;  3AZG B;  1P3B D;  3MGR A;  4KGC B;  1P3K D;  3WTP E;  3LEL B;  3X1T C;  5CPK B;  3NQU A;  4UUZ B;  2PYO C;  3KWQ A;  1P3L C;  1A7W A;  4WNN A;  4J8U B;  5GSU A;  3REK A;  5B2J D;  5AV8 D;  1M18 D;  5JA4 B;  3VH6 T;  5AV5 C;  2HIO A;  5CPJ D;  5GXQ B;  1P3G B;  1HQ3 A;  3W98 A;  4R8P D;  3X1T B;  1P3I C;  5E5A C;  3AFA C;  2PYO B;  1P3L B;  4NE5 A;  3C1B A;  3AZE C;  3B0B A;  3AV2 C;  3LZ1 C;  5B2I D;  4H9N B;  3VH6 A;  5AVC C;  3REI C;  1P3O A;  4G91 B;  4AWL C;  3AZH D;  5AV5 B;  3W99 A;  1KX5 C;  1TZY C;  2RVQ C;  3MGR D;  2L5A A;  3W97 D;  3AZF C;  5CHL B;  5JRG C;  4WU9 C;  1H3O B;  1F66 A;  4KUD C;  3AZG A;  3KWQ D;  4H9R B;  5E5A B;  3AFA B;  3AZN A;  4Z66 C;  5C3I C;  3AZE B;  3REK D;  5CPK A;  4UUZ A;  3AV2 B;  4CAY A;  3LZ1 B;  4XUJ D;  5AVC B;  4J8U A;  3REI B;  4AWL B;  3KXB C;  2HIO D;  3LZ0 C;  5AV8 C;  5B1M D;  1M18 C;  5JA4 A;  1B6W A;  5CP6 D;  1TZY B;  5B1L C;  1BFM A;  3W98 D;  3AZF B;  5GXQ A;  5JRG B;  4WU9 B;  5CPJ C;  4KUD B;  1S32 C;  1P3G A;  5BS7 C;  4Z66 B;  5C3I B;  4CSR B;  3X1S C;  3X1T A;  4R8P C;  5FUG B;  1P3O D;  2PYO A;  1P3L A;  3KXB B;  3W99 D;  3LZ0 B;  3AZM C;  5AV8 B;  1M18 B;  5B33 D;  3AZH C;  5AV5 A;  5B24 D;  4XZQ C;  5B1L B;  1F66 D;  5CPJ B;  3AZN D;  2YFW B;  3AZJ C;  3W97 C;  2HUE C;  3X1S B;  5CPK D;  1H3O A;  1P3I A;  4R8P B;  5E5A A;  3AFA A;  3REJ D;  3B0D C;  4Z2M H;  4E45 A;  4J8U D;  3AZE A;  3AV2 A;  3LZ1 A;  3AZM B;  5B2I B;  2YFV A;  4XUJ C;  5AVC A;  3REI A;  1AOI C;  3AZH B;  5CPI D;  4JJN C;  4XZQ B;  5B1M C;  1KX5 A;  3KUY D;  1TZY A;  5CP6 C;  3AZJ B;  3W97 B;  3W98 C;  2HUE B;  3AZF A;  5JRG A;  3X1T D;  4WU9 A;  4KUD A;  3KWQ B;  1TAF B;  4Z66 A;  4CSR A;  3UTB C;  4H9S C;  5B31 A;  3REK B;  5FUG A;  3KSY A;  1P3O C;  4XUJ B;  2CV5 C;  1AOI B;  3KXB A;  3LZ0 A;  4LD9 C;  5AV8 A;  4JJN B;  3MGS C;  5B1M B;  5B33 C;  3B0C T;  5B24 C;  5B1L A;  5CP6 B;  3UTA A;  3W98 B;  5CPJ A;  1P3I D;  2YFW A;  5E5A D;  3AFA D;  3AZN C;  1S32 A;  5BS7 A;  1ZLA D;  3X1S A;  3UTB B;  3LZ1 D;  3AV2 D;  4R8P A;  3REJ C;  3MGP C;  5AVC D;  1P3O B;  4WZS B;  2CV5 B;  3AZM A;  4LD9 B;  1KX5 D;  