1BH9A

Htafii18/htafii28 heterodimer crystal structure with bound pcmbs
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation complex
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh9A00
3AZLC 4J8XC 5B1MB 5CP6D 3MGQA 5B0YD 2F8ND 4J8WB 5AVCB 1M18B 5AV9D 3AFAB 3MNNA 3B6FA 1M1AB 3REKD 4QLCB 3REJC 3LZ1B 3VH6W 3WAAC 4Z2MG 3MGPA 2HUEB 4KUDD 5JRGB 3UTBC 1TZYB 3MVDA 1KX4D 3AZEC 1P3IA 1P3KC 1P34C 2HIOD 4JJND 2BYKA 3AZKD 4X23C 3REID 2NZDB 3W99C 5F99A 2AROA 4NE5A 4J8VB 3TU4A 3MGSD 5B32C 1M19D 3WTPB 3X1TA 4WU8B 1HQ3B 3AZHD 1AOIA 3W97B 3MGRA 4ZUXC 2NQBB 4Z66B 3NQJB 5DNMA 3MNND 1TAFB 4DRAA 5GXQC 4AWLC 5AV5A 4CAYB 3AZGB 4J8XB 2IO5C 4NFTA 3AYWD 4NE6A 4G92C 5BO0B 3AZFC 1P3LB 1KX5D 5GT3C 1TZYA 3REHB 2PYOB 1U35A 4Z5TC 4H9NA 5CPJA 3W98D 5AY8C 5B31B 1KX3A 1EQZC 3WAAB 3C1CA 1H3OB 5AVBA 3UTBB 1AOID 4UUZA 2LY8A 1R4VA 3X1SB 5DNMD 4LD9C 3LZ0C 5GT0A 3RELA 3UT9B 3W99B 3W96C 3KUYD 3C1BC 1F66C 4E45A 4H9QA 1BH8A 1ULYA 3AZLA 4J8XA 3B6GC 1P3BC 4ZUXB 5CPKD 4HGAB 1P3PD 5G49A 5B2IC 3AZND 4WU9B 2BYMA 3AZJC 3O62A 5CPJD 3A6ND 4KHAB 5B1MC 3VH6A 1S32D 3C1CD 5B33C 2JSSA 3REJA 5AV8B 1P3OD 3WAAA 2F8NK 1M18C 2F8NB 3R45B 4H9PB 1M1AC 4QLCC 2CV5B 2RVQD 1ID3C 4Z5TB 3AZEA 1P3KA 1ZLAC 1P34A 5GT0D 3LZ1C 3WA9D 3REKB 4WV4B 4X23A 2HUEC 5JRGC 3AZLD 4KUDB 5B32A 1WWIA 4YS3C 5B0ZD 2YFWB 4WNNB 5JA4B 4R8PB 4ZUXA 1JFIB 4WZSB 4LD9B 5DNNC 3O62D 3B0BA 1Q9CA 4J8VC 3AZMD 3B0DB 5CPID 3WTPC 1F66B 4WU8C 1HQ3C 3REJD 5GXQA 5AV6C 3MGSB 4KHAA 5BT1C 3W97C 1M19B 3B6GB 3AZHB 1HTAA 2FJ7B 2NQBC 4Z66C 5B40C 5B2IB 3AZFA 4ZBJB 3AV2C 5GT3A 3AZED 1P3KD 1P34D 5B2JB 3AZGC 3WKJD 3NQUA 4Z5TA 5B33B 5AY8A 1EQZA 1P3LC 2YFVA 5B32D 3AYWB 3REHC 1KX5B 2PYOC 1P3FB 3X1UD 4XZQC 1ID3B 5B31C 1ZLAB 3KXBD 4WNNA 4J8UC 4DRBA 3LZ0A 3AZID 5B24B 3W96A 3C1BA 1F66A 3X1SC 4CSRA 4YS3B 1P3GD 4XUJB 3AZFD 3B6GA 3AN2D 1P3BA 5E5AD 5DNNB 3UT9C 5B2IA 3LJAB 3AZJA 3MGQD 5AY8D 5AV6B 1EQZD 5B1LB 5B1MA 4HGAC 4WU9C 5CPKB 3B6FD 5B40B 4J8WA 5AVCA 1P3PB 1M18A 3AV2B 3AFAA 1N1JB 3AZNB 3X1VC 1M1AA 4QLCA 1P3MC 3LZ0D 1ID3A 3MGPD 1ZLAA 5AV8C 1A7WA 3LZ1A 4H9OB 3W96D 3LELB 5B0YC 5GSUB 3MVDD 3C1BD 1P3OB 1P3ID 5JRGA 1P3AB 3VH5T 2L5AA 5AV9C 2CV5C 4XZQB 3AV1B 5F99D 2AROD 5BNXB 4YM6B 5KDMB 3REKC 2NZDA 3TU4D 4J8UB 3AZJD 3WA9B 3X1TD 4J8VA 4KUDC 3MGRD 3UTAB 3WTPA 4WU8A 1HQ3A 5AV6A 3W97A 3WTPE 4R8PC 3V9RB 5C3IB 5B0ZB 5AVCD 4J8WD 5BNVB 3AFAD 2NQBA 4Z66A 3NQJA 3B0DC 5AV5D 1M1AD 1TAFA 3MGSC 5CPIB 3LZ1D 1M19C 4CAYA 3AZGA 3AZHC 1WWSA 5JRGD 2FJ7C 1TZYD 4H9OA 5BO0A 3KWQB 1P3LA 4ZBJC 1U35D 4KGCB 4NE3A 3MNNC 5B2JC 3REHA 1KX3D 2PYOA 2NZDD 3X1VB 1P3MB 5B31A 1BH9B 5CP6B 5AVBD 5B32G 3AYWC 5B0YB 3WTPD 1H3OA 4WU8D 1HQ3D 3UTBA 1KX5C 3W97D 5BT1D 1P3FC 5AV9B 3X1SA 3X1UB 4Z66D 3V9RA 3RELD 3W98C 1F1EA 5B24C 3W99A 3UT9A 3AZIB 3AZGD 4J8XD 4XUJC 1KX4B 2HIOB 4JJNB 3REHD 3AZKB 3AN2B 3REIB 5E5AB 3LJAC 4WU9A 2PYOD 3KUYC 5B31D 5B1LC 3X1VA 1P3MA 3WAAD 5AV8A 3UTBD 5CPKC 5B0YA 1P3PC 3AZNC 2F8NA 3X1SD 3MNNB 3R45A 3B6FB 4H9PA 5AV9A 3A6NC 2CV5A 4X23D 3KSYA 3W99D 3UT9D 1S32C 3REKA 3LELC 3C1CC 5GSUC 3MGPB 1P3OC 4H9SC 1P3AC 3MVDB 1BFMA 4KUDA 4ZUXD 3AV1C 5FUGB 4YM6C 2YFWA 4R8PA 5JA4A 1JFIA 4LD9A 3W98B 5F99B 3WA9C 2AROB 5GXQD 3TU4B 3UTAC 3X1TB 1AOIB 5AV8D 3MGSA 3MGRB 1M19A 5C3IC 5B0ZC 3AZHA 5GT3D 2FJ7A 5DNMB 3O62C 2CV5D 4Z5TD 3VH5W 3AZMC 5CPIC 5AV5B 3KUYB 5B2JA 1B67A 4EO5B 5B33A 3KWQC 3AYWA 4KGCC 1KU5A 1KX5A 1U35B 1P3FA 4E44A 4R8PD 4H9NB 4LD9D 5FUGA 3A6NB 5CPJB 1KX3B 5CP6C 3WKJC 1S32B 3C1CB 3W98A 1F66D 5AVBB 5B24A 4UUZB 3B6GD 1P3BD 2FJ7D 4YS3A 3X1UC 4XUJA 5B2ID 3VH6T 5GT0B 3KXBC 3RELB 5BS7C 5DNNA 4Z2MH 5B2JD 3AZIC 5B1MD 3LJAA 1BH8B 4H9QB 5B33D 3KUYA 3AZLB 5B1LA 1KX4C 1P3GC 1M18D 2HIOC 5G49B 4JJNC 3AZKC 3AN2C 2BYMB 5E5AC 2CWEA 3REIC 5CPKA 5B40A 1P3FD 1P3PA 4QLCD 3O62B 5B31G 3AV2A 1ID3D 1ZLAD 1N1JA 3AZNA 3AZMB 3MGQC 3A6NA 3REJB 5B24D 1S32A 3LELA 5GSUA 1P3OA 4H9SA 1P3AA 4YS3D 3B6FC 4XUJD 3AZEB 1P3KB 4XZQA 3AV1A 1P34B 4G91C 5DNND 5BNXA 4YM6A 5KDMA 3WKJB 3MGPC 4X23B 4J8VD 3LJAD 4J8UA 3WA9A 3MVDC 5AV6D 5B32B 5B1LD 1P3IC 3UTAA 2NQBD 5B40D 5B0ZA 5F99C 2AROC 3AV2D 5BNVA 3KXBB 3VH5A 3TU4C 3X1TC 5GXQB 1AOIC 3AZMA 4H9RB 4AWLB 5CPIA 3MGRC 3LELD 5GSUD 2IO5B 1P3LD 2F8NG 1P3AD 5DNMC 4G92B 1P3GB 3AZFB 4J8WC 5AVCC 4M6BA 3KWQA 5GT3B 3AFAC 4XZQD 3AV1D 4KGCA 5AV5C 3B0CW 4YM6D 3NQUB 4J8UD 3MGQB 4EO5C 5AY8B 1EQZB 1BH9A 5CP6A 3WKJA 2YFVB 1TZYC 3UTAD 1U35C 5CPJC 1KX3C 4G91B 2NZDC 3X1UA 3LZ0B 2F8NH 1B6WA 5AVBC 3KXBA 5BS7A 3W96B 5CHLB 3AZIA 3C1BB 1P3IB 3B0CT 4H9RA 4CSRB 2RVQC 2BYKB 3KWQD 1P3BB 1KX4A 4WU9D 5GT0C 3RELC 4KGCD 1P3GA 2HIOA 4JJNA 3AZKA 3AN2A 3REIA 5E5AA 3AZJB 3X1VD 1P3MD
