3X1VA

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vA00
3AZLC 1S32C 4J8UB 4XZQC 3AZLB 3AZND 1S32B 1AOID 5BT1D 4Z2MG 3X1TC 4ZUXD 5E5AA 1H3OA 5CPIA 2BYMB 3LJAB 3MGQB 3REHD 3AZKA 2BYKA 5B32D 5B31C 3NQJA 5JRGD 3AN2D 3KXBD 2PYOA 2IO5C 5B0YA 3AYWC 3VH6W 3AYWB 1P3FD 3KWQD 3UTAA 4J8WA 3WTPE 3B0BA 2FJ7C 4LD9B 2HIOD 3LZ0B 5G49A 4R8PC 1JFIA 4QLCB 1EQZC 3VH6A 3O62B 1P34C 5AV6C 3MGSC 1P3GB 3AZED 3MGPD 3REIC 3UT9A 1BFMA 3REIB 3X1UD 3AZMC 1P3LB 1P3KD 5B32G 5GXQA 5BO0B 3MGRB 3X1VD 3LZ1B 3REKC 3WTPA 3X1SC 3REKB 4UUZA 1WWSA 5B1LC 3C1CA 1U35C 5AV8A 5B1LB 3C1BC 4M6BA 1KX3A 1M19D 1P3IB 1U35B 3C1BB 4YS3A 3MNNB 1M18B 2CV5B 5AY8B 3UTBA 3AV1A 3WA9C 5CHLB 1M1AB 4WU9D 5GT3A 4J8VC 2CWEA 5B2JD 3V9RA 4KUDC 3AZGC 1P3BA 2YFWA 3W98D 3AZGB 1F66B 2F8NA 4ZBJC 5B24B 4WNNB 3LELA 3AZJB 3TU4B 1KX4D 3AZID 1N1JA 4JJNC 3WKJB 4J8XC 3AV2D 5AVCC 4JJNB 4J8XB 5AVCB 3W99C 2NQBB 3W97D 4Z5TD 4NFTA 3W99B 5AVBA 5B2ID 3AZNB 1TZYC 4DRBA 3REJA 4J8UA 5DNMC 1P3MD 3AZHD 3AZLA 5CPJD 1S32A 3REHB 4XZQA 3AFAD 5B32B 1P3AD 4WU8D 5BNVB 5JRGB 3A6NC 3X1TA 3KXBB 5B1MD 1TAFB 1P3FB 5CP6C 1A7WA 4H9SC 5CP6B 5B33D 3AYWA 5CPKC 4YM6D 5BS7C 1P3OD 2FJ7A 3LZ0A 3AZEB 3MGPB 1ID3D 3MVDD 4R8PA 1EQZA 5B0ZC 3RELC 3X1UB 1P34A 5AV6A 3MGSA 1P3PD 3X1VC 5GT0D 3REIA 3X1VB 4KGCC 1P3BC 4KGCB 3AZMA 4Z66D 4H9QB 3B6FC 2F8NK 3B6FB 4KHAA 5B40D 1M19B 3B6GD 3REKA 3X1SA 5B1LA 4XUJD 1U35A 2AROC 3C1BA 3AZFD 3W96D 5GSUD 4J8UC 5AV9C 5AV9B 3KUYC 2NZDD 3WA9A 3W98B 4J8VA 5F99D 3AZGA 4KUDA 4H9OB 3LJAC 5B24A 3MGQC 3AZIB 4Z5TC 1BH8B 3W97B 4Z5TB 5E5AD 5CPID 5B2IB 4JJNA 3AZKD 4J8XA 5AVCA 4NE3A 3W99A 4CAYB 3AZHB 5CPJB 2PYOD 4LD9C 5B0YD 4WU8C 2RVQC 1TZYA 1P3AB 4HGAB 4WU8B 3LZ0C 5KDMB 4QLCC 5DNMA 4J8WD 3UTAD 3O62C 1BH9B 5B1MB 3VH6T 1P3GC 5BNVA 3A6NA 2F8NH 5AV5C 4CSRB 5B33B 5BNXA 1P3LC 5AV5B 5CP6A 3MGRC 4H9SA 3UT9D 3LZ1C 4YM6B 1P3OB 1ID3B 2HUEC 5GXQD 4DRAA 5CPKA 2HUEB 1P3IC 5BS7A 3MNNC 1M18C 2CV5C 1WWIA 5AY8C 5GT0B 3C1CD 5DNNC 5AV8D 4H9NA 1KX3D 1M1AC 1KX5C 5DNNB 5B0ZA 3RELA 3NQUA 1HQ3C 4YS3D 1KX5B 1HQ3B 3X1VA 3R45A 5B40B 3UTBD 4KGCA 1F66C 3B6GB 5B24C 5GT3D 3B6FA 3AZJC 3TU4C 3AZFB 3WKJC 5GSUB 2F8ND 2NZDB 2NQBC 3LELD 2AROA 3AZNC 4H9RB 1AOIC 2YFVA 5BT1C 5AV9A 3B0CW 1AOIB 4ZUXC 3KUYA 5F99B 4ZUXB 3REHC 5AVBD 1F1EA 3WAAD 5B32C 5JRGC 3AN2C 2LY8A 3KXBC 3REJD 5E5AB 4J8UD 1R4VA 3AN2B 2BYMA 3LJAA 3MGQA 3AZLD 3AZKB 1S32D 4XZQD 3B0CT 1BH8A 1P3FC 4Z5TA 3KWQC 3NQJB 1ZLAD 3X1TD 3KWQB 2PYOB 2HIOC 4H9PB 5B31D 2HIOB 4J8WB 4LD9A 4WU8A 3AZEC 3MGPC 2L5AA 4QLCA 1B6WA 1JFIB 3O62A 3X1UC 2FJ7D 1P3GA 1P3KC 1P3KB 3B0DB 4CSRA 4R8PD 1EQZD 5AV5A 1P3LA 1P34D 5AV6D 3MGSD 5GXQB 5BO0A 3MGRA 1M19C 3REID 3LZ1A 3AZMD 4UUZB 5B31G 1Q9CA 5AV8B 1KX3B 1P3IA 4WU9C 3MNNA 4EO5C 3REKD 4WU9B 4YS3B 1M18A 5B2JC 3X1SD 2CV5A 4EO5B 5AY8A 5B2JB 3UTBB 1U35D 5DNNA 4X23D 3C1BD 3W98C 5JA4B 1M1AA 1KX5A 1HQ3A 3V9RB 1KX4C 3B6GA 3AZIC 2YFWB 3WA9D 3AV2C 1KX4B 1F66A 4J8VD 3AV2B 4WNNA 3LELB 3AZJA 3W97C 3TU4A 3AZGD 4KUDD 5B2IC 3WKJA 3VH5W 2NQBA 1P3MC 3AZHC 5CPJC 3WAAC 4H9RA 5FUGB 1P3MB 3AFAC 5AVBB 4JJND 4AWLB 3AZNA 4J8XD 1AOIA 3WAAB 1P3AC 4HGAC 3AFAB 5AVCD 4ZUXA 3REJB 3W99D 4WZSB 3REHA 4XZQB 5B1MC 5B32A 1TZYD 3VH5T 3VH5A 2JSSA 4E44A 1ZLAC 5JRGA 3AN2A 1ZLAB 3KXBA 3X1TB 5DNMD 5B33C 1TAFA 4NE5A 1P3FA 5B31B 3KWQA 1KU5A 3A6ND 4YM6C 1P3OC 2IO5B 4H9PA 2HIOA 1ID3C 3MVDC 5CP6D 3MVDB 2FJ7B 1P3PC 3AZEA 3WTPD 3MGPA 1P3PB 5GT0C 5CPKD 4R8PB 1EQZB 3X1UA 4Z66C 1P34B 5AV6B 3MGSB 1P3KA 4Z66B 5B40C 3AV1D 3B6GC 5B0ZD 3RELD 4H9QA 3AZMB 4XUJC 4KHAB 4XUJB 3W96C 3AZFC 1M19A 5GSUC 4KGCD 3W96B 1P3BD 3X1SB 3B6FD 2NZDC 4X23C 4X23B 4WU9A 5B2JA 5F99C 5JA4A 2AROD 3W98A 3WA9B 5AV9D 4J8VB 5E5AC 3KUYD 5CPIC 1KX4A 4KUDB 4H9OA 3AZIA 1H3OB 3AZKC 5CPIB 3AV2A 4ZBJB 2BYKB 3W97A 2PYOC 4E45A 5B2IA 5B0YC 3LJAD 3MGQD 5B0YB 2F8NG 3UTAC 5FUGA 4J8WC 4CAYA 1P3MA 3AZHA 5CPJA 3WAAA 3UTAB 4Z2MH 3AFAA 1TZYB 1P3AA 3AYWD 5KDMA 5DNMB 5G49B 1BH9A 4LD9D 5B1MA 2RVQD 4G91C 1ZLAA 3B0DC 4G91B 3LZ0D 3A6NB 3UT9C 4QLCD 3O62D 5B33A 3UT9B 5BNXB 5B31A 1P3GD 5GXQC 4YM6A 1P3OA 5AV5D 3WTPC 1P3LD 1HTAA 3WTPB 1ID3A 1ULYA 3MVDA 5CPKB 3C1CC 3MGRD 5AV8C 1KX3C 3C1CB 4NE6A 3LZ1D 4YS3C 1P3PA 5GT0A 4WV4B 3UTBC 3AV1C 5B1LD 4H9NB 3AV1B 1P3ID 5B0ZB 4G92C 5GT3C 3NQUB 4Z66A 3MNND 3RELB 1M18D 4G92B 5GT3B 2CV5D 5AY8D 5B40A 3R45B 5DNND 1KX5D 1M1AD 1P3BB 1HQ3D 2F8NB 4XUJA 3LELC 3W96A 3AZFA 5GSUA 1F66D 1B67A 1N1JB 5B24D 5C3IC 2NZDA 4X23A 3AZJD 5C3IB 2AROB 3TU4D 5AVBC 3KSYA 4AWLC 3WKJD 2YFVB 3REJC 3KUYB 2NQBD 5F99A
