1BH9A

Htafii18/htafii28 heterodimer crystal structure with bound pcmbs
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation complex
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh9A00
5JRGA 5AV8A 5CPJA 1TZYB 2NZDD 4J8WD 1EQZA 1P3IB 2F8NK 1P3KC 4XZQC 5AV9A 5GT0D 1H3OA 3C1CC 5AVBB 4H9OB 5B2IC 3AZEA 5B2JD 4J8VD 3AZLA 5F99D 5G49A 5GT0C 4LD9D 3MGRC 3O62B 4WU8B 3X1SD 3REHB 4Z5TC 2JSSA 4ZBJC 3AFAB 5E5AD 3MGPB 1M18A 3X1UC 4WU9D 4J8UD 3W98C 5B32D 2BYMA 2YFWA 4DRBA 2HUEB 3AZJC 3B6FA 4AWLB 3LJAC 1P3BA 1P3GD 1KX5A 1P3AB 3W99A 1ZLAC 3UT9C 4ZUXB 3UTBD 3NQUB 5BT1C 3UTAC 3MGQB 1S32C 4KUDC 2L5AA 3X1VD 4YS3B 5B1LC 4JJND 3AZGB 1P3OB 1KX4A 5CHLB 5AVCA 5GT3C 3RELD 2HIOC 1P34B 1U35A 4J8XD 3AZKD 5B40B 3AZHC 5JA4B 4WNNB 4WV4B 3AYWA 5AY8D 3REKA 3B6GB 5B24B 3REIA 3WTPC 2F8NG 3R45A 5CP6D 5CPKB 1A7WA 3VH6W 4R8PB 5BO0B 4XUJB 3AZND 3LZ1C 4Z66A 2LY8A 4X23C 3KWQB 2AROC 3AV2C 1EQZD 1BH8B 4H9NA 1ULYA 3WKJB 5JRGC 5BNVB 5AV8C 5CPJC 4G92B 3MGSB 3W97A 3AZLD 5AV9C 1JFIA 4XZQA 4CSRB 3A6NB 3REJD 4HGAB 3AZFB 4DRAA 3AZEC 2PYOB 1P3FA 5B2IA 1P3LC 1M18D 5AV6B 4E44A 5B1MB 3VH5A 1M19B 1ID3D 3WTPE 5B0YD 3B6FD 2FJ7A 5KDMB 3VH5T 4J8WB 3W98A 5B31G 1P3BD 1KX5D 3NQJA 5DNNA 3MNNC 3AZJA 3W99D 1M1AA 2CV5D 1F66A 3AFAC 5F99B 4LD9B 2BYKA 4NE3A 3X1SB 5B0ZA 4J8UB 4WU9B 5B32B 3C1BC 4YM6A 5B33B 5AVCD 3UTAA 4H9RB 3WA9D 4KUDA 3AV1C 1HQ3C 3WAAA 3TU4A 5B1LA 1P3AC 1KX4C 1P3GB 3AYWD 3W96A 3LELD 2IO5C 5CPIA 3AZMA 1U35C 1P3PA 4ZUXC 5B31A 3AZHA 4G91C 3REKC 3UTBB 1Q9CA 1B6WA 3REIC 3WTPA 3VH6A 3AZIA 3X1VB 4UUZB 4JJNB 4Z66C 4NE5A 5DNMC 1P34C 3X1TB 3VH6T 4X23A 5GSUC 2AROA 4QLCB 1P3KD 4KGCC 3RELB 4XZQD 5BNXA 4Z2MH 1KX3A 5FUGB 3C1CD 4J8XB 3AZKB 1HTAA 5GXQC 5B2ID 1AOIA 3W97C 5AY8B 1KU5A 3MGRD 4XUJC 5AV5A 5CP6B 4Z5TD 3LZ0A 1P3FC 1TAFB 2FJ7D 1P3LA 3AZNB 1EQZB 3X1UD 4NFTA 3W98D 1TZYA 2FJ7C 3AZJD 3KUYC 3A6NC 3LJAD 5AVBA 4H9OA 5G49B 5DNNC 3REJB 4EO5B 3MNNA 1M1AC 3KXBB 3O62A 4WU8A 1F66C 3REHA 2NQBB 3AFAA 1ZLAD 1ID3B 3MGPA 3UT9D 5BT1D 3UTAD 5B0ZC 5B0YB 1S32D 4KUDD 3B6FB 1P3MB 5C3IB 4YM6C 3B0CT 3C1BA 5B1LD 4E45A 1P3BB 1KX5B 5GT3D 3AV1A 1HQ3A 2HIOD 3WAAC 3TU4C 3W99B 2CV5B 1WWIA 3AZHD 1P3AA 3W96C 1N1JB 3V9RB 5CPIC 3AZMC 1P3PC 5B33C 3WTPD 4ZUXA 3NQUA 5B31C 3MGQA 3B0BA 3LZ1D 4X23D 5AVCB 2AROD 3AV2D 3WA9B 4YS3A 3AZIC 1P3OA 5JRGD 5AV8D 5CPJD 1F1EA 5DNMA 1P34A 5GSUA 5AV9D 5B40A 3LELB 4KGCA 1BFMA 1KX3C 5JA4A 4WNNA 3AN2B 3AZED 1AOIC 3B6GA 5GXQA 1P3LD 3MVDB 4H9NB 4R8PA 5BO0A 5AV5C 4XUJA 3LZ0C 1BH8A 3WKJA 4H9QB 1P3KB 1R4VA 1TZYC 1BH9B 1P3IC 3C1CB 2RVQC 5B32G 3MNND 2NZDB 5B2IB 4CSRA 3A6NA 5AVBC 3KUYA 3AFAD 5GT0B 2F8NA 3MGRB 2PYOA 3B0DB 3MGPD 4Z5TB 3O62C 4WU8C 3REHC 5B2JB 4J8VB 3X1UB 3W98B 3C1BD 3MGPC 5KDMA 5E5AB 3AV1D 1HQ3D 2YFVA 3LJAB 2HUEC 4EO5C 4AWLC 1P3AD 1KX4D 3KXBC 4KHAB 4H9SC 3X1SA 1U35D 4ZUXD 1ZLAB 1B67A 3UT9B 3REKD 1P3MC 4J8UA 4WU9A 3REID 1S32B 5B33A 3MGQC 4H9RA 5B1LB 4Z66D 5DNMD 4CAYB 1P34D 5GSUD 5GT3B 4YS3C 4KGCD 3AZGC 1P3OC 2HIOB 1P3GA 4H9PB 5GXQD 3W97D 5B40C 3WTPB 4XUJD 3B6GC 5B24C 1P3FD 5CPKC 3LZ1B 4X23B 4WZSB 4R8PC 3AV2B 3X1VA 5BNXB 3KWQC 2F8NH 5JRGB 3X1TA 5AV8B 4QLCA 5CPJB 3RELA 3WKJC 3KUYD 3A6ND 5FUGA 3AZKA 5AV9B 3AN2C 4G92C 2F8ND 3MGSC 1H3OB 1P3IA 5DNND 5AY8A 3MVDC 3AZEB 1M1AD 1P3LB 3AZLB 4HGAC 3AZFC 1F66D 2PYOC 1TAFA 5AV6C 3AZNA 5B1MC 1M19C 5B0ZD 1M18B 4YM6D 2NZDC 4J8WC 2BYMB 2YFWB 3MNNB 3WAAD 3TU4D 3B0DC 3REJA 3VH5W 3KXBA 5B2JC 4J8VC 3W96D 5F99C 2NQBA 4LD9C 5CPID 3AZMD 3X1SC 4H9SA 5B33D 1P3PD 1ID3A 5B31D 5E5AC 3C1BB 5B0YA 4J8UC 4WU9C 1P3MA 5B32C 3AV1B 1HQ3B 3AZID 3KSYA 1KX4B 2CV5A 3AZGA 1KX3D 2IO5B 1P3GC 1U35B 1N1JA 3V9RA 1AOID 3AYWB 4G91B 3REKB 3REIB 3R45B 5AV5D 3UTBC 3LZ0D 3X1TD 4QLCD 5B24A 3WA9A 4Z2MG 4Z66B 5CPKA 5DNMB 3X1VC 5GSUB 4JJNC 1WWSA 4KGCB 1TZYD 3X1TC 3KWQA 1P3ID 4QLCC 3RELC 2RVQD 3LELA 5GXQB 3W97B 5BNVA 5BS7C 5AVBD 4J8XC 3AZKC 1JFIB 4XZQB 3AN2A 3MGSA 5AY8C 1P3FB 3MVDA 3O62D 4M6BA 4WU8D 3REHD 5CP6C 3AZFA 3AZNC 1EQZC 5AV6A 4H9QA 4ZBJB 5B1MA 1P3KA 1M19A 2FJ7B 1BH9A 3KUYB 3C1CA 2F8NB 2NZDA 4J8WA 3KXBD 3NQJB 3AZLC 5DNNB 2NQBD 3AZJB 5GT0A 3MGRA 1M1AB 3REJC 1F66B 4Z5TA 2BYKB 1M18C 5B2JA 4J8VA 1P3MD 3X1UA 5F99A 4LD9A 2NQBC 5B0ZB 1ID3C 2YFVB 5B0YC 4YM6B 3MGQD 5E5AA 3B6FC 5C3IC 5B32A 3LJAA 3UTAB 4YS3D 4KUDB 1P3BC 3AZGD 1P3OD 3WAAB 3TU4B 1KX5C 4KHAA 3W99C 3B0CW 2CV5C 4NE6A 3W96B 5B40D 5CPIB 3AZMB 1P3PB 1ZLAA 3UT9A 5B31B 3B6GD 3AZHB 5B24D 1S32A 5CPKD 4R8PD 3UTBA 3AZIB 3KWQD 5AVCC 4CAYA 3WA9C 5GT3A 2HIOA 3WKJD 2AROB 4H9PA 4UUZA 4JJNA 3AN2D 1KX3B 3MGSD 2CWEA 3AYWC 3LELC 3MVDD 1AOIB 3AZFD 5BS7A 4J8XA 2PYOD 5AV5B 5AV6D 3LZ0B 3LZ1A 5B1MD 1M19D 3AV2A 5CP6A
