1BH9A

Htafii18/htafii28 heterodimer crystal structure with bound pcmbs
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
b'LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation complex
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh9A00
5AV9B 3RELD 4R8PC 5AV9C 4XZQA 2YFVB 5B0YA 5GSUA 1KX5B 4WU9B 5BO0B 1EQZC 1N1JA 1P3PB 3W97B 5B0ZA 3KXBB 5B24C 1P3PC 1TZYD 4H9PB 3REKA 5G49A 4CAYB 4H9NA 4XZQB 4XUJA 4XZQC 1P3GB 4QLCA 3LJAA 1KX3D 5B0YC 5GSUC 3KWQA 3AZGD 1H3OB 3W99A 5BNVB 5BS7A 1P3KD 3WKJA 5B2JD 4E44A 5B0ZC 2CWEA 3B0DB 3REKC 3X1TB 3UTBB 3B0DC 4H9NB 5JRGB 3UTBC 3AZNA 3AZFD 2NZDD 4YM6D 1ULYA 4XUJC 3LJAB 1KU5A 3AZID 5CPJD 1F1EA 3LJAC 3KWQC 3W99C 2AROD 3W96B 4LD9D 4E45A 5BS7C 4YS3D 3WKJC 4UUZA 3AZLB 1HQ3A 4NE6A 1P3FB 3AZNC 3W98B 4H9QA 3X1SB 5DNNB 2FJ7A 5GXQD 3WTPE 1U35A 3A6NB 3A6NC 5DNMB 1HQ3C 4CSRA 4J8XD 3AYWB 1P34D 5B33B 1S32A 1P3MA 5AVCB 2FJ7C 3KUYB 3AZJB 5AY8D 4Z5TD 4WNNB 3MGPA 4ZUXB 5GT0D 1U35C 5CPKD 1P3AD 5KDMA 1BH8A 1KX4A 4X23B 3AZKB 5C3IB 3NQUB 5CHLB 1P3MC 3NQJA 4NFTA 1BH9A 5AV9D 3MGQA 3MGPC 5KDMB 1KX4C 3AZFB 1KX5D 2NZDB 3B0CT 3B6GA 1P3LA 2CV5A 1ID3B 1P3PD 3W97D 3KXBD 2RVQD 5BT1C 3AFAA 2PYOB 5AVBB 5AV5A 4EO5B 1WWIA 3MGQC 4XZQD 1P3GD 2BYMB 4KUDB 3MGRA 3LZ1B 3B6GC 1P3LC 3O62B 3REJB 4H9RB 1M18A 5B32B 3X1TD 3UTBD 5B32C 5B2IA 5JRGD 5AV5C 4J8UB 2YFWA 4J8XB 4KGCA 3LJAD 5AV8A 5B1LA 1B67A 5B32G 4DRBA 3MGRB 3W96D 3MVDB 5GT3A 1M19A 5B31A 3MGRC 3X1UB 3WKJD 2F8NA 3KSYA 4J8VB 3AZHB 3WAAA 3AZLD 3AN2A 4J8VC 5F99B 1M18C 1P3FD 4JJNA 5B2IC 3W98D 5FUGB 3X1SD 5B1LB 4KGCC 5AV8C 5B1LC 5DNND 3V9RB 1ZLAB 3C1BB 3WA9A 5GT3C 3WTPA 3C1BC 1M19C 4G92C 3A6ND 3REIA 4R8PB 5DNMD 3WAAC 3AN2C 3UTAB 4KHAB 4JJNC 3UTAC 3AYWD 3AV1A 1TAFB 4H9OB 4ZBJC 3TU4A 5B1MA 1EQZB 5B33D 5B24B 3B6FA 5AVCD 3KUYD 3AZJD 3WA9C 4HGAC 3WTPC 4ZUXD 3REIC 2HIOA 3UT9A 1M1AA 4X23D 4WU8A 5B0YB 5GSUB 3AZKD 3AV1C 2IO5C 3TU4C 5B1MC 1P3OA 1N1JB 5B0ZB 3REKB 3B6FC 5G49B 1Q9CA 2HUEC 4G91B 5AV6A 4G91C 3AZEA 3C1CA 3R45A 2HIOC 5E5AA 4XUJB 4WU8B 1M1AC 5B40A 4QLCB 2NQBA 4WU8C 1ID3D 4QLCC 3KWQB 1AOIA 1B6WA 1JFIA 3W99B 1P3BA 2PYOD 3WKJB 5AVBD 1P3OC 4J8WA 3B0CW 3REHA 5AV6C 3AZEC 3AZNB 3C1CC 5E5AB 5E5AC 4KUDD 5B40C 2NQBC 3LZ1D 1JFIB 3O62D 3LZ0A 3REJD 1F66A 3LELA 3AZMA 5B32D 5AV5D 4UUZB 1HQ3B 4J8WC 4J8UD 3VH5W 3REHC 3MGSA 4H9QB 5CP6A 3MGRD 3MVDD 3RELA 3X1UD 2FJ7B 3LZ0C 1F66B 4J8VD 3AZHD 1F66C 1U35B 3LELC 5F99D 3AZMC 4CSRB 3X1VA 5B1LD 1TZYA 3MGSC 1ZLAD 5CP6C 3C1BD 1S32B 1P3MB 1S32C 3VH6W 4R8PD 1KX3A 3AN2D 3MGPB 3AZGA 1KX4B 1BH8B 2BYKA 3UTAD 3X1VB 1P3KA 1EQZD 5B2JA 3X1VC 5B24D 3NQJB 4YM6A 1BH9B 3MGQB 5CPJA 1KX3C 5B0YD 5GSUD 2AROA 3VH5A 4LD9A 4YS3A 3TU4D 3B6GB 5B1MD 1P3LB 2CV5B 1P3KC 5B2JC 2CV5C 3AV2A 5B0ZD 3MNNA 3AFAB 3REKD 3AFAC 5AV5B 1BFMA 4YM6C 4XUJD 5CPJC 4WU8D 4QLCD 5CPIA 5GXQA 3KWQD 2AROC 4LD9C 3W99D 4YS3C 3AV2B 3MNNB 3AV2C 3MNNC 1M18B 3VH6A 5B2IB 1P34A 3AZND 2YFWB 5E5AD 5B40D 4KGCB 5CPIB 5AV8B 5CPIC 5GXQC 5AY8A 4Z5TA 5GT3B 5GT0A 5B31B 1M19B 4G92B 5CPKA 1P3AA 2F8NB 5B31C 4Z66A 3WAAB 1HQ3D 3AN2B 5BNXA 1WWSA 4AWLC 4JJNB 1P34C 5B31G 4ZBJB 2F8NG 3LZ0D 2FJ7D 5AY8C 3WA9B 1F66D 2YFVA 4HGAB 3WTPB 4Z66B 5GT0C 1U35D 5CPKC 1P3AC 3REIB 1KX5A 4Z66C 4WU9A 5BO0A 3W97A 1P3PA 3KXBA 3AV1B 4H9PA 2IO5B 3TU4B 5B1MB 4CAYA 1S32D 1P3MD 3B6FB 2HUEB 1P3GA 3MGPD 1H3OA 2HIOB 3UT9B 1KX4D 1KX5C 5BNVA 4WU9C 3UT9C 1M1AB 3X1VD 4DRAA 3W97C 3KXBC 2RVQC 3X1TA 5BT1D 3UTBA 1P3OB 5JRGA 4WZSB 3MGQD 1P3GC 5AV6B 3AZEB 3C1CB 3R45B 3W96A 5B40B 2NQBB 3B6GD 1P3LD 2CV5D 1AOIB 3AZLA 2F8NH 1AOIC 3X1TC 3AFAD 1P3BB 1P3IA 1P3FA 1P3BC 5JRGC 4J8WB 3W98A 4WV4B 3X1SA 3REHB 5DNNA 4H9SA 3W96C 3A6NA 4Z2MG 5DNMA 3LZ0B 3AZLC 3AV2D 3MNND 3LELB 1P3IB 3AZMB 1M18D 1P3IC 1P3FC 3AYWA 5B2ID 3W98C 3X1SC 5B33A 4KGCD 5CPID 5DNNC 5AV8D 5AVCA 4H9SC 3MGSB 3KUYA 3AZJA 5CP6B 4WNNA 4NE3A 5GT3D 4ZUXA 5B31D 1M19D 3RELB 2F8ND 3RELC 5DNMC 4X23A 3WAAD 3AZKA 1A7WA 3AYWC 3NQUA 4JJND 2LY8A 5B33C 1R4VA 1TZYB 5AVCC 1TZYC 3KUYC 3AZJC 3WA9D 4ZUXC 3WTPD 4Z66D 3REID 3AZFA 4NE5A 2NZDA 1KX3B 4X23C 3AZIA 3AZGB 1ID3A 3AZKC 5C3IC 3AZGC 2JSSA 2BYKB 3AV1D 2PYOA 1P3KB 5AVBA 5B2JB 3B6FD 3B0BA 2F8NK 4Z2MH 2BYMA 5JA4A 4YM6B 4WU9D 3AZFC 2HIOD 3UT9D 3AZIB 5CPJB 4KUDA 3AZIC 2NZDC 3LZ1A 1M1AD 1HTAA 1ID3C 3O62A 4LD9B 2AROB 3REJA 4YS3B 4H9RA 2PYOC 5B32A 5AVBC 1P3OD 4J8UA 4EO5C 4J8XA 5JA4B 3VH5T 5AV6D 3AZED 3C1CD 4KUDC 3MVDA 4M6BA 3LZ1C 3X1UA 2NQBD 5GXQB 3O62C 4J8VA 3AZHA 1AOID 3REJC 5F99A 1P3BD 4J8UC 4J8WD 4J8XC 5FUGA 4AWLB 1P34B 3REHD 3V9RA 1ZLAA 3C1BA 3MVDC 3X1UC 4R8PA 5AY8B 4Z5TB 5AV9A 3AZHC 4Z5TC 2L5AA 5GT0B 5F99C 3LELD 5CPKB 3VH6T 3AZMD 1P3AB 3UTAA 4KHAA 1P3ID 1TAFA 4H9OA 5BNXB 1EQZA 5B24A 1ZLAC 3MGSD 5CP6D