chains in the Genus database with same CATH superfamily
3AZLC 1S32C 4J8UB 4XZQC 3AZLB 3AZND 1S32B 1AOID 5BT1D 4Z2MG 3X1TC 4ZUXD 5E5AA 1H3OA 5CPIA 2BYMB 3LJAB 3MGQB 3REHD 3AZKA 2BYKA 5B32D 5B31C 3NQJA 5JRGD 3AN2D 3KXBD 2PYOA 2IO5C 5B0YA 3AYWC 3VH6W 3AYWB 3EG5B 1P3FD 3KWQD 3UTAA 4J8WA 3WTPE 3B0BA 2FJ7C 4LD9B 2DF4C 2HIOD 3LZ0B 5G49A 4R8PC 1JFIA 4QLCB 1EQZC 3VH6A 3O62B 1P34C 5AV6C 3MGSC 1P3GB 2XD5A 3AZED 2ZY2A 3MGPD 3REIC 3UT9A 1BFMA 3REIB 3X1UD 3AZMC 1P3LB 1P3KD 5B32G 5GXQA 5BO0B 3MGRB 3X1VD 3LZ1B 3REKC 3WTPA 3X1SC 3REKB 4UUZA 1WWSA 5B1LC 3C1CA 1U35C 5AV8A 5B1LB 3C1BC 4M6BA 1KX3A 1M19D 1P3IB 1U35B 3C1BB 3H0LC 4YS3A 3MNNB 1M18B 2CV5B 5AY8B 3A1KA 3UTBA 3AV1A 3WA9C 5CHLB 1M1AB 4WU9D 5GT3A 4J8VC 2CWEA 5B2JD 3V9RA 4KUDC 3AZGC 1P3BA 2YFWA 3W98D 4DQYB 3AZGB 1F66B 2F8NA 4ZBJC 5B24B 4WNNB 2Y2QA 3LELA 3AZJB 3TU4B 1KX4D 3AZID 1N1JA 4JJNC 3WKJB 4J8XC 3AV2D 5AVCC 4JJNB 4J8XB 5AVCB 3W99C 2NQBB 3W97D 4Z5TD 4NFTA 3W99B 5AVBA 5B2ID 3AZNB 1TZYC 4DRBA 3REJA 4J8UA 5DNMC 1P3MD 3AZHD 3AZLA 5CPJD 1S32A 3REHB 4XZQA 3AFAD 3P5JB 5B32B 1P3AD 4WU8D 5BNVB 5JRGB 3A6NC 3X1TA 3KXBB 5B1MD 1TAFB 3A1IA 5CP6C 1P3FB 1A7WA 4H9SC 5CP6B 5B33D 2XD1A 3AYWA 3FDDA 2Y2JA 2JCHA 5CPKC 4YM6D 5BS7C 1P3OD 2FJ7A 3LZ0A 3AZEB 3MGPB 1ID3D 3MVDD 4R8PA 1EQZA 5B0ZC 3RELC 3X1UB 1P34A 3KFUG 5AV6A 3MGSA 1P3PD 3X1VC 5GT0D 3REIA 3X1VB 4KGCC 1P3BC 4KGCB 3AZMA 4Z66D 4H9QB 3B6FC 2F8NK 3B6FB 4KHAA 5B40D 1M19B 3B6GD 3REKA 3X1SA 5B1LA 4XUJD 1U35A 2ZM5A 2AROC 3C1BA 3AZFD 3W96D 5GSUD 4J8UC 5AV9C 5AV9B 3KUYC 2NZDD 3WA9A 3W98B 4J8VA 3EPHA 5F99D 3AZGA 4KUDA 4H9OB 3LJAC 5B24A 3MGQC 3AZIB 4Z5TC 1BH8B 3F6TA 3W97B 4Z5TB 5E5AD 5CPID 5B2IB 4JJNA 3AZKD 4J8XA 5AVCA 4NE3A 3W99A 4CAYB 3AZHB 5CPJB 2PYOD 4LD9C 5B0YD 4WU8C 2RVQC 1TZYA 1P3AB 4HGAB 4WU8B 3LZ0C 5KDMB 4QLCC 5DNMA 4J8WD 3UTAD 2Y2KA 3O62C 1BH9B 2Y2MA 5B1MB 3VH6T 1P3GC 5BNVA 2Y2PA 3A6NA 2F8NH 5AV5C 4CSRB 5B33B 5BNXA 1P3LC 5AV5B 5CP6A 3MGRC 4H9SA 3EPKA 3UT9D 3LZ1C 4YM6B 1P3OB 1ID3B 2HUEC 5GXQD 4DRAA 5CPKA 2HUEB 1P3IC 5BS7A 3MNNC 1M18C 2CV5C 1WWIA 5AY8C 5GT0B 3C1CD 5DNNC 5AV8D 4H9NA 1KX3D 1M1AC 1KX5C 5DNNB 5B0ZA 3RELA 3NQUA 1HQ3C 4YS3D 1KX5B 1HQ3B 3X1VA 3R45A 5B40B 3UTBD 4KGCA 1F66C 3B6GB 5B24C 5GT3D 3B6FA 3AL0C 3AZJC 3TU4C 3AZFB 3WKJC 5GSUB 2F8ND 3WAAB 4WJ3C 2NZDB 2NQBC 3LELD 2AROA 3AZNC 4H9RB 1AOIC 2YFVA 5BT1C 5AV9A 3B0CW 1AOIB 4ZUXC 3KUYA 5F99B 4ZUXB 3REHC 5AVBD 1F1EA 3WAAD 5B32C 5JRGC 3AN2C 2LY8A 3KXBC 3REJD 5E5AB 4J8UD 1R4VA 3AN2B 2BYMA 3LJAA 3MGQA 3AZLD 3AZKB 1S32D 4XZQD 3B0CT 1BH8A 1P3FC 4Z5TA 3KWQC 3NQJB 2ZY3A 3X1TD 1ZLAD 3KWQB 2PYOB 2HIOC 4H9PB 5B31D 2HIOB 4J8WB 4LD9A 4WU8A 3AZEC 3MGPC 2ZY5A 2L5AA 4QLCA 1B6WA 1JFIB 3O62A 3X1UC 2FJ7D 1P3GA 1P3KC 1P3KB 3B0DB 4CSRA 4R8PD 1EQZD 5AV5A 1P3LA 1P34D 5AV6D 3MGSD 5GXQB 3IP4C 5BO0A 3MGRA 1M19C 3REID 1T3UA 3LZ1A 3EPJA 3AZMD 4UUZB 5B31G 1Q9CA 5AV8B 1KX3B 1P3IA 4WU9C 3MNNA 4EO5C 3REKD 3H0MC 4WU9B 4YS3B 1M18A 5B2JC 3X1SD 2CV5A 2J8PA 1Z2CB 4EO5B 5AY8A 5B2JB 3UTBB 1U35D 5DNNA 2BG1A 4X23D 3C1BD 3W98C 5JA4B 1M1AA 1KX5A 4UPKA 1HQ3A 3V9RB 1KX4C 3B6GA 3AZIC 2YFWB 3WA9D 3AV2C 1KX4B 1F66A 4J8VD 3AV2B 4WNNA 3LELB 3AZJA 3W97C 3TU4A 3AZGD 4KUDD 5B2IC 3WKJA 3VH5W 2NQBA 1P3MC 3AZHC 5CPJC 3WAAC 4H9RA 5FUGB 1P3MB 3AFAC 5AVBB 4JJND 4AWLB 3AZNA 4J8XD 1AOIA 2RIQA 1P3AC 4HGAC 2W8SA 2F2AC 5AVCD 3AFAB 4ZUXA 3REJB 3W99D 4WZSB 3REHA 4XZQB 5B1MC 5B32A 1TZYD 3VH5T 3VH5A 2JSSA 4E44A 1ZLAC 5JRGA 3AN2A 1ZLAB 3KXBA 3X1TB 5DNMD 5B33C 2VQRA 1TAFA 4NE5A 1P3FA 5B31B 3KWQA 1KU5A 3A6ND 4YM6C 1P3OC 2IO5B 4H9PA 2HIOA 1ID3C 3MVDC 5CP6D 3MVDB 2FJ7B 1P3PC 3AZEA 3WTPD 3MGPA 1P3PB 5GT0C 5CPKD 4R8PB 2Y2NA 1EQZB 3X1UA 4Z66C 1P34B 5AV6B 3MGSB 1P3KA 4Z66B 5B40C 2Y2IA 3AV1D 3B6GC 1PZRA 5B0ZD 3RELD 4H9QA 3AZMB 4XUJC 4KHAB 4XUJB 3W96C 3AZFC 1M19A 3H0RC 5GSUC 4KGCD 3W96B 1P3BD 3X1SB 3B6FD 2NZDC 4X23C 4X23B 4WU9A 2Y2GA 5B2JA 2ZY4A 5F99C 5JA4A 2AROD 3W98A 3WA9B 5AV9D 4J8VB 5E5AC 3KUYD 5CPIC 1KX4A 4KUDB 4H9OA 3AZIA 2Y2HA 1H3OB 3AZKC 2Y2LA 3AV2A 5CPIB 4ZBJB 2BYKB 3W97A 2G5IC 2PYOC 4E45A 5B2IA 5B0YC 3LJAD 3MGQD 5B0YB 2F8NG 3UTAC 5FUGA 3EPLA 4CAYA 4J8WC 3AZHA 1P3MA 5CPJA 3WAAA 3UTAB 4Z2MH 3AFAA 1TZYB 1P3AA 3AYWD 5KDMA 5DNMB 5G49B 1BH9A 4LD9D 5B1MA 2RVQD 4G91C 1ZLAA 1W2EA 3B0DC 4G91B 3LZ0D 3A6NB 3UT9C 4QLCD 3O62D 5B33A 3UT9B 5BNXB 5B31A 1P3GD 5GXQC 2G5HC 4YM6A 2DQNC 1P3OA 5AV5D 3WTPC 1P3LD 1HTAA 3WTPB 1ID3A 1ULYA 3MVDA 5CPKB 3C1CC 3MGRD 5AV8C 1KX3C 3C1CB 4NE6A 3LZ1D 4YS3C 1P3PA 5GT0A 4WV4B 3UTBC 3AV1C 5B1LD 2JE5A 4H9NB 3AV1B 1P3ID 5B0ZB 4G92C 5GT3C 3NQUB 4Z66A 3MNND 2UWXA 3RELB 1M18D 4G92B 5GT3B 2CV5D 5AY8D 5B40A 3R45B 5DNND 2FFFB 1KX5D 1M1AD 2Y2OA 1P3BB 1HQ3D 2F8NB 4XUJA 3LELC 3W96A 3AZFA 5GSUA 1F66D 1B67A 1N1JB 5B24D 5C3IC 2NZDA 4X23A 3AZJD 5C3IB 2AROB 3TU4D 5AVBC 3KSYA 4AWLC 3WKJD 2YFVB 3REJC 3KUYB 2NQBD 5F99A
