3X1VA

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vA00
1B67A 4KUDD 4XZQD 3UT9A 1P3FC 1M18C 5AV9D 3B6FB 4J8UA 5GT0D 3AZFA 2YFVA 2HIOA 5B1MD 5CPKD 5AV8D 5C3IB 5B40D 2CWEA 5BNVA 1KX5C 3KXBD 3NQJA 3AN2D 5CPKB 3V9RB 5B2IC 5B40B 1EQZA 2F8NA 3WTPA 3W96A 1P3AC 1P3LC 3W97B 4X23C 3KXBB 3AV2A 4YM6A 3A6NA 4H9PA 2FJ7D 4XUJA 3X1UC 3AZJA 3TU4C 3AZKB 4LD9B 5B1LC 5AVBB 5BO0B 1S32C 3MVDD 2FJ7B 3MNND 4JJNC 3AZMA 1M19C 3B6GA 5CPIC 1P3PA 3AYWA 3UTAC 4ZUXA 3LELC 1KU5A 4H9RB 5GXQD 4WZSB 5B24B 5JA4A 4HGAB 5BNXA 3AZHA 5B33D 3RELC 3REHD 3KUYD 1P3BB 5GT3A 4Z5TB 3LZ0D 1N1JA 4KUDA 3REJC 4XZQA 5B33B 5AV9A 3WA9C 3W98D 5GT0A 5B1MA 5BS7C 5CPKA 5AV8A 5F99C 1P34C 1ID3C 1ULYA 1P3KC 3AZGD 1P3LB 2PYOC 3AN2A 2F8NH 5AY8C 3W99D 4WNNA 2IO5C 5JRGD 3AZED 3B0DC 5B1LB 1S32B 3AZND 5JRGB 5B32A 1M19B 5CPIB 1H3OA 2BYMB 3AZNB 1P3MC 3AZID 1BH8A 3MVDA 3MNNA 2CV5B 3UTBD 4CSRB 4G92C 1M1AC 4YS3C 5GXQA 3RELB 4QLCD 3MGPC 4WU8D 3NQUA 3REJB 5DNMD 4DRAA 3REHA 1P3IC 3X1SD 5CP6C 3AFAD 3KUYA 5AVCD 3VH5T 3LZ0A 5DNMB 3WAAD 2YFWB 3REID 3UT9C 3W98A 5F99B 4KHAA 5E5AB 3WAAB 3VH6T 5AV6A 5B31A 2HIOC 1TZYB 1ZLAC 4EO5C 5CPJA 1KX3D 3AZGA 3R45B 4CAYB 1B6WA 3W99A 5GSUB 3KWQA 1HQ3C 3W96C 4E44A 3C1CA 3MGSD 3AZEA 3AV2C 4YM6C 2F8NG 4NE6A 1P3MB 3X1VC 3MGSB 1U35D 1BH9A 2BYKA 4XUJC 4J8VD 3AZJC 5B0YA 3X1TB 4AWLB 3AV1D 4YS3B 3AZIA 3MGPB 3UTBA 4DRBA 3B6GC 3AZMC 4R8PB 1P3GB 3O62D 3MGQC 3AYWC 3AV1B 1P3PC 2F8NK 1WWIA 4UUZA 4NE3A 4QLCA 4ZUXC 1P3IB 1F66C 3WKJD 4Z2MG 4WU8A 5B2JD 3LZ1D 3AZHC 3X1SA 3WKJB 3AFAA 2AROC 5AVCA 3LZ1B 1P3OD 5GT3C 4KUDC 4XZQC 3REIA 1P3OB 1ZLAB 5AV9C 4ZBJC 5GT0C 4WU9D 1KX4A 1HQ3B 1KX3A 3B6FD 4WU9B 4G91C 4J8XC 4H9NA 3AN2C 4Z66B 1A7WA 4NFTA 5B0ZA 3W97D 1U35A 4J8VA 5B32C 1JFIA 4KGCC 3MGQB 3AV1A 3MVDC 5B32G 5AV5B 3C1BB 3O62A 3AZKD 5G49A 4LD9D 5AVBD 3WKJA 4H9SA 2AROB 5B2JA 3VH6W 3MGRA 2LY8A 5B24D 1AOIC 3AZLA 4H9QA 3LZ0C 4J8WA 5FUGA 4ZBJB 2NZDC 1P3BD 4Z5TD 2JSSA 4WU9A 1P3FB 1M18B 1WWSA 5AV6C 5B31C 4J8XB 2HUEC 3B6FA 5CPJC 1R4VA 5B31G 2NQBC 3W99C 3KWQC 1KX5B 1P3LD 3REKC 3LJAC 5DNNC 5B2IB 3V9RA 3C1CC 5BT1C 5B40A 3AZEC 4KGCB 1P3AB 1TAFB 3W97A 4X23B 3KXBA 3B0BA 4E45A 5B0YC 5B1LD 1S32D 2RVQC 3X1UB 4JJND 1M19D 3TU4B 5KDMB 5CPID 4H9OB 3UTAD 3AZKA 4LD9A 5AVBA 5BO0A 2FJ7A 4JJNB 4QLCC 2CV5D 1AOIB 3UTAB 4WU8C 3LELB 4H9RA 2NZDB 3RELD 5B24A 3AFAC 3REJD 3REIC 1P3BA 3WA9D 4Z5TA 5B33A 3WA9B 1KX4C 2NQBB 5F99D 1P34D 1P3KD 5E5AD 1KX3C 3LJAB 5AY8D 1P34B 1ID3B 1TZYD 1P3KB 2PYOB 1P3LA 4J8UC 5AY8B 3AZFC 5GSUD 2IO5B 5B0ZC 1U35C 5KDMA 4J8VC 1EQZC 3B0DB 5B1LA 3WTPC 1S32A 1P3MD 5JRGA 1M19A 5CPIA 3A6NC 1HTAA 2BYMA 3X1TD 3O62C 4YS3D 3AZNA 2CV5A 3MGPD 4H9SC 4R8PD 4G92B 4CSRA 1P3GD 1M1AB 1Q9CA 3RELA 3MGRC 1P3ID 5CP6D 3REJA 3AZLC 4J8WC 5CP6B 3UT9D 5DNMA 2YFWA 3UT9B 2HIOD 5F99A 1ZLAD 5E5AA 3B6FC 3WAAA 4J8UB 2YFVB 5AY8A 2HIOB 1HQ3D 1TZYA 4EO5B 5BNVB 3R45A 3W96D 4CAYA 3NQJB 5B1MC 5GSUA 3AV2D 5CPKC 5AV8C 1EQZB 2F8NB 5B40C 4Z66D 3W96B 3X1VD 3W97C 3KXBC 3AV2B 4XUJD 4YM6B 3AZJD 4H9PB 3X1VB 1P3MA 3MGSA 4XUJB 3AZMD 3AZJB 3X1TA 3MGQD 3AYWD 4YS3A 3MGPA 3B6GB 1F66D 3AZMB 2FJ7C 5AV5D 4R8PA 1P3GA 3C1BD 3AYWB 1P3PB 4ZUXB 1P3IA 1F66B 3VH5W 3MNNC 2AROD 5B24C 5JA4B 4HGAC 5BNXB 5GT3D 3AZHB 5GXQC 3LZ1A 1P3BC 5GT3B 1N1JB 4Z5TC 4KUDB 4XZQB 5B33C 3REHC 3KUYC 1P3OA 5AV9B 1ZLAA 5GT0B 1P3FD 1M18D 5B1MB 4J8XD 1HQ3A 3W98C 5AV8B 3WTPE 4G91B 3AN2B 4Z66A 4WNNB 3AZGC 3X1VA 1KX5D 5B2ID 5B32D 4KGCD 1P3AD 4X23D 5JRGC 5B32B 1H3OB 3MGQA 3AZNC 1BH8B 3MVDB 3X1UD 3MNNB 1F66A 5AV5A 2CV5C 3TU4D 3C1BA 3AZIC 5GXQB 2AROA 3UTBC 1AOID 3NQUB 3LELD 2NZDD 3REHB 3KUYB 3LZ0B 5DNMC 5AV6D 3X1SC 3KSYA 5B31D 3W98B 5AVCC 4KHAB 5CPJD 5E5AC 1P3FA 3WAAC 5AV6B 1M18A 5B31B 4J8XA 2HUEB 2NQBD 3KWQD 1TZYC 5CPJB 3B0CT 3AZGB 3REKD 3LJAD 5DNND 3C1CD 3W99B 5BT1D 5GSUC 3KWQB 1ID3D 2PYOD 1KX5A 3REKB 5DNNB 3C1CB 5B2IA 3AZEB 4KGCA 1P3AA 5B0YD 1TAFA 1F1EA 4NE5A 4X23A 2RVQD 4Z2MH 3MGSC 1BH9B 2BYKB 5B0YB 3X1TC 4AWLC 3AZIB 3X1UA 3UTBB 2L5AA 3TU4A 4H9OA 4R8PC 1P3GC 3AV1C 4JJNA 4UUZB 4QLCB 4WV4B 3UTAA 1AOIA 4WU8B 1M1AD 3LELA 2NZDA 3X1SB 3AFAB 3WKJC 5AVCB 5B2JC 3LZ1C 3REIB 1KX4D 3VH5A 1P3OC 4M6BA 1BFMA 3WA9A 1KX4B 2NQBA 1KX3B 3VH6A 3REKA 4J8UD 3LJAA 4WU9C 5BS7A 5DNNA 3AZFD 4H9NB 1P34A 1ID3A 1P3KA 2PYOA 4Z66C 3AZFB 5B0ZD 5C3IC 1EQZD 2F8ND 3WTPD 5B0ZB 1U35B 4J8VB 4YM6D 3A6ND 1JFIB 3WTPB 5CHLB 3A6NB 5AV5C 3O62B 3C1BC 5G49B 3MGRD 3B6GD 5B2JB 1M1AA 1P3PD 3AZKC 3AZLD 3MGRB 4ZUXD 4J8WD 5AVBC 4LD9C 3B0CW 3AZLB 4H9QB 3AZHD 4J8WB 5FUGB 5CP6A