chains in the Genus database with same CATH superfamily
5AV9B 3RELD 4R8PC 5AV9C 4XZQA 2YFVB 5B0YA 5GSUA 1KX5B 3IP4C 4WU9B 1W2EA 5BO0B 1EQZC 1N1JA 1P3PB 3W97B 5B0ZA 3KXBB 5B24C 2Y2JA 1P3PC 1TZYD 4H9PB 3REKA 5G49A 4CAYB 4H9NA 4XZQB 4XUJA 4XZQC 1P3GB 4QLCA 3LJAA 1KX3D 5B0YC 5GSUC 3KWQA 3AZGD 1H3OB 3W99A 5BNVB 5BS7A 1P3KD 3WKJA 5B2JD 4E44A 5B0ZC 2CWEA 3B0DB 3REKC 3X1TB 3FDDA 3UTBB 3B0DC 4H9NB 5JRGB 3UTBC 3AZNA 2Y2IA 3AZFD 2NZDD 4YM6D 1ULYA 4XUJC 3LJAB 1KU5A 3AZID 5CPJD 1F1EA 3LJAC 3KWQC 3W99C 2AROD 3W96B 4LD9D 4E45A 5BS7C 4YS3D 3KFUG 3WKJC 4UUZA 3AZLB 1HQ3A 4NE6A 3H0RC 1P3FB 3AZNC 3W98B 2F2AC 4H9QA 3X1SB 5DNNB 2FJ7A 5GXQD 3WTPE 3EPKA 1U35A 3A6NB 3A6NC 5DNMB 1HQ3C 4CSRA 4J8XD 2J8PA 3AYWB 1P34D 5B33B 1S32A 1P3MA 5AVCB 2FJ7C 3KUYB 3AZJB 5AY8D 4Z5TD 4WNNB 3MGPA 4ZUXB 5GT0D 1U35C 5CPKD 1P3AD 5KDMA 1BH8A 1KX4A 4X23B 3AZKB 5C3IB 3NQUB 3H0LC 5CHLB 1P3MC 3NQJA 4NFTA 1BH9A 5AV9D 3MGQA 3MGPC 2FFFB 5KDMB 1KX4C 3AZFB 1KX5D 2NZDB 3B0CT 3EPJA 3B6GA 1P3LA 2CV5A 1ID3B 1P3PD 3W97D 3KXBD 2RVQD 5BT1C 3AFAA 2PYOB 5AVBB 5AV5A 4EO5B 1WWIA 3MGQC 4XZQD 2Y2PA 1P3GD 2BYMB 4KUDB 2Y2KA 3MGRA 3LZ1B 3B6GC 1P3LC 3O62B 3REJB 4H9RB 1M18A 5B32B 3X1TD 3UTBD 2Y2NA 5B32C 5B2IA 5JRGD 5AV5C 4J8UB 2YFWA 4J8XB 4KGCA 3LJAD 5AV8A 5B1LA 1B67A 5B32G 4DRBA 3MGRB 3W96D 3MVDB 5GT3A 1M19A 5B31A 3MGRC 3X1UB 3WKJD 2F8NA 3KSYA 4J8VB 3AZHB 3WAAA 3AZLD 3AN2A 4J8VC 2G5IC 5F99B 1M18C 1P3FD 4JJNA 5B2IC 3W98D 5FUGB 3X1SD 5B1LB 4KGCC 5AV8C 5B1LC 5DNND 3V9RB 1ZLAB 3AL0C 3C1BB 2Y2MA 3WA9A 5GT3C 3WTPA 3C1BC 1M19C 4G92C 3A6ND 3REIA 4R8PB 5DNMD 3WAAC 3AN2C 3UTAB 4KHAB 4JJNC 3UTAC 3AYWD 3AV1A 1TAFB 4H9OB 4UPKA 4ZBJC 5B1MA 3TU4A 1EQZB 5B33D 5B24B 3B6FA 5AVCD 3KUYD 3AZJD 3WA9C 4HGAC 3WTPC 4ZUXD 3REIC 2HIOA 3UT9A 1M1AA 2ZY3A 4X23D 4WU8A 5B0YB 5GSUB 3AZKD 3AV1C 2IO5C 3TU4C 5B1MC 1P3OA 1N1JB 5B0ZB 2DF4C 3REKB 3B6FC 5G49B 1Q9CA 2HUEC 4G91B 5AV6A 4G91C 3AZEA 3C1CA 3R45A 2HIOC 5E5AA 4XUJB 4WU8B 1M1AC 5B40A 4QLCB 2NQBA 4WU8C 1ID3D 4QLCC 3KWQB 1AOIA 1B6WA 1JFIA 3W99B 1P3BA 2PYOD 3WKJB 5AVBD 1P3OC 2VQRA 4J8WA 3B0CW 3REHA 5AV6C 2JE5A 3AZEC 3AZNB 3C1CC 5E5AB 5E5AC 4KUDD 3A1IA 5B40C 2NQBC 3LZ1D 1JFIB 3O62D 3LZ0A 3REJD 1F66A 3LELA 3AZMA 4DQYB 5B32D 5AV5D 4UUZB 1HQ3B 4J8WC 4J8UD 3VH5W 2ZY4A 2Y2QA 3REHC 3MGSA 4H9QB 5CP6A 3MGRD 3MVDD 3RELA 3X1UD 2FJ7B 3LZ0C 1F66B 4J8VD 3AZHD 1F66C 1U35B 3LELC 5F99D 3AZMC 4CSRB 3X1VA 5B1LD 1TZYA 3MGSC 1ZLAD 5CP6C 3C1BD 1S32B 1P3MB 1S32C 3VH6W 2Y2LA 4R8PD 1KX3A 3AN2D 3MGPB 3AZGA 1KX4B 1BH8B 2BYKA 3UTAD 2ZM5A 3X1VB 1P3KA 1EQZD 5B2JA 3X1VC 5B24D 3EPHA 1Z2CB 3NQJB 4YM6A 1BH9B 3MGQB 5CPJA 1KX3C 1PZRA 5B0YD 5GSUD 2AROA 3VH5A 4LD9A 4YS3A 3TU4D 3B6GB 5B1MD 1P3LB 2CV5B 1P3KC 5B2JC 2CV5C 3AV2A 5B0ZD 3MNNA 3AFAB 3REKD 3AFAC 5AV5B 1BFMA 1T3UA 4YM6C 4XUJD 5CPJC 4WU8D 4QLCD 5CPIA 5GXQA 3KWQD 2AROC 4LD9C 3W99D 4YS3C 3AV2B 3EG5B 3MNNB 3AV2C 3MNNC 2ZY2A 1M18B 3A1KA 3VH6A 5B2IB 1P34A 3AZND 2YFWB 5E5AD 5B40D 4KGCB 5CPIB 5AV8B 5CPIC 5GXQC 5AY8A 4Z5TA 2XD5A 5GT3B 5GT0A 5B31B 1M19B 4G92B 5CPKA 1P3AA 2F8NB 5B31C 4Z66A 3WAAB 1HQ3D 3AN2B 5BNXA 1WWSA 4AWLC 4JJNB 1P34C 5B31G 4ZBJB 2F8NG 2RIQA 3LZ0D 2FJ7D 5AY8C 3WA9B 1F66D 2YFVA 4HGAB 3WTPB 4Z66B 5GT0C 1U35D 5CPKC 1P3AC 3REIB 1KX5A 4Z66C 4WU9A 5BO0A 3W97A 1P3PA 3KXBA 4WJ3C 3AV1B 4H9PA 2IO5B 3TU4B 5B1MB 4CAYA 1S32D 1P3MD 3B6FB 2HUEB 1P3GA 3MGPD 2Y2GA 1H3OA 2HIOB 3UT9B 1KX4D 1KX5C 5BNVA 4WU9C 3UT9C 1M1AB 3X1VD 4DRAA 3W97C 3KXBC 2XD1A 2RVQC 3H0MC 3X1TA 5BT1D 3UTBA 1P3OB 5JRGA 4WZSB 3MGQD 1P3GC 5AV6B 3AZEB 3C1CB 3R45B 3W96A 5B40B 2NQBB 3B6GD 1P3LD 2CV5D 2G5HC 1AOIB 3AZLA 2F8NH 1AOIC 3X1TC 3AFAD 1P3BB 2JCHA 1P3IA 1P3FA 1P3BC 5JRGC 4J8WB 3W98A 4WV4B 3X1SA 3REHB 5DNNA 4H9SA 3W96C 3A6NA 4Z2MG 2Y2HA 5DNMA 3LZ0B 3AZLC 3AV2D 3MNND 3P5JB 3LELB 1P3IB 3AZMB 1M18D 1P3IC 1P3FC 3AYWA 5B2ID 3W98C 3X1SC 5B33A 4KGCD 5CPID 5DNNC 5AV8D 5AVCA 4H9SC 3MGSB 3KUYA 3AZJA 5CP6B 4WNNA 4NE3A 5GT3D 4ZUXA 5B31D 1M19D 3RELB 2F8ND 3RELC 5DNMC 4X23A 3WAAD 3AZKA 1A7WA 3AYWC 3NQUA 4JJND 2LY8A 5B33C 1R4VA 1TZYB 5AVCC 1TZYC 3KUYC 3AZJC 2ZY5A 3WA9D 4ZUXC 3WTPD 4Z66D 3REID 3AZFA 4NE5A 2NZDA 1KX3B 4X23C 3AZIA 3F6TA 3AZGB 1ID3A 3AZKC 5C3IC 3AZGC 2JSSA 2BYKB 3AV1D 2PYOA 1P3KB 5AVBA 5B2JB 3B6FD 3B0BA 2F8NK 4Z2MH 2BYMA 5JA4A 4YM6B 4WU9D 3AZFC 2HIOD 3UT9D 3AZIB 5CPJB 4KUDA 3AZIC 2NZDC 3LZ1A 1M1AD 1HTAA 1ID3C 3O62A 4LD9B 2AROB 3REJA 4YS3B 4H9RA 2PYOC 5B32A 5AVBC 1P3OD 4J8UA 4EO5C 4J8XA 5JA4B 3VH5T 5AV6D 3AZED 2BG1A 3C1CD 4KUDC 3MVDA 4M6BA 3LZ1C 3X1UA 2NQBD 5GXQB 3O62C 4J8VA 3AZHA 1AOID 3REJC 5F99A 1P3BD 4J8UC 4J8WD 4J8XC 5FUGA 2Y2OA 4AWLB 2DQNC 2W8SA 3REHD 1P34B 3V9RA 1ZLAA 3C1BA 3EPLA 3MVDC 3X1UC 4R8PA 5AY8B 2UWXA 4Z5TB 5AV9A 3AZHC 4Z5TC 2L5AA 5GT0B 5F99C 3LELD 5CPKB 3VH6T 3AZMD 1P3AB 3UTAA 4KHAA 1P3ID 1TAFA 4H9OA 5BNXB 1EQZA 5B24A 1ZLAC 3MGSD 5CP6D