3MGS B;  1JFI B;  3AZH A;  5B33 B;  5CPI C;  1TZY D;  5KDM A;  5DNM C;  5B24 B;  5B0Y C;  3A6N C;  4XZQ A;  2F8N K;  2NZD C;  1R4V A;  5JRG D;  4WU9 D;  3KUY C;  5AY8 C;  4KUD D;  2NQB C;  3AZN B;  3AZJ A;  3TU4 A;  3VH5 T;  4Z66 D;  3W97 A;  5B31 D;  4CAY B;  1TAF A;  3REJ B;  2CWE A;  3KXB D;  3LZ0 D;  5AV6 A;  1M19 A;  4XUJ A;  4DRA A;  1AOI A;  4KHA B;  3A6N B;  5CPI B;  5B1L D;  3UTA D;  4JJN A;  5B1M A;  2NQB B;  3KUY B;  3VH5 A;  5B40 D;  1S32 D;  5CP6 A;  4Z5T D;  4YM6 C;  3X1S D;  1ZLA C;  3UTB A;  4H9S A;  3AZI C;  3AZM D;  1P3F A;  4J8W C;  1P3M D;  1ID3 C;  2CV5 A;  4LD9 A;  4XZQ D;  3MGS A;  1JFI A;  4H9P B;  5B33 A;  5B24 A;  3TU4 D;  3AZJ D;  2FJ7 A;  4YM6 B;  3WTP C;  1P3I B;  1ZLA B;  5B31 C;  5AV6 D;  1P34 C;  4J8W B;  3REJ A;  3AN2 C;  2YFV B;  3MGP A;  1M19 D;  1AOI D;  4H9Q A;  4YS3 C;  4JJN D;  3B0C W;  1EQZ C;  1KX5 B;  4KHA A; 
#chains in the Genus database with same CATH topology
 3A6N A;  5DNM A;  5CPI A;  2NZD A;  5B0Y A;  3UTA C;  1KX3 D;  3V9R B;  3WTP B;  2NQB A;  3KUY A;  3WKJ D;  5AY8 A;  5B40 C;  4Z5T C;  3UT9 D;  3UTB D;  1P3F D;  2Y2G A;  5B31 B;  1U35 C;  1P34 B;  3AN2 B;  2CV5 D;  1M1A D;  4LD9 D;  1P3M C;  4YS3 B;  3MGS D;  4NE3 A;  1EQZ B;  3X1U C;  2FJ7 D;  3UTA B;  3AZL D;  3VH5 W;  4H9P A;  3X1V A;  5B40 B;  1S32 B;  3TU4 C;  4YM6 A;  4Z5T B;  3MVD C;  1KX4 A;  3MNN C;  1U35 B;  4J8V D;  3WA9 D;  3MGP D;  5BNX B;  3NQJ B;  1ZLA A;  3AZI A;  1ID3 A;  5AV6 C;  4J8W A;  1P3M B;  1M19 C;  3B6F C;  3A6N D;  5DNM D;  5KDM B;  5B0Y D;  4DRB A;  3X1U B;  2NZD D;  2NQB D;  5AY8 D;  5AVB D;  2DQN C;  3REL C;  3TU4 B;  3V9R A;  4ZUX A;  1KX3 C;  3REH C;  2JSS A;  3WTP A;  3MVD B;  3MNN B;  3WKJ C;  3B0D B;  3UT9 C;  1P3F C;  1T3U A;  5B31 G;  1P34 A;  5AV6 B;  3AN2 A;  1M19 B;  3LJA C;  1M1A C;  3B6F B;  4H9O B;  4YS3 A;  1EQZ A;  3X1V D;  4X23 C;  3AZK C;  3REL B;  2FJ7 C;  4YM6 D;  3W96 D;  3AZL C;  3B6G D;  5G49 B;  1KX3 B;  1KX4 D;  2XD5 A;  5B40 A;  3WKJ B;  4Z5T A;  3AYW C;  1WWI A;  4HGA C;  3UT9 B;  3AZI D;  2Y2P A;  1P3F B;  3R45 A;  4J8W D;  1U35 A;  5B32 D;  1ID3 D;  5BNX A;  4J8V C;  3WA9 C;  3H0M