chains in the Genus database with same CATH superfamily
2FFFB 1B67A 4KUDD 4XZQD 3UT9A 1P3FC 1M18C 5AV9D 2ZY5A 3B6FB 4J8UA 5GT0D 3AZFA 2YFVA 2HIOA 3F6TA 5B1MD 5CPKD 5C3IB 5AV8D 5B40D 2CWEA 5BNVA 1KX5C 2J8PA 3KXBD 3NQJA 3AN2D 5CPKB 3V9RB 5B2IC 5B40B 1EQZA 2F8NA 3WTPA 3W96A 1P3AC 1P3LC 3W97B 4X23C 3KXBB 3AV2A 4YM6A 3A6NA 4H9PA 2FJ7D 4XUJA 3X1UC 3AZJA 3TU4C 3AZKB 4LD9B 5B1LC 5AVBB 5BO0B 1S32C 3MVDD 2FJ7B 3MNND 4JJNC 3AZMA 1M19C 3B6GA 5CPIC 1P3PA 3AYWA 3UTAC 4ZUXA 3LELC 1KU5A 4H9RB 5GXQD 4WZSB 5B24B 5JA4A 4HGAB 5BNXA 3AZHA 5B33D 3RELC 3REHD 3KUYD 1P3BB 2JCHA 5GT3A 4Z5TB 3LZ0D 1N1JA 4KUDA 3REJC 4XZQA 5B33B 5AV9A 3WA9C 3W98D 5GT0A 5B1MA 5BS7C 5CPKA 5AV8A 5F99C 1P34C 1ID3C 1ULYA 1P3KC 3AZGD 1P3LB 2PYOC 3AN2A 2F8NH 5AY8C 3W99D 4WNNA 3IP4C 2IO5C 5JRGD 3AZED 3EPHA 3B0DC 5B1LB 1S32B 3AZND 5JRGB 5B32A 1M19B 5CPIB 1H3OA 2BYMB 3AZNB 1P3MC 3AZID 1BH8A 3MVDA 3MNNA 2CV5B 3UTBD 4CSRB 4G92C 1M1AC 4YS3C 5GXQA 3RELB 4QLCD 3MGPC 2G5HC 4WU8D 3NQUA 3REJB 5DNMD 4DRAA 3REHA 1P3IC 3X1SD 5CP6C 3AFAD 3KUYA 5AVCD 3VH5T 3LZ0A 5DNMB 3WAAD 2YFWB 3REID 3UT9C 3W98A 5F99B 4KHAA 5E5AB 3WAAB 2W8SA 3VH6T 5AV6A 5B31A 2HIOC 1TZYB 1ZLAC 4EO5C 5CPJA 1KX3D 3AZGA 3R45B 4CAYB 2ZY2A 3EPJA 1B6WA 3W99A 5GSUB 3KWQA 1HQ3C 3W96C 4E44A 3C1CA 3MGSD 3AZEA 3AV2C 3A1KA 4YM6C 4NE6A 2ZM5A 2F8NG 1P3MB 3X1VC 3MGSB 1U35D 1BH9A 2BYKA 4XUJC 4J8VD 3AZJC 5B0YA 3H0RC 3X1TB 4AWLB 3AV1D 4YS3B 3AZIA 3MGPB 3UTBA 4DRBA 3B6GC 3AZMC 4R8PB 4WJ3C 1P3GB 3O62D 3MGQC 3AYWC 3AV1B 1P3PC 2F8NK 1WWIA 4UUZA 4NE3A 4QLCA 4ZUXC 1P3IB 1F66C 3WKJD 4Z2MG 4WU8A 5B2JD 3LZ1D 3AZHC 3X1SA 3WKJB 3AFAA 2AROC 5AVCA 3LZ1B 1P3OD 5GT3C 4KUDC 4XZQC 3REIA 1P3OB 1ZLAB 5AV9C 4ZBJC 5GT0C 4WU9D 1KX4A 1HQ3B 1KX3A 3B6FD 2DQNC 4WU9B 4G91C 4J8XC 4H9NA 3AN2C 4Z66B 2Y2NA 1A7WA 4NFTA 5B0ZA 3W97D 2Y2HA 1U35A 4J8VA 5B32C 1JFIA 4KGCC 3MGQB 3AV1A 2Y2KA 3MVDC 5B32G 5AV5B 3C1BB 3O62A 3AZKD 5G49A 4LD9D 5AVBD 3WKJA 4H9SA 2AROB 5B2JA 3VH6W 3MGRA 2LY8A 5B24D 1AOIC 3AZLA 4H9QA 3LZ0C 4J8WA 2XD1A 5FUGA 4ZBJB 2NZDC 2G5IC 1P3BD 4Z5TD 2JSSA 4WU9A 1P3FB 1M18B 1WWSA 2RIQA 5AV6C 5B31C 4J8XB 2HUEC 3B6FA 5CPJC 1R4VA 5B31G 2BG1A 3W99C 2NQBC 2Y2MA 3KWQC 1KX5B 1P3LD 3REKC 3LJAC 5DNNC 5B2IB 3V9RA 3C1CC 5BT1C 5B40A 3AZEC 4KGCB 1P3AB 2ZY3A 1TAFB 3W97A 4X23B 3KXBA 3B0BA 4E45A 5B0YC 5B1LD 1S32D 2RVQC 3X1UB 4JJND 1M19D 3TU4B 5KDMB 5CPID 4H9OB 3UTAD 3EPLA 3AZKA 4LD9A 5AVBA 5BO0A 2FJ7A 4JJNB 2Y2LA 4QLCC 2CV5D 1AOIB 3UTAB 4WU8C 3LELB 4H9RA 2NZDB 3RELD 5B24A 3AFAC 3REJD 3REIC 1P3BA 3WA9D 4UPKA 4Z5TA 3KFUG 5B33A 3WA9B 1KX4C 2NQBB 5F99D 1P34D 1P3KD 1PZRA 5E5AD 1KX3C 3LJAB 5AY8D 1P34B 1ID3B 1TZYD 1P3KB 2PYOB 1P3LA 4J8UC 5AY8B 3AZFC 5GSUD 2IO5B 5B0ZC 1U35C 5KDMA 4J8VC 1EQZC 3B0DB 5B1LA 3WTPC 1S32A 1P3MD 5JRGA 1M19A 5CPIA 3A6NC 1HTAA 2BYMA 3X1TD 3O62C 4YS3D 3AZNA 2CV5A 3MGPD 2Y2PA 4H9SC 3H0LC 4R8PD 2JE5A 4CSRA 4G92B 1P3GD 1M1AB 1Q9CA 3RELA 3MGRC 1P3ID 5CP6D 3REJA 3AZLC 4J8WC 5CP6B 3UT9D 2XD5A 5DNMA 2YFWA 3UT9B 2HIOD 5F99A 1ZLAD 5E5AA 3B6FC 3WAAA 4J8UB 2YFVB 5AY8A 2HIOB 1HQ3D 1TZYA 4EO5B 5BNVB 3R45A 3W96D 4CAYA 3NQJB 5B1MC 5GSUA 3AV2D 5CPKC 5AV8C 1EQZB 2F8NB 5B40C 4Z66D 3W96B 3X1VD 3W97C 2DF4C 3KXBC 3AV2B 2ZY4A 4XUJD 4YM6B 3AZJD 4H9PB 3X1VB 1P3MA 3EG5B 3MGSA 2UWXA 3P5JB 3A1IA 4XUJB 3AZMD 3AZJB 3X1TA 3MGQD 3AYWD 4YS3A 3MGPA 3B6GB 1F66D 3AZMB 2FJ7C 5AV5D 4R8PA 1P3GA 3C1BD 3AYWB 1P3PB 4ZUXB 1P3IA 1F66B 3VH5W 3MNNC 2AROD 5B24C 5JA4B 4HGAC 5BNXB 5GT3D 3AZHB 5GXQC 3LZ1A 1P3BC 5GT3B 1N1JB 1W2EA 4Z5TC 4KUDB 4XZQB 5B33C 3REHC 3KUYC 4DQYB 1P3OA 5AV9B 1ZLAA 5GT0B 1P3FD 1M18D 5B1MB 4J8XD 1HQ3A 3W98C 5AV8B 3WTPE 4G91B 3AN2B 2Y2IA 4Z66A 4WNNB 3AZGC 3X1VA 1KX5D 5B2ID 5B32D 4KGCD 1P3AD 4X23D 5JRGC 5B32B 1H3OB 3MGQA 3AZNC 1BH8B 3MVDB 3X1UD 3MNNB 1F66A 5AV5A 2CV5C 3TU4D 3C1BA 3AZIC 2F2AC 5GXQB 2AROA 3UTBC 1AOID 3NQUB 3LELD 2NZDD 3REHB 3KUYB 3LZ0B 5DNMC 1Z2CB 5AV6D 3X1SC 3KSYA 5B31D 3W98B 5AVCC 4KHAB 2Y2QA 5CPJD 5E5AC 1P3FA 3WAAC 5AV6B 1M18A 5B31B 4J8XA 2HUEB 2NQBD 3KWQD 1TZYC 5CPJB 3B0CT 3AZGB 3REKD 3LJAD 5DNND 3C1CD 3W99B 5BT1D 5GSUC 3KWQB 1ID3D 2PYOD 1KX5A 3REKB 5DNNB 3C1CB 5B2IA 3AZEB 4KGCA 1P3AA 5B0YD 1TAFA 1F1EA 4NE5A 4X23A 2RVQD 4Z2MH 3MGSC 1BH9B 2BYKB 5B0YB 3X1TC 4AWLC 3AZIB 3X1UA 3UTBB 2L5AA 3TU4A 4H9OA 4R8PC 1P3GC 3AV1C 4JJNA 4UUZB 2Y2OA 4QLCB 4WV4B 3UTAA 1AOIA 4WU8B 1M1AD 3LELA 2VQRA 2NZDA 3X1SB 3AFAB 3WKJC 5AVCB 5B2JC 3LZ1C 3EPKA 3AL0C 3REIB 1KX4D 3VH5A 1P3OC 4M6BA 1BFMA 3WA9A 1KX4B 2NQBA 1KX3B 3VH6A 3REKA 4J8UD 3LJAA 4WU9C 5BS7A 5DNNA 3AZFD 4H9NB 1P34A 1ID3A 1P3KA 2PYOA 4Z66C 3AZFB 5B0ZD 5C3IC 1EQZD 2F8ND 3H0MC 3WTPD 5B0ZB 1U35B 4J8VB 4YM6D 3A6ND 1JFIB 3WTPB 2Y2GA 5CHLB 3A6NB 5AV5C 3O62B 2Y2JA 3C1BC 5G49B 3MGRD 3B6GD 5B2JB 1M1AA 1P3PD 3AZKC 1T3UA 3AZLD 3MGRB 4ZUXD 4J8WD 5AVBC 4LD9C 3FDDA 3B0CW 3AZLB 4H9QB 3AZHD 4J8WB 5FUGB 5CP6A