chains in the Genus database with same CATH topology
5AV9B 3RELD 4R8PC 5AV9C 4XZQA 2YFVB 5B0YA 5GSUA 1KX5B 3IP4C 4WU9B 1W2EA 5BO0B 1EQZC 1N1JA 1P3PB 3W97B 5B0ZA 3KXBB 5B24C 2Y2JA 1P3PC 1TZYD 4H9PB 3REKA 5G49A 4CAYB 4H9NA 4XZQB 4XUJA 4XZQC 1P3GB 4QLCA 3LJAA 1KX3D 5B0YC 5GSUC 3KWQA 3AZGD 1H3OB 3W99A 5BNVB 5BS7A 1P3KD 3WKJA 5B2JD 4E44A 5B0ZC 2CWEA 3B0DB 3REKC 3X1TB 3FDDA 3UTBB 3B0DC 4H9NB 5JRGB 3UTBC 3AZNA 2Y2IA 3AZFD 2NZDD 4YM6D 1ULYA 4XUJC 3LJAB 1KU5A 3AZID 5CPJD 1F1EA 3LJAC 3KWQC 3W99C 2AROD 3W96B 4LD9D 4E45A 5BS7C 4YS3D 3KFUG 3WKJC 4UUZA 3AZLB 1HQ3A 4NE6A 3H0RC 1P3FB 3AZNC 3W98B 2F2AC 4H9QA 3X1SB 5DNNB 2FJ7A 5GXQD 3WTPE 3EPKA 1U35A 3A6NB 3A6NC 5DNMB 1HQ3C 4CSRA 4J8XD 2J8PA 3AYWB 1P34D 5B33B 1S32A 1P3MA 5AVCB 2FJ7C 3KUYB 3AZJB 5AY8D 4Z5TD 4WNNB 3MGPA 4ZUXB 5GT0D 1U35C 5CPKD 1P3AD 5KDMA 1BH8A 1KX4A 4X23B 3AZKB 5C3IB 3NQUB 3H0LC 5CHLB 1P3MC 3NQJA 4NFTA 1BH9A 5AV9D 3MGQA 3MGPC 2FFFB 5KDMB 1KX4C 3AZFB 1KX5D 2NZDB 3B0CT 3EPJA 3B6GA 1P3LA 2CV5A 1ID3B 1P3PD 3W97D 3KXBD 2RVQD 5BT1C 3AFAA 2PYOB 5AVBB 5AV5A 4EO5B 1WWIA 3MGQC 4XZQD 2Y2PA 1P3GD 2BYMB 4KUDB 2Y2KA 3MGRA 3LZ1B 3B6GC 1P3LC 3O62B 3REJB 4H9RB 1M18A 5B32B 3X1TD 3UTBD 2Y2NA 5B32C 5B2IA 5JRGD 5AV5C 4J8UB 2YFWA 4J8XB 4KGCA 3LJAD 5AV8A 5B1LA 1B67A 5B32G 4DRBA 3MGRB 3W96D 3MVDB 5GT3A 1M19A 5B31A 3MGRC 3X1UB 3WKJD 2F8NA 3KSYA 4J8VB 3AZHB 3WAAA 3AZLD 3AN2A 4J8VC 2G5IC 5F99B 1M18C 1P3FD 4JJNA 5B2IC 3W98D 5FUGB 3X1SD 5B1LB 4KGCC 5AV8C 5B1LC 5DNND 3V9RB 1ZLAB 3AL0C 3C1BB 2Y2MA 3WA9A 5GT3C 3WTPA 3C1BC 1M19C 4G92C 3A6ND 3REIA 4R8PB 5DNMD 3WAAC 3AN2C 3UTAB 4KHAB 4JJNC 3UTAC 3AYWD 3AV1A 1TAFB 4H9OB 4UPKA 4ZBJC 5B1MA 3TU4A 1EQZB 5B33D 5B24B 3B6FA 5AVCD 3KUYD 3AZJD 3WA9C 4HGAC 3WTPC 4ZUXD 3REIC 2HIOA 3UT9A 1M1AA 2ZY3A 4X23D 4WU8A 5B0YB 5GSUB 3AZKD 3AV1C 2IO5C 3TU4C 5B1MC 1P3OA 1N1JB 5B0ZB 2DF4C 3REKB 3B6FC 5G49B 1Q9CA 2HUEC 4G91B 5AV6A 4G91C 3AZEA 3C1CA 3R45A 2HIOC 5E5AA 4XUJB 4WU8B 1M1AC 5B40A 4QLCB 2NQBA 4WU8C 1ID3D 4QLCC 3KWQB 1AOIA 1B6WA 1JFIA 3W99B 1P3BA 2PYOD 3WKJB 5AVBD 1P3OC 2VQRA 4J8WA 3B0CW 3REHA 5AV6C 2JE5A 3AZEC 3AZNB 3C1CC 5E5AB 5E5AC 4KUDD 3A1IA 5B40C 2NQBC 3LZ1D 1JFIB 3O62D 3LZ0A 3REJD 1F66A 3LELA 3AZMA 4DQYB 5B32D 5AV5D 4UUZB 1HQ3B 4J8WC 4J8UD 3VH5W 2ZY4A 2Y2QA 3REHC 3MGSA 4H9QB 5CP6A 3MGRD 3MVDD 3RELA 3X1UD 2FJ7B 3LZ0C 1F66B 4J8VD 3AZHD 1F66C 1U35B 3LELC 5F99D 3AZMC 4CSRB 3X1VA 5B1LD 1TZYA 3MGSC 1ZLAD 5CP6C 3C1BD 1S32B 1P3MB 1S32C 3VH6W 2Y2LA 4R8PD 1KX3A 3AN2D 3MGPB 3AZGA 1KX4B 1BH8B 2BYKA 3UTAD 2ZM5A 3X1VB 1P3KA 1EQZD 5B2JA 3X1VC 5B24D 3EPHA 1Z2CB 3NQJB 4YM6A 1BH9B 3MGQB 5CPJA 1KX3C 1PZRA 5B0YD 5GSUD 2AROA 3VH5A 4LD9A 4YS3A 3TU4D 3B6GB 5B1MD 1P3LB 2CV5B 1P3KC 5B2JC 2CV5C 3AV2A 5B0ZD 3MNNA 3AFAB 3REKD 3AFAC 5AV5B 1BFMA 1T3UA 4YM6C 4XUJD 5CPJC 4WU8D 4QLCD 5CPIA 5GXQA 3KWQD 2AROC 4LD9C 3W99D 4YS3C 3AV2B 3EG5B 3MNNB 3AV2C 3MNNC 2ZY2A 1M18B 3A1KA 3VH6A 5B2IB 1P34A 3AZND 2YFWB 5E5AD 5B40D 4KGCB 5CPIB 5AV8B 5CPIC 5GXQC 5AY8A 4Z5TA 2XD5A 5GT3B 5GT0A 5B31B 1M19B 4G92B 5CPKA 1P3AA 2F8NB 5B31C 4Z66A 3WAAB 1HQ3D 3AN2B 5BNXA 1WWSA 4AWLC 4JJNB 1P34C 5B31G 4ZBJB 2F8NG 2RIQA 3LZ0D 2FJ7D 5AY8C 3WA9B 1F66D 2YFVA 4HGAB 3WTPB 4Z66B 5GT0C 1U35D 5CPKC 1P3AC 3REIB 1KX5A 4Z66C 4WU9A 5BO0A 3W97A 1P3PA 3KXBA 4WJ3C 3AV1B 4H9PA 2IO5B 3TU4B 5B1MB 4CAYA 1S32D 1P3MD 3B6FB 2HUEB 1P3GA 3MGPD 2Y2GA 1H3OA 2HIOB 3UT9B 1KX4D 1KX5C 5BNVA 4WU9C 3UT9C 1M1AB 3X1VD 4DRAA 3W97C 3KXBC 2XD1A 2RVQC 3H0MC 3X1TA 5BT1D 3UTBA 1P3OB 5JRGA 4WZSB 3MGQD 1P3GC 5AV6B 3AZEB 3C1CB 3R45B 3W96A 5B40B 2NQBB 3B6GD 1P3LD 2CV5D 2G5HC 1AOIB 3AZLA 2F8NH 1AOIC 3X1TC 3AFAD 1P3BB 2JCHA 1P3IA 1P3FA 1P3BC 5JRGC 4J8WB 3W98A 4WV4B 3X1SA 3REHB 5DNNA 4H9SA 3W96C 3A6NA 4Z2MG 2Y2HA 5DNMA 3LZ0B 3AZLC 3AV2D 3MNND 3P5JB 3LELB 1P3IB 3AZMB 1M18D 