chains in the Genus database with same CATH topology
3AZLC 1S32C 4J8UB 4XZQC 3AZLB 3AZND 1S32B 1AOID 5BT1D 4Z2MG 3X1TC 4ZUXD 5E5AA 1H3OA 5CPIA 2BYMB 3LJAB 3MGQB 3REHD 3AZKA 2BYKA 5B32D 5B31C 3NQJA 5JRGD 3AN2D 3KXBD 2PYOA 2IO5C 5B0YA 3AYWC 3VH6W 3AYWB 3EG5B 1P3FD 3KWQD 3UTAA 4J8WA 3WTPE 3B0BA 2FJ7C 4LD9B 2DF4C 2HIOD 3LZ0B 5G49A 4R8PC 1JFIA 4QLCB 1EQZC 3VH6A 3O62B 1P34C 5AV6C 3MGSC 1P3GB 2XD5A 3AZED 2ZY2A 3MGPD 3REIC 3UT9A 1BFMA 3REIB 3X1UD 3AZMC 1P3LB 1P3KD 5B32G 5GXQA 5BO0B 3MGRB 3X1VD 3LZ1B 3REKC 3WTPA 3X1SC 3REKB 4UUZA 1WWSA 5B1LC 3C1CA 1U35C 5AV8A 5B1LB 3C1BC 4M6BA 1KX3A 1M19D 1P3IB 1U35B 3C1BB 3H0LC 4YS3A 3MNNB 1M18B 2CV5B 5AY8B 3A1KA 3UTBA 3AV1A 3WA9C 5CHLB 1M1AB 4WU9D 5GT3A 4J8VC 2CWEA 5B2JD 3V9RA 4KUDC 3AZGC 1P3BA 2YFWA 3W98D 4DQYB 3AZGB 1F66B 2F8NA 4ZBJC 5B24B 4WNNB 2Y2QA 3LELA 3AZJB 3TU4B 1KX4D 3AZID 1N1JA 4JJNC 3WKJB 4J8XC 3AV2D 5AVCC 4JJNB 4J8XB 5AVCB 3W99C 2NQBB 3W97D 4Z5TD 4NFTA 3W99B 5AVBA 5B2ID 3AZNB 1TZYC 4DRBA 3REJA 4J8UA 5DNMC 1P3MD 3AZHD 3AZLA 5CPJD 1S32A 3REHB 4XZQA 3AFAD 3P5JB 5B32B 1P3AD 4WU8D 5BNVB 5JRGB 3A6NC 3X1TA 3KXBB 5B1MD 1TAFB 3A1IA 5CP6C 1P3FB 1A7WA 4H9SC 5CP6B 5B33D 2XD1A 3AYWA 3FDDA 2Y2JA 2JCHA 5CPKC 4YM6D 5BS7C 1P3OD 2FJ7A 3LZ0A 3AZEB 3MGPB 1ID3D 3MVDD 4R8PA 1EQZA 5B0ZC 3RELC 3X1UB 1P34A 3KFUG 5AV6A 3MGSA 1P3PD 3X1VC 5GT0D 3REIA 3X1VB 4KGCC 1P3BC 4KGCB 3AZMA 4Z66D 4H9QB 3B6FC 2F8NK 3B6FB 4KHAA 5B40D 1M19B 3B6GD 3REKA 3X1SA 5B1LA 4XUJD 1U35A 2ZM5A 2AROC 3C1BA 3AZFD 3W96D 5GSUD 4J8UC 5AV9C 5AV9B 3KUYC 2NZDD 3WA9A 3W98B 4J8VA 3EPHA 5F99D 3AZGA 4KUDA 4H9OB 3LJAC 5B24A 3MGQC 3AZIB 4Z5TC 1BH8B 3F6TA 3W97B 4Z5TB 5E5AD 5CPID 5B2IB 4JJNA 3AZKD 4J8XA 5AVCA 4NE3A 3W99A 4CAYB 3AZHB 5CPJB 2PYOD 4LD9C 5B0YD 4WU8C 2RVQC 1TZYA 1P3AB 4HGAB 4WU8B 3LZ0C 5KDMB 4QLCC 5DNMA 4J8WD 3UTAD 2Y2KA 3O62C 1BH9B 2Y2MA 5B1MB 3VH6T 1P3GC 5BNVA 2Y2PA 3A6NA 2F8NH 5AV5C 4CSRB 5B33B 5BNXA 1P3LC 5AV5B 5CP6A 3MGRC 4H9SA 3EPKA 3UT9D 3LZ1C 4YM6B 1P3OB 1ID3B 2HUEC 5GXQD 4DRAA 5CPKA 2HUEB 1P3IC 5BS7A 3MNNC 1M18C 2CV5C 1WWIA 5AY8C 5GT0B 3C1CD 5DNNC 5AV8D 4H9NA 1KX3D 1M1AC 1KX5C 5DNNB 5B0ZA 3RELA 3NQUA 1HQ3C 4YS3D 1KX5B 1HQ3B 3X1VA 3R45A 5B40B 3UTBD 4KGCA 1F66C 3B6GB 5B24C 5GT3D 3B6FA 3AL0C 3AZJC 3TU4C 3AZFB 3WKJC 5GSUB 2F8ND 3WAAB 4WJ3C 2NZDB 2NQBC 3LELD 2AROA 3AZNC 4H9RB 1AOIC 2YFVA 5BT1C 5AV9A 3B0CW 1AOIB 4ZUXC 3KUYA 5F99B 4ZUXB 3REHC 5AVBD 1F1EA 3WAAD 5B32C 5JRGC 3AN2C 2LY8A 3KXBC 3REJD 5E5AB 4J8UD 1R4VA 3AN2B 2BYMA 3LJAA 3MGQA 3AZLD 3AZKB 1S32D 4XZQD 3B0CT 1BH8A 1P3FC 4Z5TA 3KWQC 3NQJB 2ZY3A 3X1TD 1ZLAD 3KWQB 2PYOB 2HIOC 4H9PB 5B31D 2HIOB 4J8WB 4LD9A 4WU8A 3AZEC 3MGPC 2ZY5A 2L5AA 4QLCA 1B6WA 1JFIB 3O62A 3X1UC 2FJ7D 1P3GA 1P3KC 1P3KB 3B0DB 4CSRA 4R8PD 1EQZD 5AV5A 1P3LA 1P34D 5AV6D 3MGSD 5GXQB 3IP4C 5BO0A 3MGRA 1M19C 3REID 1T3UA 3LZ1A 3EPJA 3AZMD 4UUZB 5B31G 1Q9CA 5AV8B 1KX3B 1P3IA 4WU9C 3MNNA 4EO5C 3REKD 3H0MC 4WU9B 4YS3B 1M18A 5B2JC 3X1SD 2CV5A 2J8PA 1Z2CB 4EO5B 5AY8A 5B2JB 3UTBB 1U35D 5DNNA 2BG1A 4X23D 3C1BD 3W98C 5JA4B 1M1AA 1KX5A 4UPKA 1HQ3A 3V9RB 1KX4C 3B6GA 3AZIC 2YFWB 3WA9D 3AV2C 1KX4B 1F66A 4J8VD 3AV2B 4WNNA 3LELB 3AZJA 3W97C 3TU4A 3AZGD 4KUDD 5B2IC 3WKJA 3VH5W 2NQBA 1P3MC 3AZHC 5CPJC 3WAAC 4H9RA 5FUGB 1P3MB 3AFAC 5AVBB 4JJND 4AWLB 3AZNA 4J8XD 1AOIA 2RIQA 1P3AC 4HGAC 2W8SA 2F2AC 5AVCD 3AFAB 4ZUXA 3REJB 3W99D 4WZSB 3REHA 4XZQB 5B1MC 5B32A 1TZYD 3VH5T 3VH5A 2JSSA 4E44A 1ZLAC 5JRGA 3AN2A 1ZLAB 3KXBA 3X1TB 5DNMD 5B33C 2VQRA 1TAFA 4NE5A 1P3FA 5B31B 3KWQA 1KU5A 3A6ND 4YM6C 1P3OC 2IO5B 4H9PA 2HIOA 1ID3C 3MVDC 5CP6D 3MVDB 2FJ7B 1P3PC 3AZEA 3WTPD 3MGPA 1P3PB 5GT0C 5CPKD 4R8PB 2Y2NA 1EQZB 3X1UA 4Z66C 1P34B 5AV6B 3MGSB 1P3KA 4Z66B 5B40C 2Y2IA 3AV1D 3B6GC 1PZRA 5B0ZD 3RELD 4H9QA 3AZMB 4XUJC 4KHAB 4XUJB 3W96C 3AZFC 1M19A 3H0RC 5GSUC 4KGCD 3W96B 1P3BD 3X1SB 3B6FD 2NZDC 4X23C 4X23B 4WU9A 2Y2GA 5B2JA 2ZY4A 5F99C 5JA4A 2AROD 3W98A 3WA9B 5AV9D 4J8VB 