chains in the Genus database with same CATH topology
2FFFB 1B67A 4KUDD 4XZQD 3UT9A 1P3FC 1M18C 5AV9D 2ZY5A 3B6FB 4J8UA 5GT0D 3AZFA 2YFVA 2HIOA 3F6TA 5B1MD 5CPKD 5C3IB 5AV8D 5B40D 2CWEA 5BNVA 1KX5C 2J8PA 3KXBD 3NQJA 3AN2D 5CPKB 3V9RB 5B2IC 5B40B 1EQZA 2F8NA 3WTPA 3W96A 1P3AC 1P3LC 3W97B 4X23C 3KXBB 3AV2A 4YM6A 3A6NA 4H9PA 2FJ7D 4XUJA 3X1UC 3AZJA 3TU4C 3AZKB 4LD9B 5B1LC 5AVBB 5BO0B 1S32C 3MVDD 2FJ7B 3MNND 4JJNC 3AZMA 1M19C 3B6GA 5CPIC 1P3PA 3AYWA 3UTAC 4ZUXA 3LELC 1KU5A 4H9RB 5GXQD 4WZSB 5B24B 5JA4A 4HGAB 5BNXA 3AZHA 5B33D 3RELC 3REHD 3KUYD 1P3BB 2JCHA 5GT3A 4Z5TB 3LZ0D 1N1JA 4KUDA 3REJC 4XZQA 5B33B 5AV9A 3WA9C 3W98D 5GT0A 5B1MA 5BS7C 5CPKA 5AV8A 5F99C 1P34C 1ID3C 1ULYA 1P3KC 3AZGD 1P3LB 2PYOC 3AN2A 2F8NH 5AY8C 3W99D 4WNNA 3IP4C 2IO5C 5JRGD 3AZED 3EPHA 3B0DC 5B1LB 1S32B 3AZND 5JRGB 5B32A 1M19B 5CPIB 1H3OA 2BYMB 3AZNB 1P3MC 3AZID 1BH8A 3MVDA 3MNNA 2CV5B 3UTBD 4CSRB 4G92C 1M1AC 4YS3C 5GXQA 3RELB 4QLCD 3MGPC 2G5HC 4WU8D 3NQUA 3REJB 5DNMD 4DRAA 3REHA 1P3IC 3X1SD 5CP6C 3AFAD 3KUYA 5AVCD 3VH5T 3LZ0A 5DNMB 3WAAD 2YFWB 3REID 3UT9C 3W98A 5F99B 4KHAA 5E5AB 3WAAB 2W8SA 3VH6T 5AV6A 5B31A 2HIOC 1TZYB 1ZLAC 4EO5C 5CPJA 1KX3D 3AZGA 3R45B 4CAYB 2ZY2A 3EPJA 1B6WA 3W99A 5GSUB 3KWQA 1HQ3C 3W96C 4E44A 3C1CA 3MGSD 3AZEA 3AV2C 3A1KA 4YM6C 4NE6A 2ZM5A 2F8NG 1P3MB 3X1VC 3MGSB 1U35D 1BH9A 2BYKA 4XUJC 4J8VD 3AZJC 5B0YA 3H0RC 3X1TB 4AWLB 3AV1D 4YS3B 3AZIA 3MGPB 3UTBA 4DRBA 3B6GC 3AZMC 4R8PB 4WJ3C 1P3GB 3O62D 3MGQC 3AYWC 3AV1B 1P3PC 2F8NK 1WWIA 4UUZA 4NE3A 4QLCA 4ZUXC 1P3IB 1F66C 3WKJD 4Z2MG 4WU8A 5B2JD 3LZ1D 3AZHC 3X1SA 3WKJB 3AFAA 2AROC 5AVCA 3LZ1B 1P3OD 5GT3C 4KUDC 4XZQC 3REIA 1P3OB 1ZLAB 5AV9C 4ZBJC 5GT0C 4WU9D 1KX4A 1HQ3B 1KX3A 3B6FD 2DQNC 4WU9B 4G91C 4J8XC 4H9NA 3AN2C 4Z66B 2Y2NA 1A7WA 4NFTA 5B0ZA 3W97D 2Y2HA 1U35A 4J8VA 5B32C 1JFIA 4KGCC 3MGQB 3AV1A 2Y2KA 3MVDC 5B32G 5AV5B 3C1BB 3O62A 3AZKD 5G49A 4LD9D 5AVBD 3WKJA 4H9SA 2AROB 5B2JA 3VH6W 3MGRA 2LY8A 5B24D 1AOIC 3AZLA 4H9QA 3LZ0C 4J8WA 2XD1A 5FUGA 4ZBJB 2NZDC 2G5IC 1P3BD 4Z5TD 2JSSA 4WU9A 1P3FB 1M18B 1WWSA 2RIQA 5AV6C 5B31C 4J8XB 2HUEC 3B6FA 5CPJC 1R4VA 5B31G 2BG1A 3W99C 2NQBC 2Y2MA 3KWQC 1KX5B 1P3LD 3REKC 3LJAC 5DNNC 5B2IB 3V9RA 3C1CC 5BT1C 5B40A 3AZEC 4KGCB 1P3AB 2ZY3A 1TAFB 3W97A 4X23B 3KXBA 3B0BA 4E45A 5B0YC 5B1LD 1S32D 2RVQC 3X1UB 4JJND 1M19D 3TU4B 5KDMB 5CPID 4H9OB 3UTAD 3EPLA 3AZKA 4LD9A 5AVBA 5BO0A 2FJ7A 4JJNB 2Y2LA 4QLCC 2CV5D 1AOIB 3UTAB 4WU8C 3LELB 4H9RA 2NZDB 3RELD 5B24A 3AFAC 3REJD 3REIC 1P3BA 3WA9D 4UPKA 4Z5TA 3KFUG 5B33A 3WA9B 1KX4C 2NQBB 5F99D 1P34D 1P3KD 1PZRA 5E5AD 1KX3C 3LJAB 5AY8D 1P34B 1ID3B 1TZYD 1P3KB 2PYOB 1P3LA 4J8UC 5AY8B 3AZFC 5GSUD 2IO5B 5B0ZC 1U35C 5KDMA 4J8VC 1EQZC 3B0DB 5B1LA 3WTPC 1S32A 1P3MD 5JRGA 1M19A 5CPIA 3A6NC 1HTAA 2BYMA 3X1TD 3O62C 4YS3D 3AZNA 2CV5A 3MGPD 2Y2PA 4H9SC 3H0LC 4R8PD 2JE5A 4CSRA 4G92B 1P3GD 1M1AB 1Q9CA 3RELA 3MGRC 1P3ID 5CP6D 3REJA 3AZLC 4J8WC 5CP6B 3UT9D 2XD5A 5DNMA 2YFWA 3UT9B 2HIOD 5F99A 1ZLAD 5E5AA 3B6FC 3WAAA 4J8UB 2YFVB 5AY8A 2HIOB 1HQ3D 1TZYA 4EO5B 5BNVB 3R45A 3W96D 4CAYA 3NQJB 5B1MC 5GSUA 3AV2D 5CPKC 5AV8C 1EQZB 2F8NB 5B40C 4Z66D 3W96B 3X1VD 3W97C 2DF4C 3KXBC 3AV2B 2ZY4A 4XUJD 4YM6B 3AZJD 4H9PB 3X1VB 1P3MA 3EG5B 3MGSA 2UWXA 3P5JB 3A1IA 4XUJB 3AZMD 3AZJB 3X1TA 3MGQD 3AYWD 4YS3A 3MGPA 3B6GB 1F66D 3AZMB 2FJ7C 5AV5D 4R8PA 1P3GA 3C1BD 3AYWB 1P3PB 4ZUXB 1P3IA 1F66B 3VH5W 3MNNC 2AROD 5B24C 5JA4B 4HGAC 5BNXB 5GT3D 3AZHB 5GXQC 3LZ1A 1P3BC 5GT3B 1N1JB 1W2EA 4Z5TC 4KUDB 4XZQB 5B33C 3REHC 3KUYC 4DQYB 1P3OA 5AV9B 1ZLAA 5GT0B 1P3FD 1M18D 5B1MB 4J8XD 1HQ3A 3W98C 5AV8B 3WTPE 4G91B 3AN2B 2Y2IA 4Z66A 4WNNB 3AZGC 3X1VA 1KX5D 5B2ID 5B32D 4KGCD 1P3AD 4X23D 5JRGC 5B32B 1H3OB 3MGQA 3AZNC 1BH8B 3MVDB 3X1UD 3MNNB 1F66A 5AV5A 2CV5C 3TU4D 3C1BA 3AZIC 2F2AC 5GXQB 2AROA 3UTBC 1AOID 3NQUB 3LELD 2NZDD 3REHB 3KUYB 3LZ0B 5DNMC 1Z2CB 5AV6D 3X1SC 3KSYA 5B31D 3W98B 5AVCC 4KHAB 2Y2QA 