1P3IC 1P3FC 3AYWA 5B2ID 3W98C 3X1SC 5B33A 4KGCD 5CPID 5DNNC 5AV8D 5AVCA 4H9SC 3MGSB 3KUYA 3AZJA 5CP6B 4WNNA 4NE3A 5GT3D 4ZUXA 5B31D 1M19D 3RELB 2F8ND 3RELC 5DNMC 4X23A 3WAAD 3AZKA 1A7WA 3AYWC 3NQUA 4JJND 2LY8A 5B33C 1R4VA 1TZYB 5AVCC 1TZYC 3KUYC 3AZJC 2ZY5A 3WA9D 4ZUXC 3WTPD 4Z66D 3REID 3AZFA 4NE5A 2NZDA 1KX3B 4X23C 3AZIA 3F6TA 3AZGB 1ID3A 3AZKC 5C3IC 3AZGC 2JSSA 2BYKB 3AV1D 2PYOA 1P3KB 5AVBA 5B2JB 3B6FD 3B0BA 2F8NK 4Z2MH 2BYMA 5JA4A 4YM6B 4WU9D 3AZFC 2HIOD 3UT9D 3AZIB 5CPJB 4KUDA 3AZIC 2NZDC 3LZ1A 1M1AD 1HTAA 1ID3C 3O62A 4LD9B 2AROB 3REJA 4YS3B 4H9RA 2PYOC 5B32A 5AVBC 1P3OD 4J8UA 4EO5C 4J8XA 5JA4B 3VH5T 5AV6D 3AZED 2BG1A 3C1CD 4KUDC 3MVDA 4M6BA 3LZ1C 3X1UA 2NQBD 5GXQB 3O62C 4J8VA 3AZHA 1AOID 3REJC 5F99A 1P3BD 4J8UC 4J8WD 4J8XC 5FUGA 2Y2OA 4AWLB 2DQNC 2W8SA 3REHD 1P34B 3V9RA 1ZLAA 3C1BA 3EPLA 3MVDC 3X1UC 4R8PA 5AY8B 2UWXA 4Z5TB 5AV9A 3AZHC 4Z5TC 2L5AA 5GT0B 5F99C 3LELD 5CPKB 3VH6T 3AZMD 1P3AB 3UTAA 4KHAA 1P3ID 1TAFA 4H9OA 5BNXB 1EQZA 5B24A 1ZLAC 3MGSD 5CP6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 B;  3REL D;  4R8P C;  5AV9 C;  4XZQ A;  2YFV B;  5B0Y A;  5GSU A;  1KX5 B;  4WU9 B;  5BO0 B;  1EQZ C;  1N1J A;  1P3P B;  3W97 B;  5B0Z A;  3KXB B;  5B24 C;  1P3P C;  1TZY D;  4H9P B;  3REK A;  5G49 A;  4CAY B;  4H9N A;  4XZQ B;  4XUJ A;  4XZQ C;  1P3G B;  4QLC A;  3LJA A;  1KX3 D;  5B0Y C;  5GSU C;  3KWQ A;  3AZG D;  1H3O B;  3W99 A;  5BNV B;  5BS7 A;  1P3K D;  3WKJ A;  5B2J D;  4E44 A;  5B0Z C;  2CWE A;  3B0D B;  3REK C;  3X1T B;  3UTB B;  3B0D C;  4H9N B;  5JRG B;  3UTB C;  3AZN A;  3AZF D;  2NZD D;  4YM6 D;  1ULY A;  4XUJ C;  3LJA B;  1KU5 A;  3AZI D;  5CPJ D;  1F1E A;  3LJA C;  3KWQ C;  3W99 C;  2ARO D;  3W96 B;  4LD9 D;  4E45 A;  5BS7 C;  4YS3 D;  3WKJ C;  4UUZ A;  3AZL B;  1HQ3 A;  4NE6 A;  1P3F B;  3AZN C;  3W98 B;  4H9Q A;  3X1S B;  5DNN B;  2FJ7 A;  5GXQ D;  3WTP E;  1U35 A;  3A6N B;  3A6N C;  5DNM B;  1HQ3 C;  4CSR A;  4J8X D;  3AYW B;  1P34 D;  5B33 B;  1S32 A;  1P3M A;  5AVC B;  2FJ7 C;  3KUY B;  3AZJ B;  5AY8 D;  4Z5T D;  4WNN B;  3MGP A;  4ZUX B;  5GT0 D;  1U35 C;  5CPK D;  1P3A D;  5KDM A;  1BH8 A;  1KX4 A;  4X23 B;  3AZK B;  5C3I B;  3NQU B;  5CHL B;  1P3M C;  3NQJ A;  4NFT A;  1BH9 A;  5AV9 D;  3MGQ A;  3MGP C;  5KDM B;  1KX4 C;  3AZF B;  1KX5 D;  2NZD B;  3B0C T;  3B6G A;  1P3L A;  2CV5 A;  1ID3 B;  1P3P D;  3W97 D;  3KXB D;  2RVQ D;  5BT1 C;  3AFA A;  2PYO B;  5AVB B;  5AV5 A;  4EO5 B;  1WWI A;  3MGQ C;  4XZQ D;  1P3G D;  2BYM B;  4KUD B;  3MGR A;  3LZ1 B;  3B6G C;  1P3L C;  3O62 B;  3REJ B;  4H9R B;  1M18 A;  5B32 B;  3X1T D;  3UTB D;  5B32 C;  5B2I A;  5JRG D;  5AV5 C;  4J8U B;  2YFW A;  4J8X B;  4KGC A;  3LJA D;  5AV8 A;  5B1L A;  1B67 A;  5B32 G;  4DRB A;  3MGR B;  3W96 D;  3MVD B;  5GT3 A;  1M19 A;  5B31 A;  3MGR C;  3X1U B;  3WKJ D;  2F8N A;  3KSY A;  4J8V B;  3AZH B;  3WAA A;  3AZL D;  3AN2 A;  4J8V C;  5F99 B;  1M18 C;  1P3F D;  4JJN A;  5B2I C;  3W98 D;  5FUG B;  3X1S D;  5B1L B;  4KGC C;  5AV8 C;  5B1L C;  5DNN D;  3V9R B;  1ZLA B;  3C1B B;  3WA9 A;  5GT3 C;  3WTP A;  3C1B C;  1M19 C;  4G92 C;  3A6N D;  3REI A;  4R8P B;  5DNM D;  3WAA C;  3AN2 C;  3UTA B;  4KHA B;  4JJN C;  3UTA C;  3AYW D;  3AV1 A;  1TAF B;  4H9O B;  4ZBJ C;  3TU4 A;  5B1M A;  1EQZ B;  5B33 D;  5B24 B;  3B6F A;  5AVC D;  3KUY D;  3AZJ D;  3WA9 C;  4HGA C;  3WTP C;  4ZUX D;  3REI C;  2HIO A;  3UT9 A;  1M1A A;  4X23 D;  4WU8 A;  5B0Y B;  5GSU B;  3AZK D;  3AV1 C;  2IO5 C;  3TU4 C;  5B1M C;  1P3O A;  1N1J B;  5B0Z B;  3REK B;  3B6F C;  5G49 B;  1Q9C A;  2HUE C;  4G91 B;  5AV6 A;  4G91 C;  3AZE A;  3C1C A;  3R45 A;  2HIO C;  5E5A A;  4XUJ B;  4WU8 B;  1M1A C;  5B40 A;  4QLC B;  2NQB A;  4WU8 C;  1ID3 D;  4QLC C;  3KWQ B;  1AOI A;  1B6W A;  1JFI A;  3W99 B;  1P3B A;  2PYO D;  3WKJ B;  5AVB D;  1P3O C;  4J8W A;  3B0C W;  3REH A;  5AV6 C;  3AZE C;  3AZN B;  3C1C C;  5E5A B;  5E5A C;  4KUD D;  5B40 C;  2NQB C;  3LZ1 D;  1JFI B;  3O62 D;  3LZ0 A;  3REJ D;  1F66 A;  3LEL A;  3AZM A;  5B32 D;  5AV5 D;  4UUZ B;  1HQ3 B;  4J8W C;  4J8U D;  3VH5 W;  3REH C;  3MGS A;  4H9Q B;  5CP6 A;  3MGR D;  3MVD D;  3REL A;  3X1U D;  2FJ7 B;  3LZ0 C;  1F66 B;  4J8V D;  3AZH D;  1F66 C;  1U35 B;  3LEL C;  5F99 D;  3AZM C;  4CSR B;  3X1V A;  5B1L D;  1TZY A;  3MGS C;  1ZLA D;  5CP6 C;  3C1B D;  1S32 B;  1P3M B;  1S32 C;  3VH6 W;  4R8P D;  