chains in the Genus database with same CATH superfamily
3AZLC 4J8XC 5B1MB 5CP6D 3MGQA 5B0YD 2F8ND 4J8WB 5AVCB 1M18B 5AV9D 3AFAB 3MNNA 3B6FA 1M1AB 3REKD 4QLCB 3REJC 3LZ1B 3VH6W 3EPHA 3WAAC 4Z2MG 3MGPA 2HUEB 4KUDD 5JRGB 3UTBC 1TZYB 2F2AC 3MVDA 2G5HC 1KX4D 3AZEC 1P3IA 2Y2HA 1P3KC 1P34C 2HIOD 4JJND 2BYKA 3AZKD 4X23C 3REID 2NZDB 3W99C 2Y2IA 5F99A 2AROA 4NE5A 4J8VB 3TU4A 3MGSD 5B32C 1M19D 3WTPB 2ZY4A 3X1TA 4WU8B 1HQ3B 3AZHD 1AOIA 3W97B 3MGRA 4ZUXC 2Y2QA 2NQBB 4Z66B 3NQJB 5DNMA 3MNND 2Y2JA 1TAFB 4DRAA 5GXQC 2BG1A 4AWLC 5AV5A 4CAYB 3AZGB 4J8XB 2IO5C 4NFTA 3AYWD 2ZY3A 4NE6A 4G92C 2JE5A 5BO0B 3AZFC 1P3LB 1KX5D 5GT3C 1TZYA 3REHB 2PYOB 3F6TA 1U35A 4Z5TC 4H9NA 5CPJA 3W98D 5AY8C 5B31B 1KX3A 1EQZC 3H0LC 3WAAB 3C1CA 1H3OB 5AVBA 3UTBB 1AOID 4UUZA 2LY8A 3EPLA 2Y2PA 1R4VA 3X1SB 5DNMD 4LD9C 3LZ0C 5GT0A 3RELA 3UT9B 3W99B 3W96C 3KUYD 3C1BC 1F66C 4E45A 1BH8A 1ULYA 4H9QA 3AZLA 4J8XA 3B6GC 1P3BC 4ZUXB 5CPKD 4HGAB 1P3PD 5G49A 5B2IC 3AZND 4WU9B 2BYMA 3AZJC 3O62A 5CPJD 3A6ND 4KHAB 5B1MC 3VH6A 1S32D 3C1CD 5B33C 2JSSA 2VQRA 3REJA 5AV8B 1P3OD 3WAAA 2F8NK 1M18C 2F8NB 3R45B 4H9PB 1M1AC 4QLCC 2CV5B 2RVQD 1ID3C 4Z5TB 3AZEA 1P3KA 1ZLAC 1P34A 5GT0D 3LZ1C 3WA9D 3REKB 4WV4B 2FFFB 4X23A 2HUEC 5JRGC 2ZY2A 3AZLD 4KUDB 5B32A 1WWIA 4YS3C 5B0ZD 4DQYB 2YFWB 4WNNB 5JA4B 4R8PB 4ZUXA 1JFIB 4WZSB 4LD9B 5DNNC 3O62D 3B0BA 1Q9CA 4J8VC 3AZMD 3B0DB 5CPID 1W2EA 3WTPC 1F66B 4WU8C 1HQ3C 3REJD 5GXQA 5AV6C 3MGSB 4KHAA 5BT1C 3W97C 1M19B 3B6GB 3AZHB 1HTAA 2FJ7B 2NQBC 4Z66C 5B40C 5B2IB 3AZFA 4ZBJB 3AV2C 5GT3A 3AZED 1P3KD 1P34D 5B2JB 3AZGC 3WKJD 3NQUA 4Z5TA 5B33B 5AY8A 1EQZA 1P3LC 2YFVA 5B32D 3AYWB 3REHC 1KX5B 2PYOC 1P3FB 3X1UD 4XZQC 1ID3B 5B31C 1ZLAB 3KXBD 4WNNA 4J8UC 4DRBA 3LZ0A 3AZID 5B24B 2J8PA 3W96A 3C1BA 1F66A 3X1SC 4CSRA 4YS3B 1P3GD 4XUJB 3AZFD 3B6GA 3AN2D 1P3BA 5E5AD 2ZM5A 5DNNB 3UT9C 5B2IA 3LJAB 3AZJA 3MGQD 2G5IC 5AY8D 5AV6B 1EQZD 5B1LB 5B1MA 4HGAC 4WU9C 5CPKB 3B6FD 5B40B 4J8WA 5AVCA 1P3PB 1M18A 3AV2B 3AFAA 1N1JB 3AZNB 2RIQA 3X1VC 1M1AA 4QLCA 1P3MC 3LZ0D 1ID3A 3MGPD 1ZLAA 5AV8C 1A7WA 3LZ1A 4H9OB 3W96D 3LELB 5B0YC 5GSUB 3EG5B 3MVDD 3C1BD 1P3OB 3IP4C 1P3ID 5JRGA 1P3AB 3VH5T 2L5AA 5AV9C 2CV5C 2DF4C 4XZQB 3AV1B 5F99D 2AROD 5BNXB 4YM6B 5KDMB 3REKC 2NZDA 3TU4D 4J8UB 3AZJD 3WA9B 3X1TD 4J8VA 4KUDC 3MGRD 2Y2KA 3UTAB 3WTPA 2Y2LA 4WU8A 1HQ3A 5AV6A 4UPKA 3W97A 3WTPE 4R8PC 3V9RB 5C3IB 5B0ZB 3P5JB 5AVCD 4J8WD 5BNVB 3AFAD 2NQBA 4Z66A 3NQJA 3B0DC 5AV5D 1M1AD 1TAFA 1T3UA 3MGSC 5CPIB 3LZ1D 1M19C 4CAYA 3A1KA 3AZGA 3AZHC 3KFUG 1WWSA 5JRGD 2FJ7C 1TZYD 4H9OA 5BO0A 3KWQB 1P3LA 4ZBJC 1U35D 3FDDA 4KGCB 4NE3A 3MNNC 5B2JC 3REHA 1KX3D 2PYOA 2NZDD 3X1VB 1P3MB 5B31A 1BH9B 5CP6B 5AVBD 5B32G 3AYWC 1PZRA 5B0YB 3WTPD 1H3OA 4WU8D 1HQ3D 3UTBA 1KX5C 3W97D 5BT1D 1P3FC 5AV9B 3X1SA 3X1UB 4Z66D 3V9RA 3RELD 3W98C 3H0MC 1F1EA 5B24C 3W99A 3UT9A 3AZIB 3AZGD 4J8XD 3EPKA 1Z2CB 4XUJC 1KX4B 3A1IA 2HIOB 4JJNB 3REHD 3AZKB 3AN2B 3REIB 5E5AB 3LJAC 4WU9A 2PYOD 3KUYC 5B31D 5B1LC 3X1VA 2Y2OA 1P3MA 3WAAD 5AV8A 3UTBD 5CPKC 5B0YA 1P3PC 3AZNC 2F8NA 3X1SD 3MNNB 3R45A 3B6FB 4H9PA 5AV9A 3A6NC 2CV5A 4X23D 3KSYA 3W99D 3UT9D 1S32C 3REKA 3LELC 3C1CC 5GSUC 3MGPB 1P3OC 4H9SC 1P3AC 3MVDB 1BFMA 4KUDA 4ZUXD 3AV1C 5FUGB 4YM6C 2YFWA 4R8PA 5JA4A 1JFIA 4LD9A 3W98B 5F99B 3WA9C 2AROB 5GXQD 3TU4B 3UTAC 3X1TB 1AOIB 5AV8D 3MGSA 3MGRB 1M19A 5C3IC 5B0ZC 3AZHA 5GT3D 2FJ7A 5DNMB 3O62C 2CV5D 4Z5TD 3VH5W 3AZMC 5CPIC 5AV5B 3KUYB 5B2JA 1B67A 4EO5B 5B33A 3KWQC 3AYWA 4KGCC 1KU5A 1KX5A 1U35B 1P3FA 4E44A 4R8PD 4H9NB 4LD9D 5FUGA 3A6NB 5CPJB 1KX3B 5CP6C 3WKJC 1S32B 3C1CB 3W98A 1F66D 5AVBB 5B24A 4UUZB 3B6GD 1P3BD 2FJ7D 4YS3A 3X1UC 4XUJA 5B2ID 3VH6T 3H0RC 2W8SA 5GT0B 3KXBC 3RELB 5BS7C 5DNNA 4Z2MH 5B2JD 3AZIC 5B1MD 2XD5A 3LJAA 1BH8B 4H9QB 5B33D 3KUYA 3AZLB 5B1LA 1KX4C 1P3GC 1M18D 2HIOC 5G49B 4JJNC 3AZKC 3AN2C 2BYMB 5E5AC 2CWEA 3REIC 5CPKA 5B40A 1P3FD 1P3PA 4QLCD 3O62B 5B31G 3AV2A 1ID3D 1ZLAD 1N1JA 3AZNA 3AZMB 3MGQC 3A6NA 3REJB 5B24D 1S32A 3LELA 5GSUA 3AL0C 1P3OA 2DQNC 4H9SA 1P3AA 4YS3D 3B6FC 4XUJD 3AZEB 1P3KB 4XZQA 3AV1A 1P34B 2UWXA 4G91C 5DNND 5BNXA 4YM6A 5KDMA 3WKJB 3MGPC 4X23B 4J8VD 3LJAD 4J8UA 3WA9A 3MVDC 2Y2GA 5AV6D 5B32B 5B1LD 1P3IC 3UTAA 2NQBD 5B40D 5B0ZA 5F99C 2AROC 3AV2D 5BNVA 3KXBB 3VH5A 3TU4C 3X1TC 5GXQB 1AOIC 3AZMA 4H9RB 4AWLB 5CPIA 3MGRC 3LELD 5GSUD 2IO5B 1P3LD 4WJ3C 2F8NG 1P3AD 5DNMC 4G92B 1P3GB 3AZFB 4J8WC 5AVCC 4M6BA 3KWQA 5GT3B 3AFAC 4XZQD 3AV1D 4KGCA 5AV5C 2XD1A 3B0CW 4YM6D 3NQUB 4J8UD 3MGQB 4EO5C 5AY8B 1EQZB 1BH9A 5CP6A 3WKJA 2Y2NA 2YFVB 2JCHA 1TZYC 3UTAD 1U35C 5CPJC 2ZY5A 1KX3C 4G91B 2NZDC 3X1UA 3LZ0B 2F8NH 3EPJA 1B6WA 5AVBC 3KXBA 5BS7A 3W96B 5CHLB 3AZIA 3C1BB 2Y2MA 1P3IB 3B0CT 4H9RA 4CSRB 2RVQC 2BYKB 3KWQD 1P3BB 1KX4A 4WU9D 5GT0C 3RELC 4KGCD 1P3GA 2HIOA 4JJNA 3AZKA 3AN2A 3REIA 5E5AA 3AZJB 3X1VD 1P3MD