5CPJD 5E5AC 1P3FA 3WAAC 5AV6B 1M18A 5B31B 4J8XA 2HUEB 2NQBD 3KWQD 1TZYC 5CPJB 3B0CT 3AZGB 3REKD 3LJAD 5DNND 3C1CD 3W99B 5BT1D 5GSUC 3KWQB 1ID3D 2PYOD 1KX5A 3REKB 5DNNB 3C1CB 5B2IA 3AZEB 4KGCA 1P3AA 5B0YD 1TAFA 1F1EA 4NE5A 4X23A 2RVQD 4Z2MH 3MGSC 1BH9B 2BYKB 5B0YB 3X1TC 4AWLC 3AZIB 3X1UA 3UTBB 2L5AA 3TU4A 4H9OA 4R8PC 1P3GC 3AV1C 4JJNA 4UUZB 2Y2OA 4QLCB 4WV4B 3UTAA 1AOIA 4WU8B 1M1AD 3LELA 2VQRA 2NZDA 3X1SB 3AFAB 3WKJC 5AVCB 5B2JC 3LZ1C 3EPKA 3AL0C 3REIB 1KX4D 3VH5A 1P3OC 4M6BA 1BFMA 3WA9A 1KX4B 2NQBA 1KX3B 3VH6A 3REKA 4J8UD 3LJAA 4WU9C 5BS7A 5DNNA 3AZFD 4H9NB 1P34A 1ID3A 1P3KA 2PYOA 4Z66C 3AZFB 5B0ZD 5C3IC 1EQZD 2F8ND 3H0MC 3WTPD 5B0ZB 1U35B 4J8VB 4YM6D 3A6ND 1JFIB 3WTPB 2Y2GA 5CHLB 3A6NB 5AV5C 3O62B 2Y2JA 3C1BC 5G49B 3MGRD 3B6GD 5B2JB 1M1AA 1P3PD 3AZKC 1T3UA 3AZLD 3MGRB 4ZUXD 4J8WD 5AVBC 4LD9C 3FDDA 3B0CW 3AZLB 4H9QB 3AZHD 4J8WB 5FUGB 5CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B67 A;  4KUD D;  4XZQ D;  3UT9 A;  1P3F C;  1M18 C;  5AV9 D;  3B6F B;  4J8U A;  5GT0 D;  3AZF A;  2YFV A;  2HIO A;  5B1M D;  5CPK D;  5AV8 D;  5C3I B;  5B40 D;  2CWE A;  5BNV A;  1KX5 C;  3KXB D;  3NQJ A;  3AN2 D;  5CPK B;  3V9R B;  5B2I C;  5B40 B;  1EQZ A;  2F8N A;  3WTP A;  3W96 A;  1P3A C;  1P3L C;  3W97 B;  4X23 C;  3KXB B;  3AV2 A;  4YM6 A;  3A6N A;  4H9P A;  2FJ7 D;  4XUJ A;  3X1U C;  3AZJ A;  3TU4 C;  3AZK B;  4LD9 B;  5B1L C;  5AVB B;  5BO0 B;  1S32 C;  3MVD D;  2FJ7 B;  3MNN D;  4JJN C;  3AZM A;  1M19 C;  3B6G A;  5CPI C;  1P3P A;  3AYW A;  3UTA C;  4ZUX A;  3LEL C;  1KU5 A;  4H9R B;  5GXQ D;  4WZS B;  5B24 B;  5JA4 A;  4HGA B;  5BNX A;  3AZH A;  5B33 D;  3REL C;  3REH D;  3KUY D;  1P3B B;  5GT3 A;  4Z5T B;  3LZ0 D;  1N1J A;  4KUD A;  3REJ C;  4XZQ A;  5B33 B;  5AV9 A;  3WA9 C;  3W98 D;  5GT0 A;  5B1M A;  5BS7 C;  5CPK A;  5AV8 A;  5F99 C;  1P34 C;  1ID3 C;  1ULY A;  1P3K C;  3AZG D;  1P3L B;  2PYO C;  3AN2 A;  2F8N H;  5AY8 C;  3W99 D;  4WNN A;  2IO5 C;  5JRG D;  3AZE D;  3B0D C;  5B1L B;  1S32 B;  3AZN D;  5JRG B;  5B32 A;  1M19 B;  5CPI B;  1H3O A;  2BYM B;  3AZN B;  1P3M C;  3AZI D;  1BH8 A;  3MVD A;  3MNN A;  2CV5 B;  3UTB D;  4CSR B;  4G92 C;  1M1A C;  4YS3 C;  5GXQ A;  3REL B;  4QLC D;  3MGP C;  4WU8 D;  3NQU A;  3REJ B;  5DNM D;  4DRA A;  3REH A;  1P3I C;  3X1S D;  5CP6 C;  3AFA D;  3KUY A;  5AVC D;  3VH5 T;  3LZ0 A;  5DNM B;  3WAA D;  2YFW B;  3REI D;  3UT9 C;  3W98 A;  5F99 B;  4KHA A;  5E5A B;  3WAA B;  3VH6 T;  5AV6 A;  5B31 A;  2HIO C;  1TZY B;  1ZLA C;  4EO5 C;  5CPJ A;  1KX3 D;  3AZG A;  3R45 B;  4CAY B;  1B6W A;  3W99 A;  5GSU B;  3KWQ A;  1HQ3 C;  3W96 C;  4E44 A;  3C1C A;  3MGS D;  3AZE A;  3AV2 C;  4YM6 C;  2F8N G;  4NE6 A;  1P3M B;  3X1V C;  3MGS B;  1U35 D;  1BH9 A;  2BYK A;  4XUJ C;  4J8V D;  3AZJ C;  5B0Y A;  3X1T B;  4AWL B;  3AV1 D;  4YS3 B;  3AZI A;  3MGP B;  3UTB A;  4DRB A;  3B6G C;  3AZM C;  4R8P B;  1P3G B;  3O62 D;  3MGQ C;  3AYW C;  3AV1 B;  1P3P C;  2F8N K;  1WWI A;  4UUZ A;  4NE3 A;  4QLC A;  4ZUX C;  1P3I B;  1F66 C;  3WKJ D;  4Z2M G;  4WU8 A;  5B2J D;  3LZ1 D;  3AZH C;  3X1S A;  3WKJ B;  3AFA A;  2ARO C;  5AVC A;  3LZ1 B;  1P3O D;  5GT3 C;  4KUD C;  4XZQ C;  3REI A;  1P3O B;  1ZLA B;  5AV9 C;  4ZBJ C;  5GT0 C;  4WU9 D;  1KX4 A;  1HQ3 B;  1KX3 A;  3B6F D;  4WU9 B;  4G91 C;  4J8X C;  4H9N A;  3AN2 C;  4Z66 B;  1A7W A;  4NFT A;  5B0Z A;  3W97 D;  1U35 A;  4J8V A;  5B32 C;  1JFI A;  4KGC C;  3MGQ B;  3AV1 A;  3MVD C;  5B32 G;  5AV5 B;  3C1B B;  3O62 A;  3AZK D;  5G49 A;  4LD9 D;  5AVB D;  3WKJ A;  4H9S A;  2ARO B;  5B2J A;  3VH6 W;  3MGR A;  2LY8 A;  5B24 D;  1AOI C;  3AZL A;  4H9Q A;  3LZ0 C;  4J8W A;  5FUG A;  4ZBJ B;  2NZD C;  1P3B D;  4Z5T D;  2JSS A;  4WU9 A;  1P3F B;  1M18 B;  1WWS A;  5AV6 C;  5B31 C;  4J8X B;  2HUE C;  3B6F A;  5CPJ C;  1R4V A;  5B31 G;  2NQB C;  3W99 C;  3KWQ C;  1KX5 B;  1P3L D;  3REK C;  3LJA C;  5DNN C;  5B2I B;  3V9R A;  3C1C C;  5BT1 C;  5B40 A;  3AZE C;  4KGC B;  1P3A B;  1TAF B;  3W97 A;  4X23 B;  3KXB A;  3B0B A;  4E45 A;  5B0Y C;  5B1L D;  1S32 D;  2RVQ C;  3X1U B;  4JJN D;  1M19 D;  3TU4 B;  5KDM B;  5CPI D;  4H9O B;  3UTA D;  3AZK A;  4LD9 A;  5AVB A;  5BO0 A;  2FJ7 A;  4JJN B;  4QLC C;  2CV5 D;  1AOI B;  3UTA B;  4WU8 C;  3LEL B;  4H9R A;  2NZD B;  3REL D;  5B24 A;  3AFA C;  3REJ D;  3REI C;  1P3B A;  3WA9 D;  4Z5T A;  5B33 