1KX3 A;  3AN2 D;  3MGP B;  3AZG A;  1KX4 B;  1BH8 B;  2BYK A;  3UTA D;  3X1V B;  1P3K A;  1EQZ D;  5B2J A;  3X1V C;  5B24 D;  3NQJ B;  4YM6 A;  1BH9 B;  3MGQ B;  5CPJ A;  1KX3 C;  5B0Y D;  5GSU D;  2ARO A;  3VH5 A;  4LD9 A;  4YS3 A;  3TU4 D;  3B6G B;  5B1M D;  1P3L B;  2CV5 B;  1P3K C;  5B2J C;  2CV5 C;  3AV2 A;  5B0Z D;  3MNN A;  3AFA B;  3REK D;  3AFA C;  5AV5 B;  1BFM A;  4YM6 C;  4XUJ D;  5CPJ C;  4WU8 D;  4QLC D;  5CPI A;  5GXQ A;  3KWQ D;  2ARO C;  4LD9 C;  3W99 D;  4YS3 C;  3AV2 B;  3MNN B;  3AV2 C;  3MNN C;  1M18 B;  3VH6 A;  5B2I B;  1P34 A;  3AZN D;  2YFW B;  5E5A D;  5B40 D;  4KGC B;  5CPI B;  5AV8 B;  5CPI C;  5GXQ C;  5AY8 A;  4Z5T A;  5GT3 B;  5GT0 A;  5B31 B;  1M19 B;  4G92 B;  5CPK A;  1P3A A;  2F8N B;  5B31 C;  4Z66 A;  3WAA B;  1HQ3 D;  3AN2 B;  5BNX A;  1WWS A;  4AWL C;  4JJN B;  1P34 C;  5B31 G;  4ZBJ B;  2F8N G;  3LZ0 D;  2FJ7 D;  5AY8 C;  3WA9 B;  1F66 D;  2YFV A;  4HGA B;  3WTP B;  4Z66 B;  5GT0 C;  1U35 D;  5CPK C;  1P3A C;  3REI B;  1KX5 A;  4Z66 C;  4WU9 A;  5BO0 A;  3W97 A;  1P3P A;  3KXB A;  3AV1 B;  4H9P A;  2IO5 B;  3TU4 B;  5B1M B;  4CAY A;  1S32 D;  1P3M D;  3B6F B;  2HUE B;  1P3G A;  3MGP D;  1H3O A;  2HIO B;  3UT9 B;  1KX4 D;  1KX5 C;  5BNV A;  4WU9 C;  3UT9 C;  1M1A B;  3X1V D;  4DRA A;  3W97 C;  3KXB C;  2RVQ C;  3X1T A;  5BT1 D;  3UTB A;  1P3O B;  5JRG A;  4WZS B;  3MGQ D;  1P3G C;  5AV6 B;  3AZE B;  3C1C B;  3R45 B;  3W96 A;  5B40 B;  2NQB B;  3B6G D;  1P3L D;  2CV5 D;  1AOI B;  3AZL A;  2F8N H;  1AOI C;  3X1T C;  3AFA D;  1P3B B;  1P3I A;  1P3F A;  1P3B C;  5JRG C;  4J8W B;  3W98 A;  4WV4 B;  3X1S A;  3REH B;  5DNN A;  4H9S A;  3W96 C;  3A6N A;  4Z2M G;  5DNM A;  3LZ0 B;  3AZL C;  3AV2 D;  3MNN D;  3LEL B;  1P3I B;  3AZM B;  1M18 D;  1P3I C;  1P3F C;  3AYW A;  5B2I D;  3W98 C;  3X1S C;  5B33 A;  4KGC D;  5CPI D;  5DNN C;  5AV8 D;  5AVC A;  4H9S C;  3MGS B;  3KUY A;  3AZJ A;  5CP6 B;  4WNN A;  4NE3 A;  5GT3 D;  4ZUX A;  5B31 D;  1M19 D;  3REL B;  2F8N D;  3REL C;  5DNM C;  4X23 A;  3WAA D;  3AZK A;  1A7W A;  3AYW C;  3NQU A;  4JJN D;  2LY8 A;  5B33 C;  1R4V A;  1TZY B;  5AVC C;  1TZY C;  3KUY C;  3AZJ C;  3WA9 D;  4ZUX C;  3WTP D;  4Z66 D;  3REI D;  3AZF A;  4NE5 A;  2NZD A;  1KX3 B;  4X23 C;  3AZI A;  3AZG B;  1ID3 A;  3AZK C;  5C3I C;  3AZG C;  2JSS A;  2BYK B;  3AV1 D;  2PYO A;  1P3K B;  5AVB A;  5B2J B;  3B6F D;  3B0B A;  2F8N K;  4Z2M H;  2BYM A;  5JA4 A;  4YM6 B;  4WU9 D;  3AZF C;  2HIO D;  3UT9 D;  3AZI B;  5CPJ B;  4KUD A;  3AZI C;  2NZD C;  3LZ1 A;  1M1A D;  1HTA A;  1ID3 C;  3O62 A;  4LD9 B;  2ARO B;  3REJ A;  4YS3 B;  4H9R A;  2PYO C;  5B32 A;  5AVB C;  1P3O D;  4J8U A;  4EO5 C;  4J8X A;  5JA4 B;  3VH5 T;  5AV6 D;  3AZE D;  3C1C D;  4KUD C;  3MVD A;  4M6B A;  3LZ1 C;  3X1U A;  2NQB D;  5GXQ B;  3O62 C;  4J8V A;  3AZH A;  1AOI D;  3REJ C;  5F99 A;  1P3B D;  4J8U C;  4J8W D;  4J8X C;  5FUG A;  4AWL B;  1P34 B;  3REH D;  3V9R A;  1ZLA A;  3C1B A;  3MVD C;  3X1U C;  4R8P A;  5AY8 B;  4Z5T B;  5AV9 A;  3AZH C;  4Z5T C;  2L5A A;  5GT0 B;  5F99 C;  3LEL D;  5CPK B;  3VH6 T;  3AZM D;  1P3A B;  3UTA A;  4KHA A;  1P3I D;  1TAF A;  4H9O A;  5BNX B;  1EQZ A;  5B24 A;  1ZLA C;  3MGS D;  5CP6 D; 
#chains in the Genus database with same CATH topology
 5AV9 B;  3REL D;  4R8P C;  5AV9 C;  4XZQ A;  2YFV B;  5B0Y A;  5GSU A;  1KX5 B;  3IP4 C;  4WU9 B;  1W2E A;  5BO0 B;  1EQZ C;  1N1J A;  1P3P B;  3W97 B;  5B0Z A;  3KXB B;  5B24 C;  2Y2J A;  1P3P C;  1TZY D;  4H9P B;  3REK A;  5G49 A;  4CAY B;  4H9N A;  4XZQ B;  4XUJ A;  4XZQ C;  1P3G B;  4QLC A;  3LJA A;  1KX3 D;  5B0Y C;  5GSU C;  3KWQ A;  3AZG D;  1H3O B;  3W99 A;  5BNV B;  5BS7 A;  1P3K D;  3WKJ A;  5B2J D;  4E44 A;  5B0Z C;  2CWE A;  3B0D B;  3REK C;  3X1T B;  3FDD A;  3UTB B;  3B0D C;  4H9N B;  5JRG B;  3UTB C;  3AZN A;  2Y2I A;  3AZF D;  2NZD D;  4YM6 D;  1ULY A;  4XUJ C;  3LJA B;  1KU5 A;  3AZI D;  5CPJ D;  1F1E A;  3LJA C;  3KWQ C;  3W99 C;  2ARO D;  3W96 B;  4LD9 D;  4E45 A;  5BS7 C;  4YS3 D;  3KFU G;  3WKJ C;  4UUZ A;  3AZL B;  1HQ3 A;  4NE6 A;  3H0R C;  1P3F B;  3AZN C;  3W98 B;  2F2A C;  4H9Q A;  3X1S B;  5DNN B;  2FJ7 A;  5GXQ D;  3WTP E;  3EPK A;  1U35 A;  3A6N B;  3A6N C;  5DNM B;  1HQ3 C;  4CSR A;  4J8X D;  2J8P A;  3AYW B;  1P34 D;  5B33 B;  1S32 A;  1P3M A;  5AVC B;  2FJ7 C;  3KUY B;  3AZJ B;  5AY8 D;  4Z5T D;  