chains in the Genus database with same CATH topology
3AZLC 4J8XC 5B1MB 5CP6D 3MGQA 5B0YD 2F8ND 4J8WB 5AVCB 1M18B 5AV9D 3AFAB 3MNNA 3B6FA 1M1AB 3REKD 4QLCB 3REJC 3LZ1B 3VH6W 3EPHA 3WAAC 4Z2MG 3MGPA 2HUEB 4KUDD 5JRGB 3UTBC 1TZYB 2F2AC 3MVDA 2G5HC 1KX4D 3AZEC 1P3IA 2Y2HA 1P3KC 1P34C 2HIOD 4JJND 2BYKA 3AZKD 4X23C 3REID 2NZDB 3W99C 2Y2IA 5F99A 2AROA 4NE5A 4J8VB 3TU4A 3MGSD 5B32C 1M19D 3WTPB 2ZY4A 3X1TA 4WU8B 1HQ3B 3AZHD 1AOIA 3W97B 3MGRA 4ZUXC 2Y2QA 2NQBB 4Z66B 3NQJB 5DNMA 3MNND 2Y2JA 1TAFB 4DRAA 5GXQC 2BG1A 4AWLC 5AV5A 4CAYB 3AZGB 4J8XB 2IO5C 4NFTA 3AYWD 2ZY3A 4NE6A 4G92C 2JE5A 5BO0B 3AZFC 1P3LB 1KX5D 5GT3C 1TZYA 3REHB 2PYOB 3F6TA 1U35A 4Z5TC 4H9NA 5CPJA 3W98D 5AY8C 5B31B 1KX3A 1EQZC 3H0LC 3WAAB 3C1CA 1H3OB 5AVBA 3UTBB 1AOID 4UUZA 2LY8A 3EPLA 2Y2PA 1R4VA 3X1SB 5DNMD 4LD9C 3LZ0C 5GT0A 3RELA 3UT9B 3W99B 3W96C 3KUYD 3C1BC 1F66C 4E45A 1BH8A 1ULYA 4H9QA 3AZLA 4J8XA 3B6GC 1P3BC 4ZUXB 5CPKD 4HGAB 1P3PD 5G49A 5B2IC 3AZND 4WU9B 2BYMA 3AZJC 3O62A 5CPJD 3A6ND 4KHAB 5B1MC 3VH6A 1S32D 3C1CD 5B33C 2JSSA 2VQRA 3REJA 5AV8B 1P3OD 3WAAA 2F8NK 1M18C 2F8NB 3R45B 4H9PB 1M1AC 4QLCC 2CV5B 2RVQD 1ID3C 4Z5TB 3AZEA 1P3KA 1ZLAC 1P34A 5GT0D 3LZ1C 3WA9D 3REKB 4WV4B 2FFFB 4X23A 2HUEC 5JRGC 2ZY2A 3AZLD 4KUDB 5B32A 1WWIA 4YS3C 5B0ZD 4DQYB 2YFWB 4WNNB 5JA4B 4R8PB 4ZUXA 1JFIB 4WZSB 4LD9B 5DNNC 3O62D 3B0BA 1Q9CA 4J8VC 3AZMD 3B0DB 5CPID 1W2EA 3WTPC 1F66B 4WU8C 1HQ3C 3REJD 5GXQA 5AV6C 3MGSB 4KHAA 5BT1C 3W97C 1M19B 3B6GB 3AZHB 1HTAA 2FJ7B 2NQBC 4Z66C 5B40C 5B2IB 3AZFA 4ZBJB 3AV2C 5GT3A 3AZED 1P3KD 1P34D 5B2JB 3AZGC 3WKJD 3NQUA 4Z5TA 5B33B 5AY8A 1EQZA 1P3LC 2YFVA 5B32D 3AYWB 3REHC 1KX5B 2PYOC 1P3FB 3X1UD 4XZQC 1ID3B 5B31C 1ZLAB 3KXBD 4WNNA 4J8UC 4DRBA 3LZ0A 3AZID 5B24B 2J8PA 3W96A 3C1BA 1F66A 3X1SC 4CSRA 4YS3B 1P3GD 4XUJB 3AZFD 3B6GA 3AN2D 1P3BA 5E5AD 2ZM5A 5DNNB 3UT9C 5B2IA 3LJAB 3AZJA 3MGQD 2G5IC 5AY8D 5AV6B 1EQZD 5B1LB 5B1MA 4HGAC 4WU9C 5CPKB 3B6FD 5B40B 4J8WA 5AVCA 1P3PB 1M18A 3AV2B 3AFAA 1N1JB 3AZNB 2RIQA 3X1VC 1M1AA 4QLCA 1P3MC 3LZ0D 1ID3A 3MGPD 1ZLAA 5AV8C 1A7WA 3LZ1A 4H9OB 3W96D 3LELB 5B0YC 5GSUB 3EG5B 3MVDD 3C1BD 1P3OB 3IP4C 1P3ID 5JRGA 1P3AB 3VH5T 2L5AA 5AV9C 2CV5C 2DF4C 4XZQB 3AV1B 5F99D 2AROD 5BNXB 4YM6B 5KDMB 3REKC 2NZDA 3TU4D 4J8UB 3AZJD 3WA9B 3X1TD 4J8VA 4KUDC 3MGRD 2Y2KA 3UTAB 3WTPA 2Y2LA 4WU8A 1HQ3A 5AV6A 4UPKA 3W97A 3WTPE 4R8PC 3V9RB 5C3IB 5B0ZB 3P5JB 5AVCD 4J8WD 5BNVB 3AFAD 2NQBA 4Z66A 3NQJA 3B0DC 5AV5D 1M1AD 1TAFA 1T3UA 3MGSC 5CPIB 3LZ1D 1M19C 4CAYA 3A1KA 3AZGA 3AZHC 3KFUG 1WWSA 5JRGD 2FJ7C 1TZYD 4H9OA 5BO0A 3KWQB 1P3LA 4ZBJC 1U35D 3FDDA 4KGCB 4NE3A 3MNNC 5B2JC 3REHA 1KX3D 2PYOA 2NZDD 3X1VB 1P3MB 5B31A 1BH9B 5CP6B 5AVBD 5B32G 3AYWC 1PZRA 5B0YB 3WTPD 1H3OA 4WU8D 1HQ3D 3UTBA 1KX5C 3W97D 5BT1D 1P3FC 5AV9B 3X1SA 3X1UB 4Z66D 3V9RA 3RELD 3W98C 3H0MC 1F1EA 5B24C 3W99A 3UT9A 3AZIB 3AZGD 4J8XD 3EPKA 1Z2CB 4XUJC 1KX4B 3A1IA 2HIOB 4JJNB 3REHD 3AZKB 3AN2B 3REIB 5E5AB 3LJAC 4WU9A 2PYOD 3KUYC 5B31D 5B1LC 3X1VA 2Y2OA 1P3MA 3WAAD 5AV8A 3UTBD 5CPKC 5B0YA 1P3PC 3AZNC 2F8NA 3X1SD 3MNNB 3R45A 3B6FB 4H9PA 5AV9A 3A6NC 2CV5A 4X23D 3KSYA 3W99D 3UT9D 1S32C 3REKA 3LELC 3C1CC 5GSUC 3MGPB 1P3OC 4H9SC 1P3AC 3MVDB 1BFMA 4KUDA 4ZUXD 3AV1C 5FUGB 4YM6C 2YFWA 4R8PA 5JA4A 1JFIA 4LD9A 3W98B 5F99B 3WA9C 2AROB 5GXQD 3TU4B 3UTAC 3X1TB 1AOIB 5AV8D 3MGSA 3MGRB 1M19A 5C3IC 5B0ZC 3AZHA 5GT3D 2FJ7A 5DNMB 3O62C 2CV5D 4Z5TD 3VH5W 3AZMC 5CPIC 5AV5B 3KUYB 5B2JA 1B67A 4EO5B 5B33A 3KWQC 3AYWA 4KGCC 1KU5A 1KX5A 1U35B 1P3FA 4E44A 4R8PD 4H9NB 4LD9D 5FUGA 3A6NB 5CPJB 1KX3B 5CP6C 3WKJC 1S32B 3C1CB 3W98A 1F66D 5AVBB 5B24A 4UUZB 3B6GD 1P3BD 2FJ7D 4YS3A 3X1UC 4XUJA 5B2ID 3VH6T 3H0RC 2W8SA 5GT0B 3KXBC 3RELB 5BS7C 5DNNA 4Z2MH 5B2JD 3AZIC 5B1MD 2XD5A 3LJAA 1BH8B 4H9QB 5B33D 3KUYA 3AZLB 5B1LA 1KX4C 1P3GC 1M18D 2HIOC 5G49B 4JJNC 3AZKC 