C;  2BYK B;  3NQJ A;  2ZY2 A;  5DNN D;  1M1A B;  1P3M A;  2Y2J A;  4X23 B;  1P3P D;  3X1U A;  3C1C A;  1HTA A;  4Z2M G;  4ZUX D;  2FJ7 B;  3AZL B;  3WTP D;  3AV1 C;  5AVB C;  2F8N D;  4WU8 D;  3MVD A;  3AYW B;  4HGA B;  3MNN A;  1P34 D;  3WAA C;  3MGQ A;  3AN2 D;  4J8V B;  3WA9 B;  3MGP B;  5GT0 D;  5GT3 C;  5B0Z C;  4H9Q B;  4YS3 D;  1EQZ D;  2ZM5 A;  4QLC D;  3B6F A;  4H9O A;  4NFT A;  5DNM B;  2J8P A;  2NZD B;  5B0Y B;  3X1V C;  5AY8 B;  5AVB B;  3REL A;  3F6T A;  5G49 A;  3W96 C;  4DQY B;  3REH A;  1KX3 A;  2Y2H A;  1KX4 C;  3B6G C;  1U35 D;  3WKJ A;  3WAA B;  4J8X C;  3UT9 A;  1F1E A;  3EPL A;  5GT3 B;  5B0Z B;  5B32 C;  2BYK A;  3LJA A;  5DNN C;  3H0L C;  3X1U D;  3C1C D;  1M1A A;  5F99 D;  1P3A C;  3EG5 B;  4G91 C;  2ARO D;  3X1V B;  4X23 A;  1P3P C;  3AZK A;  4ZUX C;  3MVD D;  3AZL A;  3B6G B;  3W96 B;  3MNN D;  1KX4 B;  2Y2I A;  3MGQ D;  4J8X B;  4WU8 C;  2LY8 A;  3AYW A;  5BT1 C;  3AZI B;  3A1K A;  1ID3 B;  4J8V A;  5B32 B;  3WA9 A;  3B6F D;  5DNN B;  5GT0 C;  1P3A B;  2F8N H;  3O62 C;  1BH9 B;  4QLC C;  3REL D;  1P3P B;  3REH D;  4ZUX B;  1N1J B;  5AV9 C;  3AV1 A;  5AVB A;  2F8N B;  2BYM B;  2F2A C;  4WU8 B;  2Y2K A;  3WAA A;  1P3B C;  4KGC A;  3LJA D;  1P3K C;  5GSU D;  3LEL A;  1BH8 B;  5GT0 B;  5GT3 A;  5B0Z A;  3O62 B;  4X23 D;  4QLC B;  3C1C C;  3AZK D;  5B2J C;  5F99 C;  4G92 C;  2ARO C;  5AV9 B;  1HQ3 D;  3W96 A;  3AYW D;  3B6G A;  3R45 B;  3MGQ C;  1P3B B;  4J8X A;  3C1B D;  4E44 A;  1W2E A;  1P3K B;  5BNV B;  5B32 A;  5B32 G;  2IO5 C;  5DNN A;  1ULY A;  3EPH A;  3C1C B;  5BO0 B;  5B2I C;  1P3A A;  5B2J B;  2XD1 A;  4H9N A;  5F99 B;  4G92 B;  1BH9 A;  2ARO B;  3AV1 D;  1P3P A;  1N1J A;  3AZG D;  2W8S A;  4M6B A;  4WV4 B;  3WAA D;  2F8N G;  2BYM A;  3MGQ B;  3FDD A;  3MGR C;  2F8N A;  4KGC D;  4WU8 A;  3LEL D;  5GT3 D;  5B0Z D;  4H9R A;  3KWQ C;  2IO5 B;  2JCH A;  5GSU C;  1BH8 A;  2DF4 C;  5GT0 A;  3REK C;  3VH6 W;  3O62 A;  2G5I C;  4QLC A;  2HIO C;  3REH B;  5GXQ D;  5AV9 A;  1P3G D;  4EO5 C;  1HQ3 C;  4J8X D;  3MGR B;  1KU5 A;  4ZBJ C;  3NQU B;  2PYO D;  1P3B A;  1P3L D;  3C1B C;  4WNN B;  1P3K A;  3LJA B;  5GSU B;  