4WNN B;  3MGP A;  4ZUX B;  5GT0 D;  1U35 C;  5CPK D;  1P3A D;  5KDM A;  1BH8 A;  1KX4 A;  4X23 B;  3AZK B;  5C3I B;  3NQU B;  3H0L C;  5CHL B;  1P3M C;  3NQJ A;  4NFT A;  1BH9 A;  5AV9 D;  3MGQ A;  3MGP C;  2FFF B;  5KDM B;  1KX4 C;  3AZF B;  1KX5 D;  2NZD B;  3B0C T;  3EPJ A;  3B6G A;  1P3L A;  2CV5 A;  1ID3 B;  1P3P D;  3W97 D;  3KXB D;  2RVQ D;  5BT1 C;  3AFA A;  2PYO B;  5AVB B;  5AV5 A;  4EO5 B;  1WWI A;  3MGQ C;  4XZQ D;  2Y2P A;  1P3G D;  2BYM B;  4KUD B;  2Y2K A;  3MGR A;  3LZ1 B;  3B6G C;  1P3L C;  3O62 B;  3REJ B;  4H9R B;  1M18 A;  5B32 B;  3X1T D;  3UTB D;  2Y2N A;  5B32 C;  5B2I A;  5JRG D;  5AV5 C;  4J8U B;  2YFW A;  4J8X B;  4KGC A;  3LJA D;  5AV8 A;  5B1L A;  1B67 A;  5B32 G;  4DRB A;  3MGR B;  3W96 D;  3MVD B;  5GT3 A;  1M19 A;  5B31 A;  3MGR C;  3X1U B;  3WKJ D;  2F8N A;  3KSY A;  4J8V B;  3AZH B;  3WAA A;  3AZL D;  3AN2 A;  4J8V C;  2G5I C;  5F99 B;  1M18 C;  1P3F D;  4JJN A;  5B2I C;  3W98 D;  5FUG B;  3X1S D;  5B1L B;  4KGC C;  5AV8 C;  5B1L C;  5DNN D;  3V9R B;  1ZLA B;  3AL0 C;  3C1B B;  2Y2M A;  3WA9 A;  5GT3 C;  3WTP A;  3C1B C;  1M19 C;  4G92 C;  3A6N D;  3REI A;  4R8P B;  5DNM D;  3WAA C;  3AN2 C;  3UTA B;  4KHA B;  4JJN C;  3UTA C;  3AYW D;  3AV1 A;  1TAF B;  4H9O B;  4UPK A;  4ZBJ C;  5B1M A;  3TU4 A;  1EQZ B;  5B33 D;  5B24 B;  3B6F A;  5AVC D;  3KUY D;  3AZJ D;  3WA9 C;  4HGA C;  3WTP C;  4ZUX D;  3REI C;  2HIO A;  3UT9 A;  1M1A A;  2ZY3 A;  4X23 D;  4WU8 A;  5B0Y B;  5GSU B;  3AZK D;  3AV1 C;  2IO5 C;  3TU4 C;  5B1M C;  1P3O A;  1N1J B;  5B0Z B;  2DF4 C;  3REK B;  3B6F C;  5G49 B;  1Q9C A;  2HUE C;  4G91 B;  5AV6 A;  4G91 C;  3AZE A;  3C1C A;  3R45 A;  2HIO C;  5E5A A;  4XUJ B;  4WU8 B;  1M1A C;  5B40 A;  4QLC B;  2NQB A;  4WU8 C;  1ID3 D;  4QLC C;  3KWQ B;  1AOI A;  1B6W A;  1JFI A;  3W99 B;  1P3B A;  2PYO D;  3WKJ B;  5AVB D;  1P3O C;  2VQR A;  4J8W A;  3B0C W;  3REH A;  5AV6 C;  2JE5 A;  3AZE C;  3AZN B;  3C1C C;  5E5A B;  5E5A C;  4KUD D;  3A1I A;  5B40 C;  2NQB C;  3LZ1 D;  1JFI B;  3O62 D;  3LZ0 A;  3REJ D;  1F66 A;  3LEL A;  3AZM A;  4DQY B;  5B32 D;  5AV5 D;  4UUZ B;  1HQ3 B;  4J8W C;  4J8U D;  3VH5 W;  2ZY4 A;  2Y2Q A;  3REH C;  3MGS A;  4H9Q B;  5CP6 A;  3MGR D;  3MVD D;  3REL A;  3X1U D;  2FJ7 B;  3LZ0 C;  1F66 B;  4J8V D;  3AZH D;  1F66 C;  1U35 B;  3LEL C;  5F99 D;  3AZM C;  4CSR B;  3X1V A;  5B1L D;  1TZY A;  3MGS C;  1ZLA D;  5CP6 C;  3C1B D;  1S32 B;  1P3M B;  1S32 C;  3VH6 W;  2Y2L A;  4R8P D;  1KX3 A;  3AN2 D;  3MGP B;  3AZG A;  1KX4 B;  1BH8 B;  2BYK A;  3UTA D;  2ZM5 A;  3X1V B;  1P3K A;  1EQZ D;  5B2J A;  3X1V C;  5B24 D;  3EPH A;  1Z2C B;  3NQJ B;  4YM6 A;  1BH9 B;  3MGQ B;  5CPJ A;  1KX3 C;  1PZR A;  5B0Y D;  5GSU D;  2ARO A;  3VH5 A;  4LD9 A;  4YS3 A;  3TU4 D;  3B6G B;  5B1M D;  1P3L B;  2CV5 B;  1P3K C;  5B2J C;  2CV5 C;  3AV2 A;  5B0Z D;  3MNN A;  3AFA B;  3REK D;  3AFA C;  5AV5 B;  1BFM A;  1T3U A;  4YM6 C;  4XUJ D;  5CPJ C;  4WU8 D;  4QLC D;  5CPI A;  5GXQ A;  3KWQ D;  2ARO C;  4LD9 C;  3W99 D;  4YS3 C;  3AV2 B;  3EG5 B;  3MNN B;  3AV2 C;  3MNN C;  2ZY2 A;  1M18 B;  3A1K A;  3VH6 A;  5B2I B;  1P34 A;  3AZN D;  2YFW B;  5E5A D;  5B40 D;  4KGC B;  5CPI B;  5AV8 B;  5CPI C;  5GXQ C;  5AY8 A;  4Z5T A;  2XD5 A;  5GT3 B;  5GT0 A;  5B31 B;  1M19 B;  4G92 B;  5CPK A;  1P3A A;  2F8N B;  5B31 C;  4Z66 A;  3WAA B;  1HQ3 D;  3AN2 B;  5BNX A;  1WWS A;  4AWL C;  4JJN B;  1P34 C;  5B31 G;  4ZBJ B;  2F8N G;  2RIQ A;  3LZ0 D;  2FJ7 D;  5AY8 C;  3WA9 B;  1F66 D;  2YFV A;  4HGA B;  3WTP B;  4Z66 B;  5GT0 C;  1U35 D;  5CPK C;  1P3A C;  3REI B;  1KX5 A;  4Z66 C;  4WU9 A;  5BO0 A;  3W97 A;  1P3P A;  3KXB A;  4WJ3 C;  3AV1 B;  4H9P A;  2IO5 B;  3TU4 B;  5B1M B;  4CAY A;  1S32 D;  1P3M D;  3B6F B;  2HUE B;  1P3G A;  3MGP D;  2Y2G A;  1H3O A;  2HIO B;  3UT9 B;  1KX4 D;  1KX5 C;  5BNV A;  4WU9 C;  3UT9 C;  1M1A B;  3X1V D;  4DRA A;  3W97 C;  3KXB C;  2XD1 A;  2RVQ C;  3H0M C;  3X1T A;  5BT1 D;  3UTB A;  1P3O B;  5JRG A;  4WZS B;  3MGQ D;  1P3G C;  5AV6 B;  3AZE B;  3C1C B;  3R45 B;  3W96 A;  5B40 B;  2NQB B;  3B6G D;  1P3L D;  2CV5 D;  2G5H C;  1AOI B;  3AZL A;  2F8N H;  1AOI C;  3X1T C;  3AFA D;  1P3B B;  2JCH A;  1P3I A;  1P3F A;  1P3B C;  5JRG C;  4J8W B;  3W98 A;  4WV4 B;  3X1S A;  3REH B;  5DNN A;  4H9S A;  3W96 C;  3A6N A;  4Z2M G;  2Y2H A;  5DNM A;  3LZ0 B;  3AZL C;  3AV2 