3AN2C 2BYMB 5E5AC 2CWEA 3REIC 5CPKA 5B40A 1P3FD 1P3PA 4QLCD 3O62B 5B31G 3AV2A 1ID3D 1ZLAD 1N1JA 3AZNA 3AZMB 3MGQC 3A6NA 3REJB 5B24D 1S32A 3LELA 5GSUA 3AL0C 1P3OA 2DQNC 4H9SA 1P3AA 4YS3D 3B6FC 4XUJD 3AZEB 1P3KB 4XZQA 3AV1A 1P34B 2UWXA 4G91C 5DNND 5BNXA 4YM6A 5KDMA 3WKJB 3MGPC 4X23B 4J8VD 3LJAD 4J8UA 3WA9A 3MVDC 2Y2GA 5AV6D 5B32B 5B1LD 1P3IC 3UTAA 2NQBD 5B40D 5B0ZA 5F99C 2AROC 3AV2D 5BNVA 3KXBB 3VH5A 3TU4C 3X1TC 5GXQB 1AOIC 3AZMA 4H9RB 4AWLB 5CPIA 3MGRC 3LELD 5GSUD 2IO5B 1P3LD 4WJ3C 2F8NG 1P3AD 5DNMC 4G92B 1P3GB 3AZFB 4J8WC 5AVCC 4M6BA 3KWQA 5GT3B 3AFAC 4XZQD 3AV1D 4KGCA 5AV5C 2XD1A 3B0CW 4YM6D 3NQUB 4J8UD 3MGQB 4EO5C 5AY8B 1EQZB 1BH9A 5CP6A 3WKJA 2Y2NA 2YFVB 2JCHA 1TZYC 3UTAD 1U35C 5CPJC 2ZY5A 1KX3C 4G91B 2NZDC 3X1UA 3LZ0B 2F8NH 3EPJA 1B6WA 5AVBC 3KXBA 5BS7A 3W96B 5CHLB 3AZIA 3C1BB 2Y2MA 1P3IB 3B0CT 4H9RA 4CSRB 2RVQC 2BYKB 3KWQD 1P3BB 1KX4A 4WU9D 5GT0C 3RELC 4KGCD 1P3GA 2HIOA 4JJNA 3AZKA 3AN2A 3REIA 5E5AA 3AZJB 3X1VD 1P3MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL C;  4J8X C;  5B1M B;  5CP6 D;  3MGQ A;  5B0Y D;  2F8N D;  4J8W B;  5AVC B;  1M18 B;  5AV9 D;  3AFA B;  3MNN A;  3B6F A;  1M1A B;  3REK D;  4QLC B;  3REJ C;  3LZ1 B;  3VH6 W;  3WAA C;  4Z2M G;  3MGP A;  2HUE B;  4KUD D;  5JRG B;  3UTB C;  1TZY B;  3MVD A;  1KX4 D;  3AZE C;  1P3I A;  1P3K C;  1P34 C;  2HIO D;  4JJN D;  2BYK A;  3AZK D;  4X23 C;  3REI D;  2NZD B;  3W99 C;  5F99 A;  2ARO A;  4NE5 A;  4J8V B;  3TU4 A;  3MGS D;  5B32 C;  1M19 D;  3WTP B;  3X1T A;  4WU8 B;  1HQ3 B;  3AZH D;  1AOI A;  3W97 B;  3MGR A;  4ZUX C;  2NQB B;  4Z66 B;  3NQJ B;  5DNM A;  3MNN D;  1TAF B;  4DRA A;  5GXQ C;  4AWL C;  5AV5 A;  4CAY B;  3AZG B;  4J8X B;  2IO5 C;  4NFT A;  3AYW D;  4NE6 A;  4G92 C;  5BO0 B;  3AZF C;  1P3L B;  1KX5 D;  5GT3 C;  1TZY A;  3REH B;  2PYO B;  1U35 A;  4Z5T C;  4H9N A;  5CPJ A;  3W98 D;  5AY8 C;  5B31 B;  1KX3 A;  1EQZ C;  3WAA B;  3C1C A;  1H3O B;  5AVB A;  3UTB B;  1AOI D;  4UUZ A;  2LY8 A;  1R4V A;  3X1S B;  5DNM D;  4LD9 C;  3LZ0 C;  5GT0 A;  3REL A;  3UT9 B;  3W99 B;  3W96 C;  3KUY D;  3C1B C;  1F66 C;  4E45 A;  4H9Q A;  1BH8 A;  1ULY A;  3AZL A;  4J8X A;  3B6G C;  1P3B C;  4ZUX B;  5CPK D;  4HGA B;  1P3P D;  5G49 A;  5B2I C;  3AZN D;  4WU9 B;  2BYM A;  3AZJ C;  3O62 A;  5CPJ D;  3A6N D;  4KHA B;  5B1M C;  3VH6 A;  1S32 D;  3C1C D;  5B33 C;  2JSS A;  3REJ A;  5AV8 B;  1P3O D;  3WAA A;  2F8N K;  1M18 C;  2F8N B;  3R45 B;  4H9P B;  1M1A C;  4QLC C;  2CV5 B;  2RVQ D;  1ID3 C;  4Z5T B;  3AZE A;  1P3K A;  1ZLA C;  1P34 A;  5GT0 D;  3LZ1 C;  3WA9 D;  3REK B;  4WV4 B;  4X23 A;  2HUE C;  5JRG C;  3AZL D;  4KUD B;  5B32 A;  1WWI A;  4YS3 C;  5B0Z D;  2YFW B;  4WNN B;  5JA4 B;  4R8P B;  4ZUX A;  1JFI B;  4WZS B;  4LD9 B;  5DNN C;  3O62 D;  3B0B A;  1Q9C A;  4J8V C;  3AZM D;  3B0D B;  5CPI D;  3WTP C;  1F66 B;  4WU8 C;  1HQ3 C;  3REJ D;  5GXQ A;  5AV6 C;  3MGS B;  4KHA A;  5BT1 C;  3W97 C;  1M19 B;  3B6G B;  3AZH B;  1HTA A;  2FJ7 B;  2NQB C;  4Z66 C;  5B40 C;  5B2I B;  3AZF A;  4ZBJ B;  3AV2 C;  5GT3 A;  3AZE D;  1P3K D;  1P34 D;  5B2J B;  3AZG C;  3WKJ D;  3NQU A;  4Z5T A;  5B33 B;  5AY8 A;  1EQZ A;  1P3L C;  2YFV A;  5B32 D;  3AYW B;  3REH C;  1KX5 B;  2PYO C;  1P3F B;  3X1U D;  4XZQ C;  1ID3 B;  5B31 C;  1ZLA B;  3KXB D;  4WNN A;  4J8U C;  4DRB A;  3LZ0 A;  3AZI D;  5B24 B;  3W96 A;  3C1B A;  1F66 A;  3X1S C;  4CSR A;  4YS3 B;  1P3G D;  4XUJ B;  3AZF D;  3B6G A;  3AN2 D;  1P3B A;  5E5A D;  5DNN B;  3UT9 C;  5B2I A;  3LJA B;  3AZJ A;  3MGQ D;  5AY8 D;  5AV6 B;  1EQZ D;  5B1L B;  5B1M A;  4HGA C;  4WU9 C;  5CPK B;  3B6F D;  5B40 B;  4J8W A;  5AVC A;  1P3P B;  1M18 A;  3AV2 B;  3AFA A;  1N1J B;  3AZN B;  3X1V C;  1M1A A;  4QLC A;  1P3M C;  3LZ0 D;  1ID3 A;  3MGP D;  1ZLA A;  5AV8 C;  1A7W A;  3LZ1 A;  4H9O B;  3W96 D;  3LEL B;  5B0Y C;  5GSU B;  3MVD D;  3C1B D;  1P3O B;  1P3I D;  5JRG A;  1P3A B;  3VH5 T;  2L5A A;  5AV9 C;  2CV5 C;  4XZQ B;  3AV1 B;  5F99 D;  2ARO D;  5BNX B;  4YM6 B;  5KDM B;  3REK C;  2NZD A;  3TU4 D;  4J8U B;  3AZJ D;  3WA9 B;  3X1T D;  4J8V A;  4KUD C;  3MGR D;  3UTA B;  3WTP A;  4WU8 A;  1HQ3 A;  5AV6 A;  3W97 A;  3WTP E;  4R8P C;  3V9R B;  5C3I B;  5B0Z B;  5AVC D;  4J8W D;  5BNV B;  3AFA D;  2NQB A;  4Z66 A;  3NQJ A;  3B0D C;  5AV5 D;  1M1A D;  1TAF A;  3MGS C;  5CPI B;  3LZ1 D;  1M19 C;  4CAY A;  3AZG A;  