1P3A D;  5BNV A;  5AV5 D;  2HIO B;  5BO0 A;  3W99 C;  3AZK B;  5B2J A;  5F99 A;  1Q9C A;  1M18 A;  2ARO A;  4NE6 A;  4EO5 B;  1HQ3 B;  1B67 A;  5BT1 D;  1F66 C;  4ZBJ B;  3AZG C;  4KGC C;  3H0R C;  3AZE D;  3C1B B;  3LEL C;  5CPK C;  1PZR A;  3REI D;  3O62 D;  4J8U C;  3W99 B;  5B2I A;  3EPK A;  5AV9 D;  2RVQ D;  3AV1 B;  1WWS A;  3AZF D;  5GXQ C;  1F66 B;  1P3G C;  3AZG B;  1P3B D;  3MGR A;  4KGC B;  1P3K D;  3WTP E;  3LEL B;  3X1T C;  5CPK B;  3NQU A;  4UUZ B;  2PYO C;  3KWQ A;  1P3L C;  1A7W A;  4WNN A;  4J8U B;  5GSU A;  3REK A;  5B2J D;  5AV8 D;  2Y2M A;  1M18 D;  5JA4 B;  3KFU G;  3VH6 T;  5AV5 C;  2HIO A;  1Z2C B;  2RIQ A;  2BG1 A;  5CPJ D;  5GXQ B;  1P3G B;  1HQ3 A;  2Y2O A;  3W98 A;  4R8P D;  3X1T B;  1P3I C;  5E5A C;  3AFA C;  2PYO B;  1P3L B;  4NE5 A;  3C1B A;  3AZE C;  3B0B A;  3AV2 C;  3LZ1 C;  2VQR A;  5B2I D;  4H9N B;  3VH6 A;  5AVC C;  3REI C;  1P3O A;  4G91 B;  4AWL C;  3AZH D;  5AV5 B;  3W99 A;  1KX5 C;  1TZY C;  2RVQ C;  2Y2L A;  3MGR D;  2L5A A;  3W97 D;  3AZF C;  5CHL B;  5JRG C;  4WU9 C;  1H3O B;  1F66 A;  4KUD C;  3AZG A;  3KWQ D;  4H9R B;  5E5A B;  3AFA B;  3AZN A;  4Z66 C;  5C3I C;  3AZE B;  3REK D;  5CPK A;  4UUZ A;  2UWX A;  4CAY A;  3LZ1 B;  3AV2 B;  4XUJ D;  5AVC B;  4J8U A;  3REI B;  4AWL B;  3KXB C;  2HIO D;  3LZ0 C;  5AV8 C;  5B1M D;  1M18 C;  5JA4 A;  1B6W A;  5CP6 D;  1TZY B;  5B1L C;  1BFM A;  3W98 D;  3P5J B;  3AZF B;  5GXQ A;  5JRG B;  4WU9 B;  5CPJ C;  4KUD B;  1S32 C;  1P3G A;  5BS7 C;  2Y2Q A;  4Z66 B;  5C3I B;  4CSR B;  3X1S C;  3X1T A;  4R8P C;  5FUG B;  1P3O D;  2PYO A;  3EPJ A;  1P3L A;  2Y2N A;  3KXB B;  3W99 D;  3LZ0 B;  3AZM C;  2JE5 A;  5AV8 B;  1M18 B;  5B33 D;  3AZH C;  5AV5 A;  5B24 D;  4XZQ C;  5B1L B;  1F66 D;  5CPJ B;  3AZN D;  2YFW B;  3AZJ C;  3W97 C;  2HUE C;  3X1S B;  5CPK D;  1H3O A;  1P3I A;  4R8P B;  5E5A A;  3AFA A;  3REJ D;  3B0D C;  4Z2M H;  4E45 A;  4J8U D;  3AZE A;  3AV2 A;  3LZ1 A;  3AZM B;  5B2I B;  2G5H C;  2YFV A;  3A1I A;  4XUJ C;  5AVC A;  3REI A;  1AOI C;  3AZH B;  5CPI D;  4JJN C;  4XZQ B;  5B1M C;  1KX5 A;  3KUY D;  1TZY A;  5CP6 C;  3AZJ B;  3W97 B;  3W98 C;  2HUE