chains in the Genus database with same CATH superfamily
5JRGA 5AV8A 5CPJA 1TZYB 2NZDD 4J8WD 1EQZA 4UPKA 1P3IB 1P3KC 2F8NK 4XZQC 5AV9A 5GT0D 1H3OA 2ZY4A 2Y2MA 3C1CC 5AVBB 4H9OB 5B2IC 3AZEA 5B2JD 4J8VD 3AZLA 2ZY3A 5G49A 5F99D 5GT0C 3MGRC 4LD9D 3O62B 4WU8B 3X1SD 3REHB 4Z5TC 2JSSA 4ZBJC 3AFAB 5E5AD 3MGPB 1M18A 3X1UC 4WU9D 4J8UD 3W98C 5B32D 2BYMA 2YFWA 4DRBA 2HUEB 3AZJC 3B6FA 4AWLB 3LJAC 2G5HC 1P3BA 1P3GD 1KX5A 1P3AB 3W99A 1ZLAC 3UT9C 4ZUXB 3UTBD 3NQUB 5BT1C 3UTAC 3MGQB 1S32C 4KUDC 2L5AA 2Y2GA 3X1VD 4YS3B 5B1LC 4JJND 3AZGB 1P3OB 1KX4A 5CHLB 5AVCA 5GT3C 3RELD 2HIOC 1P34B 1U35A 4J8XD 3AZKD 5B40B 3AZHC 5JA4B 4WNNB 3EPHA 2Y2PA 4WV4B 3AYWA 5AY8D 3REKA 3B6GB 3KFUG 5B24B 3REIA 3WTPC 2F8NG 3R45A 5CP6D 5CPKB 1A7WA 3VH6W 4R8PB 2J8PA 5BO0B 4XUJB 3AZND 3LZ1C 4Z66A 2LY8A 4X23C 3KWQB 2AROC 3AV2C 1EQZD 1BH8B 4H9NA 1ULYA 3WKJB 5JRGC 5BNVB 5AV8C 5CPJC 1W2EA 4G92B 3MGSB 3W97A 3A1IA 3AZLD 5AV9C 2Y2NA 1JFIA 4XZQA 4CSRB 3A6NB 3REJD 4HGAB 3AZFB 4DRAA 3AZEC 2PYOB 1P3FA 5B2IA 1P3LC 1M18D 5AV6B 4E44A 5B1MB 3VH5A 1M19B 1ID3D 3WTPE 2XD1A 5B0YD 3B6FD 2FJ7A 5KDMB 3VH5T 4J8WB 3W98A 5B31G 1P3BD 1KX5D 3NQJA 5DNNA 3MNNC 3AZJA 3W99D 1M1AA 2CV5D 1F66A 3AFAC 5F99B 4LD9B 2BYKA 4NE3A 3X1SB 5B0ZA 4J8UB 4WU9B 5B32B 3C1BC 4YM6A 5B33B 5AVCD 3UTAA 4H9RB 3WA9D 4KUDA 3AV1C 1HQ3C 3WAAA 3TU4A 5B1LA 1P3AC 1KX4C 1P3GB 3AYWD 3W96A 3LELD 2IO5C 5CPIA 3AZMA 1U35C 1P3PA 4ZUXC 5B31A 3AZHA 4G91C 3REKC 3UTBB 1Q9CA 2UWXA 1B6WA 3REIC 3WTPA 3VH6A 3AZIA 3X1VB 4UUZB 3EG5B 4JJNB 4Z66C 4NE5A 5DNMC 1P34C 3X1TB 3VH6T 4X23A 5GSUC 2AROA 4QLCB 1P3KD 4KGCC 3RELB 4XZQD 2JCHA 5BNXA 4Z2MH 1KX3A 5FUGB 3C1CD 4J8XB 3AZKB 1HTAA 5GXQC 5B2ID 1AOIA 3W97C 5AY8B 1KU5A 3MGRD 2VQRA 4XUJC 5AV5A 5CP6B 4Z5TD 3LZ0A 1P3FC 1TAFB 2FJ7D 1P3LA 3AZNB 1EQZB 3X1UD 4NFTA 3W98D 2JE5A 2W8SA 1TZYA 2FJ7C 3AZJD 3KUYC 3A6NC 3LJAD 5AVBA 4H9OA 5G49B 2FFFB 5DNNC 4DQYB 3REJB 4EO5B 3MNNA 1M1AC 3KXBB 3O62A 4WU8A 1F66C 3REHA 2NQBB 3AFAA 1ZLAD 1ID3B 3MGPA 3UT9D 5BT1D 3UTAD 5B0ZC 5B0YB 1S32D 4KUDD 3B6FB 3H0MC 5C3IB 1P3MB 4YM6C 3B0CT 3C1BA 5B1LD 4E45A 1P3BB 1KX5B 5GT3D 3AV1A 1HQ3A 2HIOD 2Y2LA 3WAAC 3TU4C 3W99B 2Y2JA 2CV5B 1WWIA 3AZHD 1P3AA 3W96C 1N1JB 3V9RB 5CPIC 3AZMC 1P3PC 5B33C 3WTPD 1PZRA 4ZUXA 3NQUA 5B31C 3MGQA 3B0BA 3EPKA 3LZ1D 4X23D 5AVCB 2AROD 3AV2D 3WA9B 4YS3A 3AZIC 1P3OA 5JRGD 5AV8D 5CPJD 1F1EA 5DNMA 1P34A 5GSUA 5AV9D 5B40A 3LELB 4KGCA 1BFMA 1KX3C 5JA4A 4WNNA 3AN2B 3AZED 1AOIC 3B6GA 5GXQA 1P3LD 3MVDB 4H9NB 4R8PA 5BO0A 5AV5C 4XUJA 3LZ0C 1BH8A 3H0LC 3WKJA 4H9QB 1P3KB 1R4VA 2ZY5A 1TZYC 1BH9B 1P3IC 3H0RC 3C1CB 2RVQC 3P5JB 5B32G 3MNND 2NZDB 5B2IB 4CSRA 3A6NA 5AVBC 3KUYA 3AFAD 5GT0B 2F8NA 3MGRB 2PYOA 3B0DB 3MGPD 2BG1A 4Z5TB 3O62C 4WU8C 3REHC 5B2JB 4J8VB 3X1UB 3W98B 3C1BD 3MGPC 5KDMA 5E5AB 3AV1D 1HQ3D 2YFVA 3LJAB 2HUEC 4EO5C 4AWLC 1P3AD 1KX4D 3KXBC 1T3UA 2Y2HA 4KHAB 4H9SC 3X1SA 1U35D 4ZUXD 1ZLAB 1B67A 3UT9B 3REKD 1P3MC 4J8UA 4WU9A 3REID 1S32B 5B33A 1Z2CB 3MGQC 4H9RA 5B1LB 4Z66D 5DNMD 4CAYB 1P34D 5GSUD 5GT3B 4YS3C 2RIQA 4KGCD 3AZGC 1P3OC 2HIOB 1P3GA 4H9PB 5GXQD 3W97D 5B40C 2DF4C 3WTPB 4XUJD 3B6GC 5B24C 1P3FD 4WJ3C 5CPKC 3LZ1B 4X23B 4WZSB 2ZM5A 4R8PC 3AV2B 3X1VA 5BNXB 3KWQC 2F8NH 5JRGB 3X1TA 5AV8B 4QLCA 5CPJB 3RELA 3WKJC 3KUYD 3A6ND 5FUGA 3AZKA 5AV9B 3AN2C 4G92C 2F8ND 3MGSC 1H3OB 1P3IA 5DNND 5AY8A 3MVDC 3AZEB 1M1AD 2DQNC 1P3LB 3AZLB 4HGAC 3AZFC 1F66D 2PYOC 1TAFA 5AV6C 3AZNA 5B1MC 1M19C 5B0ZD 1M18B 2Y2OA 4YM6D 3FDDA 2NZDC 4J8WC 2BYMB 2YFWB 3MNNB 3WAAD 3TU4D 3B0DC 3REJA 3VH5W 3KXBA 2Y2KA 5B2JC 4J8VC 3W96D 5F99C 2NQBA 4LD9C 5CPID 3AZMD 3X1SC 4H9SA 5B33D 1P3PD 1ID3A 5B31D 5E5AC 3C1BB 5B0YA 2G5IC 4J8UC 4WU9C 5B32C 1P3MA 3AV1B 1HQ3B 3AZID 3KSYA 1KX4B 2CV5A 2XD5A 3AZGA 1KX3D 2IO5B 1P3GC 1U35B 1N1JA 3V9RA 1AOID 3AYWB 4G91B 3REKB 3REIB 3R45B 5AV5D 3UTBC 3LZ0D 3X1TD 4QLCD 3AL0C 5B24A 3WA9A 4Z2MG 3EPLA 4Z66B 5CPKA 5DNMB 3X1VC 5GSUB 4JJNC 1WWSA 4KGCB 1TZYD 3X1TC 3KWQA 1P3ID 4QLCC 3RELC 2RVQD 3LELA 5GXQB 3W97B 5BNVA 5BS7C 5AVBD 4J8XC 3AZKC 1JFIB 4XZQB 3IP4C 3AN2A 3MGSA 5AY8C 1P3FB 3MVDA 3O62D 4M6BA 4WU8D 3REHD 5CP6C 3AZFA 2F2AC 3AZNC 1EQZC 5AV6A 4H9QA 4ZBJB 5B1MA 1P3KA 1M19A 2FJ7B 1BH9A 3KUYB 3C1CA 2F8NB 2NZDA 4J8WA 3KXBD 3NQJB 3AZLC 5DNNB 2NQBD 3AZJB 5GT0A 3MGRA 1M1AB 3REJC 1F66B 4Z5TA 2BYKB 1M18C 5B2JA 4J8VA 1P3MD 3X1UA 5F99A 4LD9A 2NQBC 3F6TA 5B0ZB 1ID3C 2YFVB 5B0YC 4YM6B 3MGQD 5E5AA 3B6FC 5C3IC 5B32A 3LJAA 3UTAB 4YS3D 4KUDB 1P3BC 3AZGD 1P3OD 3WAAB 3TU4B 1KX5C 4KHAA 3W99C 3EPJA 3B0CW 2CV5C 4NE6A 2Y2IA 3W96B 5B40D 5CPIB 3AZMB 1P3PB 1ZLAA 3UT9A 5B31B 3B6GD 2ZY2A 3AZHB 5B24D 1S32A 5CPKD 2Y2QA 4R8PD 3UTBA 3AZIB 3KWQD 5AVCC 4CAYA 3WA9C 5GT3A 2HIOA 3WKJD 2AROB 4H9PA 4UUZA 4JJNA 3AN2D 1KX3B 3MGSD 2CWEA 3AYWC 3LELC 3MVDD 1AOIB 3AZFD 5BS7A 4J8XA 2PYOD 5AV5B 5AV6D 3LZ0B 3LZ1A 5B1MD 1M19D 3AV2A 3A1KA 5CP6A