3AZH C;  1WWS A;  5JRG D;  2FJ7 C;  1TZY D;  4H9O A;  5BO0 A;  3KWQ B;  1P3L A;  4ZBJ C;  1U35 D;  4KGC B;  4NE3 A;  3MNN C;  5B2J C;  3REH A;  1KX3 D;  2PYO A;  2NZD D;  3X1V B;  1P3M B;  5B31 A;  1BH9 B;  5CP6 B;  5AVB D;  5B32 G;  3AYW C;  5B0Y B;  3WTP D;  1H3O A;  4WU8 D;  1HQ3 D;  3UTB A;  1KX5 C;  3W97 D;  5BT1 D;  1P3F C;  5AV9 B;  3X1S A;  3X1U B;  4Z66 D;  3V9R A;  3REL D;  3W98 C;  1F1E A;  5B24 C;  3W99 A;  3UT9 A;  3AZI B;  3AZG D;  4J8X D;  4XUJ C;  1KX4 B;  2HIO B;  4JJN B;  3REH D;  3AZK B;  3AN2 B;  3REI B;  5E5A B;  3LJA C;  4WU9 A;  2PYO D;  3KUY C;  5B31 D;  5B1L C;  3X1V A;  1P3M A;  3WAA D;  5AV8 A;  3UTB D;  5CPK C;  5B0Y A;  1P3P C;  3AZN C;  2F8N A;  3X1S D;  3MNN B;  3R45 A;  3B6F B;  4H9P A;  5AV9 A;  3A6N C;  2CV5 A;  4X23 D;  3KSY A;  3W99 D;  3UT9 D;  1S32 C;  3REK A;  3LEL C;  3C1C C;  5GSU C;  3MGP B;  1P3O C;  4H9S C;  1P3A C;  3MVD B;  1BFM A;  4KUD A;  4ZUX D;  3AV1 C;  5FUG B;  4YM6 C;  2YFW A;  4R8P A;  5JA4 A;  1JFI A;  4LD9 A;  3W98 B;  5F99 B;  3WA9 C;  2ARO B;  5GXQ D;  3TU4 B;  3UTA C;  3X1T B;  1AOI B;  5AV8 D;  3MGS A;  3MGR B;  1M19 A;  5C3I C;  5B0Z C;  3AZH A;  5GT3 D;  2FJ7 A;  5DNM B;  3O62 C;  2CV5 D;  4Z5T D;  3VH5 W;  3AZM C;  5CPI C;  5AV5 B;  3KUY B;  5B2J A;  1B67 A;  4EO5 B;  5B33 A;  3KWQ C;  3AYW A;  4KGC C;  1KU5 A;  1KX5 A;  1U35 B;  1P3F A;  4E44 A;  4R8P D;  4H9N B;  4LD9 D;  5FUG A;  3A6N B;  5CPJ B;  1KX3 B;  5CP6 C;  3WKJ C;  1S32 B;  3C1C B;  3W98 A;  1F66 D;  5AVB B;  5B24 A;  4UUZ B;  3B6G D;  1P3B D;  2FJ7 D;  4YS3 A;  3X1U C;  4XUJ A;  5B2I D;  3VH6 T;  5GT0 B;  3KXB C;  3REL B;  5BS7 C;  5DNN A;  4Z2M H;  5B2J D;  3AZI C;  5B1M D;  3LJA A;  1BH8 B;  4H9Q B;  5B33 D;  3KUY A;  3AZL B;  5B1L A;  1KX4 C;  1P3G C;  1M18 D;  2HIO C;  5G49 B;  4JJN C;  3AZK C;  3AN2 C;  2BYM B;  5E5A C;  2CWE A;  3REI C;  5CPK A;  5B40 A;  1P3F D;  1P3P A;  4QLC D;  3O62 B;  5B31 G;  3AV2 A;  1ID3 D;  1ZLA D;  1N1J A;  3AZN A;  3AZM B;  3MGQ C;  3A6N A;  3REJ B;  5B24 D;  1S32 A;  3LEL A;  5GSU A;  1P3O A;  4H9S A;  1P3A A;  4YS3 D;  3B6F C;  4XUJ D;  3AZE B;  1P3K B;  4XZQ A;  3AV1 A;  1P34 B;  4G91 C;  5DNN D;  5BNX A;  4YM6 A;  5KDM A;  3WKJ B;  3MGP C;  4X23 B;  4J8V D;  3LJA D;  4J8U A;  3WA9 A;  3MVD C;  5AV6 D;  5B32 B;  5B1L D;  1P3I C;  3UTA A;  2NQB D;  5B40 D;  5B0Z A;  5F99 C;  2ARO C;  3AV2 D;  5BNV A;  3KXB B;  3VH5 A;  3TU4 C;  3X1T C;  5GXQ B;  1AOI C;  3AZM A;  4H9R B;  4AWL B;  5CPI A;  3MGR C;  3LEL D;  5GSU D;  2IO5 B;  1P3L D;  2F8N G;  1P3A D;  5DNM C;  4G92 B;  1P3G B;  3AZF B;  4J8W C;  5AVC C;  4M6B A;  3KWQ A;  5GT3 B;  3AFA C;  4XZQ D;  3AV1 D;  4KGC A;  5AV5 C;  3B0C W;  4YM6 D;  3NQU B;  4J8U D;  3MGQ B;  4EO5 C;  5AY8 B;  1EQZ B;  1BH9 A;  5CP6 A;  3WKJ A;  2YFV B;  1TZY C;  3UTA D;  1U35 C;  5CPJ C;  1KX3 C;  4G91 B;  2NZD C;  3X1U A;  3LZ0 B;  2F8N H;  1B6W A;  5AVB C;  3KXB A;  5BS7 A;  3W96 B;  5CHL B;  3AZI A;  3C1B B;  1P3I B;  3B0C T;  4H9R A;  4CSR B;  2RVQ C;  2BYK B;  3KWQ D;  1P3B B;  1KX4 A;  4WU9 D;  5GT0 C;  3REL C;  4KGC D;  1P3G A;  2HIO A;  4JJN A;  3AZK A;  3AN2 A;  3REI A;  5E5A A;  3AZJ B;  3X1V D;  1P3M D; 
#chains in the Genus database with same CATH topology
 3AZL C;  4J8X C;  5B1M B;  5CP6 D;  3MGQ A;  5B0Y D;  2F8N D;  4J8W B;  5AVC B;  1M18 B;  5AV9 D;  3AFA B;  3MNN A;  3B6F A;  1M1A B;  3REK D;  4QLC B;  3REJ C;  3LZ1 B;  3VH6 W;  3EPH A;  3WAA C;  4Z2M G;  3MGP A;  2HUE B;  4KUD D;  5JRG B;  3UTB C;  1TZY B;  2F2A C;  3MVD A;  2G5H C;  1KX4 D;  3AZE C;  1P3I A;  2Y2H A;  1P3K C;  1P34 C;  2HIO D;  4JJN D;  2BYK A;  3AZK D;  4X23 C;  3REI D;  2NZD B;  3W99 C;  2Y2I A;  5F99 A;  2ARO A;  4NE5 A;  4J8V B;  3TU4 A;  3MGS D;  5B32 C;  1M19 D;  3WTP B;  2ZY4 A;  3X1T A;  4WU8 B;  1HQ3 B;  3AZH D;  1AOI A;  3W97 B;  3MGR A;  4ZUX C;  2Y2Q A;  2NQB B;  4Z66 B;  3NQJ B;  5DNM A;  3MNN D;  2Y2J A;  1TAF B;  4DRA A;  5GXQ C;  2BG1 A;  4AWL C;  5AV5 A;  4CAY B;  3AZG B;  4J8X B;  2IO5 C;  4NFT A;  3AYW D;  2ZY3 A;  4NE6 A;  4G92 C;  2JE5 A;  5BO0 B;  3AZF C;  1P3L B;  1KX5 D;  5GT3 C;  1TZY A;  3REH B;  2PYO B;  3F6T A;  1U35 A;  4Z5T C;  4H9N A;  5CPJ A;  3W98 D;  5AY8 C;  5B31 B;  1KX3 A;  1EQZ C;  3H0L C;  3WAA B;  3C1C A;  1H3O B;  5AVB A;  3UTB B;  1AOI D;  4UUZ A;  2LY8 A;  3EPL A;  2Y2P A;  1R4V A;  3X1S