5E5AC 3KUYD 5CPIC 1KX4A 4KUDB 4H9OA 3AZIA 2Y2HA 1H3OB 3AZKC 2Y2LA 3AV2A 5CPIB 4ZBJB 2BYKB 3W97A 2G5IC 2PYOC 4E45A 5B2IA 5B0YC 3LJAD 3MGQD 5B0YB 2F8NG 3UTAC 5FUGA 3EPLA 4CAYA 4J8WC 3AZHA 1P3MA 5CPJA 3WAAA 3UTAB 4Z2MH 3AFAA 1TZYB 1P3AA 3AYWD 5KDMA 5DNMB 5G49B 1BH9A 4LD9D 5B1MA 2RVQD 4G91C 1ZLAA 1W2EA 3B0DC 4G91B 3LZ0D 3A6NB 3UT9C 4QLCD 3O62D 5B33A 3UT9B 5BNXB 5B31A 1P3GD 5GXQC 2G5HC 4YM6A 2DQNC 1P3OA 5AV5D 3WTPC 1P3LD 1HTAA 3WTPB 1ID3A 1ULYA 3MVDA 5CPKB 3C1CC 3MGRD 5AV8C 1KX3C 3C1CB 4NE6A 3LZ1D 4YS3C 1P3PA 5GT0A 4WV4B 3UTBC 3AV1C 5B1LD 2JE5A 4H9NB 3AV1B 1P3ID 5B0ZB 4G92C 5GT3C 3NQUB 4Z66A 3MNND 2UWXA 3RELB 1M18D 4G92B 5GT3B 2CV5D 5AY8D 5B40A 3R45B 5DNND 2FFFB 1KX5D 1M1AD 2Y2OA 1P3BB 1HQ3D 2F8NB 4XUJA 3LELC 3W96A 3AZFA 5GSUA 1F66D 1B67A 1N1JB 5B24D 5C3IC 2NZDA 4X23A 3AZJD 5C3IB 2AROB 3TU4D 5AVBC 3KSYA 4AWLC 3WKJD 2YFVB 3REJC 3KUYB 2NQBD 5F99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL C;  1S32 C;  4J8U B;  4XZQ C;  3AZL B;  3AZN D;  1S32 B;  1AOI D;  5BT1 D;  4Z2M G;  3X1T C;  4ZUX D;  5E5A A;  1H3O A;  5CPI A;  2BYM B;  3LJA B;  3MGQ B;  3REH D;  3AZK A;  2BYK A;  5B32 D;  5B31 C;  3NQJ A;  5JRG D;  3AN2 D;  3KXB D;  2PYO A;  2IO5 C;  5B0Y A;  3AYW C;  3VH6 W;  3AYW B;  1P3F D;  3KWQ D;  3UTA A;  4J8W A;  3WTP E;  3B0B A;  2FJ7 C;  4LD9 B;  2HIO D;  3LZ0 B;  5G49 A;  4R8P C;  1JFI A;  4QLC B;  1EQZ C;  3VH6 A;  3O62 B;  1P34 C;  5AV6 C;  3MGS C;  1P3G B;  3AZE D;  3MGP D;  3REI C;  3UT9 A;  1BFM A;  3REI B;  3X1U D;  3AZM C;  1P3L B;  1P3K D;  5B32 G;  5GXQ A;  5BO0 B;  3MGR B;  3X1V D;  3LZ1 B;  3REK C;  3WTP A;  3X1S C;  3REK B;  4UUZ A;  1WWS A;  5B1L C;  3C1C A;  1U35 C;  5AV8 A;  5B1L B;  3C1B C;  4M6B A;  1KX3 A;  1M19 D;  1P3I B;  1U35 B;  3C1B B;  4YS3 A;  3MNN B;  1M18 B;  2CV5 B;  5AY8 B;  3UTB A;  3AV1 A;  3WA9 C;  5CHL B;  1M1A B;  4WU9 D;  5GT3 A;  4J8V C;  2CWE A;  5B2J D;  3V9R A;  4KUD C;  3AZG C;  1P3B A;  2YFW A;  3W98 D;  3AZG B;  1F66 B;  2F8N A;  4ZBJ C;  5B24 B;  4WNN B;  3LEL A;  3AZJ B;  3TU4 B;  1KX4 D;  3AZI D;  1N1J A;  4JJN C;  3WKJ B;  4J8X C;  3AV2 D;  5AVC C;  4JJN B;  4J8X B;  5AVC B;  3W99 C;  2NQB B;  3W97 D;  4Z5T D;  4NFT A;  3W99 B;  5AVB A;  5B2I D;  3AZN B;  1TZY C;  4DRB A;  3REJ A;  4J8U A;  5DNM C;  1P3M D;  3AZH D;  3AZL A;  5CPJ D;  1S32 A;  3REH B;  4XZQ A;  3AFA D;  5B32 B;  1P3A D;  4WU8 D;  5BNV B;  5JRG B;  3A6N C;  3X1T A;  3KXB B;  5B1M D;  1TAF B;  1P3F B;  5CP6 C;  1A7W A;  4H9S C;  5CP6 B;  5B33 D;  3AYW A;  5CPK C;  4YM6 D;  5BS7 C;  1P3O D;  2FJ7 A;  3LZ0 A;  3AZE B;  3MGP B;  1ID3 D;  3MVD D;  4R8P A;  1EQZ A;  5B0Z C;  3REL C;  3X1U B;  1P34 A;  5AV6 A;  3MGS A;  1P3P D;  3X1V C;  5GT0 D;  3REI A;  3X1V B;  4KGC C;  1P3B C;  4KGC B;  3AZM A;  4Z66 D;  4H9Q B;  3B6F C;  2F8N K;  3B6F B;  4KHA A;  5B40 D;  1M19 B;  3B6G D;  3REK A;  3X1S A;  5B1L A;  4XUJ D;  1U35 A;  2ARO C;  3C1B A;  3AZF D;  3W96 D;  5GSU D;  4J8U C;  5AV9 C;  5AV9 B;  3KUY C;  2NZD D;  3WA9 A;  3W98 B;  4J8V A;  5F99 D;  3AZG A;  4KUD A;  4H9O B;  3LJA C;  5B24 A;  3MGQ C;  3AZI B;  4Z5T C;  1BH8 B;  3W97 B;  4Z5T B;  5E5A D;  5CPI D;  5B2I B;  4JJN A;  3AZK D;  4J8X A;  5AVC A;  4NE3 A;  3W99 A;  4CAY B;  3AZH B;  5CPJ B;  2PYO D;  4LD9 C;  5B0Y D;  4WU8 C;  2RVQ C;  1TZY A;  1P3A B;  4HGA B;  4WU8 B;  3LZ0 C;  5KDM B;  4QLC C;  5DNM A;  4J8W D;  3UTA D;  3O62 C;  1BH9 B;  5B1M B;  3VH6 T;  1P3G C;  5BNV A;  3A6N A;  2F8N H;  5AV5 C;  4CSR B;  5B33 B;  5BNX A;  1P3L C;  5AV5 B;  5CP6 A;  3MGR C;  4H9S A;  3UT9 D;  3LZ1 C;  4YM6 B;  1P3O B;  1ID3 B;  2HUE C;  5GXQ D;  4DRA A;  5CPK A;  2HUE B;  1P3I C;  5BS7 A;  3MNN C;  1M18 C;  2CV5 C;  1WWI A;  5AY8 C;  5GT0 B;  3C1C D;  5DNN C;  5AV8 D;  4H9N A;  1KX3 D;  1M1A C;  1KX5 C;  5DNN B;  5B0Z A;  3REL A;  3NQU A;  1HQ3 C;  4YS3 D;  1KX5 B;  1HQ3 B;  3X1V A;  3R45 A;  5B40 B;  3UTB D;  4KGC A;  1F66 C;  3B6G B;  5B24 C;  5GT3 D;  3B6F A;  3AZJ C;  3TU4 C;  3AZF B;  3WKJ C;  5GSU B;  2F8N D;  2NZD B;  2NQB C;  3LEL D;  2ARO A;  3AZN C;  4H9R B;  1AOI C;  2YFV A;  5BT1 C;  5AV9 A;  3B0C W;  1AOI B;  4ZUX C;  3KUY A;  5F99 B;  4ZUX B;  3REH C;  5AVB D;  1F1E A;  3WAA D;  5B32 C;  5JRG C;  3AN2 C;  2LY8 A;  3KXB C;  3REJ D;  5E5A B;  4J8U D;  1R4V A;  3AN2 B;  2BYM A;  3LJA A;  3MGQ A;  3AZL D;  3AZK B;  1S32 