chains in the Genus database with same CATH topology
5JRGA 5AV8A 5CPJA 1TZYB 2NZDD 4J8WD 1EQZA 4UPKA 1P3IB 1P3KC 2F8NK 4XZQC 5AV9A 5GT0D 1H3OA 2ZY4A 2Y2MA 3C1CC 5AVBB 4H9OB 5B2IC 3AZEA 5B2JD 4J8VD 3AZLA 2ZY3A 5G49A 5F99D 5GT0C 3MGRC 4LD9D 3O62B 4WU8B 3X1SD 3REHB 4Z5TC 2JSSA 4ZBJC 3AFAB 5E5AD 3MGPB 1M18A 3X1UC 4WU9D 4J8UD 3W98C 5B32D 2BYMA 2YFWA 4DRBA 2HUEB 3AZJC 3B6FA 4AWLB 3LJAC 2G5HC 1P3BA 1P3GD 1KX5A 1P3AB 3W99A 1ZLAC 3UT9C 4ZUXB 3UTBD 3NQUB 5BT1C 3UTAC 3MGQB 1S32C 4KUDC 2L5AA 2Y2GA 3X1VD 4YS3B 5B1LC 4JJND 3AZGB 1P3OB 1KX4A 5CHLB 5AVCA 5GT3C 3RELD 2HIOC 1P34B 1U35A 4J8XD 3AZKD 5B40B 3AZHC 5JA4B 4WNNB 3EPHA 2Y2PA 4WV4B 3AYWA 5AY8D 3REKA 3B6GB 3KFUG 5B24B 3REIA 3WTPC 2F8NG 3R45A 5CP6D 5CPKB 1A7WA 3VH6W 4R8PB 2J8PA 5BO0B 4XUJB 3AZND 3LZ1C 4Z66A 2LY8A 4X23C 3KWQB 2AROC 3AV2C 1EQZD 1BH8B 4H9NA 1ULYA 3WKJB 5JRGC 5BNVB 5AV8C 5CPJC 1W2EA 4G92B 3MGSB 3W97A 3A1IA 3AZLD 5AV9C 2Y2NA 1JFIA 4XZQA 4CSRB 3A6NB 3REJD 4HGAB 3AZFB 4DRAA 3AZEC 2PYOB 1P3FA 5B2IA 1P3LC 1M18D 5AV6B 4E44A 5B1MB 3VH5A 1M19B 1ID3D 3WTPE 2XD1A 5B0YD 3B6FD 2FJ7A 5KDMB 3VH5T 4J8WB 3W98A 5B31G 1P3BD 1KX5D 3NQJA 5DNNA 3MNNC 3AZJA 3W99D 1M1AA 2CV5D 1F66A 3AFAC 5F99B 4LD9B 2BYKA 4NE3A 3X1SB 5B0ZA 4J8UB 4WU9B 5B32B 3C1BC 4YM6A 5B33B 5AVCD 3UTAA 4H9RB 3WA9D 4KUDA 3AV1C 1HQ3C 3WAAA 3TU4A 5B1LA 1P3AC 1KX4C 1P3GB 3AYWD 3W96A 3LELD 2IO5C 5CPIA 3AZMA 1U35C 1P3PA 4ZUXC 5B31A 3AZHA 4G91C 3REKC 3UTBB 1Q9CA 2UWXA 1B6WA 3REIC 3WTPA 3VH6A 3AZIA 3X1VB 4UUZB 3EG5B 4JJNB 4Z66C 4NE5A 5DNMC 1P34C 3X1TB 3VH6T 4X23A 5GSUC 2AROA 4QLCB 1P3KD 4KGCC 3RELB 4XZQD 2JCHA 5BNXA 4Z2MH 1KX3A 5FUGB 3C1CD 4J8XB 3AZKB 1HTAA 5GXQC 5B2ID 1AOIA 3W97C 5AY8B 1KU5A 3MGRD 2VQRA 4XUJC 5AV5A 5CP6B 4Z5TD 3LZ0A 1P3FC 1TAFB 2FJ7D 1P3LA 3AZNB 1EQZB 3X1UD 4NFTA 3W98D 2JE5A 2W8SA 1TZYA 2FJ7C 3AZJD 3KUYC 3A6NC 3LJAD 5AVBA 4H9OA 5G49B 2FFFB 5DNNC 4DQYB 3REJB 4EO5B 3MNNA 1M1AC 3KXBB 3O62A 4WU8A 1F66C 3REHA 2NQBB 3AFAA 1ZLAD 1ID3B 3MGPA 3UT9D 5BT1D 3UTAD 5B0ZC 5B0YB 1S32D 4KUDD 3B6FB 3H0MC 5C3IB 1P3MB 4YM6C 3B0CT 3C1BA 5B1LD 4E45A 1P3BB 1KX5B 5GT3D 3AV1A 1HQ3A 2HIOD 2Y2LA 3WAAC 3TU4C 3W99B 2Y2JA 2CV5B 1WWIA 3AZHD 1P3AA 3W96C 1N1JB 3V9RB 5CPIC 3AZMC 1P3PC 5B33C 3WTPD 1PZRA 4ZUXA 3NQUA 5B31C 3MGQA 3B0BA 3EPKA 3LZ1D 4X23D 5AVCB 2AROD 3AV2D 3WA9B 4YS3A 3AZIC 1P3OA 5JRGD 5AV8D 5CPJD 1F1EA 5DNMA 1P34A 5GSUA 5AV9D 5B40A 3LELB 4KGCA 1BFMA 1KX3C 5JA4A 4WNNA 3AN2B 3AZED 1AOIC 3B6GA 5GXQA 1P3LD 3MVDB 4H9NB 4R8PA 5BO0A 5AV5C 4XUJA 3LZ0C 1BH8A 3H0LC 3WKJA 4H9QB 1P3KB 1R4VA 2ZY5A 1TZYC 1BH9B 1P3IC 3H0RC 3C1CB 2RVQC 3P5JB 5B32G 3MNND 2NZDB 5B2IB 4CSRA 3A6NA 5AVBC 3KUYA 3AFAD 5GT0B 2F8NA 3MGRB 2PYOA 3B0DB 3MGPD 2BG1A 4Z5TB 3O62C 4WU8C 3REHC 5B2JB 4J8VB 3X1UB 3W98B 3C1BD 3MGPC 5KDMA 5E5AB 3AV1D 1HQ3D 2YFVA 3LJAB 2HUEC 4EO5C 4AWLC 1P3AD 1KX4D 3KXBC 1T3UA 2Y2HA 4KHAB 4H9SC 3X1SA 1U35D 4ZUXD 1ZLAB 1B67A 3UT9B 3REKD 1P3MC 4J8UA 4WU9A 3REID 1S32B 5B33A 1Z2CB 3MGQC 4H9RA 5B1LB 4Z66D 5DNMD 4CAYB 1P34D 5GSUD 5GT3B 4YS3C 2RIQA 4KGCD 3AZGC 1P3OC 2HIOB 1P3GA 4H9PB 5GXQD 3W97D 5B40C 2DF4C 3WTPB 4XUJD 3B6GC 5B24C 1P3FD 4WJ3C 5CPKC 3LZ1B 4X23B 4WZSB 2ZM5A 4R8PC 3AV2B 3X1VA 5BNXB 3KWQC 2F8NH 5JRGB 3X1TA 5AV8B 4QLCA 5CPJB 3RELA 3WKJC 3KUYD 3A6ND 5FUGA 3AZKA 5AV9B 3AN2C 4G92C 2F8ND 3MGSC 1H3OB 1P3IA 5DNND 5AY8A 3MVDC 3AZEB 1M1AD 2DQNC 1P3LB 3AZLB 4HGAC 3AZFC 1F66D 2PYOC 1TAFA 5AV6C 3AZNA 5B1MC 1M19C 5B0ZD 1M18B 2Y2OA 4YM6D 3FDDA 2NZDC 4J8WC 2BYMB 2YFWB 3MNNB 3WAAD 3TU4D 3B0DC 3REJA 3VH5W 3KXBA 2Y2KA 5B2JC 4J8VC 3W96D 5F99C 2NQBA 4LD9C 5CPID 3AZMD 3X1SC 4H9SA 5B33D 1P3PD 1ID3A 5B31D 5E5AC 3C1BB 5B0YA 2G5IC 4J8UC 4WU9C 5B32C 1P3MA 3AV1B 1HQ3B 3AZID 3KSYA 1KX4B 2CV5A 2XD5A 3AZGA 1KX3D 2IO5B 1P3GC 1U35B 1N1JA 3V9RA 1AOID 3AYWB 4G91B 3REKB 3REIB 3R45B 5AV5D 3UTBC 3LZ0D 3X1TD 4QLCD 3AL0C 