B;  3AZF A;  5JRG A;  3X1T D;  4WU9 A;  4KUD A;  3KWQ B;  1TAF B;  4Z66 A;  4CSR A;  3UTB C;  4H9S C;  5B31 A;  3REK B;  2ZY3 A;  5FUG A;  3KSY A;  1P3O C;  4XUJ B;  2CV5 C;  1AOI B;  3KXB A;  3LZ0 A;  4LD9 C;  5AV8 A;  4JJN B;  3MGS C;  5B1M B;  5B33 C;  3B0C T;  5B24 C;  5B1L A;  5CP6 B;  3UTA A;  3AL0 C;  3W98 B;  5CPJ A;  1P3I D;  2YFW A;  5E5A D;  3AFA D;  3AZN C;  1S32 A;  5BS7 A;  1ZLA D;  3X1S A;  3UTB B;  3LZ1 D;  3AV2 D;  4R8P A;  3REJ C;  3MGP C;  5AVC D;  1P3O B;  4WZS B;  2CV5 B;  3AZM A;  4LD9 B;  1KX5 D;  3MGS B;  3IP4 C;  1JFI B;  3AZH A;  5B33 B;  5CPI C;  1TZY D;  5KDM A;  5DNM C;  5B24 B;  5B0Y C;  3A6N C;  4XZQ A;  2F8N K;  2NZD C;  4UPK A;  1R4V A;  5JRG D;  4WU9 D;  3KUY C;  5AY8 C;  4KUD D;  2NQB C;  3AZN B;  3AZJ A;  3TU4 A;  3VH5 T;  4Z66 D;  3W97 A;  5B31 D;  4CAY B;  1TAF A;  3REJ B;  2CWE A;  2FFF B;  3KXB D;  3LZ0 D;  5AV6 A;  1M19 A;  4XUJ A;  4DRA A;  1AOI A;  4KHA B;  3A6N B;  5CPI B;  5B1L D;  3UTA D;  4JJN A;  5B1M A;  2NQB B;  3KUY B;  3VH5 A;  5B40 D;  1S32 D;  5CP6 A;  4Z5T D;  4YM6 C;  3X1S D;  1ZLA C;  3UTB A;  4H9S A;  3AZI C;  3AZM D;  1P3F A;  4J8W C;  1P3M D;  1ID3 C;  2CV5 A;  4LD9 A;  4XZQ D;  4WJ3 C;  3MGS A;  1JFI A;  4H9P B;  5B33 A;  5B24 A;  3TU4 D;  3AZJ D;  2FJ7 A;  4YM6 B;  3WTP C;  1P3I B;  2ZY4 A;  1ZLA B;  5B31 C;  5AV6 D;  1P34 C;  4J8W B;  3REJ A;  3AN2 C;  2YFV B;  3MGP A;  1M19 D;  2ZY5 A;  1AOI D;  4H9Q A;  4YS3 C;  4JJN D;  3B0C W;  1EQZ C;  1KX5 B;  4KHA A; 
#chains in the Genus database with same CATH homology
 3A6N A;  5DNM A;  5CPI A;  2NZD A;  5B0Y A;  3UTA C;  1KX3 D;  3V9R B;  3WTP B;  2NQB A;  3KUY A;  3WKJ D;  5AY8 A;  5B40 C;  4Z5T C;  3UT9 D;  3UTB D;  1P3F D;  2Y2G A;  5B31 B;  1U35 C;  1P34 B;  3AN2 B;  2CV5 D;  1M1A D;  4LD9 D;  1P3M C;  4YS3 B;  3MGS D;  4NE3 A;  1EQZ B;  3X1U C;  2FJ7 D;  3UTA B;  3AZL D;  3VH5 W;  4H9P A;  3X1V A;  5B40 B;  1S32 B;  3TU4 C;  4YM6 A;  4Z5T B;  3MVD C;  1KX4 A;  3MNN C;  1U35 B;  4J8V D;  3WA9 D;  3MGP D;  5BNX B;  3NQJ B;  1ZLA A;  3AZI A;  1ID3 A;  5AV6 C;  4J8W A;  1P3M B;  1M19 C;  3B6F C;  3A6N D;  5DNM D;  5KDM B;  5B0Y