D;  3MNN D;  3P5J B;  3LEL B;  1P3I B;  3AZM B;  1M18 D;  1P3I C;  1P3F C;  3AYW A;  5B2I D;  3W98 C;  3X1S C;  5B33 A;  4KGC D;  5CPI D;  5DNN C;  5AV8 D;  5AVC A;  4H9S C;  3MGS B;  3KUY A;  3AZJ A;  5CP6 B;  4WNN A;  4NE3 A;  5GT3 D;  4ZUX A;  5B31 D;  1M19 D;  3REL B;  2F8N D;  3REL C;  5DNM C;  4X23 A;  3WAA D;  3AZK A;  1A7W A;  3AYW C;  3NQU A;  4JJN D;  2LY8 A;  5B33 C;  1R4V A;  1TZY B;  5AVC C;  1TZY C;  3KUY C;  3AZJ C;  2ZY5 A;  3WA9 D;  4ZUX C;  3WTP D;  4Z66 D;  3REI D;  3AZF A;  4NE5 A;  2NZD A;  1KX3 B;  4X23 C;  3AZI A;  3F6T A;  3AZG B;  1ID3 A;  3AZK C;  5C3I C;  3AZG C;  2JSS A;  2BYK B;  3AV1 D;  2PYO A;  1P3K B;  5AVB A;  5B2J B;  3B6F D;  3B0B A;  2F8N K;  4Z2M H;  2BYM A;  5JA4 A;  4YM6 B;  4WU9 D;  3AZF C;  2HIO D;  3UT9 D;  3AZI B;  5CPJ B;  4KUD A;  3AZI C;  2NZD C;  3LZ1 A;  1M1A D;  1HTA A;  1ID3 C;  3O62 A;  4LD9 B;  2ARO B;  3REJ A;  4YS3 B;  4H9R A;  2PYO C;  5B32 A;  5AVB C;  1P3O D;  4J8U A;  4EO5 C;  4J8X A;  5JA4 B;  3VH5 T;  5AV6 D;  3AZE D;  2BG1 A;  3C1C D;  4KUD C;  3MVD A;  4M6B A;  3LZ1 C;  3X1U A;  2NQB D;  5GXQ B;  3O62 C;  4J8V A;  3AZH A;  1AOI D;  3REJ C;  5F99 A;  1P3B D;  4J8U C;  4J8W D;  4J8X C;  5FUG A;  2Y2O A;  4AWL B;  2DQN C;  2W8S A;  3REH D;  1P34 B;  3V9R A;  1ZLA A;  3C1B A;  3EPL A;  3MVD C;  3X1U C;  4R8P A;  5AY8 B;  2UWX A;  4Z5T B;  5AV9 A;  3AZH C;  4Z5T C;  2L5A A;  5GT0 B;  5F99 C;  3LEL D;  5CPK B;  3VH6 T;  3AZM D;  1P3A B;  3UTA A;  4KHA A;  1P3I D;  1TAF A;  4H9O A;  5BNX B;  1EQZ A;  5B24 A;  1ZLA C;  3MGS D;  5CP6 D; 
#chains in the Genus database with same CATH homology
 5AV9 B;  3REL D;  4R8P C;  5AV9 C;  4XZQ A;  2YFV B;  5B0Y A;  5GSU A;  1KX5 B;  3IP4 C;  4WU9 B;  1W2E A;  5BO0 B;  1EQZ C;  1N1J A;  1P3P B;  3W97 B;  5B0Z A;  3KXB B;  5B24 C;  2Y2J A;  1P3P C;  1TZY D;  4H9P B;  3REK A;  5G49 A;  4CAY B;  4H9N A;  4XZQ B;  4XUJ A;  4XZQ C;  1P3G B;  4QLC A;  3LJA A;  1KX3 D;  5B0Y C;  5GSU C;  3KWQ A;  3AZG D;  1H3O B;  3W99 A;  5BNV B;  5BS7 A;  1P3K D;  3WKJ A;  5B2J D;  4E44 A;  5B0Z C;  2CWE A;  3B0D B;  3REK C;  3X1T B;  3FDD A;  3UTB B;  3B0D C;  4H9N B;  5JRG B;  3UTB C;  3AZN A;  2Y2I A;  3AZF D;  2NZD D;  4YM6 D;  1ULY A;  4XUJ C;  3LJA B;  1KU5 A;  3AZI D;  5CPJ D;  1F1E A;  3LJA C;  3KWQ C;  3W99 C;  2ARO D;  3W96 B;  4LD9 D;  4E45 A;  5BS7 C;  4YS3 D;  3KFU G;  3WKJ C;  4UUZ A;  3AZL B;  1HQ3 A;  4NE6 A;  3H0R C;  1P3F B;  3AZN C;  3W98 B;  2F2A C;  4H9Q A;  3X1S B;  5DNN B;  2FJ7 A;  5GXQ D;  3WTP E;  3EPK A;  1U35 A;  3A6N B;  3A6N C;  5DNM B;  1HQ3 C;  4CSR A;  4J8X D;  2J8P A;  3AYW B;  1P34 D;  5B33 B;  1S32 A;  1P3M A;  5AVC B;  2FJ7 C;  3KUY B;  3AZJ B;  5AY8 D;  4Z5T D;  4WNN B;  3MGP A;  4ZUX B;  5GT0 D;  1U35 C;  5CPK D;  1P3A D;  5KDM A;  1BH8 A;  1KX4 A;  4X23 B;  3AZK B;  5C3I B;  3NQU B;  3H0L C;  5CHL B;  1P3M C;  3NQJ A;  4NFT A;  1BH9 A;  5AV9 D;  3MGQ A;  3MGP C;  2FFF B;  5KDM B;  1KX4 C;  3AZF B;  1KX5 D;  2NZD B;  3B0C T;  3EPJ A;  3B6G A;  1P3L A;  2CV5 A;  1ID3 B;  1P3P D;  3W97 D;  3KXB D;  2RVQ D;  5BT1 C;  3AFA A;  2PYO B;  5AVB B;  5AV5 A;  4EO5 B;  1WWI A;  3MGQ C;  4XZQ D;  2Y2P A;  1P3G D;  2BYM B;  4KUD B;  2Y2K A;  3MGR A;  3LZ1 B;  3B6G C;  1P3L C;  3O62 B;  3REJ B;  4H9R B;  1M18 A;  5B32 B;  3X1T D;  3UTB D;  2Y2N A;  5B32 C;  5B2I A;  5JRG D;  5AV5 C;  4J8U B;  2YFW A;  4J8X B;  4KGC A;  3LJA D;  5AV8 A;  5B1L A;  1B67 A;  5B32 G;  4DRB A;  3MGR B;  3W96 D;  3MVD B;  5GT3 A;  1M19 A;  5B31 A;  3MGR C;  3X1U B;  3WKJ D;  2F8N A;  3KSY A;  4J8V B;  3AZH B;  3WAA A;  3AZL D;  3AN2 A;  4J8V C;  2G5I C;  5F99 B;  1M18 C;  1P3F D;  4JJN A;  5B2I C;  3W98 D;  5FUG B;  3X1S D;  5B1L B;  4KGC C;  5AV8 C;  5B1L C;  5DNN D;  3V9R B;  1ZLA B;  3AL0 C;  3C1B B;  2Y2M A;  3WA9 A;  5GT3 C;  3WTP A;  3C1B C;  1M19 C;  4G92 C;  3A6N D;  3REI A;  4R8P B;  5DNM D;  3WAA C;  3AN2 C;  3UTA B;  4KHA B;  4JJN C;  3UTA C;  3AYW D;  3AV1 A;  1TAF B;  4H9O B;  4UPK A;  4ZBJ C;  5B1M A;  3TU4 A;  1EQZ B;  5B33 D;  5B24 B;  3B6F A;  5AVC D;  3KUY D;  3AZJ D;  3WA9 C;  4HGA C;  3WTP C;  4ZUX D;  3REI C;  2HIO A;  3UT9 A;  1M1A A;  2ZY3 A;  4X23 D;  4WU8 A;  5B0Y B;  5GSU B;  3AZK D;  3AV1 C;  2IO5 C;  3TU4 C;  5B1M C;  1P3O A;  1N1J B;  5B0Z B;  2DF4 C;  3REK B;  3B6F C;  5G49 B;  1Q9C A;  2HUE C;  4G91 B;  5AV6 