5B24A 3WA9A 4Z2MG 3EPLA 4Z66B 5CPKA 5DNMB 3X1VC 5GSUB 4JJNC 1WWSA 4KGCB 1TZYD 3X1TC 3KWQA 1P3ID 4QLCC 3RELC 2RVQD 3LELA 5GXQB 3W97B 5BNVA 5BS7C 5AVBD 4J8XC 3AZKC 1JFIB 4XZQB 3IP4C 3AN2A 3MGSA 5AY8C 1P3FB 3MVDA 3O62D 4M6BA 4WU8D 3REHD 5CP6C 3AZFA 2F2AC 3AZNC 1EQZC 5AV6A 4H9QA 4ZBJB 5B1MA 1P3KA 1M19A 2FJ7B 1BH9A 3KUYB 3C1CA 2F8NB 2NZDA 4J8WA 3KXBD 3NQJB 3AZLC 5DNNB 2NQBD 3AZJB 5GT0A 3MGRA 1M1AB 3REJC 1F66B 4Z5TA 2BYKB 1M18C 5B2JA 4J8VA 1P3MD 3X1UA 5F99A 4LD9A 2NQBC 3F6TA 5B0ZB 1ID3C 2YFVB 5B0YC 4YM6B 3MGQD 5E5AA 3B6FC 5C3IC 5B32A 3LJAA 3UTAB 4YS3D 4KUDB 1P3BC 3AZGD 1P3OD 3WAAB 3TU4B 1KX5C 4KHAA 3W99C 3EPJA 3B0CW 2CV5C 4NE6A 2Y2IA 3W96B 5B40D 5CPIB 3AZMB 1P3PB 1ZLAA 3UT9A 5B31B 3B6GD 2ZY2A 3AZHB 5B24D 1S32A 5CPKD 2Y2QA 4R8PD 3UTBA 3AZIB 3KWQD 5AVCC 4CAYA 3WA9C 5GT3A 2HIOA 3WKJD 2AROB 4H9PA 4UUZA 4JJNA 3AN2D 1KX3B 3MGSD 2CWEA 3AYWC 3LELC 3MVDD 1AOIB 3AZFD 5BS7A 4J8XA 2PYOD 5AV5B 5AV6D 3LZ0B 3LZ1A 5B1MD 1M19D 3AV2A 3A1KA 5CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG A;  5AV8 A;  5CPJ A;  1TZY B;  2NZD D;  4J8W D;  1EQZ A;  1P3I B;  2F8N K;  1P3K C;  4XZQ C;  5AV9 A;  5GT0 D;  1H3O A;  3C1C C;  5AVB B;  4H9O B;  5B2I C;  3AZE A;  5B2J D;  4J8V D;  3AZL A;  5F99 D;  5G49 A;  5GT0 C;  4LD9 D;  3MGR C;  3O62 B;  4WU8 B;  3X1S D;  3REH B;  4Z5T C;  2JSS A;  4ZBJ C;  3AFA B;  5E5A D;  3MGP B;  1M18 A;  3X1U C;  4WU9 D;  4J8U D;  3W98 C;  5B32 D;  2BYM A;  2YFW A;  4DRB A;  2HUE B;  3AZJ C;  3B6F A;  4AWL B;  3LJA C;  1P3B A;  1P3G D;  1KX5 A;  1P3A B;  3W99 A;  1ZLA C;  3UT9 C;  4ZUX B;  3UTB D;  3NQU B;  5BT1 C;  3UTA C;  3MGQ B;  1S32 C;  4KUD C;  2L5A A;  3X1V D;  4YS3 B;  5B1L C;  4JJN D;  3AZG B;  1P3O B;  1KX4 A;  5CHL B;  5AVC A;  5GT3 C;  3REL D;  2HIO C;  1P34 B;  1U35 A;  4J8X D;  3AZK D;  5B40 B;  3AZH C;  5JA4 B;  4WNN B;  4WV4 B;  3AYW A;  5AY8 D;  3REK A;  3B6G B;  5B24 B;  3REI A;  3WTP C;  2F8N G;  3R45 A;  5CP6 D;  5CPK B;  1A7W A;  3VH6 W;  4R8P B;  5BO0 B;  4XUJ B;  3AZN D;  3LZ1 C;  4Z66 A;  2LY8 A;  4X23 C;  3KWQ B;  2ARO C;  3AV2 C;  1EQZ D;  1BH8 B;  4H9N A;  1ULY A;  3WKJ B;  5JRG C;  5BNV B;  5AV8 C;  5CPJ C;  4G92 B;  3MGS B;  3W97 A;  3AZL D;  5AV9 C;  1JFI A;  4XZQ A;  4CSR B;  3A6N B;  3REJ D;  4HGA B;  3AZF B;  4DRA A;  3AZE C;  2PYO B;  1P3F A;  5B2I A;  1P3L C;  1M18 D;  5AV6 B;  4E44 A;  5B1M B;  3VH5 A;  1M19 B;  1ID3 D;  3WTP E;  5B0Y D;  3B6F D;  2FJ7 A;  5KDM B;  3VH5 T;  4J8W B;  3W98 A;  5B31 G;  1P3B D;  1KX5 D;  3NQJ A;  5DNN A;  3MNN C;  3AZJ A;  3W99 D;  1M1A A;  2CV5 D;  1F66 A;  3AFA C;  5F99 B;  4LD9 B;  2BYK A;  4NE3 A;  3X1S B;  5B0Z A;  4J8U B;  4WU9 B;  5B32 B;  3C1B C;  4YM6 A;  5B33 B;  5AVC D;  3UTA A;  4H9R B;  3WA9 D;  4KUD A;  3AV1 C;  1HQ3 C;  3WAA A;  3TU4 A;  5B1L A;  1P3A C;  1KX4 C;  1P3G B;  3AYW D;  3W96 A;  3LEL D;  2IO5 C;  5CPI A;  3AZM A;  1U35 C;  1P3P A;  4ZUX C;  5B31 A;  3AZH A;  4G91 C;  3REK C;  3UTB B;  1Q9C A;  1B6W A;  3REI C;  3WTP A;  3VH6 A;  3AZI A;  3X1V B;  4UUZ B;  4JJN B;  4Z66 C;  4NE5 A;  5DNM C;  1P34 C;  3X1T B;  3VH6 T;  4X23 A;  5GSU C;  2ARO A;  4QLC B;  1P3K D;  4KGC C;  3REL B;  4XZQ D;  5BNX A;  4Z2M H;  1KX3 A;  5FUG B;  3C1C D;  4J8X B;  3AZK B;  1HTA A;  5GXQ C;  5B2I D;  1AOI A;  3W97 C;  5AY8 B;  1KU5 A;  3MGR D;  4XUJ C;  5AV5 A;  5CP6 B;  4Z5T D;  3LZ0 A;  1P3F C;  1TAF B;  2FJ7 D;  1P3L A;  3AZN B;  1EQZ B;  3X1U D;  4NFT A;  3W98 D;  1TZY A;  2FJ7 C;  3AZJ D;  3KUY C;  3A6N C;  3LJA D;  5AVB A;  4H9O A;  5G49 B;  5DNN C;  3REJ B;  4EO5 B;  3MNN A;  1M1A C;  3KXB B;  3O62 A;  4WU8 A;  1F66 C;  3REH A;  2NQB B;  3AFA A;  1ZLA D;  1ID3 B;  3MGP A;  3UT9 D;  5BT1 D;  3UTA D;  5B0Z C;  5B0Y B;  1S32 D;  4KUD D;  3B6F B;  1P3M B;  5C3I B;  4YM6 C;  3B0C T;  3C1B A;  5B1L D;  4E45 A;  1P3B B;  1KX5 B;  5GT3 D;  3AV1 A;  1HQ3 A;  2HIO D;  3WAA C;  3TU4 C;  3W99 B;  2CV5 B;  1WWI A;  3AZH D;  1P3A A;  3W96 C;  1N1J B;  3V9R B;  5CPI C;  3AZM C;  1P3P C;  5B33 C;  3WTP D;  4ZUX A;  3NQU A;  5B31 C;  3MGQ A;  3B0B A;  3LZ1 D;  4X23 D;  5AVC B;  2ARO D;  3AV2 D;  3WA9 B;  4YS3 A;  3AZI C;  1P3O A;  5JRG D;  5AV8 D;  5CPJ D;  1F1E A;  5DNM A;  1P34 A;  5GSU A;  5AV9 D;  5B40 A;  3LEL B;  4KGC A;  1BFM A;  1KX3 C;  5JA4 A;  4WNN A;  3AN2 B;  3AZE D;  1AOI C;  3B6G A;  5GXQ A;  1P3L D;  3MVD B;  4H9N B;  4R8P A;  