D;  4DRB A;  3X1U B;  2NZD D;  2NQB D;  5AY8 D;  5AVB D;  2DQN C;  3REL C;  3TU4 B;  3V9R A;  4ZUX A;  1KX3 C;  3REH C;  2JSS A;  3WTP A;  3MVD B;  3MNN B;  3WKJ C;  3B0D B;  3UT9 C;  1P3F C;  1T3U A;  5B31 G;  1P34 A;  5AV6 B;  3AN2 A;  1M19 B;  3LJA C;  1M1A C;  3B6F B;  4H9O B;  4YS3 A;  1EQZ A;  3X1V D;  4X23 C;  3AZK C;  3REL B;  2FJ7 C;  4YM6 D;  3W96 D;  3AZL C;  3B6G D;  5G49 B;  1KX3 B;  1KX4 D;  2XD5 A;  5B40 A;  3WKJ B;  4Z5T A;  3AYW C;  1WWI A;  4HGA C;  3UT9 B;  3AZI D;  2Y2P A;  1P3F B;  3R45 A;  4J8W D;  1U35 A;  5B32 D;  1ID3 D;  5BNX A;  4J8V C;  3WA9 C;  3H0M C;  2BYK B;  3NQJ A;  2ZY2 A;  5DNN D;  1M1A B;  1P3M A;  2Y2J A;  4X23 B;  1P3P D;  3X1U A;  3C1C A;  1HTA A;  4Z2M G;  4ZUX D;  2FJ7 B;  3AZL B;  3WTP D;  3AV1 C;  5AVB C;  2F8N D;  4WU8 D;  3MVD A;  3AYW B;  4HGA B;  3MNN A;  1P34 D;  3WAA C;  3MGQ A;  3AN2 D;  4J8V B;  3WA9 B;  3MGP B;  5GT0 D;  5GT3 C;  5B0Z C;  4H9Q B;  4YS3 D;  1EQZ D;  2ZM5 A;  4QLC D;  3B6F A;  4H9O A;  4NFT A;  5DNM B;  2J8P A;  2NZD B;  5B0Y B;  3X1V C;  5AY8 B;  5AVB B;  3REL A;  3F6T A;  5G49 A;  3W96 C;  4DQY B;  3REH A;  1KX3 A;  2Y2H A;  1KX4 C;  3B6G C;  1U35 D;  3WKJ A;  3WAA B;  4J8X C;  3UT9 A;  1F1E A;  3EPL A;  5GT3 B;  5B0Z B;  5B32 C;  2BYK A;  3LJA A;  5DNN C;  3H0L C;  3X1U D;  3C1C D;  1M1A A;  5F99 D;  1P3A C;  3EG5 B;  4G91 C;  2ARO D;  3X1V B;  4X23 A;  1P3P C;  3AZK A;  4ZUX C;  3MVD D;  3AZL A;  3B6G B;  3W96 B;  3MNN D;  1KX4 B;  2Y2I A;  3MGQ D;  4J8X B;  4WU8 C;  2LY8 A;  3AYW A;  5BT1 C;  3AZI B;  3A1K A;  1ID3 B;  4J8V A;  5B32 B;  3WA9 A;  3B6F D;  5DNN B;  5GT0 C;  1P3A B;  2F8N H;  3O62 C;  1BH9 B;  4QLC C;  3REL D;  1P3P B;  3REH D;  4ZUX B;  1N1J B;  5AV9 C;  3AV1 A;  5AVB A;  2F8N B;  2BYM B;  2F2A C;  4WU8 B;  2Y2K A;  3WAA A;  1P3B C;  4KGC A;  3LJA D;  1P3K C;  5GSU D;  3LEL A;  1BH8 B;  5GT0 B;  5GT3 A;  5B0Z A;  3O62 B;  4X23 D;  4QLC B;  3C1C C;  3AZK D;  5B2J C;  5F99 C;  4G92 C;  2ARO C;  5AV9 B;  1HQ3 D;  3W96 A;  3AYW D;  3B6G A;  3R45 B;  3MGQ C;  1P3B B;  4J8X A;  3C1B D;  4E44 A;  1W2E A;  1P3K B;  5BNV B;  5B32 A;  5B32 G;  2IO5 C;  5DNN A;  