D;  4XZQ D;  3B0C T;  1BH8 A;  1P3F C;  4Z5T A;  3KWQ C;  3NQJ B;  1ZLA D;  3X1T D;  3KWQ B;  2PYO B;  2HIO C;  4H9P B;  5B31 D;  2HIO B;  4J8W B;  4LD9 A;  4WU8 A;  3AZE C;  3MGP C;  2L5A A;  4QLC A;  1B6W A;  1JFI B;  3O62 A;  3X1U C;  2FJ7 D;  1P3G A;  1P3K C;  1P3K B;  3B0D B;  4CSR A;  4R8P D;  1EQZ D;  5AV5 A;  1P3L A;  1P34 D;  5AV6 D;  3MGS D;  5GXQ B;  5BO0 A;  3MGR A;  1M19 C;  3REI D;  3LZ1 A;  3AZM D;  4UUZ B;  5B31 G;  1Q9C A;  5AV8 B;  1KX3 B;  1P3I A;  4WU9 C;  3MNN A;  4EO5 C;  3REK D;  4WU9 B;  4YS3 B;  1M18 A;  5B2J C;  3X1S D;  2CV5 A;  4EO5 B;  5AY8 A;  5B2J B;  3UTB B;  1U35 D;  5DNN A;  4X23 D;  3C1B D;  3W98 C;  5JA4 B;  1M1A A;  1KX5 A;  1HQ3 A;  3V9R B;  1KX4 C;  3B6G A;  3AZI C;  2YFW B;  3WA9 D;  3AV2 C;  1KX4 B;  1F66 A;  4J8V D;  3AV2 B;  4WNN A;  3LEL B;  3AZJ A;  3W97 C;  3TU4 A;  3AZG D;  4KUD D;  5B2I C;  3WKJ A;  3VH5 W;  2NQB A;  1P3M C;  3AZH C;  5CPJ C;  3WAA C;  4H9R A;  5FUG B;  1P3M B;  3AFA C;  5AVB B;  4JJN D;  4AWL B;  3AZN A;  4J8X D;  1AOI A;  3WAA B;  1P3A C;  4HGA C;  3AFA B;  5AVC D;  4ZUX A;  3REJ B;  3W99 D;  4WZS B;  3REH A;  4XZQ B;  5B1M C;  5B32 A;  1TZY D;  3VH5 T;  3VH5 A;  2JSS A;  4E44 A;  1ZLA C;  5JRG A;  3AN2 A;  1ZLA B;  3KXB A;  3X1T B;  5DNM D;  5B33 C;  1TAF A;  4NE5 A;  1P3F A;  5B31 B;  3KWQ A;  1KU5 A;  3A6N D;  4YM6 C;  1P3O C;  2IO5 B;  4H9P A;  2HIO A;  1ID3 C;  3MVD C;  5CP6 D;  3MVD B;  2FJ7 B;  1P3P C;  3AZE A;  3WTP D;  3MGP A;  1P3P B;  5GT0 C;  5CPK D;  4R8P B;  1EQZ B;  3X1U A;  4Z66 C;  1P34 B;  5AV6 B;  3MGS B;  1P3K A;  4Z66 B;  5B40 C;  3AV1 D;  3B6G C;  5B0Z D;  3REL D;  4H9Q A;  3AZM B;  4XUJ C;  4KHA B;  4XUJ B;  3W96 C;  3AZF C;  1M19 A;  5GSU C;  4KGC D;  3W96 B;  1P3B D;  3X1S B;  3B6F D;  2NZD C;  4X23 C;  4X23 B;  4WU9 A;  5B2J A;  5F99 C;  5JA4 A;  2ARO D;  3W98 A;  3WA9 B;  5AV9 D;  4J8V B;  5E5A C;  3KUY D;  5CPI C;  1KX4 A;  4KUD B;  4H9O A;  3AZI A;  1H3O B;  3AZK C;  5CPI B;  3AV2 A;  4ZBJ B;  2BYK B;  3W97 A;  2PYO C;  4E45 A;  5B2I A;  5B0Y C;  3LJA D;  3MGQ D;  5B0Y B;  2F8N G;  3UTA C;  5FUG A;  4J8W C;  4CAY A;  1P3M A;  3AZH A;  5CPJ A;  3WAA A;  3UTA B;  4Z2M H;  3AFA A;  1TZY B;  1P3A A;  3AYW D;  5KDM A;  5DNM B;  5G49 B;  1BH9 A;  4LD9 D;  5B1M A;  2RVQ D;  4G91 C;  1ZLA A;  3B0D C;  4G91 B;  3LZ0 D;  3A6N B;  3UT9 C;  4QLC D;  3O62 D;  5B33 A;  3UT9 B;  5BNX B;  5B31 A;  1P3G D;  5GXQ C;  4YM6 A;  1P3O A;  5AV5 D;  3WTP C;  1P3L D;  1HTA A;  3WTP B;  1ID3 A;  1ULY A;  3MVD A;  5CPK B;  3C1C C;  3MGR D;  5AV8 C;  1KX3 C;  3C1C B;  4NE6 A;  3LZ1 D;  4YS3 C;  1P3P A;  5GT0 A;  4WV4 B;  3UTB C;  3AV1 C;  5B1L D;  4H9N B;  3AV1 B;  1P3I D;  5B0Z B;  4G92 C;  5GT3 C;  3NQU B;  4Z66 A;  3MNN D;  3REL B;  1M18 D;  4G92 B;  5GT3 B;  2CV5 D;  5AY8 D;  5B40 A;  3R45 B;  5DNN D;  1KX5 D;  1M1A D;  1P3B B;  1HQ3 D;  2F8N B;  4XUJ A;  3LEL C;  3W96 A;  3AZF A;  5GSU A;  1F66 D;  1B67 A;  1N1J B;  5B24 D;  5C3I C;  2NZD A;  4X23 A;  3AZJ D;  5C3I B;  2ARO B;  3TU4 D;  5AVB C;  3KSY A;  4AWL C;  3WKJ D;  2YFV B;  3REJ C;  3KUY B;  2NQB D;  5F99 A; 
#chains in the Genus database with same CATH topology
 3AZL C;  1S32 C;  4J8U B;  4XZQ C;  3AZL B;  3AZN D;  1S32 B;  1AOI D;  5BT1 D;  4Z2M G;  3X1T C;  4ZUX D;  5E5A A;  1H3O A;  5CPI A;  2BYM B;  3LJA B;  3MGQ B;  3REH D;  3AZK A;  2BYK A;  5B32 D;  5B31 C;  3NQJ A;  5JRG D;  3AN2 D;  3KXB D;  2PYO A;  2IO5 C;  5B0Y A;  3AYW C;  3VH6 W;  3AYW B;  3EG5 B;  1P3F D;  3KWQ D;  3UTA A;  4J8W A;  3WTP E;  3B0B A;  2FJ7 C;  4LD9 B;  2DF4 C;  2HIO D;  3LZ0 B;  5G49 A;  4R8P C;  1JFI A;  4QLC B;  1EQZ C;  3VH6 A;  3O62 B;  1P34 C;  5AV6 C;  3MGS C;  1P3G B;  2XD5 A;  3AZE D;  2ZY2 A;  3MGP D;  3REI C;  3UT9 A;  1BFM A;  3REI B;  3X1U D;  3AZM C;  1P3L B;  1P3K D;  5B32 G;  5GXQ A;  5BO0 B;  3MGR B;  3X1V D;  3LZ1 B;  3REK C;  3WTP A;  3X1S C;  3REK B;  4UUZ A;  1WWS A;  5B1L C;  3C1C A;  1U35 C;  5AV8 A;  5B1L B;  3C1B C;  4M6B A;  1KX3 A;  1M19 D;  1P3I B;  1U35 B;  3C1B B;  3H0L C;  4YS3 A;  3MNN B;  1M18 B;  2CV5 B;  5AY8 B;  3A1K A;  3UTB A;  3AV1 A;  3WA9 C;  5CHL B;  1M1A B;  4WU9 D;  5GT3 A;  4J8V C;  2CWE A;  5B2J D;  3V9R A;  4KUD C;  3AZG C;  1P3B A;  2YFW A;  3W98 D;  4DQY B;  3AZG B;  1F66 B;  2F8N A;  4ZBJ C;  5B24 B;  4WNN B;  2Y2Q A;  3LEL A;  