5BO0 A;  5AV5 C;  4XUJ A;  3LZ0 C;  1BH8 A;  3WKJ A;  4H9Q B;  1P3K B;  1R4V A;  1TZY C;  1BH9 B;  1P3I C;  3C1C B;  2RVQ C;  5B32 G;  3MNN D;  2NZD B;  5B2I B;  4CSR A;  3A6N A;  5AVB C;  3KUY A;  3AFA D;  5GT0 B;  2F8N A;  3MGR B;  2PYO A;  3B0D B;  3MGP D;  4Z5T B;  3O62 C;  4WU8 C;  3REH C;  5B2J B;  4J8V B;  3X1U B;  3W98 B;  3C1B D;  3MGP C;  5KDM A;  5E5A B;  3AV1 D;  1HQ3 D;  2YFV A;  3LJA B;  2HUE C;  4EO5 C;  4AWL C;  1P3A D;  1KX4 D;  3KXB C;  4KHA B;  4H9S C;  3X1S A;  1U35 D;  4ZUX D;  1ZLA B;  1B67 A;  3UT9 B;  3REK D;  1P3M C;  4J8U A;  4WU9 A;  3REI D;  1S32 B;  5B33 A;  3MGQ C;  4H9R A;  5B1L B;  4Z66 D;  5DNM D;  4CAY B;  1P34 D;  5GSU D;  5GT3 B;  4YS3 C;  4KGC D;  3AZG C;  1P3O C;  2HIO B;  1P3G A;  4H9P B;  5GXQ D;  3W97 D;  5B40 C;  3WTP B;  4XUJ D;  3B6G C;  5B24 C;  1P3F D;  5CPK C;  3LZ1 B;  4X23 B;  4WZS B;  4R8P C;  3AV2 B;  3X1V A;  5BNX B;  3KWQ C;  2F8N H;  5JRG B;  3X1T A;  5AV8 B;  4QLC A;  5CPJ B;  3REL A;  3WKJ C;  3KUY D;  3A6N D;  5FUG A;  3AZK A;  5AV9 B;  3AN2 C;  4G92 C;  2F8N D;  3MGS C;  1H3O B;  1P3I A;  5DNN D;  5AY8 A;  3MVD C;  3AZE B;  1M1A D;  1P3L B;  3AZL B;  4HGA C;  3AZF C;  1F66 D;  2PYO C;  1TAF A;  5AV6 C;  3AZN A;  5B1M C;  1M19 C;  5B0Z D;  1M18 B;  4YM6 D;  2NZD C;  4J8W C;  2BYM B;  2YFW B;  3MNN B;  3WAA D;  3TU4 D;  3B0D C;  3REJ A;  3VH5 W;  3KXB A;  5B2J C;  4J8V C;  3W96 D;  5F99 C;  2NQB A;  4LD9 C;  5CPI D;  3AZM D;  3X1S C;  4H9S A;  5B33 D;  1P3P D;  1ID3 A;  5B31 D;  5E5A C;  3C1B B;  5B0Y A;  4J8U C;  4WU9 C;  1P3M A;  5B32 C;  3AV1 B;  1HQ3 B;  3AZI D;  3KSY A;  1KX4 B;  2CV5 A;  3AZG A;  1KX3 D;  2IO5 B;  1P3G C;  1U35 B;  1N1J A;  3V9R A;  1AOI D;  3AYW B;  4G91 B;  3REK B;  3REI B;  3R45 B;  5AV5 D;  3UTB C;  3LZ0 D;  3X1T D;  4QLC D;  5B24 A;  3WA9 A;  4Z2M G;  4Z66 B;  5CPK A;  5DNM B;  3X1V C;  5GSU B;  4JJN C;  1WWS A;  4KGC B;  1TZY D;  3X1T C;  3KWQ A;  1P3I D;  4QLC C;  3REL C;  2RVQ D;  3LEL A;  5GXQ B;  3W97 B;  5BNV A;  5BS7 C;  5AVB D;  4J8X C;  3AZK C;  1JFI B;  4XZQ B;  3AN2 A;  3MGS A;  5AY8 C;  1P3F B;  3MVD A;  3O62 D;  4M6B A;  4WU8 D;  3REH D;  5CP6 C;  3AZF A;  3AZN C;  1EQZ C;  5AV6 A;  4H9Q A;  4ZBJ B;  5B1M A;  1P3K A;  1M19 A;  2FJ7 B;  1BH9 A;  3KUY B;  3C1C A;  2F8N B;  2NZD A;  4J8W A;  3KXB D;  3NQJ B;  3AZL C;  5DNN B;  2NQB D;  3AZJ B;  5GT0 A;  3MGR A;  1M1A B;  3REJ C;  1F66 B;  4Z5T A;  2BYK B;  1M18 C;  5B2J A;  4J8V A;  1P3M D;  3X1U A;  5F99 A;  4LD9 A;  2NQB C;  5B0Z B;  1ID3 C;  2YFV B;  5B0Y C;  4YM6 B;  3MGQ D;  5E5A A;  3B6F C;  5C3I C;  5B32 A;  3LJA A;  3UTA B;  4YS3 D;  4KUD B;  1P3B C;  3AZG D;  1P3O D;  3WAA B;  3TU4 B;  1KX5 C;  4KHA A;  3W99 C;  3B0C W;  2CV5 C;  4NE6 A;  3W96 B;  5B40 D;  5CPI B;  3AZM B;  1P3P B;  1ZLA A;  3UT9 A;  5B31 B;  3B6G D;  3AZH B;  5B24 D;  1S32 A;  5CPK D;  4R8P D;  3UTB A;  3AZI B;  3KWQ D;  5AVC C;  4CAY A;  3WA9 C;  5GT3 A;  2HIO A;  3WKJ D;  2ARO B;  4H9P A;  4UUZ A;  4JJN A;  3AN2 D;  1KX3 B;  3MGS D;  2CWE A;  3AYW C;  3LEL C;  3MVD D;  1AOI B;  3AZF D;  5BS7 A;  4J8X A;  2PYO D;  5AV5 B;  5AV6 D;  3LZ0 B;  3LZ1 A;  5B1M D;  1M19 D;  3AV2 A;  5CP6 A; 
#chains in the Genus database with same CATH topology
 5JRG A;  5AV8 A;  5CPJ A;  1TZY B;  2NZD D;  4J8W D;  1EQZ A;  4UPK A;  1P3I B;  1P3K C;  2F8N K;  4XZQ C;  5AV9 A;  5GT0 D;  1H3O A;  2ZY4 A;  2Y2M A;  3C1C C;  5AVB B;  4H9O B;  5B2I C;  3AZE A;  5B2J D;  4J8V D;  3AZL A;  2ZY3 A;  5G49 A;  5F99 D;  5GT0 C;  3MGR C;  4LD9 D;  3O62 B;  4WU8 B;  3X1S D;  3REH B;  4Z5T C;  2JSS A;  4ZBJ C;  3AFA B;  5E5A D;  3MGP B;  1M18 A;  3X1U C;  4WU9 D;  4J8U D;  3W98 C;  5B32 D;  2BYM A;  2YFW A;  4DRB A;  2HUE B;  3AZJ C;  3B6F A;  4AWL B;  3LJA C;  2G5H C;  1P3B A;  1P3G D;  1KX5 A;  1P3A B;  3W99 A;  1ZLA C;  3UT9 C;  4ZUX B;  3UTB D;  3NQU B;  5BT1 C;  3UTA C;  3MGQ B;  1S32 C;  4KUD C;  2L5A A;  2Y2G A;  3X1V D;  4YS3 B;  5B1L C;  4JJN D;  3AZG B;  1P3O B;  1KX4 A;  5CHL B;  5AVC A;  5GT3 C;  3REL D;  2HIO C;  1P34 B;  1U35 A;  4J8X D;  3AZK D;  5B40 B;  3AZH C;  5JA4 B;  4WNN B;  3EPH A;  2Y2P A;  4WV4 B;  3AYW A;  5AY8 D;  3REK A;  3B6G B;  3KFU G;  5B24 B;  3REI A;  3WTP C;  2F8N G;  3R45 A;  5CP6 D;  5CPK B;  1A7W A;  3VH6 W;  4R8P B;  2J8P A;  5BO0 B;  4XUJ B;  3AZN D;  3LZ1 C;  4Z66 A;  2LY8 A;  4X23 