B;  5DNM D;  4LD9 C;  3LZ0 C;  5GT0 A;  3REL A;  3UT9 B;  3W99 B;  3W96 C;  3KUY D;  3C1B C;  1F66 C;  4E45 A;  1BH8 A;  1ULY A;  4H9Q A;  3AZL A;  4J8X A;  3B6G C;  1P3B C;  4ZUX B;  5CPK D;  4HGA B;  1P3P D;  5G49 A;  5B2I C;  3AZN D;  4WU9 B;  2BYM A;  3AZJ C;  3O62 A;  5CPJ D;  3A6N D;  4KHA B;  5B1M C;  3VH6 A;  1S32 D;  3C1C D;  5B33 C;  2JSS A;  2VQR A;  3REJ A;  5AV8 B;  1P3O D;  3WAA A;  2F8N K;  1M18 C;  2F8N B;  3R45 B;  4H9P B;  1M1A C;  4QLC C;  2CV5 B;  2RVQ D;  1ID3 C;  4Z5T B;  3AZE A;  1P3K A;  1ZLA C;  1P34 A;  5GT0 D;  3LZ1 C;  3WA9 D;  3REK B;  4WV4 B;  2FFF B;  4X23 A;  2HUE C;  5JRG C;  2ZY2 A;  3AZL D;  4KUD B;  5B32 A;  1WWI A;  4YS3 C;  5B0Z D;  4DQY B;  2YFW B;  4WNN B;  5JA4 B;  4R8P B;  4ZUX A;  1JFI B;  4WZS B;  4LD9 B;  5DNN C;  3O62 D;  3B0B A;  1Q9C A;  4J8V C;  3AZM D;  3B0D B;  5CPI D;  1W2E A;  3WTP C;  1F66 B;  4WU8 C;  1HQ3 C;  3REJ D;  5GXQ A;  5AV6 C;  3MGS B;  4KHA A;  5BT1 C;  3W97 C;  1M19 B;  3B6G B;  3AZH B;  1HTA A;  2FJ7 B;  2NQB C;  4Z66 C;  5B40 C;  5B2I B;  3AZF A;  4ZBJ B;  3AV2 C;  5GT3 A;  3AZE D;  1P3K D;  1P34 D;  5B2J B;  3AZG C;  3WKJ D;  3NQU A;  4Z5T A;  5B33 B;  5AY8 A;  1EQZ A;  1P3L C;  2YFV A;  5B32 D;  3AYW B;  3REH C;  1KX5 B;  2PYO C;  1P3F B;  3X1U D;  4XZQ C;  1ID3 B;  5B31 C;  1ZLA B;  3KXB D;  4WNN A;  4J8U C;  4DRB A;  3LZ0 A;  3AZI D;  5B24 B;  2J8P A;  3W96 A;  3C1B A;  1F66 A;  3X1S C;  4CSR A;  4YS3 B;  1P3G D;  4XUJ B;  3AZF D;  3B6G A;  3AN2 D;  1P3B A;  5E5A D;  2ZM5 A;  5DNN B;  3UT9 C;  5B2I A;  3LJA B;  3AZJ A;  3MGQ D;  2G5I C;  5AY8 D;  5AV6 B;  1EQZ D;  5B1L B;  5B1M A;  4HGA C;  4WU9 C;  5CPK B;  3B6F D;  5B40 B;  4J8W A;  5AVC A;  1P3P B;  1M18 A;  3AV2 B;  3AFA A;  1N1J B;  3AZN B;  2RIQ A;  3X1V C;  1M1A A;  4QLC A;  1P3M C;  3LZ0 D;  1ID3 A;  3MGP D;  1ZLA A;  5AV8 C;  1A7W A;  3LZ1 A;  4H9O B;  3W96 D;  3LEL B;  5B0Y C;  5GSU B;  3EG5 B;  3MVD D;  3C1B D;  1P3O B;  3IP4 C;  1P3I D;  5JRG A;  1P3A B;  3VH5 T;  2L5A A;  5AV9 C;  2CV5 C;  2DF4 C;  4XZQ B;  3AV1 B;  5F99 D;  2ARO D;  5BNX B;  4YM6 B;  5KDM B;  3REK C;  2NZD A;  3TU4 D;  4J8U B;  3AZJ D;  3WA9 B;  3X1T D;  4J8V A;  4KUD C;  3MGR D;  2Y2K A;  3UTA B;  3WTP A;  2Y2L A;  4WU8 A;  1HQ3 A;  5AV6 A;  4UPK A;  3W97 A;  3WTP E;  4R8P C;  3V9R B;  5C3I B;  5B0Z B;  3P5J B;  5AVC D;  4J8W D;  5BNV B;  3AFA D;  2NQB A;  4Z66 A;  3NQJ A;  3B0D C;  5AV5 D;  1M1A D;  1TAF A;  1T3U A;  3MGS C;  5CPI B;  3LZ1 D;  1M19 C;  4CAY A;  3A1K A;  3AZG A;  3AZH C;  3KFU G;  1WWS A;  5JRG D;  2FJ7 C;  1TZY D;  4H9O A;  5BO0 A;  3KWQ B;  1P3L A;  4ZBJ C;  1U35 D;  3FDD A;  4KGC B;  4NE3 A;  3MNN C;  5B2J C;  3REH A;  1KX3 D;  2PYO A;  2NZD D;  3X1V B;  1P3M B;  5B31 A;  1BH9 B;  5CP6 B;  5AVB D;  5B32 G;  3AYW C;  1PZR A;  5B0Y B;  3WTP D;  1H3O A;  4WU8 D;  1HQ3 D;  3UTB A;  1KX5 C;  3W97 D;  5BT1 D;  1P3F C;  5AV9 B;  3X1S A;  3X1U B;  4Z66 D;  3V9R A;  3REL D;  3W98 C;  3H0M C;  1F1E A;  5B24 C;  3W99 A;  3UT9 A;  3AZI B;  3AZG D;  4J8X D;  3EPK A;  1Z2C B;  4XUJ C;  1KX4 B;  3A1I A;  2HIO B;  4JJN B;  3REH D;  3AZK B;  3AN2 B;  3REI B;  5E5A B;  3LJA C;  4WU9 A;  2PYO D;  3KUY C;  5B31 D;  5B1L C;  3X1V A;  2Y2O A;  1P3M A;  3WAA D;  5AV8 A;  3UTB D;  5CPK C;  5B0Y A;  1P3P C;  3AZN C;  2F8N A;  3X1S D;  3MNN B;  3R45 A;  3B6F B;  4H9P A;  5AV9 A;  3A6N C;  2CV5 A;  4X23 D;  3KSY A;  3W99 D;  3UT9 D;  1S32 C;  3REK A;  3LEL C;  3C1C C;  5GSU C;  3MGP B;  1P3O C;  4H9S C;  1P3A C;  3MVD B;  1BFM A;  4KUD A;  4ZUX D;  3AV1 C;  5FUG B;  4YM6 C;  2YFW A;  4R8P A;  5JA4 A;  1JFI A;  4LD9 A;  3W98 B;  5F99 B;  3WA9 C;  2ARO B;  5GXQ D;  3TU4 B;  3UTA C;  3X1T B;  1AOI B;  5AV8 D;  3MGS A;  3MGR B;  1M19 A;  5C3I C;  5B0Z C;  3AZH A;  5GT3 D;  2FJ7 A;  5DNM B;  3O62 C;  2CV5 D;  4Z5T D;  3VH5 W;  3AZM C;  5CPI C;  5AV5 B;  3KUY B;  5B2J A;  1B67 A;  4EO5 B;  5B33 A;  3KWQ C;  3AYW A;  4KGC C;  1KU5 A;  1KX5 A;  1U35 B;  1P3F A;  4E44 A;  4R8P D;  4H9N B;  4LD9 D;  5FUG A;  3A6N B;  5CPJ B;  1KX3 B;  5CP6 C;  3WKJ C;  1S32 B;  3C1C B;  3W98 A;  1F66 D;  5AVB B;  5B24 A;  4UUZ B;  3B6G D;  1P3B D;  2FJ7 D;  4YS3 A;  3X1U C;  4XUJ A;  5B2I D;  3VH6 T;  3H0R C;  2W8S A;  5GT0 B;  3KXB C;  3REL B;  5BS7 C;  5DNN A;  4Z2M H;  5B2J D;  3AZI C;  5B1M D;  2XD5 A;  3LJA A;  1BH8 B;  4H9Q B;  