3AZJ B;  3TU4 B;  1KX4 D;  3AZI D;  1N1J A;  4JJN C;  3WKJ B;  4J8X C;  3AV2 D;  5AVC C;  4JJN B;  4J8X B;  5AVC B;  3W99 C;  2NQB B;  3W97 D;  4Z5T D;  4NFT A;  3W99 B;  5AVB A;  5B2I D;  3AZN B;  1TZY C;  4DRB A;  3REJ A;  4J8U A;  5DNM C;  1P3M D;  3AZH D;  3AZL A;  5CPJ D;  1S32 A;  3REH B;  4XZQ A;  3AFA D;  3P5J B;  5B32 B;  1P3A D;  4WU8 D;  5BNV B;  5JRG B;  3A6N C;  3X1T A;  3KXB B;  5B1M D;  1TAF B;  3A1I A;  5CP6 C;  1P3F B;  1A7W A;  4H9S C;  5CP6 B;  5B33 D;  2XD1 A;  3AYW A;  3FDD A;  2Y2J A;  2JCH A;  5CPK C;  4YM6 D;  5BS7 C;  1P3O D;  2FJ7 A;  3LZ0 A;  3AZE B;  3MGP B;  1ID3 D;  3MVD D;  4R8P A;  1EQZ A;  5B0Z C;  3REL C;  3X1U B;  1P34 A;  3KFU G;  5AV6 A;  3MGS A;  1P3P D;  3X1V C;  5GT0 D;  3REI A;  3X1V B;  4KGC C;  1P3B C;  4KGC B;  3AZM A;  4Z66 D;  4H9Q B;  3B6F C;  2F8N K;  3B6F B;  4KHA A;  5B40 D;  1M19 B;  3B6G D;  3REK A;  3X1S A;  5B1L A;  4XUJ D;  1U35 A;  2ZM5 A;  2ARO C;  3C1B A;  3AZF D;  3W96 D;  5GSU D;  4J8U C;  5AV9 C;  5AV9 B;  3KUY C;  2NZD D;  3WA9 A;  3W98 B;  4J8V A;  3EPH A;  5F99 D;  3AZG A;  4KUD A;  4H9O B;  3LJA C;  5B24 A;  3MGQ C;  3AZI B;  4Z5T C;  1BH8 B;  3F6T A;  3W97 B;  4Z5T B;  5E5A D;  5CPI D;  5B2I B;  4JJN A;  3AZK D;  4J8X A;  5AVC A;  4NE3 A;  3W99 A;  4CAY B;  3AZH B;  5CPJ B;  2PYO D;  4LD9 C;  5B0Y D;  4WU8 C;  2RVQ C;  1TZY A;  1P3A B;  4HGA B;  4WU8 B;  3LZ0 C;  5KDM B;  4QLC C;  5DNM A;  4J8W D;  3UTA D;  2Y2K A;  3O62 C;  1BH9 B;  2Y2M A;  5B1M B;  3VH6 T;  1P3G C;  5BNV A;  2Y2P A;  3A6N A;  2F8N H;  5AV5 C;  4CSR B;  5B33 B;  5BNX A;  1P3L C;  5AV5 B;  5CP6 A;  3MGR C;  4H9S A;  3EPK A;  3UT9 D;  3LZ1 C;  4YM6 B;  1P3O B;  1ID3 B;  2HUE C;  5GXQ D;  4DRA A;  5CPK A;  2HUE B;  1P3I C;  5BS7 A;  3MNN C;  1M18 C;  2CV5 C;  1WWI A;  5AY8 C;  5GT0 B;  3C1C D;  5DNN C;  5AV8 D;  4H9N A;  1KX3 D;  1M1A C;  1KX5 C;  5DNN B;  5B0Z A;  3REL A;  3NQU A;  1HQ3 C;  4YS3 D;  1KX5 B;  1HQ3 B;  3X1V A;  3R45 A;  5B40 B;  3UTB D;  4KGC A;  1F66 C;  3B6G B;  5B24 C;  5GT3 D;  3B6F A;  3AL0 C;  3AZJ C;  3TU4 C;  3AZF B;  3WKJ C;  5GSU B;  2F8N D;  3WAA B;  4WJ3 C;  2NZD B;  2NQB C;  3LEL D;  2ARO A;  3AZN C;  4H9R B;  1AOI C;  2YFV A;  5BT1 C;  5AV9 A;  3B0C W;  1AOI B;  4ZUX C;  3KUY A;  5F99 B;  4ZUX B;  3REH C;  5AVB D;  1F1E A;  3WAA D;  5B32 C;  5JRG C;  3AN2 C;  2LY8 A;  3KXB C;  3REJ D;  5E5A B;  4J8U D;  1R4V A;  3AN2 B;  2BYM A;  3LJA A;  3MGQ A;  3AZL D;  3AZK B;  1S32 D;  4XZQ D;  3B0C T;  1BH8 A;  1P3F C;  4Z5T A;  3KWQ C;  3NQJ B;  2ZY3 A;  3X1T D;  1ZLA D;  3KWQ B;  2PYO B;  2HIO C;  4H9P B;  5B31 D;  2HIO B;  4J8W B;  4LD9 A;  4WU8 A;  3AZE C;  3MGP C;  2ZY5 A;  2L5A A;  4QLC A;  1B6W A;  1JFI B;  3O62 A;  3X1U C;  2FJ7 D;  1P3G A;  1P3K C;  1P3K B;  3B0D B;  4CSR A;  4R8P D;  1EQZ D;  5AV5 A;  1P3L A;  1P34 D;  5AV6 D;  3MGS D;  5GXQ B;  3IP4 C;  5BO0 A;  3MGR A;  1M19 C;  3REI D;  1T3U A;  3LZ1 A;  3EPJ A;  3AZM D;  4UUZ B;  5B31 G;  1Q9C A;  5AV8 B;  1KX3 B;  1P3I A;  4WU9 C;  3MNN A;  4EO5 C;  3REK D;  3H0M C;  4WU9 B;  4YS3 B;  1M18 A;  5B2J C;  3X1S D;  2CV5 A;  2J8P A;  1Z2C B;  4EO5 B;  5AY8 A;  5B2J B;  3UTB B;  1U35 D;  5DNN A;  2BG1 A;  4X23 D;  3C1B D;  3W98 C;  5JA4 B;  1M1A A;  1KX5 A;  4UPK A;  1HQ3 A;  3V9R B;  1KX4 C;  3B6G A;  3AZI C;  2YFW B;  3WA9 D;  3AV2 C;  1KX4 B;  1F66 A;  4J8V D;  3AV2 B;  4WNN A;  3LEL B;  3AZJ A;  3W97 C;  3TU4 A;  3AZG D;  4KUD D;  5B2I C;  3WKJ A;  3VH5 W;  2NQB A;  1P3M C;  3AZH C;  5CPJ C;  3WAA C;  4H9R A;  5FUG B;  1P3M B;  3AFA C;  5AVB B;  4JJN D;  4AWL B;  3AZN A;  4J8X D;  1AOI A;  2RIQ A;  1P3A C;  4HGA C;  2W8S A;  2F2A C;  5AVC D;  3AFA B;  4ZUX A;  3REJ B;  3W99 D;  4WZS B;  3REH A;  4XZQ B;  5B1M C;  5B32 A;  1TZY D;  3VH5 T;  3VH5 A;  2JSS A;  4E44 A;  1ZLA C;  5JRG A;  3AN2 A;  1ZLA B;  3KXB A;  3X1T B;  5DNM D;  5B33 C;  2VQR A;  1TAF A;  4NE5 A;  1P3F A;  5B31 B;  3KWQ A;  1KU5 A;  3A6N D;  4YM6 C;  1P3O C;  2IO5 B;  4H9P A;  2HIO A;  1ID3 C;  3MVD C;  5CP6 D;  3MVD B;  2FJ7 B;  1P3P C;  3AZE A;  3WTP D;  3MGP A;  1P3P B;  5GT0 C;  5CPK D;  4R8P B;  2Y2N A;  1EQZ B;  3X1U A;  4Z66 C;  1P34 B;  5AV6 B;  3MGS B;  1P3K A;  4Z66 B;  5B40 C;  2Y2I A;  3AV1 D;  3B6G C;  1PZR A;  5B0Z D;  3REL D;  4H9Q A;  3AZM B;  4XUJ C;  4KHA B;  4XUJ B;  3W96 C;  3AZF C;  1M19 