A;  3WA9 B;  1KX4 C;  2NQB B;  5F99 D;  1P34 D;  1P3K D;  5E5A D;  1KX3 C;  3LJA B;  5AY8 D;  1P34 B;  1ID3 B;  1TZY D;  1P3K B;  2PYO B;  1P3L A;  4J8U C;  5AY8 B;  3AZF C;  5GSU D;  2IO5 B;  5B0Z C;  1U35 C;  5KDM A;  4J8V C;  1EQZ C;  3B0D B;  5B1L A;  3WTP C;  1S32 A;  1P3M D;  5JRG A;  1M19 A;  5CPI A;  3A6N C;  1HTA A;  2BYM A;  3X1T D;  3O62 C;  4YS3 D;  3AZN A;  2CV5 A;  3MGP D;  4H9S C;  4R8P D;  4G92 B;  4CSR A;  1P3G D;  1M1A B;  1Q9C A;  3REL A;  3MGR C;  1P3I D;  5CP6 D;  3REJ A;  3AZL C;  4J8W C;  5CP6 B;  3UT9 D;  5DNM A;  2YFW A;  3UT9 B;  2HIO D;  5F99 A;  1ZLA D;  5E5A A;  3B6F C;  3WAA A;  4J8U B;  2YFV B;  5AY8 A;  2HIO B;  1HQ3 D;  1TZY A;  4EO5 B;  5BNV B;  3R45 A;  3W96 D;  4CAY A;  3NQJ B;  5B1M C;  5GSU A;  3AV2 D;  5CPK C;  5AV8 C;  1EQZ B;  2F8N B;  5B40 C;  4Z66 D;  3W96 B;  3X1V D;  3W97 C;  3KXB C;  3AV2 B;  4XUJ D;  4YM6 B;  3AZJ D;  4H9P B;  3X1V B;  1P3M A;  3MGS A;  4XUJ B;  3AZM D;  3AZJ B;  3X1T A;  3MGQ D;  3AYW D;  4YS3 A;  3MGP A;  3B6G B;  1F66 D;  3AZM B;  2FJ7 C;  5AV5 D;  4R8P A;  1P3G A;  3C1B D;  3AYW B;  1P3P B;  4ZUX B;  1P3I A;  1F66 B;  3VH5 W;  3MNN C;  2ARO D;  5B24 C;  5JA4 B;  4HGA C;  5BNX B;  5GT3 D;  3AZH B;  5GXQ C;  3LZ1 A;  1P3B C;  5GT3 B;  1N1J B;  4Z5T C;  4KUD B;  4XZQ B;  5B33 C;  3REH C;  3KUY C;  1P3O A;  5AV9 B;  1ZLA A;  5GT0 B;  1P3F D;  1M18 D;  5B1M B;  4J8X D;  1HQ3 A;  3W98 C;  5AV8 B;  3WTP E;  4G91 B;  3AN2 B;  4Z66 A;  4WNN B;  3AZG C;  3X1V A;  1KX5 D;  5B2I D;  5B32 D;  4KGC D;  1P3A D;  4X23 D;  5JRG C;  5B32 B;  1H3O B;  3MGQ A;  3AZN C;  1BH8 B;  3MVD B;  3X1U D;  3MNN B;  1F66 A;  5AV5 A;  2CV5 C;  3TU4 D;  3C1B A;  3AZI C;  5GXQ B;  2ARO A;  3UTB C;  1AOI D;  3NQU B;  3LEL D;  2NZD D;  3REH B;  3KUY B;  3LZ0 B;  5DNM C;  5AV6 D;  3X1S C;  3KSY A;  5B31 D;  3W98 B;  5AVC C;  4KHA B;  5CPJ D;  5E5A C;  1P3F A;  3WAA C;  5AV6 B;  1M18 A;  5B31 B;  4J8X A;  2HUE B;  2NQB D;  3KWQ D;  1TZY C;  5CPJ B;  3B0C T;  3AZG B;  3REK D;  3LJA D;  5DNN D;  3C1C D;  3W99 B;  5BT1 D;  5GSU C;  3KWQ B;  1ID3 D;  2PYO D;  1KX5 A;  3REK B;  5DNN B;  3C1C B;  5B2I A;  3AZE B;  4KGC A;  1P3A A;  5B0Y D;  1TAF A;  1F1E A;  4NE5 A;  4X23 A;  2RVQ D;  4Z2M H;  3MGS C;  1BH9 B;  2BYK B;  5B0Y B;  3X1T C;  4AWL C;  3AZI B;  3X1U A;  3UTB B;  2L5A A;  3TU4 A;  4H9O A;  4R8P C;  1P3G C;  3AV1 C;  4JJN A;  4UUZ B;  4QLC B;  4WV4 B;  3UTA A;  1AOI A;  4WU8 B;  1M1A D;  3LEL A;  2NZD A;  3X1S B;  3AFA B;  3WKJ C;  5AVC B;  5B2J C;  3LZ1 C;  3REI B;  1KX4 D;  3VH5 A;  1P3O C;  4M6B A;  1BFM A;  3WA9 A;  1KX4 B;  2NQB A;  1KX3 B;  3VH6 A;  3REK A;  4J8U D;  3LJA A;  4WU9 C;  5BS7 A;  5DNN A;  3AZF D;  4H9N B;  1P34 A;  1ID3 A;  1P3K A;  2PYO A;  4Z66 C;  3AZF B;  5B0Z D;  5C3I C;  1EQZ D;  2F8N D;  3WTP D;  5B0Z B;  1U35 B;  4J8V B;  4YM6 D;  3A6N D;  1JFI B;  3WTP B;  5CHL B;  3A6N B;  5AV5 C;  3O62 B;  3C1B C;  5G49 B;  3MGR D;  3B6G D;  5B2J B;  1M1A A;  1P3P D;  3AZK C;  3AZL D;  3MGR B;  4ZUX D;  4J8W D;  5AVB C;  4LD9 C;  3B0C W;  3AZL B;  4H9Q B;  3AZH D;  4J8W B;  5FUG B;  5CP6 A; 
#chains in the Genus database with same CATH topology
 2FFF B;  1B67 A;  4KUD D;  4XZQ D;  3UT9 A;  1P3F C;  1M18 C;  5AV9 D;  2ZY5 A;  3B6F B;  4J8U A;  5GT0 D;  3AZF A;  2YFV A;  2HIO A;  3F6T A;  5B1M D;  5CPK D;  5C3I B;  5AV8 D;  5B40 D;  2CWE A;  5BNV A;  1KX5 C;  2J8P A;  3KXB D;  3NQJ A;  3AN2 D;  5CPK B;  3V9R B;  5B2I C;  5B40 B;  1EQZ A;  2F8N A;  3WTP A;  3W96 A;  1P3A C;  1P3L C;  3W97 B;  4X23 C;  3KXB B;  3AV2 A;  4YM6 A;  3A6N A;  4H9P A;  2FJ7 D;  4XUJ A;  3X1U C;  3AZJ A;  3TU4 C;  3AZK B;  4LD9 B;  5B1L C;  5AVB B;  5BO0 B;  1S32 C;  3MVD D;  2FJ7 B;  3MNN D;  4JJN C;  3AZM A;  1M19 C;  3B6G A;  5CPI C;  1P3P A;  3AYW A;  3UTA C;  4ZUX A;  3LEL C;  1KU5 A;  4H9R B;  5GXQ D;  4WZS B;  5B24 B;  5JA4 A;  4HGA B;  5BNX A;  3AZH A;  5B33 D;  3REL C;  3REH D;  3KUY D;  1P3B B;  2JCH A;  5GT3 A;  4Z5T B;  3LZ0 D;  1N1J A;  4KUD A;  3REJ C;  4XZQ A;  5B33 B;  5AV9 A;  3WA9 C;  3W98 D;  5GT0 A;  5B1M A;  5BS7 C;  5CPK A;  5AV8 A;  5F99 C;  1P34 C;  1ID3 C;  1ULY A;  1P3K C;  3AZG D;  1P3L B;  2PYO C;  3AN2 A;  2F8N H;  5AY8 C;  3W99 D;  4WNN A;  3IP4 C;  2IO5 C;  5JRG D;  3AZE D;  3EPH A;  3B0D C;  5B1L B;  1S32 B;  3AZN D;  5JRG B;  5B32 A;  