A;  4G91 C;  3AZE A;  3C1C A;  3R45 A;  2HIO C;  5E5A A;  4XUJ B;  4WU8 B;  1M1A C;  5B40 A;  4QLC B;  2NQB A;  4WU8 C;  1ID3 D;  4QLC C;  3KWQ B;  1AOI A;  1B6W A;  1JFI A;  3W99 B;  1P3B A;  2PYO D;  3WKJ B;  5AVB D;  1P3O C;  2VQR A;  4J8W A;  3B0C W;  3REH A;  5AV6 C;  2JE5 A;  3AZE C;  3AZN B;  3C1C C;  5E5A B;  5E5A C;  4KUD D;  3A1I A;  5B40 C;  2NQB C;  3LZ1 D;  1JFI B;  3O62 D;  3LZ0 A;  3REJ D;  1F66 A;  3LEL A;  3AZM A;  4DQY B;  5B32 D;  5AV5 D;  4UUZ B;  1HQ3 B;  4J8W C;  4J8U D;  3VH5 W;  2ZY4 A;  2Y2Q A;  3REH C;  3MGS A;  4H9Q B;  5CP6 A;  3MGR D;  3MVD D;  3REL A;  3X1U D;  2FJ7 B;  3LZ0 C;  1F66 B;  4J8V D;  3AZH D;  1F66 C;  1U35 B;  3LEL C;  5F99 D;  3AZM C;  4CSR B;  3X1V A;  5B1L D;  1TZY A;  3MGS C;  1ZLA D;  5CP6 C;  3C1B D;  1S32 B;  1P3M B;  1S32 C;  3VH6 W;  2Y2L A;  4R8P D;  1KX3 A;  3AN2 D;  3MGP B;  3AZG A;  1KX4 B;  1BH8 B;  2BYK A;  3UTA D;  2ZM5 A;  3X1V B;  1P3K A;  1EQZ D;  5B2J A;  3X1V C;  5B24 D;  3EPH A;  1Z2C B;  3NQJ B;  4YM6 A;  1BH9 B;  3MGQ B;  5CPJ A;  1KX3 C;  1PZR A;  5B0Y D;  5GSU D;  2ARO A;  3VH5 A;  4LD9 A;  4YS3 A;  3TU4 D;  3B6G B;  5B1M D;  1P3L B;  2CV5 B;  1P3K C;  5B2J C;  2CV5 C;  3AV2 A;  5B0Z D;  3MNN A;  3AFA B;  3REK D;  3AFA C;  5AV5 B;  1BFM A;  1T3U A;  4YM6 C;  4XUJ D;  5CPJ C;  4WU8 D;  4QLC D;  5CPI A;  5GXQ A;  3KWQ D;  2ARO C;  4LD9 C;  3W99 D;  4YS3 C;  3AV2 B;  3EG5 B;  3MNN B;  3AV2 C;  3MNN C;  2ZY2 A;  1M18 B;  3A1K A;  3VH6 A;  5B2I B;  1P34 A;  3AZN D;  2YFW B;  5E5A D;  5B40 D;  4KGC B;  5CPI B;  5AV8 B;  5CPI C;  5GXQ C;  5AY8 A;  4Z5T A;  2XD5 A;  5GT3 B;  5GT0 A;  5B31 B;  1M19 B;  4G92 B;  5CPK A;  1P3A A;  2F8N B;  5B31 C;  4Z66 A;  3WAA B;  1HQ3 D;  3AN2 B;  5BNX A;  1WWS A;  4AWL C;  4JJN B;  1P34 C;  5B31 G;  4ZBJ B;  2F8N G;  2RIQ A;  3LZ0 D;  2FJ7 D;  5AY8 C;  3WA9 B;  1F66 D;  2YFV A;  4HGA B;  3WTP B;  4Z66 B;  5GT0 C;  1U35 D;  5CPK C;  1P3A C;  3REI B;  1KX5 A;  4Z66 C;  4WU9 A;  5BO0 A;  3W97 A;  1P3P A;  3KXB A;  4WJ3 C;  3AV1 B;  4H9P A;  2IO5 B;  3TU4 B;  5B1M B;  4CAY A;  1S32 D;  1P3M D;  3B6F B;  2HUE B;  1P3G A;  3MGP D;  2Y2G A;  1H3O A;  2HIO B;  3UT9 B;  1KX4 D;  1KX5 C;  5BNV A;  4WU9 C;  3UT9 C;  1M1A B;  3X1V D;  4DRA A;  3W97 C;  3KXB C;  2XD1 A;  2RVQ C;  3H0M C;  3X1T A;  5BT1 D;  3UTB A;  1P3O B;  5JRG A;  4WZS B;  3MGQ D;  1P3G C;  5AV6 B;  3AZE B;  3C1C B;  3R45 B;  3W96 A;  5B40 B;  2NQB B;  3B6G D;  1P3L D;  2CV5 D;  2G5H C;  1AOI B;  3AZL A;  2F8N H;  1AOI C;  3X1T C;  3AFA D;  1P3B B;  2JCH A;  1P3I A;  1P3F A;  1P3B C;  5JRG C;  4J8W B;  3W98 A;  4WV4 B;  3X1S A;  3REH B;  5DNN A;  4H9S A;  3W96 C;  3A6N A;  4Z2M G;  2Y2H A;  5DNM A;  3LZ0 B;  3AZL C;  3AV2 D;  3MNN D;  3P5J B;  3LEL B;  1P3I B;  3AZM B;  1M18 D;  1P3I C;  1P3F C;  3AYW A;  5B2I D;  3W98 C;  3X1S C;  5B33 A;  4KGC D;  5CPI D;  5DNN C;  5AV8 D;  5AVC A;  4H9S C;  3MGS B;  3KUY A;  3AZJ A;  5CP6 B;  4WNN A;  4NE3 A;  5GT3 D;  4ZUX A;  5B31 D;  1M19 D;  3REL B;  2F8N D;  3REL C;  5DNM C;  4X23 A;  3WAA D;  3AZK A;  1A7W A;  3AYW C;  3NQU A;  4JJN D;  2LY8 A;  5B33 C;  1R4V A;  1TZY B;  5AVC C;  1TZY C;  3KUY C;  3AZJ C;  2ZY5 A;  3WA9 D;  4ZUX C;  3WTP D;  4Z66 D;  3REI D;  3AZF A;  4NE5 A;  2NZD A;  1KX3 B;  4X23 C;  3AZI A;  3F6T A;  3AZG B;  1ID3 A;  3AZK C;  5C3I C;  3AZG C;  2JSS A;  2BYK B;  3AV1 D;  2PYO A;  1P3K B;  5AVB A;  5B2J B;  3B6F D;  3B0B A;  2F8N K;  4Z2M H;  2BYM A;  5JA4 A;  4YM6 B;  4WU9 D;  3AZF C;  2HIO D;  3UT9 D;  3AZI B;  5CPJ B;  4KUD A;  3AZI C;  2NZD C;  3LZ1 A;  1M1A D;  1HTA A;  1ID3 C;  3O62 A;  4LD9 B;  2ARO B;  3REJ A;  4YS3 B;  4H9R A;  2PYO C;  5B32 A;  5AVB C;  1P3O D;  4J8U A;  4EO5 C;  4J8X A;  5JA4 B;  3VH5 T;  5AV6 D;  3AZE D;  2BG1 A;  3C1C D;  4KUD C;  3MVD A;  4M6B A;  3LZ1 C;  3X1U A;  2NQB D;  5GXQ B;  3O62 C;  4J8V A;  3AZH A;  1AOI D;  3REJ C;  5F99 A;  1P3B D;  4J8U C;  4J8W D;  4J8X C;  5FUG A;  2Y2O A;  4AWL B;  2DQN C;  2W8S A;  3REH D;  1P34 B;  3V9R A;  1ZLA A;  3C1B A;  3EPL A;  3MVD C;  3X1U C;  4R8P A;  5AY8 B;  2UWX A;  4Z5T B;  5AV9 A;  3AZH C;  4Z5T C;  2L5A A;  5GT0 B;  5F99 C;  3LEL D;  5CPK B;  3VH6 T;  3AZM D;  1P3A B;  3UTA A;  4KHA A;  1P3I D;  1TAF A;  4H9O A;  5BNX B;  1EQZ A;  5B24 A;  1ZLA C;  3MGS D;  5CP6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...