A;  3H0R C;  5GSU C;  4KGC D;  3W96 B;  1P3B D;  3X1S B;  3B6F D;  2NZD C;  4X23 C;  4X23 B;  4WU9 A;  2Y2G A;  5B2J A;  2ZY4 A;  5F99 C;  5JA4 A;  2ARO D;  3W98 A;  3WA9 B;  5AV9 D;  4J8V B;  5E5A C;  3KUY D;  5CPI C;  1KX4 A;  4KUD B;  4H9O A;  3AZI A;  2Y2H A;  1H3O B;  3AZK C;  2Y2L A;  3AV2 A;  5CPI B;  4ZBJ B;  2BYK B;  3W97 A;  2G5I C;  2PYO C;  4E45 A;  5B2I A;  5B0Y C;  3LJA D;  3MGQ D;  5B0Y B;  2F8N G;  3UTA C;  5FUG A;  3EPL A;  4CAY A;  4J8W C;  3AZH A;  1P3M A;  5CPJ A;  3WAA A;  3UTA B;  4Z2M H;  3AFA A;  1TZY B;  1P3A A;  3AYW D;  5KDM A;  5DNM B;  5G49 B;  1BH9 A;  4LD9 D;  5B1M A;  2RVQ D;  4G91 C;  1ZLA A;  1W2E A;  3B0D C;  4G91 B;  3LZ0 D;  3A6N B;  3UT9 C;  4QLC D;  3O62 D;  5B33 A;  3UT9 B;  5BNX B;  5B31 A;  1P3G D;  5GXQ C;  2G5H C;  4YM6 A;  2DQN C;  1P3O A;  5AV5 D;  3WTP C;  1P3L D;  1HTA A;  3WTP B;  1ID3 A;  1ULY A;  3MVD A;  5CPK B;  3C1C C;  3MGR D;  5AV8 C;  1KX3 C;  3C1C B;  4NE6 A;  3LZ1 D;  4YS3 C;  1P3P A;  5GT0 A;  4WV4 B;  3UTB C;  3AV1 C;  5B1L D;  2JE5 A;  4H9N B;  3AV1 B;  1P3I D;  5B0Z B;  4G92 C;  5GT3 C;  3NQU B;  4Z66 A;  3MNN D;  2UWX A;  3REL B;  1M18 D;  4G92 B;  5GT3 B;  2CV5 D;  5AY8 D;  5B40 A;  3R45 B;  5DNN D;  2FFF B;  1KX5 D;  1M1A D;  2Y2O A;  1P3B B;  1HQ3 D;  2F8N B;  4XUJ A;  3LEL C;  3W96 A;  3AZF A;  5GSU A;  1F66 D;  1B67 A;  1N1J B;  5B24 D;  5C3I C;  2NZD A;  4X23 A;  3AZJ D;  5C3I B;  2ARO B;  3TU4 D;  5AVB C;  3KSY A;  4AWL C;  3WKJ D;  2YFV B;  3REJ C;  3KUY B;  2NQB D;  5F99 A; 
#chains in the Genus database with same CATH homology
 3AZL C;  1S32 C;  4J8U B;  4XZQ C;  3AZL B;  3AZN D;  1S32 B;  1AOI D;  5BT1 D;  4Z2M G;  3X1T C;  4ZUX D;  5E5A A;  1H3O A;  5CPI A;  2BYM B;  3LJA B;  3MGQ B;  3REH D;  3AZK A;  2BYK A;  5B32 D;  5B31 C;  3NQJ A;  5JRG D;  3AN2 D;  3KXB D;  2PYO A;  2IO5 C;  5B0Y A;  3AYW C;  3VH6 W;  3AYW B;  3EG5 B;  1P3F D;  3KWQ D;  3UTA A;  4J8W A;  3WTP E;  3B0B A;  2FJ7 C;  4LD9 B;  2DF4 C;  2HIO D;  3LZ0 B;  5G49 A;  4R8P C;  1JFI A;  4QLC B;  1EQZ C;  3VH6 A;  3O62 B;  1P34 C;  5AV6 C;  3MGS C;  1P3G B;  2XD5 A;  3AZE D;  2ZY2 A;  3MGP D;  3REI C;  3UT9 A;  1BFM A;  3REI B;  3X1U D;  3AZM C;  1P3L B;  1P3K D;  5B32 G;  5GXQ A;  5BO0 B;  3MGR B;  3X1V D;  3LZ1 B;  3REK C;  3WTP A;  3X1S C;  3REK B;  4UUZ A;  1WWS A;  5B1L C;  3C1C A;  1U35 C;  5AV8 A;  5B1L B;  3C1B C;  4M6B A;  1KX3 A;  1M19 D;  1P3I B;  1U35 B;  3C1B B;  3H0L C;  4YS3 A;  3MNN B;  1M18 B;  2CV5 B;  5AY8 B;  3A1K A;  3UTB A;  3AV1 A;  3WA9 C;  5CHL B;  1M1A B;  4WU9 D;  5GT3 A;  4J8V C;  2CWE A;  5B2J D;  3V9R A;  4KUD C;  3AZG C;  1P3B A;  2YFW A;  3W98 D;  4DQY B;  3AZG B;  1F66 B;  2F8N A;  4ZBJ C;  5B24 B;  4WNN B;  2Y2Q A;  3LEL A;  3AZJ B;  3TU4 B;  1KX4 D;  3AZI D;  1N1J A;  4JJN C;  3WKJ B;  4J8X C;  3AV2 D;  5AVC C;  4JJN B;  4J8X B;  5AVC B;  3W99 C;  2NQB B;  3W97 D;  4Z5T D;  4NFT A;  3W99 B;  5AVB A;  5B2I D;  3AZN B;  1TZY C;  4DRB A;  3REJ A;  4J8U A;  5DNM C;  1P3M D;  3AZH D;  3AZL A;  5CPJ D;  1S32 A;  3REH B;  4XZQ A;  3AFA D;  3P5J B;  5B32 B;  1P3A D;  4WU8 D;  5BNV B;  5JRG B;  3A6N C;  3X1T A;  3KXB B;  5B1M D;  1TAF B;  3A1I A;  5CP6 C;  1P3F B;  1A7W A;  4H9S C;  5CP6 B;  5B33 D;  2XD1 A;  3AYW A;  3FDD A;  2Y2J A;  2JCH A;  5CPK C;  4YM6 D;  5BS7 C;  1P3O D;  2FJ7 A;  3LZ0 A;  3AZE B;  3MGP B;  1ID3 D;  3MVD D;  4R8P A;  1EQZ A;  5B0Z C;  3REL C;  3X1U B;  1P34 A;  3KFU G;  5AV6 A;  3MGS A;  1P3P D;  3X1V C;  5GT0 D;  3REI A;  3X1V B;  4KGC C;  1P3B C;  4KGC B;  3AZM A;  4Z66 D;  4H9Q B;  3B6F C;  2F8N K;  3B6F B;  4KHA A;  5B40 D;  1M19 B;  3B6G D;  3REK A;  3X1S A;  5B1L A;  4XUJ D;  1U35 A;  2ZM5 A;  2ARO C;  3C1B A;  3AZF D;  3W96 D;  5GSU D;  4J8U C;  5AV9 C;  5AV9 B;  3KUY C;  2NZD D;  3WA9 A;  3W98 B;  4J8V A;  3EPH A;  5F99 D;  3AZG A;  4KUD A;  4H9O B;  3LJA C;  5B24 A;  3MGQ C;  3AZI B;  4Z5T C;  1BH8 B;  3F6T A;  3W97 B;  4Z5T B;  5E5A D;  5CPI D;  5B2I B;  4JJN A;  3AZK D;  4J8X A;  5AVC A;  4NE3 A;  3W99 A;  4CAY B;  3AZH B;  5CPJ B;  2PYO D;  4LD9 C;  5B0Y D;  4WU8 C;  2RVQ C;  1TZY A;  1P3A B;  4HGA B;  4WU8 B;  3LZ0 C;  5KDM B;  4QLC C;  5DNM A;  4J8W D;  3UTA D;  2Y2K A;  3O62 C;  1BH9 B;  2Y2M A;  5B1M B;  3VH6 T;  1P3G C;  5BNV A;  2Y2P A;  3A6N A;  2F8N H;  5AV5 C;  4CSR B;  5B33 B;  