1M19 B;  5CPI B;  1H3O A;  2BYM B;  3AZN B;  1P3M C;  3AZI D;  1BH8 A;  3MVD A;  3MNN A;  2CV5 B;  3UTB D;  4CSR B;  4G92 C;  1M1A C;  4YS3 C;  5GXQ A;  3REL B;  4QLC D;  3MGP C;  2G5H C;  4WU8 D;  3NQU A;  3REJ B;  5DNM D;  4DRA A;  3REH A;  1P3I C;  3X1S D;  5CP6 C;  3AFA D;  3KUY A;  5AVC D;  3VH5 T;  3LZ0 A;  5DNM B;  3WAA D;  2YFW B;  3REI D;  3UT9 C;  3W98 A;  5F99 B;  4KHA A;  5E5A B;  3WAA B;  2W8S A;  3VH6 T;  5AV6 A;  5B31 A;  2HIO C;  1TZY B;  1ZLA C;  4EO5 C;  5CPJ A;  1KX3 D;  3AZG A;  3R45 B;  4CAY B;  2ZY2 A;  3EPJ A;  1B6W A;  3W99 A;  5GSU B;  3KWQ A;  1HQ3 C;  3W96 C;  4E44 A;  3C1C A;  3MGS D;  3AZE A;  3AV2 C;  3A1K A;  4YM6 C;  4NE6 A;  2ZM5 A;  2F8N G;  1P3M B;  3X1V C;  3MGS B;  1U35 D;  1BH9 A;  2BYK A;  4XUJ C;  4J8V D;  3AZJ C;  5B0Y A;  3H0R C;  3X1T B;  4AWL B;  3AV1 D;  4YS3 B;  3AZI A;  3MGP B;  3UTB A;  4DRB A;  3B6G C;  3AZM C;  4R8P B;  4WJ3 C;  1P3G B;  3O62 D;  3MGQ C;  3AYW C;  3AV1 B;  1P3P C;  2F8N K;  1WWI A;  4UUZ A;  4NE3 A;  4QLC A;  4ZUX C;  1P3I B;  1F66 C;  3WKJ D;  4Z2M G;  4WU8 A;  5B2J D;  3LZ1 D;  3AZH C;  3X1S A;  3WKJ B;  3AFA A;  2ARO C;  5AVC A;  3LZ1 B;  1P3O D;  5GT3 C;  4KUD C;  4XZQ C;  3REI A;  1P3O B;  1ZLA B;  5AV9 C;  4ZBJ C;  5GT0 C;  4WU9 D;  1KX4 A;  1HQ3 B;  1KX3 A;  3B6F D;  2DQN C;  4WU9 B;  4G91 C;  4J8X C;  4H9N A;  3AN2 C;  4Z66 B;  2Y2N A;  1A7W A;  4NFT A;  5B0Z A;  3W97 D;  2Y2H A;  1U35 A;  4J8V A;  5B32 C;  1JFI A;  4KGC C;  3MGQ B;  3AV1 A;  2Y2K A;  3MVD C;  5B32 G;  5AV5 B;  3C1B B;  3O62 A;  3AZK D;  5G49 A;  4LD9 D;  5AVB D;  3WKJ A;  4H9S A;  2ARO B;  5B2J A;  3VH6 W;  3MGR A;  2LY8 A;  5B24 D;  1AOI C;  3AZL A;  4H9Q A;  3LZ0 C;  4J8W A;  2XD1 A;  5FUG A;  4ZBJ B;  2NZD C;  2G5I C;  1P3B D;  4Z5T D;  2JSS A;  4WU9 A;  1P3F B;  1M18 B;  1WWS A;  2RIQ A;  5AV6 C;  5B31 C;  4J8X B;  2HUE C;  3B6F A;  5CPJ C;  1R4V A;  5B31 G;  2BG1 A;  3W99 C;  2NQB C;  2Y2M A;  3KWQ C;  1KX5 B;  1P3L D;  3REK C;  3LJA C;  5DNN C;  5B2I B;  3V9R A;  3C1C C;  5BT1 C;  5B40 A;  3AZE C;  4KGC B;  1P3A B;  2ZY3 A;  1TAF B;  3W97 A;  4X23 B;  3KXB A;  3B0B A;  4E45 A;  5B0Y C;  5B1L D;  1S32 D;  2RVQ C;  3X1U B;  4JJN D;  1M19 D;  3TU4 B;  5KDM B;  5CPI D;  4H9O B;  3UTA D;  3EPL A;  3AZK A;  4LD9 A;  5AVB A;  5BO0 A;  2FJ7 A;  4JJN B;  2Y2L A;  4QLC C;  2CV5 D;  1AOI B;  3UTA B;  4WU8 C;  3LEL B;  4H9R A;  2NZD B;  3REL D;  5B24 A;  3AFA C;  3REJ D;  3REI C;  1P3B A;  3WA9 D;  4UPK A;  4Z5T A;  3KFU G;  5B33 A;  3WA9 B;  1KX4 C;  2NQB B;  5F99 D;  1P34 D;  1P3K D;  1PZR A;  5E5A D;  1KX3 C;  3LJA B;  5AY8 D;  1P34 B;  1ID3 B;  1TZY D;  1P3K B;  2PYO B;  1P3L A;  4J8U C;  5AY8 B;  3AZF C;  5GSU D;  2IO5 B;  5B0Z C;  1U35 C;  5KDM A;  4J8V C;  1EQZ C;  3B0D B;  5B1L A;  3WTP C;  1S32 A;  1P3M D;  5JRG A;  1M19 A;  5CPI A;  3A6N C;  1HTA A;  2BYM A;  3X1T D;  3O62 C;  4YS3 D;  3AZN A;  2CV5 A;  3MGP D;  2Y2P A;  4H9S C;  3H0L C;  4R8P D;  2JE5 A;  4CSR A;  4G92 B;  1P3G D;  1M1A B;  1Q9C A;  3REL A;  3MGR C;  1P3I D;  5CP6 D;  3REJ A;  3AZL C;  4J8W C;  5CP6 B;  3UT9 D;  2XD5 A;  5DNM A;  2YFW A;  3UT9 B;  2HIO D;  5F99 A;  1ZLA D;  5E5A A;  3B6F C;  3WAA A;  4J8U B;  2YFV B;  5AY8 A;  2HIO B;  1HQ3 D;  1TZY A;  4EO5 B;  5BNV B;  3R45 A;  3W96 D;  4CAY A;  3NQJ B;  5B1M C;  5GSU A;  3AV2 D;  5CPK C;  5AV8 C;  1EQZ B;  2F8N B;  5B40 C;  4Z66 D;  3W96 B;  3X1V D;  3W97 C;  2DF4 C;  3KXB C;  3AV2 B;  2ZY4 A;  4XUJ D;  4YM6 B;  3AZJ D;  4H9P B;  3X1V B;  1P3M A;  3EG5 B;  3MGS A;  2UWX A;  3P5J B;  3A1I A;  4XUJ B;  3AZM D;  3AZJ B;  3X1T A;  3MGQ D;  3AYW D;  4YS3 A;  3MGP A;  3B6G B;  1F66 D;  3AZM B;  2FJ7 C;  5AV5 D;  4R8P A;  1P3G A;  3C1B D;  3AYW B;  1P3P B;  4ZUX B;  1P3I A;  1F66 B;  3VH5 W;  3MNN C;  2ARO D;  5B24 C;  5JA4 B;  4HGA C;  5BNX B;  5GT3 D;  3AZH B;  5GXQ C;  3LZ1 A;  1P3B C;  5GT3 B;  1N1J B;  1W2E A;  4Z5T C;  4KUD B;  4XZQ B;  5B33 C;  3REH C;  3KUY C;  4DQY B;  1P3O A;  5AV9 B;  1ZLA A;  5GT0 B;  1P3F D;  1M18 D;  5B1M B;  4J8X D;  1HQ3 A;  3W98 C;  5AV8 B;  3WTP E;  4G91 B;  3AN2 B;  2Y2I A;  4Z66 A;  4WNN B;  3AZG C;  3X1V A;  1KX5 D;  5B2I D;  5B32 D;  4KGC D;  1P3A D;  4X23 D;  5JRG C;  5B32 B;  1H3O B;  3MGQ A;  3AZN C;  1BH8 B;  3MVD B;  3X1U D;  3MNN B;  1F66 A;  5AV5 A;  2CV5 C;  3TU4 D;  3C1B A;  3AZI