1ULY A;  3EPH A;  3C1C B;  5BO0 B;  5B2I C;  1P3A A;  5B2J B;  2XD1 A;  4H9N A;  5F99 B;  4G92 B;  1BH9 A;  2ARO B;  3AV1 D;  1P3P A;  1N1J A;  3AZG D;  2W8S A;  4M6B A;  4WV4 B;  3WAA D;  2F8N G;  2BYM A;  3MGQ B;  3FDD A;  3MGR C;  2F8N A;  4KGC D;  4WU8 A;  3LEL D;  5GT3 D;  5B0Z D;  4H9R A;  3KWQ C;  2IO5 B;  2JCH A;  5GSU C;  1BH8 A;  2DF4 C;  5GT0 A;  3REK C;  3VH6 W;  3O62 A;  2G5I C;  4QLC A;  2HIO C;  3REH B;  5GXQ D;  5AV9 A;  1P3G D;  4EO5 C;  1HQ3 C;  4J8X D;  3MGR B;  1KU5 A;  4ZBJ C;  3NQU B;  2PYO D;  1P3B A;  1P3L D;  3C1B C;  4WNN B;  1P3K A;  3LJA B;  5GSU B;  1P3A D;  5BNV A;  5AV5 D;  2HIO B;  5BO0 A;  3W99 C;  3AZK B;  5B2J A;  5F99 A;  1Q9C A;  1M18 A;  2ARO A;  4NE6 A;  4EO5 B;  1HQ3 B;  1B67 A;  5BT1 D;  1F66 C;  4ZBJ B;  3AZG C;  4KGC C;  3H0R C;  3AZE D;  3C1B B;  3LEL C;  5CPK C;  1PZR A;  3REI D;  3O62 D;  4J8U C;  3W99 B;  5B2I A;  3EPK A;  5AV9 D;  2RVQ D;  3AV1 B;  1WWS A;  3AZF D;  5GXQ C;  1F66 B;  1P3G C;  3AZG B;  1P3B D;  3MGR A;  4KGC B;  1P3K D;  3WTP E;  3LEL B;  3X1T C;  5CPK B;  3NQU A;  4UUZ B;  2PYO C;  3KWQ A;  1P3L C;  1A7W A;  4WNN A;  4J8U B;  5GSU A;  3REK A;  5B2J D;  5AV8 D;  2Y2M A;  1M18 D;  5JA4 B;  3KFU G;  3VH6 T;  5AV5 C;  2HIO A;  1Z2C B;  2RIQ A;  2BG1 A;  5CPJ D;  5GXQ B;  1P3G B;  1HQ3 A;  2Y2O A;  3W98 A;  4R8P D;  3X1T B;  1P3I C;  5E5A C;  3AFA C;  2PYO B;  1P3L B;  4NE5 A;  3C1B A;  3AZE C;  3B0B A;  3AV2 C;  3LZ1 C;  2VQR A;  5B2I D;  4H9N B;  3VH6 A;  5AVC C;  3REI C;  1P3O A;  4G91 B;  4AWL C;  3AZH D;  5AV5 B;  3W99 A;  1KX5 C;  1TZY C;  2RVQ C;  2Y2L A;  3MGR D;  2L5A A;  3W97 D;  3AZF C;  5CHL B;  5JRG C;  4WU9 C;  1H3O B;  1F66 A;  4KUD C;  3AZG A;  3KWQ D;  4H9R B;  5E5A B;  3AFA B;  3AZN A;  4Z66 C;  5C3I C;  3AZE B;  3REK D;  5CPK A;  4UUZ A;  2UWX A;  4CAY A;  3LZ1 B;  3AV2 B;  4XUJ D;  5AVC B;  4J8U A;  3REI B;  4AWL B;  3KXB C;  2HIO D;  3LZ0 C;  5AV8 C;  5B1M D;  1M18 C;  5JA4 A;  1B6W A;  5CP6 D;  1TZY B;  5B1L C;  1BFM A;  3W98 D;  3P5J B;  3AZF B;  5GXQ A;  5JRG B;  4WU9 B;  5CPJ C;  4KUD B;  1S32 C;  1P3G A;  5BS7 C;  2Y2Q A;  4Z66 B;  5C3I B;  4CSR B;  3X1S