5BNX A;  1P3L C;  5AV5 B;  5CP6 A;  3MGR C;  4H9S A;  3EPK A;  3UT9 D;  3LZ1 C;  4YM6 B;  1P3O B;  1ID3 B;  2HUE C;  5GXQ D;  4DRA A;  5CPK A;  2HUE B;  1P3I C;  5BS7 A;  3MNN C;  1M18 C;  2CV5 C;  1WWI A;  5AY8 C;  5GT0 B;  3C1C D;  5DNN C;  5AV8 D;  4H9N A;  1KX3 D;  1M1A C;  1KX5 C;  5DNN B;  5B0Z A;  3REL A;  3NQU A;  1HQ3 C;  4YS3 D;  1KX5 B;  1HQ3 B;  3X1V A;  3R45 A;  5B40 B;  3UTB D;  4KGC A;  1F66 C;  3B6G B;  5B24 C;  5GT3 D;  3B6F A;  3AL0 C;  3AZJ C;  3TU4 C;  3AZF B;  3WKJ C;  5GSU B;  2F8N D;  3WAA B;  4WJ3 C;  2NZD B;  2NQB C;  3LEL D;  2ARO A;  3AZN C;  4H9R B;  1AOI C;  2YFV A;  5BT1 C;  5AV9 A;  3B0C W;  1AOI B;  4ZUX C;  3KUY A;  5F99 B;  4ZUX B;  3REH C;  5AVB D;  1F1E A;  3WAA D;  5B32 C;  5JRG C;  3AN2 C;  2LY8 A;  3KXB C;  3REJ D;  5E5A B;  4J8U D;  1R4V A;  3AN2 B;  2BYM A;  3LJA A;  3MGQ A;  3AZL D;  3AZK B;  1S32 D;  4XZQ D;  3B0C T;  1BH8 A;  1P3F C;  4Z5T A;  3KWQ C;  3NQJ B;  2ZY3 A;  3X1T D;  1ZLA D;  3KWQ B;  2PYO B;  2HIO C;  4H9P B;  5B31 D;  2HIO B;  4J8W B;  4LD9 A;  4WU8 A;  3AZE C;  3MGP C;  2ZY5 A;  2L5A A;  4QLC A;  1B6W A;  1JFI B;  3O62 A;  3X1U C;  2FJ7 D;  1P3G A;  1P3K C;  1P3K B;  3B0D B;  4CSR A;  4R8P D;  1EQZ D;  5AV5 A;  1P3L A;  1P34 D;  5AV6 D;  3MGS D;  5GXQ B;  3IP4 C;  5BO0 A;  3MGR A;  1M19 C;  3REI D;  1T3U A;  3LZ1 A;  3EPJ A;  3AZM D;  4UUZ B;  5B31 G;  1Q9C A;  5AV8 B;  1KX3 B;  1P3I A;  4WU9 C;  3MNN A;  4EO5 C;  3REK D;  3H0M C;  4WU9 B;  4YS3 B;  1M18 A;  5B2J C;  3X1S D;  2CV5 A;  2J8P A;  1Z2C B;  4EO5 B;  5AY8 A;  5B2J B;  3UTB B;  1U35 D;  5DNN A;  2BG1 A;  4X23 D;  3C1B D;  3W98 C;  5JA4 B;  1M1A A;  1KX5 A;  4UPK A;  1HQ3 A;  3V9R B;  1KX4 C;  3B6G A;  3AZI C;  2YFW B;  3WA9 D;  3AV2 C;  1KX4 B;  1F66 A;  4J8V D;  3AV2 B;  4WNN A;  3LEL B;  3AZJ A;  3W97 C;  3TU4 A;  3AZG D;  4KUD D;  5B2I C;  3WKJ A;  3VH5 W;  2NQB A;  1P3M C;  3AZH C;  5CPJ C;  3WAA C;  4H9R A;  5FUG B;  1P3M B;  3AFA C;  5AVB B;  4JJN D;  4AWL B;  3AZN A;  4J8X D;  1AOI A;  2RIQ A;  1P3A C;  4HGA C;  2W8S A;  2F2A C;  5AVC D;  3AFA B;  4ZUX A;  3REJ B;  3W99 D;  4WZS B;  3REH A;  4XZQ B;  5B1M C;  5B32 A;  1TZY D;  3VH5 T;  3VH5 A;  2JSS A;  4E44 A;  1ZLA C;  5JRG A;  3AN2 A;  1ZLA B;  3KXB A;  3X1T B;  5DNM D;  5B33 C;  2VQR A;  1TAF A;  4NE5 A;  1P3F A;  5B31 B;  3KWQ A;  1KU5 A;  3A6N D;  4YM6 C;  1P3O C;  2IO5 B;  4H9P A;  2HIO A;  1ID3 C;  3MVD C;  5CP6 D;  3MVD B;  2FJ7 B;  1P3P C;  3AZE A;  3WTP D;  3MGP A;  1P3P B;  5GT0 C;  5CPK D;  4R8P B;  2Y2N A;  1EQZ B;  3X1U A;  4Z66 C;  1P34 B;  5AV6 B;  3MGS B;  1P3K A;  4Z66 B;  5B40 C;  2Y2I A;  3AV1 D;  3B6G C;  1PZR A;  5B0Z D;  3REL D;  4H9Q A;  3AZM B;  4XUJ C;  4KHA B;  4XUJ B;  3W96 C;  3AZF C;  1M19 A;  3H0R C;  5GSU C;  4KGC D;  3W96 B;  1P3B D;  3X1S B;  3B6F D;  2NZD C;  4X23 C;  4X23 B;  4WU9 A;  2Y2G A;  5B2J A;  2ZY4 A;  5F99 C;  5JA4 A;  2ARO D;  3W98 A;  3WA9 B;  5AV9 D;  4J8V B;  5E5A C;  3KUY D;  5CPI C;  1KX4 A;  4KUD B;  4H9O A;  3AZI A;  2Y2H A;  1H3O B;  3AZK C;  2Y2L A;  3AV2 A;  5CPI B;  4ZBJ B;  2BYK B;  3W97 A;  2G5I C;  2PYO C;  4E45 A;  5B2I A;  5B0Y C;  3LJA D;  3MGQ D;  5B0Y B;  2F8N G;  3UTA C;  5FUG A;  3EPL A;  4CAY A;  4J8W C;  3AZH A;  1P3M A;  5CPJ A;  3WAA A;  3UTA B;  4Z2M H;  3AFA A;  1TZY B;  1P3A A;  3AYW D;  5KDM A;  5DNM B;  5G49 B;  1BH9 A;  4LD9 D;  5B1M A;  2RVQ D;  4G91 C;  1ZLA A;  1W2E A;  3B0D C;  4G91 B;  3LZ0 D;  3A6N B;  3UT9 C;  4QLC D;  3O62 D;  5B33 A;  3UT9 B;  5BNX B;  5B31 A;  1P3G D;  5GXQ C;  2G5H C;  4YM6 A;  2DQN C;  1P3O A;  5AV5 D;  3WTP C;  1P3L D;  1HTA A;  3WTP B;  1ID3 A;  1ULY A;  3MVD A;  5CPK B;  3C1C C;  3MGR D;  5AV8 C;  1KX3 C;  3C1C B;  4NE6 A;  3LZ1 D;  4YS3 C;  1P3P A;  5GT0 A;  4WV4 B;  3UTB C;  3AV1 C;  5B1L D;  2JE5 A;  4H9N B;  3AV1 B;  1P3I D;  5B0Z B;  4G92 C;  5GT3 C;  3NQU B;  4Z66 A;  3MNN D;  2UWX A;  3REL B;  1M18 D;  4G92 B;  5GT3 B;  2CV5 D;  5AY8 D;  5B40 A;  3R45 B;  5DNN D;  2FFF B;  1KX5 D;  1M1A D;  2Y2O A;  1P3B B;  1HQ3 D;  2F8N B;  4XUJ A;  3LEL C;  3W96 A;  3AZF A;  5GSU A;  1F66 D;  1B67 A;  1N1J B;  5B24 D;  5C3I C;  2NZD A;  4X23 A;  3AZJ D;  5C3I B;  2ARO B;  3TU4 D;  5AVB C;  3KSY A;  4AWL C;  3WKJ D;  2YFV B;  3REJ C;  3KUY B;  2NQB D;  5F99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...