C;  2F2A C;  5GXQ B;  2ARO A;  3UTB C;  1AOI D;  3NQU B;  3LEL D;  2NZD D;  3REH B;  3KUY B;  3LZ0 B;  5DNM C;  1Z2C B;  5AV6 D;  3X1S C;  3KSY A;  5B31 D;  3W98 B;  5AVC C;  4KHA B;  2Y2Q A;  5CPJ D;  5E5A C;  1P3F A;  3WAA C;  5AV6 B;  1M18 A;  5B31 B;  4J8X A;  2HUE B;  2NQB D;  3KWQ D;  1TZY C;  5CPJ B;  3B0C T;  3AZG B;  3REK D;  3LJA D;  5DNN D;  3C1C D;  3W99 B;  5BT1 D;  5GSU C;  3KWQ B;  1ID3 D;  2PYO D;  1KX5 A;  3REK B;  5DNN B;  3C1C B;  5B2I A;  3AZE B;  4KGC A;  1P3A A;  5B0Y D;  1TAF A;  1F1E A;  4NE5 A;  4X23 A;  2RVQ D;  4Z2M H;  3MGS C;  1BH9 B;  2BYK B;  5B0Y B;  3X1T C;  4AWL C;  3AZI B;  3X1U A;  3UTB B;  2L5A A;  3TU4 A;  4H9O A;  4R8P C;  1P3G C;  3AV1 C;  4JJN A;  4UUZ B;  2Y2O A;  4QLC B;  4WV4 B;  3UTA A;  1AOI A;  4WU8 B;  1M1A D;  3LEL A;  2VQR A;  2NZD A;  3X1S B;  3AFA B;  3WKJ C;  5AVC B;  5B2J C;  3LZ1 C;  3EPK A;  3AL0 C;  3REI B;  1KX4 D;  3VH5 A;  1P3O C;  4M6B A;  1BFM A;  3WA9 A;  1KX4 B;  2NQB A;  1KX3 B;  3VH6 A;  3REK A;  4J8U D;  3LJA A;  4WU9 C;  5BS7 A;  5DNN A;  3AZF D;  4H9N B;  1P34 A;  1ID3 A;  1P3K A;  2PYO A;  4Z66 C;  3AZF B;  5B0Z D;  5C3I C;  1EQZ D;  2F8N D;  3H0M C;  3WTP D;  5B0Z B;  1U35 B;  4J8V B;  4YM6 D;  3A6N D;  1JFI B;  3WTP B;  2Y2G A;  5CHL B;  3A6N B;  5AV5 C;  3O62 B;  2Y2J A;  3C1B C;  5G49 B;  3MGR D;  3B6G D;  5B2J B;  1M1A A;  1P3P D;  3AZK C;  1T3U A;  3AZL D;  3MGR B;  4ZUX D;  4J8W D;  5AVB C;  4LD9 C;  3FDD A;  3B0C W;  3AZL B;  4H9Q B;  3AZH D;  4J8W B;  5FUG B;  5CP6 A; 
#chains in the Genus database with same CATH homology
 2FFF B;  1B67 A;  4KUD D;  4XZQ D;  3UT9 A;  1P3F C;  1M18 C;  5AV9 D;  2ZY5 A;  3B6F B;  4J8U A;  5GT0 D;  3AZF A;  2YFV A;  2HIO A;  3F6T A;  5B1M D;  5CPK D;  5C3I B;  5AV8 D;  5B40 D;  2CWE A;  5BNV A;  1KX5 C;  2J8P A;  3KXB D;  3NQJ A;  3AN2 D;  5CPK B;  3V9R B;  5B2I C;  5B40 B;  1EQZ A;  2F8N A;  3WTP A;  3W96 A;  1P3A C;  1P3L C;  3W97 B;  4X23 C;  3KXB B;  3AV2 A;  4YM6 A;  3A6N A;  4H9P A;  2FJ7 D;  4XUJ A;  3X1U C;  3AZJ A;  3TU4 C;  3AZK B;  4LD9 B;  5B1L C;  5AVB B;  5BO0 B;  1S32 C;  3MVD D;  2FJ7 B;  3MNN D;  4JJN C;  3AZM A;  1M19 C;  3B6G A;  5CPI C;  1P3P A;  3AYW A;  3UTA C;  4ZUX A;  3LEL C;  1KU5 A;  4H9R B;  5GXQ D;  4WZS B;  5B24 B;  5JA4 A;  4HGA B;  5BNX A;  3AZH A;  5B33 D;  3REL C;  3REH D;  3KUY D;  1P3B B;  2JCH A;  5GT3 A;  4Z5T B;  3LZ0 D;  1N1J A;  4KUD A;  3REJ C;  4XZQ A;  5B33 B;  5AV9 A;  3WA9 C;  3W98 D;  5GT0 A;  5B1M A;  5BS7 C;  5CPK A;  5AV8 A;  5F99 C;  1P34 C;  1ID3 C;  1ULY A;  1P3K C;  3AZG D;  1P3L B;  2PYO C;  3AN2 A;  2F8N H;  5AY8 C;  3W99 D;  4WNN A;  3IP4 C;  2IO5 C;  5JRG D;  3AZE D;  3EPH A;  3B0D C;  5B1L B;  1S32 B;  3AZN D;  5JRG B;  5B32 A;  1M19 B;  5CPI B;  1H3O A;  2BYM B;  3AZN B;  1P3M C;  3AZI D;  1BH8 A;  3MVD A;  3MNN A;  2CV5 B;  3UTB D;  4CSR B;  4G92 C;  1M1A C;  4YS3 C;  5GXQ A;  3REL B;  4QLC D;  3MGP C;  2G5H C;  4WU8 D;  3NQU A;  3REJ B;  5DNM D;  4DRA A;  3REH A;  1P3I C;  3X1S D;  5CP6 C;  3AFA D;  3KUY A;  5AVC D;  3VH5 T;  3LZ0 A;  5DNM B;  3WAA D;  2YFW B;  3REI D;  3UT9 C;  3W98 A;  5F99 B;  4KHA A;  5E5A B;  3WAA B;  2W8S A;  3VH6 T;  5AV6 A;  5B31 A;  2HIO C;  1TZY B;  1ZLA C;  4EO5 C;  5CPJ A;  1KX3 D;  3AZG A;  3R45 B;  4CAY B;  2ZY2 A;  3EPJ A;  1B6W A;  3W99 A;  5GSU B;  3KWQ A;  1HQ3 C;  3W96 C;  4E44 A;  3C1C A;  3MGS D;  3AZE A;  3AV2 C;  3A1K A;  4YM6 C;  4NE6 A;  2ZM5 A;  2F8N G;  1P3M B;  3X1V C;  3MGS B;  1U35 D;  1BH9 A;  2BYK A;  4XUJ C;  4J8V D;  3AZJ C;  5B0Y A;  3H0R C;  3X1T B;  4AWL B;  3AV1 D;  4YS3 B;  3AZI A;  3MGP B;  3UTB A;  4DRB A;  3B6G C;  3AZM C;  4R8P B;  4WJ3 C;  1P3G B;  3O62 D;  3MGQ C;  3AYW C;  3AV1 B;  1P3P C;  2F8N K;  1WWI A;  4UUZ A;  4NE3 A;  4QLC A;  4ZUX C;  1P3I B;  1F66 C;  3WKJ D;  4Z2M G;  4WU8 A;  5B2J D;  3LZ1 D;  3AZH C;  3X1S A;  3WKJ B;  3AFA A;  2ARO C;  5AVC A;  3LZ1 B;  1P3O D;  5GT3 C;  4KUD C;  4XZQ C;  3REI A;  1P3O B;  1ZLA B;  5AV9 C;  4ZBJ C;  5GT0 C;  4WU9 D;  1KX4 A;  1HQ3 B;  1KX3 A;  3B6F D;  2DQN C;  4WU9 B;  4G91 C;  4J8X C;  4H9N A;  3AN2 C;  4Z66 B;  2Y2N A;  1A7W A;  4NFT A;  5B0Z A;  3W97 D;  2Y2H A;  1U35 A;  4J8V A;  5B32 C;  1JFI A;  4KGC C;  3MGQ B;  3AV1 A;  2Y2K A;  3MVD C;  5B32 G;  5AV5 B;  3C1B B;  3O62 A;  3AZK D;  5G49 A;  4LD9 D;  