C;  3KWQ B;  2ARO C;  3AV2 C;  1EQZ D;  1BH8 B;  4H9N A;  1ULY A;  3WKJ B;  5JRG C;  5BNV B;  5AV8 C;  5CPJ C;  1W2E A;  4G92 B;  3MGS B;  3W97 A;  3A1I A;  3AZL D;  5AV9 C;  2Y2N A;  1JFI A;  4XZQ A;  4CSR B;  3A6N B;  3REJ D;  4HGA B;  3AZF B;  4DRA A;  3AZE C;  2PYO B;  1P3F A;  5B2I A;  1P3L C;  1M18 D;  5AV6 B;  4E44 A;  5B1M B;  3VH5 A;  1M19 B;  1ID3 D;  3WTP E;  2XD1 A;  5B0Y D;  3B6F D;  2FJ7 A;  5KDM B;  3VH5 T;  4J8W B;  3W98 A;  5B31 G;  1P3B D;  1KX5 D;  3NQJ A;  5DNN A;  3MNN C;  3AZJ A;  3W99 D;  1M1A A;  2CV5 D;  1F66 A;  3AFA C;  5F99 B;  4LD9 B;  2BYK A;  4NE3 A;  3X1S B;  5B0Z A;  4J8U B;  4WU9 B;  5B32 B;  3C1B C;  4YM6 A;  5B33 B;  5AVC D;  3UTA A;  4H9R B;  3WA9 D;  4KUD A;  3AV1 C;  1HQ3 C;  3WAA A;  3TU4 A;  5B1L A;  1P3A C;  1KX4 C;  1P3G B;  3AYW D;  3W96 A;  3LEL D;  2IO5 C;  5CPI A;  3AZM A;  1U35 C;  1P3P A;  4ZUX C;  5B31 A;  3AZH A;  4G91 C;  3REK C;  3UTB B;  1Q9C A;  2UWX A;  1B6W A;  3REI C;  3WTP A;  3VH6 A;  3AZI A;  3X1V B;  4UUZ B;  3EG5 B;  4JJN B;  4Z66 C;  4NE5 A;  5DNM C;  1P34 C;  3X1T B;  3VH6 T;  4X23 A;  5GSU C;  2ARO A;  4QLC B;  1P3K D;  4KGC C;  3REL B;  4XZQ D;  2JCH A;  5BNX A;  4Z2M H;  1KX3 A;  5FUG B;  3C1C D;  4J8X B;  3AZK B;  1HTA A;  5GXQ C;  5B2I D;  1AOI A;  3W97 C;  5AY8 B;  1KU5 A;  3MGR D;  2VQR A;  4XUJ C;  5AV5 A;  5CP6 B;  4Z5T D;  3LZ0 A;  1P3F C;  1TAF B;  2FJ7 D;  1P3L A;  3AZN B;  1EQZ B;  3X1U D;  4NFT A;  3W98 D;  2JE5 A;  2W8S A;  1TZY A;  2FJ7 C;  3AZJ D;  3KUY C;  3A6N C;  3LJA D;  5AVB A;  4H9O A;  5G49 B;  2FFF B;  5DNN C;  4DQY B;  3REJ B;  4EO5 B;  3MNN A;  1M1A C;  3KXB B;  3O62 A;  4WU8 A;  1F66 C;  3REH A;  2NQB B;  3AFA A;  1ZLA D;  1ID3 B;  3MGP A;  3UT9 D;  5BT1 D;  3UTA D;  5B0Z C;  5B0Y B;  1S32 D;  4KUD D;  3B6F B;  3H0M C;  5C3I B;  1P3M B;  4YM6 C;  3B0C T;  3C1B A;  5B1L D;  4E45 A;  1P3B B;  1KX5 B;  5GT3 D;  3AV1 A;  1HQ3 A;  2HIO D;  2Y2L A;  3WAA C;  3TU4 C;  3W99 B;  2Y2J A;  2CV5 B;  1WWI A;  3AZH D;  1P3A A;  3W96 C;  1N1J B;  3V9R B;  5CPI C;  3AZM C;  1P3P C;  5B33 C;  3WTP D;  1PZR A;  4ZUX A;  3NQU A;  5B31 C;  3MGQ A;  3B0B A;  3EPK A;  3LZ1 D;  4X23 D;  5AVC B;  2ARO D;  3AV2 D;  3WA9 B;  4YS3 A;  3AZI C;  1P3O A;  5JRG D;  5AV8 D;  5CPJ D;  1F1E A;  5DNM A;  1P34 A;  5GSU A;  5AV9 D;  5B40 A;  3LEL B;  4KGC A;  1BFM A;  1KX3 C;  5JA4 A;  4WNN A;  3AN2 B;  3AZE D;  1AOI C;  3B6G A;  5GXQ A;  1P3L D;  3MVD B;  4H9N B;  4R8P A;  5BO0 A;  5AV5 C;  4XUJ A;  3LZ0 C;  1BH8 A;  3H0L C;  3WKJ A;  4H9Q B;  1P3K B;  1R4V A;  2ZY5 A;  1TZY C;  1BH9 B;  1P3I C;  3H0R C;  3C1C B;  2RVQ C;  3P5J B;  5B32 G;  3MNN D;  2NZD B;  5B2I B;  4CSR A;  3A6N A;  5AVB C;  3KUY A;  3AFA D;  5GT0 B;  2F8N A;  3MGR B;  2PYO A;  3B0D B;  3MGP D;  2BG1 A;  4Z5T B;  3O62 C;  4WU8 C;  3REH C;  5B2J B;  4J8V B;  3X1U B;  3W98 B;  3C1B D;  3MGP C;  5KDM A;  5E5A B;  3AV1 D;  1HQ3 D;  2YFV A;  3LJA B;  2HUE C;  4EO5 C;  4AWL C;  1P3A D;  1KX4 D;  3KXB C;  1T3U A;  2Y2H A;  4KHA B;  4H9S C;  3X1S A;  1U35 D;  4ZUX D;  1ZLA B;  1B67 A;  3UT9 B;  3REK D;  1P3M C;  4J8U A;  4WU9 A;  3REI D;  1S32 B;  5B33 A;  1Z2C B;  3MGQ C;  4H9R A;  5B1L B;  4Z66 D;  5DNM D;  4CAY B;  1P34 D;  5GSU D;  5GT3 B;  4YS3 C;  2RIQ A;  4KGC D;  3AZG C;  1P3O C;  2HIO B;  1P3G A;  4H9P B;  5GXQ D;  3W97 D;  5B40 C;  2DF4 C;  3WTP B;  4XUJ D;  3B6G C;  5B24 C;  1P3F D;  4WJ3 C;  5CPK C;  3LZ1 B;  4X23 B;  4WZS B;  2ZM5 A;  4R8P C;  3AV2 B;  3X1V A;  5BNX B;  3KWQ C;  2F8N H;  5JRG B;  3X1T A;  5AV8 B;  4QLC A;  5CPJ B;  3REL A;  3WKJ C;  3KUY D;  3A6N D;  5FUG A;  3AZK A;  5AV9 B;  3AN2 C;  4G92 C;  2F8N D;  3MGS C;  1H3O B;  1P3I A;  5DNN D;  5AY8 A;  3MVD C;  3AZE B;  1M1A D;  2DQN C;  1P3L B;  3AZL B;  4HGA C;  3AZF C;  1F66 D;  2PYO C;  1TAF A;  5AV6 C;  3AZN A;  5B1M C;  1M19 C;  5B0Z D;  1M18 B;  2Y2O A;  4YM6 D;  3FDD A;  2NZD C;  4J8W C;  2BYM B;  2YFW B;  3MNN B;  3WAA D;  3TU4 D;  3B0D C;  3REJ A;  3VH5 W;  3KXB A;  2Y2K A;  5B2J C;  4J8V C;  3W96 D;  5F99 C;  2NQB A;  4LD9 C;  5CPI D;  3AZM D;  3X1S C;  4H9S A;  5B33 D;  1P3P D;  1ID3 A;  5B31 D;  5E5A C;  3C1B B;  5B0Y A;  2G5I C;  4J8U C;  4WU9 C;  5B32 C;  1P3M A;  3AV1 B;  1HQ3 B;  3AZI D;  3KSY A;  1KX4 B;  2CV5 A;  2XD5 A;  3AZG A;  1KX3 D;  2IO5 B;  1P3G C;  1U35 B;  1N1J A;  3V9R A;  1AOI