5B33 D;  3KUY A;  3AZL B;  5B1L A;  1KX4 C;  1P3G C;  1M18 D;  2HIO C;  5G49 B;  4JJN C;  3AZK C;  3AN2 C;  2BYM B;  5E5A C;  2CWE A;  3REI C;  5CPK A;  5B40 A;  1P3F D;  1P3P A;  4QLC D;  3O62 B;  5B31 G;  3AV2 A;  1ID3 D;  1ZLA D;  1N1J A;  3AZN A;  3AZM B;  3MGQ C;  3A6N A;  3REJ B;  5B24 D;  1S32 A;  3LEL A;  5GSU A;  3AL0 C;  1P3O A;  2DQN C;  4H9S A;  1P3A A;  4YS3 D;  3B6F C;  4XUJ D;  3AZE B;  1P3K B;  4XZQ A;  3AV1 A;  1P34 B;  2UWX A;  4G91 C;  5DNN D;  5BNX A;  4YM6 A;  5KDM A;  3WKJ B;  3MGP C;  4X23 B;  4J8V D;  3LJA D;  4J8U A;  3WA9 A;  3MVD C;  2Y2G A;  5AV6 D;  5B32 B;  5B1L D;  1P3I C;  3UTA A;  2NQB D;  5B40 D;  5B0Z A;  5F99 C;  2ARO C;  3AV2 D;  5BNV A;  3KXB B;  3VH5 A;  3TU4 C;  3X1T C;  5GXQ B;  1AOI C;  3AZM A;  4H9R B;  4AWL B;  5CPI A;  3MGR C;  3LEL D;  5GSU D;  2IO5 B;  1P3L D;  4WJ3 C;  2F8N G;  1P3A D;  5DNM C;  4G92 B;  1P3G B;  3AZF B;  4J8W C;  5AVC C;  4M6B A;  3KWQ A;  5GT3 B;  3AFA C;  4XZQ D;  3AV1 D;  4KGC A;  5AV5 C;  2XD1 A;  3B0C W;  4YM6 D;  3NQU B;  4J8U D;  3MGQ B;  4EO5 C;  5AY8 B;  1EQZ B;  1BH9 A;  5CP6 A;  3WKJ A;  2Y2N A;  2YFV B;  2JCH A;  1TZY C;  3UTA D;  1U35 C;  5CPJ C;  2ZY5 A;  1KX3 C;  4G91 B;  2NZD C;  3X1U A;  3LZ0 B;  2F8N H;  3EPJ A;  1B6W A;  5AVB C;  3KXB A;  5BS7 A;  3W96 B;  5CHL B;  3AZI A;  3C1B B;  2Y2M A;  1P3I B;  3B0C T;  4H9R A;  4CSR B;  2RVQ C;  2BYK B;  3KWQ D;  1P3B B;  1KX4 A;  4WU9 D;  5GT0 C;  3REL C;  4KGC D;  1P3G A;  2HIO A;  4JJN A;  3AZK A;  3AN2 A;  3REI A;  5E5A A;  3AZJ B;  3X1V D;  1P3M D; 
#chains in the Genus database with same CATH homology
 3AZL C;  4J8X C;  5B1M B;  5CP6 D;  3MGQ A;  5B0Y D;  2F8N D;  4J8W B;  5AVC B;  1M18 B;  5AV9 D;  3AFA B;  3MNN A;  3B6F A;  1M1A B;  3REK D;  4QLC B;  3REJ C;  3LZ1 B;  3VH6 W;  3EPH A;  3WAA C;  4Z2M G;  3MGP A;  2HUE B;  4KUD D;  5JRG B;  3UTB C;  1TZY B;  2F2A C;  3MVD A;  2G5H C;  1KX4 D;  3AZE C;  1P3I A;  2Y2H A;  1P3K C;  1P34 C;  2HIO D;  4JJN D;  2BYK A;  3AZK D;  4X23 C;  3REI D;  2NZD B;  3W99 C;  2Y2I A;  5F99 A;  2ARO A;  4NE5 A;  4J8V B;  3TU4 A;  3MGS D;  5B32 C;  1M19 D;  3WTP B;  2ZY4 A;  3X1T A;  4WU8 B;  1HQ3 B;  3AZH D;  1AOI A;  3W97 B;  3MGR A;  4ZUX C;  2Y2Q A;  2NQB B;  4Z66 B;  3NQJ B;  5DNM A;  3MNN D;  2Y2J A;  1TAF B;  4DRA A;  5GXQ C;  2BG1 A;  4AWL C;  5AV5 A;  4CAY B;  3AZG B;  4J8X B;  2IO5 C;  4NFT A;  3AYW D;  2ZY3 A;  4NE6 A;  4G92 C;  2JE5 A;  5BO0 B;  3AZF C;  1P3L B;  1KX5 D;  5GT3 C;  1TZY A;  3REH B;  2PYO B;  3F6T A;  1U35 A;  4Z5T C;  4H9N A;  5CPJ A;  3W98 D;  5AY8 C;  5B31 B;  1KX3 A;  1EQZ C;  3H0L C;  3WAA B;  3C1C A;  1H3O B;  5AVB A;  3UTB B;  1AOI D;  4UUZ A;  2LY8 A;  3EPL A;  2Y2P A;  1R4V A;  3X1S B;  5DNM D;  4LD9 C;  3LZ0 C;  5GT0 A;  3REL A;  3UT9 B;  3W99 B;  3W96 C;  3KUY D;  3C1B C;  1F66 C;  4E45 A;  1BH8 A;  1ULY A;  4H9Q A;  3AZL A;  4J8X A;  3B6G C;  1P3B C;  4ZUX B;  5CPK D;  4HGA B;  1P3P D;  5G49 A;  5B2I C;  3AZN D;  4WU9 B;  2BYM A;  3AZJ C;  3O62 A;  5CPJ D;  3A6N D;  4KHA B;  5B1M C;  3VH6 A;  1S32 D;  3C1C D;  5B33 C;  2JSS A;  2VQR A;  3REJ A;  5AV8 B;  1P3O D;  3WAA A;  2F8N K;  1M18 C;  2F8N B;  3R45 B;  4H9P B;  1M1A C;  4QLC C;  2CV5 B;  2RVQ D;  1ID3 C;  4Z5T B;  3AZE A;  1P3K A;  1ZLA C;  1P34 A;  5GT0 D;  3LZ1 C;  3WA9 D;  3REK B;  4WV4 B;  2FFF B;  4X23 A;  2HUE C;  5JRG C;  2ZY2 A;  3AZL D;  4KUD B;  5B32 A;  1WWI A;  4YS3 C;  5B0Z D;  4DQY B;  2YFW B;  4WNN B;  5JA4 B;  4R8P B;  4ZUX A;  1JFI B;  4WZS B;  4LD9 B;  5DNN C;  3O62 D;  3B0B A;  1Q9C A;  4J8V C;  3AZM D;  3B0D B;  5CPI D;  1W2E A;  3WTP C;  1F66 B;  4WU8 C;  1HQ3 C;  3REJ D;  5GXQ A;  5AV6 C;  3MGS B;  4KHA A;  5BT1 C;  3W97 C;  1M19 B;  3B6G B;  3AZH B;  1HTA A;  2FJ7 B;  2NQB C;  4Z66 C;  5B40 C;  5B2I B;  3AZF A;  4ZBJ B;  3AV2 C;  5GT3 A;  3AZE D;  1P3K D;  1P34 D;  5B2J B;  3AZG C;  3WKJ D;  3NQU A;  4Z5T A;  5B33 B;  5AY8 A;  1EQZ A;  1P3L C;  2YFV A;  5B32 D;  3AYW B;  3REH C;  1KX5 B;  2PYO C;  1P3F B;  3X1U D;  4XZQ C;  1ID3 B;  5B31 C;  1ZLA B;  3KXB D;  4WNN A;  4J8U C;  4DRB A;  3LZ0 A;  3AZI D;  5B24 B;  2J8P A;  3W96 A;  3C1B A;  1F66 A;  3X1S C;  4CSR A;  4YS3 B;  1P3G D;  4XUJ B;  3AZF D;  3B6G A;  3AN2 D;  1P3B A;  5E5A D;  2ZM5 A;  5DNN B;  3UT9 C;  5B2I A;  3LJA B;  3AZJ A;  3MGQ D;  2G5I C;  5AY8 D;  5AV6 B;  