5AVB D;  3WKJ A;  4H9S A;  2ARO B;  5B2J A;  3VH6 W;  3MGR A;  2LY8 A;  5B24 D;  1AOI C;  3AZL A;  4H9Q A;  3LZ0 C;  4J8W A;  2XD1 A;  5FUG A;  4ZBJ B;  2NZD C;  2G5I C;  1P3B D;  4Z5T D;  2JSS A;  4WU9 A;  1P3F B;  1M18 B;  1WWS A;  2RIQ A;  5AV6 C;  5B31 C;  4J8X B;  2HUE C;  3B6F A;  5CPJ C;  1R4V A;  5B31 G;  2BG1 A;  3W99 C;  2NQB C;  2Y2M A;  3KWQ C;  1KX5 B;  1P3L D;  3REK C;  3LJA C;  5DNN C;  5B2I B;  3V9R A;  3C1C C;  5BT1 C;  5B40 A;  3AZE C;  4KGC B;  1P3A B;  2ZY3 A;  1TAF B;  3W97 A;  4X23 B;  3KXB A;  3B0B A;  4E45 A;  5B0Y C;  5B1L D;  1S32 D;  2RVQ C;  3X1U B;  4JJN D;  1M19 D;  3TU4 B;  5KDM B;  5CPI D;  4H9O B;  3UTA D;  3EPL A;  3AZK A;  4LD9 A;  5AVB A;  5BO0 A;  2FJ7 A;  4JJN B;  2Y2L A;  4QLC C;  2CV5 D;  1AOI B;  3UTA B;  4WU8 C;  3LEL B;  4H9R A;  2NZD B;  3REL D;  5B24 A;  3AFA C;  3REJ D;  3REI C;  1P3B A;  3WA9 D;  4UPK A;  4Z5T A;  3KFU G;  5B33 A;  3WA9 B;  1KX4 C;  2NQB B;  5F99 D;  1P34 D;  1P3K D;  1PZR A;  5E5A D;  1KX3 C;  3LJA B;  5AY8 D;  1P34 B;  1ID3 B;  1TZY D;  1P3K B;  2PYO B;  1P3L A;  4J8U C;  5AY8 B;  3AZF C;  5GSU D;  2IO5 B;  5B0Z C;  1U35 C;  5KDM A;  4J8V C;  1EQZ C;  3B0D B;  5B1L A;  3WTP C;  1S32 A;  1P3M D;  5JRG A;  1M19 A;  5CPI A;  3A6N C;  1HTA A;  2BYM A;  3X1T D;  3O62 C;  4YS3 D;  3AZN A;  2CV5 A;  3MGP D;  2Y2P A;  4H9S C;  3H0L C;  4R8P D;  2JE5 A;  4CSR A;  4G92 B;  1P3G D;  1M1A B;  1Q9C A;  3REL A;  3MGR C;  1P3I D;  5CP6 D;  3REJ A;  3AZL C;  4J8W C;  5CP6 B;  3UT9 D;  2XD5 A;  5DNM A;  2YFW A;  3UT9 B;  2HIO D;  5F99 A;  1ZLA D;  5E5A A;  3B6F C;  3WAA A;  4J8U B;  2YFV B;  5AY8 A;  2HIO B;  1HQ3 D;  1TZY A;  4EO5 B;  5BNV B;  3R45 A;  3W96 D;  4CAY A;  3NQJ B;  5B1M C;  5GSU A;  3AV2 D;  5CPK C;  5AV8 C;  1EQZ B;  2F8N B;  5B40 C;  4Z66 D;  3W96 B;  3X1V D;  3W97 C;  2DF4 C;  3KXB C;  3AV2 B;  2ZY4 A;  4XUJ D;  4YM6 B;  3AZJ D;  4H9P B;  3X1V B;  1P3M A;  3EG5 B;  3MGS A;  2UWX A;  3P5J B;  3A1I A;  4XUJ B;  3AZM D;  3AZJ B;  3X1T A;  3MGQ D;  3AYW D;  4YS3 A;  3MGP A;  3B6G B;  1F66 D;  3AZM B;  2FJ7 C;  5AV5 D;  4R8P A;  1P3G A;  3C1B D;  3AYW B;  1P3P B;  4ZUX B;  1P3I A;  1F66 B;  3VH5 W;  3MNN C;  2ARO D;  5B24 C;  5JA4 B;  4HGA C;  5BNX B;  5GT3 D;  3AZH B;  5GXQ C;  3LZ1 A;  1P3B C;  5GT3 B;  1N1J B;  1W2E A;  4Z5T C;  4KUD B;  4XZQ B;  5B33 C;  3REH C;  3KUY C;  4DQY B;  1P3O A;  5AV9 B;  1ZLA A;  5GT0 B;  1P3F D;  1M18 D;  5B1M B;  4J8X D;  1HQ3 A;  3W98 C;  5AV8 B;  3WTP E;  4G91 B;  3AN2 B;  2Y2I A;  4Z66 A;  4WNN B;  3AZG C;  3X1V A;  1KX5 D;  5B2I D;  5B32 D;  4KGC D;  1P3A D;  4X23 D;  5JRG C;  5B32 B;  1H3O B;  3MGQ A;  3AZN C;  1BH8 B;  3MVD B;  3X1U D;  3MNN B;  1F66 A;  5AV5 A;  2CV5 C;  3TU4 D;  3C1B A;  3AZI C;  2F2A C;  5GXQ B;  2ARO A;  3UTB C;  1AOI D;  3NQU B;  3LEL D;  2NZD D;  3REH B;  3KUY B;  3LZ0 B;  5DNM C;  1Z2C B;  5AV6 D;  3X1S C;  3KSY A;  5B31 D;  3W98 B;  5AVC C;  4KHA B;  2Y2Q A;  5CPJ D;  5E5A C;  1P3F A;  3WAA C;  5AV6 B;  1M18 A;  5B31 B;  4J8X A;  2HUE B;  2NQB D;  3KWQ D;  1TZY C;  5CPJ B;  3B0C T;  3AZG B;  3REK D;  3LJA D;  5DNN D;  3C1C D;  3W99 B;  5BT1 D;  5GSU C;  3KWQ B;  1ID3 D;  2PYO D;  1KX5 A;  3REK B;  5DNN B;  3C1C B;  5B2I A;  3AZE B;  4KGC A;  1P3A A;  5B0Y D;  1TAF A;  1F1E A;  4NE5 A;  4X23 A;  2RVQ D;  4Z2M H;  3MGS C;  1BH9 B;  2BYK B;  5B0Y B;  3X1T C;  4AWL C;  3AZI B;  3X1U A;  3UTB B;  2L5A A;  3TU4 A;  4H9O A;  4R8P C;  1P3G C;  3AV1 C;  4JJN A;  4UUZ B;  2Y2O A;  4QLC B;  4WV4 B;  3UTA A;  1AOI A;  4WU8 B;  1M1A D;  3LEL A;  2VQR A;  2NZD A;  3X1S B;  3AFA B;  3WKJ C;  5AVC B;  5B2J C;  3LZ1 C;  3EPK A;  3AL0 C;  3REI B;  1KX4 D;  3VH5 A;  1P3O C;  4M6B A;  1BFM A;  3WA9 A;  1KX4 B;  2NQB A;  1KX3 B;  3VH6 A;  3REK A;  4J8U D;  3LJA A;  4WU9 C;  5BS7 A;  5DNN A;  3AZF D;  4H9N B;  1P34 A;  1ID3 A;  1P3K A;  2PYO A;  4Z66 C;  3AZF B;  5B0Z D;  5C3I C;  1EQZ D;  2F8N D;  3H0M C;  3WTP D;  5B0Z B;  1U35 B;  4J8V B;  4YM6 D;  3A6N D;  1JFI B;  3WTP B;  2Y2G A;  5CHL B;  3A6N B;  5AV5 C;  3O62 B;  2Y2J A;  3C1B C;  5G49 B;  3MGR D;  3B6G D;  5B2J B;  1M1A A;  1P3P D;  3AZK C;  1T3U A;  3AZL D;  3MGR B;  4ZUX D;  4J8W D;  5AVB C;  4LD9 C;  3FDD A;  3B0C W;  3AZL B;  4H9Q B;  3AZH D;  4J8W B;  5FUG B;  5CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...