D;  3AYW B;  4G91 B;  3REK B;  3REI B;  3R45 B;  5AV5 D;  3UTB C;  3LZ0 D;  3X1T D;  4QLC D;  3AL0 C;  5B24 A;  3WA9 A;  4Z2M G;  3EPL A;  4Z66 B;  5CPK A;  5DNM B;  3X1V C;  5GSU B;  4JJN C;  1WWS A;  4KGC B;  1TZY D;  3X1T C;  3KWQ A;  1P3I D;  4QLC C;  3REL C;  2RVQ D;  3LEL A;  5GXQ B;  3W97 B;  5BNV A;  5BS7 C;  5AVB D;  4J8X C;  3AZK C;  1JFI B;  4XZQ B;  3IP4 C;  3AN2 A;  3MGS A;  5AY8 C;  1P3F B;  3MVD A;  3O62 D;  4M6B A;  4WU8 D;  3REH D;  5CP6 C;  3AZF A;  2F2A C;  3AZN C;  1EQZ C;  5AV6 A;  4H9Q A;  4ZBJ B;  5B1M A;  1P3K A;  1M19 A;  2FJ7 B;  1BH9 A;  3KUY B;  3C1C A;  2F8N B;  2NZD A;  4J8W A;  3KXB D;  3NQJ B;  3AZL C;  5DNN B;  2NQB D;  3AZJ B;  5GT0 A;  3MGR A;  1M1A B;  3REJ C;  1F66 B;  4Z5T A;  2BYK B;  1M18 C;  5B2J A;  4J8V A;  1P3M D;  3X1U A;  5F99 A;  4LD9 A;  2NQB C;  3F6T A;  5B0Z B;  1ID3 C;  2YFV B;  5B0Y C;  4YM6 B;  3MGQ D;  5E5A A;  3B6F C;  5C3I C;  5B32 A;  3LJA A;  3UTA B;  4YS3 D;  4KUD B;  1P3B C;  3AZG D;  1P3O D;  3WAA B;  3TU4 B;  1KX5 C;  4KHA A;  3W99 C;  3EPJ A;  3B0C W;  2CV5 C;  4NE6 A;  2Y2I A;  3W96 B;  5B40 D;  5CPI B;  3AZM B;  1P3P B;  1ZLA A;  3UT9 A;  5B31 B;  3B6G D;  2ZY2 A;  3AZH B;  5B24 D;  1S32 A;  5CPK D;  2Y2Q A;  4R8P D;  3UTB A;  3AZI B;  3KWQ D;  5AVC C;  4CAY A;  3WA9 C;  5GT3 A;  2HIO A;  3WKJ D;  2ARO B;  4H9P A;  4UUZ A;  4JJN A;  3AN2 D;  1KX3 B;  3MGS D;  2CWE A;  3AYW C;  3LEL C;  3MVD D;  1AOI B;  3AZF D;  5BS7 A;  4J8X A;  2PYO D;  5AV5 B;  5AV6 D;  3LZ0 B;  3LZ1 A;  5B1M D;  1M19 D;  3AV2 A;  3A1K A;  5CP6 A; 
#chains in the Genus database with same CATH homology
 5JRG A;  5AV8 A;  5CPJ A;  1TZY B;  2NZD D;  4J8W D;  1EQZ A;  4UPK A;  1P3I B;  1P3K C;  2F8N K;  4XZQ C;  5AV9 A;  5GT0 D;  1H3O A;  2ZY4 A;  2Y2M A;  3C1C C;  5AVB B;  4H9O B;  5B2I C;  3AZE A;  5B2J D;  4J8V D;  3AZL A;  2ZY3 A;  5G49 A;  5F99 D;  5GT0 C;  3MGR C;  4LD9 D;  3O62 B;  4WU8 B;  3X1S D;  3REH B;  4Z5T C;  2JSS A;  4ZBJ C;  3AFA B;  5E5A D;  3MGP B;  1M18 A;  3X1U C;  4WU9 D;  4J8U D;  3W98 C;  5B32 D;  2BYM A;  2YFW A;  4DRB A;  2HUE B;  3AZJ C;  3B6F A;  4AWL B;  3LJA C;  2G5H C;  1P3B A;  1P3G D;  1KX5 A;  1P3A B;  3W99 A;  1ZLA C;  3UT9 C;  4ZUX B;  3UTB D;  3NQU B;  5BT1 C;  3UTA C;  3MGQ B;  1S32 C;  4KUD C;  2L5A A;  2Y2G A;  3X1V D;  4YS3 B;  5B1L C;  4JJN D;  3AZG B;  1P3O B;  1KX4 A;  5CHL B;  5AVC A;  5GT3 C;  3REL D;  2HIO C;  1P34 B;  1U35 A;  4J8X D;  3AZK D;  5B40 B;  3AZH C;  5JA4 B;  4WNN B;  3EPH A;  2Y2P A;  4WV4 B;  3AYW A;  5AY8 D;  3REK A;  3B6G B;  3KFU G;  5B24 B;  3REI A;  3WTP C;  2F8N G;  3R45 A;  5CP6 D;  5CPK B;  1A7W A;  3VH6 W;  4R8P B;  2J8P A;  5BO0 B;  4XUJ B;  3AZN D;  3LZ1 C;  4Z66 A;  2LY8 A;  4X23 C;  3KWQ B;  2ARO C;  3AV2 C;  1EQZ D;  1BH8 B;  4H9N A;  1ULY A;  3WKJ B;  5JRG C;  5BNV B;  5AV8 C;  5CPJ C;  1W2E A;  4G92 B;  3MGS B;  3W97 A;  3A1I A;  3AZL D;  5AV9 C;  2Y2N A;  1JFI A;  4XZQ A;  4CSR B;  3A6N B;  3REJ D;  4HGA B;  3AZF B;  4DRA A;  3AZE C;  2PYO B;  1P3F A;  5B2I A;  1P3L C;  1M18 D;  5AV6 B;  4E44 A;  5B1M B;  3VH5 A;  1M19 B;  1ID3 D;  3WTP E;  2XD1 A;  5B0Y D;  3B6F D;  2FJ7 A;  5KDM B;  3VH5 T;  4J8W B;  3W98 A;  5B31 G;  1P3B D;  1KX5 D;  3NQJ A;  5DNN A;  3MNN C;  3AZJ A;  3W99 D;  1M1A A;  2CV5 D;  1F66 A;  3AFA C;  5F99 B;  4LD9 B;  2BYK A;  4NE3 A;  3X1S B;  5B0Z A;  4J8U B;  4WU9 B;  5B32 B;  3C1B C;  4YM6 A;  5B33 B;  5AVC D;  3UTA A;  4H9R B;  3WA9 D;  4KUD A;  3AV1 C;  1HQ3 C;  3WAA A;  3TU4 A;  5B1L A;  1P3A C;  1KX4 C;  1P3G B;  3AYW D;  3W96 A;  3LEL D;  2IO5 C;  5CPI A;  3AZM A;  1U35 C;  1P3P A;  4ZUX C;  5B31 A;  3AZH A;  4G91 C;  3REK C;  3UTB B;  1Q9C A;  2UWX A;  1B6W A;  3REI C;  3WTP A;  3VH6 A;  3AZI A;  3X1V B;  4UUZ B;  3EG5 B;  4JJN B;  4Z66 C;  4NE5 A;  5DNM C;  1P34 C;  3X1T B;  3VH6 T;  4X23 A;  5GSU C;  2ARO A;  4QLC B;  1P3K D;  4KGC C;  3REL B;  4XZQ D;  2JCH A;  5BNX A;  4Z2M H;  1KX3 A;  5FUG B;  3C1C D;  4J8X B;  3AZK B;  1HTA A;  5GXQ C;  5B2I D;  1AOI A;  3W97 C;  5AY8 B;  1KU5 A;  3MGR D;  2VQR A;  4XUJ C;  5AV5 A;  5CP6 B;  4Z5T D;  3LZ0 A;  1P3F C;  1TAF B;  2FJ7 D;  1P3L A;  3AZN B;  1EQZ B;  3X1U D;  4NFT A;  3W98 D;  2JE5 A;  2W8S A;  1TZY A;  2FJ7 C;  3AZJ D;  3KUY C;  3A6N C;  3LJA D;  5AVB A;  4H9O A;  5G49 B;  2FFF B;  5DNN C;  4DQY B;  3REJ B;  4EO5 B;  