1EQZ D;  5B1L B;  5B1M A;  4HGA C;  4WU9 C;  5CPK B;  3B6F D;  5B40 B;  4J8W A;  5AVC A;  1P3P B;  1M18 A;  3AV2 B;  3AFA A;  1N1J B;  3AZN B;  2RIQ A;  3X1V C;  1M1A A;  4QLC A;  1P3M C;  3LZ0 D;  1ID3 A;  3MGP D;  1ZLA A;  5AV8 C;  1A7W A;  3LZ1 A;  4H9O B;  3W96 D;  3LEL B;  5B0Y C;  5GSU B;  3EG5 B;  3MVD D;  3C1B D;  1P3O B;  3IP4 C;  1P3I D;  5JRG A;  1P3A B;  3VH5 T;  2L5A A;  5AV9 C;  2CV5 C;  2DF4 C;  4XZQ B;  3AV1 B;  5F99 D;  2ARO D;  5BNX B;  4YM6 B;  5KDM B;  3REK C;  2NZD A;  3TU4 D;  4J8U B;  3AZJ D;  3WA9 B;  3X1T D;  4J8V A;  4KUD C;  3MGR D;  2Y2K A;  3UTA B;  3WTP A;  2Y2L A;  4WU8 A;  1HQ3 A;  5AV6 A;  4UPK A;  3W97 A;  3WTP E;  4R8P C;  3V9R B;  5C3I B;  5B0Z B;  3P5J B;  5AVC D;  4J8W D;  5BNV B;  3AFA D;  2NQB A;  4Z66 A;  3NQJ A;  3B0D C;  5AV5 D;  1M1A D;  1TAF A;  1T3U A;  3MGS C;  5CPI B;  3LZ1 D;  1M19 C;  4CAY A;  3A1K A;  3AZG A;  3AZH C;  3KFU G;  1WWS A;  5JRG D;  2FJ7 C;  1TZY D;  4H9O A;  5BO0 A;  3KWQ B;  1P3L A;  4ZBJ C;  1U35 D;  3FDD A;  4KGC B;  4NE3 A;  3MNN C;  5B2J C;  3REH A;  1KX3 D;  2PYO A;  2NZD D;  3X1V B;  1P3M B;  5B31 A;  1BH9 B;  5CP6 B;  5AVB D;  5B32 G;  3AYW C;  1PZR A;  5B0Y B;  3WTP D;  1H3O A;  4WU8 D;  1HQ3 D;  3UTB A;  1KX5 C;  3W97 D;  5BT1 D;  1P3F C;  5AV9 B;  3X1S A;  3X1U B;  4Z66 D;  3V9R A;  3REL D;  3W98 C;  3H0M C;  1F1E A;  5B24 C;  3W99 A;  3UT9 A;  3AZI B;  3AZG D;  4J8X D;  3EPK A;  1Z2C B;  4XUJ C;  1KX4 B;  3A1I A;  2HIO B;  4JJN B;  3REH D;  3AZK B;  3AN2 B;  3REI B;  5E5A B;  3LJA C;  4WU9 A;  2PYO D;  3KUY C;  5B31 D;  5B1L C;  3X1V A;  2Y2O A;  1P3M A;  3WAA D;  5AV8 A;  3UTB D;  5CPK C;  5B0Y A;  1P3P C;  3AZN C;  2F8N A;  3X1S D;  3MNN B;  3R45 A;  3B6F B;  4H9P A;  5AV9 A;  3A6N C;  2CV5 A;  4X23 D;  3KSY A;  3W99 D;  3UT9 D;  1S32 C;  3REK A;  3LEL C;  3C1C C;  5GSU C;  3MGP B;  1P3O C;  4H9S C;  1P3A C;  3MVD B;  1BFM A;  4KUD A;  4ZUX D;  3AV1 C;  5FUG B;  4YM6 C;  2YFW A;  4R8P A;  5JA4 A;  1JFI A;  4LD9 A;  3W98 B;  5F99 B;  3WA9 C;  2ARO B;  5GXQ D;  3TU4 B;  3UTA C;  3X1T B;  1AOI B;  5AV8 D;  3MGS A;  3MGR B;  1M19 A;  5C3I C;  5B0Z C;  3AZH A;  5GT3 D;  2FJ7 A;  5DNM B;  3O62 C;  2CV5 D;  4Z5T D;  3VH5 W;  3AZM C;  5CPI C;  5AV5 B;  3KUY B;  5B2J A;  1B67 A;  4EO5 B;  5B33 A;  3KWQ C;  3AYW A;  4KGC C;  1KU5 A;  1KX5 A;  1U35 B;  1P3F A;  4E44 A;  4R8P D;  4H9N B;  4LD9 D;  5FUG A;  3A6N B;  5CPJ B;  1KX3 B;  5CP6 C;  3WKJ C;  1S32 B;  3C1C B;  3W98 A;  1F66 D;  5AVB B;  5B24 A;  4UUZ B;  3B6G D;  1P3B D;  2FJ7 D;  4YS3 A;  3X1U C;  4XUJ A;  5B2I D;  3VH6 T;  3H0R C;  2W8S A;  5GT0 B;  3KXB C;  3REL B;  5BS7 C;  5DNN A;  4Z2M H;  5B2J D;  3AZI C;  5B1M D;  2XD5 A;  3LJA A;  1BH8 B;  4H9Q B;  5B33 D;  3KUY A;  3AZL B;  5B1L A;  1KX4 C;  1P3G C;  1M18 D;  2HIO C;  5G49 B;  4JJN C;  3AZK C;  3AN2 C;  2BYM B;  5E5A C;  2CWE A;  3REI C;  5CPK A;  5B40 A;  1P3F D;  1P3P A;  4QLC D;  3O62 B;  5B31 G;  3AV2 A;  1ID3 D;  1ZLA D;  1N1J A;  3AZN A;  3AZM B;  3MGQ C;  3A6N A;  3REJ B;  5B24 D;  1S32 A;  3LEL A;  5GSU A;  3AL0 C;  1P3O A;  2DQN C;  4H9S A;  1P3A A;  4YS3 D;  3B6F C;  4XUJ D;  3AZE B;  1P3K B;  4XZQ A;  3AV1 A;  1P34 B;  2UWX A;  4G91 C;  5DNN D;  5BNX A;  4YM6 A;  5KDM A;  3WKJ B;  3MGP C;  4X23 B;  4J8V D;  3LJA D;  4J8U A;  3WA9 A;  3MVD C;  2Y2G A;  5AV6 D;  5B32 B;  5B1L D;  1P3I C;  3UTA A;  2NQB D;  5B40 D;  5B0Z A;  5F99 C;  2ARO C;  3AV2 D;  5BNV A;  3KXB B;  3VH5 A;  3TU4 C;  3X1T C;  5GXQ B;  1AOI C;  3AZM A;  4H9R B;  4AWL B;  5CPI A;  3MGR C;  3LEL D;  5GSU D;  2IO5 B;  1P3L D;  4WJ3 C;  2F8N G;  1P3A D;  5DNM C;  4G92 B;  1P3G B;  3AZF B;  4J8W C;  5AVC C;  4M6B A;  3KWQ A;  5GT3 B;  3AFA C;  4XZQ D;  3AV1 D;  4KGC A;  5AV5 C;  2XD1 A;  3B0C W;  4YM6 D;  3NQU B;  4J8U D;  3MGQ B;  4EO5 C;  5AY8 B;  1EQZ B;  1BH9 A;  5CP6 A;  3WKJ A;  2Y2N A;  2YFV B;  2JCH A;  1TZY C;  3UTA D;  1U35 C;  5CPJ C;  2ZY5 A;  1KX3 C;  4G91 B;  2NZD C;  3X1U A;  3LZ0 B;  2F8N H;  3EPJ A;  1B6W A;  5AVB C;  3KXB A;  5BS7 A;  3W96 B;  5CHL B;  3AZI A;  3C1B B;  2Y2M A;  1P3I B;  3B0C T;  4H9R A;  4CSR B;  2RVQ C;  2BYK B;  3KWQ D;  1P3B B;  1KX4 A;  4WU9 D;  5GT0 C;  3REL C;  4KGC D;  1P3G A;  2HIO A;  4JJN A;  3AZK A;  3AN2 A;  3REI A;  5E5A A;  3AZJ B;  3X1V D;  1P3M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...