C;  3X1T A;  4R8P C;  5FUG B;  1P3O D;  2PYO A;  3EPJ A;  1P3L A;  2Y2N A;  3KXB B;  3W99 D;  3LZ0 B;  3AZM C;  2JE5 A;  5AV8 B;  1M18 B;  5B33 D;  3AZH C;  5AV5 A;  5B24 D;  4XZQ C;  5B1L B;  1F66 D;  5CPJ B;  3AZN D;  2YFW B;  3AZJ C;  3W97 C;  2HUE C;  3X1S B;  5CPK D;  1H3O A;  1P3I A;  4R8P B;  5E5A A;  3AFA A;  3REJ D;  3B0D C;  4Z2M H;  4E45 A;  4J8U D;  3AZE A;  3AV2 A;  3LZ1 A;  3AZM B;  5B2I B;  2G5H C;  2YFV A;  3A1I A;  4XUJ C;  5AVC A;  3REI A;  1AOI C;  3AZH B;  5CPI D;  4JJN C;  4XZQ B;  5B1M C;  1KX5 A;  3KUY D;  1TZY A;  5CP6 C;  3AZJ B;  3W97 B;  3W98 C;  2HUE B;  3AZF A;  5JRG A;  3X1T D;  4WU9 A;  4KUD A;  3KWQ B;  1TAF B;  4Z66 A;  4CSR A;  3UTB C;  4H9S C;  5B31 A;  3REK B;  2ZY3 A;  5FUG A;  3KSY A;  1P3O C;  4XUJ B;  2CV5 C;  1AOI B;  3KXB A;  3LZ0 A;  4LD9 C;  5AV8 A;  4JJN B;  3MGS C;  5B1M B;  5B33 C;  3B0C T;  5B24 C;  5B1L A;  5CP6 B;  3UTA A;  3AL0 C;  3W98 B;  5CPJ A;  1P3I D;  2YFW A;  5E5A D;  3AFA D;  3AZN C;  1S32 A;  5BS7 A;  1ZLA D;  3X1S A;  3UTB B;  3LZ1 D;  3AV2 D;  4R8P A;  3REJ C;  3MGP C;  5AVC D;  1P3O B;  4WZS B;  2CV5 B;  3AZM A;  4LD9 B;  1KX5 D;  3MGS B;  3IP4 C;  1JFI B;  3AZH A;  5B33 B;  5CPI C;  1TZY D;  5KDM A;  5DNM C;  5B24 B;  5B0Y C;  3A6N C;  4XZQ A;  2F8N K;  2NZD C;  4UPK A;  1R4V A;  5JRG D;  4WU9 D;  3KUY C;  5AY8 C;  4KUD D;  2NQB C;  3AZN B;  3AZJ A;  3TU4 A;  3VH5 T;  4Z66 D;  3W97 A;  5B31 D;  4CAY B;  1TAF A;  3REJ B;  2CWE A;  2FFF B;  3KXB D;  3LZ0 D;  5AV6 A;  1M19 A;  4XUJ A;  4DRA A;  1AOI A;  4KHA B;  3A6N B;  5CPI B;  5B1L D;  3UTA D;  4JJN A;  5B1M A;  2NQB B;  3KUY B;  3VH5 A;  5B40 D;  1S32 D;  5CP6 A;  4Z5T D;  4YM6 C;  3X1S D;  1ZLA C;  3UTB A;  4H9S A;  3AZI C;  3AZM D;  1P3F A;  4J8W C;  1P3M D;  1ID3 C;  2CV5 A;  4LD9 A;  4XZQ D;  4WJ3 C;  3MGS A;  1JFI A;  4H9P B;  5B33 A;  5B24 A;  3TU4 D;  3AZJ D;  2FJ7 A;  4YM6 B;  3WTP C;  1P3I B;  2ZY4 A;  1ZLA B;  5B31 C;  5AV6 D;  1P34 C;  4J8W B;  3REJ A;  3AN2 C;  2YFV B;  3MGP A;  1M19 D;  2ZY5 A;  1AOI D;  4H9Q A;  4YS3 C;  4JJN D;  3B0C W;  1EQZ C;  1KX5 B;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...