3MNN A;  1M1A C;  3KXB B;  3O62 A;  4WU8 A;  1F66 C;  3REH A;  2NQB B;  3AFA A;  1ZLA D;  1ID3 B;  3MGP A;  3UT9 D;  5BT1 D;  3UTA D;  5B0Z C;  5B0Y B;  1S32 D;  4KUD D;  3B6F B;  3H0M C;  5C3I B;  1P3M B;  4YM6 C;  3B0C T;  3C1B A;  5B1L D;  4E45 A;  1P3B B;  1KX5 B;  5GT3 D;  3AV1 A;  1HQ3 A;  2HIO D;  2Y2L A;  3WAA C;  3TU4 C;  3W99 B;  2Y2J A;  2CV5 B;  1WWI A;  3AZH D;  1P3A A;  3W96 C;  1N1J B;  3V9R B;  5CPI C;  3AZM C;  1P3P C;  5B33 C;  3WTP D;  1PZR A;  4ZUX A;  3NQU A;  5B31 C;  3MGQ A;  3B0B A;  3EPK A;  3LZ1 D;  4X23 D;  5AVC B;  2ARO D;  3AV2 D;  3WA9 B;  4YS3 A;  3AZI C;  1P3O A;  5JRG D;  5AV8 D;  5CPJ D;  1F1E A;  5DNM A;  1P34 A;  5GSU A;  5AV9 D;  5B40 A;  3LEL B;  4KGC A;  1BFM A;  1KX3 C;  5JA4 A;  4WNN A;  3AN2 B;  3AZE D;  1AOI C;  3B6G A;  5GXQ A;  1P3L D;  3MVD B;  4H9N B;  4R8P A;  5BO0 A;  5AV5 C;  4XUJ A;  3LZ0 C;  1BH8 A;  3H0L C;  3WKJ A;  4H9Q B;  1P3K B;  1R4V A;  2ZY5 A;  1TZY C;  1BH9 B;  1P3I C;  3H0R C;  3C1C B;  2RVQ C;  3P5J B;  5B32 G;  3MNN D;  2NZD B;  5B2I B;  4CSR A;  3A6N A;  5AVB C;  3KUY A;  3AFA D;  5GT0 B;  2F8N A;  3MGR B;  2PYO A;  3B0D B;  3MGP D;  2BG1 A;  4Z5T B;  3O62 C;  4WU8 C;  3REH C;  5B2J B;  4J8V B;  3X1U B;  3W98 B;  3C1B D;  3MGP C;  5KDM A;  5E5A B;  3AV1 D;  1HQ3 D;  2YFV A;  3LJA B;  2HUE C;  4EO5 C;  4AWL C;  1P3A D;  1KX4 D;  3KXB C;  1T3U A;  2Y2H A;  4KHA B;  4H9S C;  3X1S A;  1U35 D;  4ZUX D;  1ZLA B;  1B67 A;  3UT9 B;  3REK D;  1P3M C;  4J8U A;  4WU9 A;  3REI D;  1S32 B;  5B33 A;  1Z2C B;  3MGQ C;  4H9R A;  5B1L B;  4Z66 D;  5DNM D;  4CAY B;  1P34 D;  5GSU D;  5GT3 B;  4YS3 C;  2RIQ A;  4KGC D;  3AZG C;  1P3O C;  2HIO B;  1P3G A;  4H9P B;  5GXQ D;  3W97 D;  5B40 C;  2DF4 C;  3WTP B;  4XUJ D;  3B6G C;  5B24 C;  1P3F D;  4WJ3 C;  5CPK C;  3LZ1 B;  4X23 B;  4WZS B;  2ZM5 A;  4R8P C;  3AV2 B;  3X1V A;  5BNX B;  3KWQ C;  2F8N H;  5JRG B;  3X1T A;  5AV8 B;  4QLC A;  5CPJ B;  3REL A;  3WKJ C;  3KUY D;  3A6N D;  5FUG A;  3AZK A;  5AV9 B;  3AN2 C;  4G92 C;  2F8N D;  3MGS C;  1H3O B;  1P3I A;  5DNN D;  5AY8 A;  3MVD C;  3AZE B;  1M1A D;  2DQN C;  1P3L B;  3AZL B;  4HGA C;  3AZF C;  1F66 D;  2PYO C;  1TAF A;  5AV6 C;  3AZN A;  5B1M C;  1M19 C;  5B0Z D;  1M18 B;  2Y2O A;  4YM6 D;  3FDD A;  2NZD C;  4J8W C;  2BYM B;  2YFW B;  3MNN B;  3WAA D;  3TU4 D;  3B0D C;  3REJ A;  3VH5 W;  3KXB A;  2Y2K A;  5B2J C;  4J8V C;  3W96 D;  5F99 C;  2NQB A;  4LD9 C;  5CPI D;  3AZM D;  3X1S C;  4H9S A;  5B33 D;  1P3P D;  1ID3 A;  5B31 D;  5E5A C;  3C1B B;  5B0Y A;  2G5I C;  4J8U C;  4WU9 C;  5B32 C;  1P3M A;  3AV1 B;  1HQ3 B;  3AZI D;  3KSY A;  1KX4 B;  2CV5 A;  2XD5 A;  3AZG A;  1KX3 D;  2IO5 B;  1P3G C;  1U35 B;  1N1J A;  3V9R A;  1AOI D;  3AYW B;  4G91 B;  3REK B;  3REI B;  3R45 B;  5AV5 D;  3UTB C;  3LZ0 D;  3X1T D;  4QLC D;  3AL0 C;  5B24 A;  3WA9 A;  4Z2M G;  3EPL A;  4Z66 B;  5CPK A;  5DNM B;  3X1V C;  5GSU B;  4JJN C;  1WWS A;  4KGC B;  1TZY D;  3X1T C;  3KWQ A;  1P3I D;  4QLC C;  3REL C;  2RVQ D;  3LEL A;  5GXQ B;  3W97 B;  5BNV A;  5BS7 C;  5AVB D;  4J8X C;  3AZK C;  1JFI B;  4XZQ B;  3IP4 C;  3AN2 A;  3MGS A;  5AY8 C;  1P3F B;  3MVD A;  3O62 D;  4M6B A;  4WU8 D;  3REH D;  5CP6 C;  3AZF A;  2F2A C;  3AZN C;  1EQZ C;  5AV6 A;  4H9Q A;  4ZBJ B;  5B1M A;  1P3K A;  1M19 A;  2FJ7 B;  1BH9 A;  3KUY B;  3C1C A;  2F8N B;  2NZD A;  4J8W A;  3KXB D;  3NQJ B;  3AZL C;  5DNN B;  2NQB D;  3AZJ B;  5GT0 A;  3MGR A;  1M1A B;  3REJ C;  1F66 B;  4Z5T A;  2BYK B;  1M18 C;  5B2J A;  4J8V A;  1P3M D;  3X1U A;  5F99 A;  4LD9 A;  2NQB C;  3F6T A;  5B0Z B;  1ID3 C;  2YFV B;  5B0Y C;  4YM6 B;  3MGQ D;  5E5A A;  3B6F C;  5C3I C;  5B32 A;  3LJA A;  3UTA B;  4YS3 D;  4KUD B;  1P3B C;  3AZG D;  1P3O D;  3WAA B;  3TU4 B;  1KX5 C;  4KHA A;  3W99 C;  3EPJ A;  3B0C W;  2CV5 C;  4NE6 A;  2Y2I A;  3W96 B;  5B40 D;  5CPI B;  3AZM B;  1P3P B;  1ZLA A;  3UT9 A;  5B31 B;  3B6G D;  2ZY2 A;  3AZH B;  5B24 D;  1S32 A;  5CPK D;  2Y2Q A;  4R8P D;  3UTB A;  3AZI B;  3KWQ D;  5AVC C;  4CAY A;  3WA9 C;  5GT3 A;  2HIO A;  3WKJ D;  2ARO B;  4H9P A;  4UUZ A;  4JJN A;  3AN2 D;  1KX3 B;  3MGS D;  2CWE A;  3AYW C;  3LEL C;  3MVD D;  1AOI B;  3AZF D;  5BS7 A;  4J8X A;  2PYO D;  5AV5 B;  5AV6 D;  3LZ0 B;  3LZ1 A;  5B1M D;  1M19 D;  3AV2 A;  3A1K A;  5CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...