3WAAB

The nucleosome containing human h2a.z.2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaB00
5CPJA 3KWQA 3W99D 2HUEC 1EQZD 3X1UA 5B1LB 4QLCD 4X23D 4J8UD 1P3OC 4XUJD 3AZJC 1P3OB 3W96A 1HQ3D 2YFVA 5B32G 1ZLAC 3X1VD 1F66C 5B2JC 1F66B 5B2JB 5B1LA 1KX5D 5B24A 3WA9D 2BYMB 4ZBJB 4JJNC 3NQJB 4DRBA 5BT1C 5B0ZD 1KX4C 3RELC 4H9OB 3W99B 3RELB 4Z5TD 4XUJC 4QLCB 5BNVA 4J8UB 3X1TD 1ID3C 2BYMA 2NQBC 4XUJB 3MNNA 1ID3B 5AV8D 5CPKD 3NQJA 3X1VB 4H9OA 3W99A 1EQZA 4QLCA 4WU8C 4X23A 4J8UA 4XUJA 1KX5B 4E44A 5F99D 5AVBC 1HQ3A 2BYKB 3WA9B 3AZGC 3X1VA 5AVBB 3AZGB 1A7WA 3B6FD 3B0DB 1KX5A 3AYWC 2BYKA 3WA9A 4Z5TB 5B1MC 4YM6D 5BNXB 4H9NB 5AV8B 3C1CD 5CPKB 5B0ZA 5B0YD 1BH8B 5B33C 4EO5C 5GT3D 4Z5TA 3X1TA 3AZEC 1WWSA 1WWIA 5F99C 5BNXA 4H9NA 5AV8A 3AZEB 5F99B 5CPKA 3AZMD 4WU9D 1BH8A 4NE3A 5B2ID 5GXQD 5DNMD 3B6FB 5B32D 3WKJD 5GSUC 5F99A 3MGPC 3UT9D 4KUDC 4J8XD 3W97D 3MGPB 4M6BA 3C1CB 2YFWB 1P3LC 5B0YB 3MVDD 3REHC 3B6FA 3VH6T 3REHB 3UTBD 2RVQC 4KGCD 4YM6A 3C1CA 2YFWA 3AZLD 5B0YA 5B2IC 4ZUXD 3AZKC 2IO5C 3AV2D 5B2IB 5GT3A 2IO5B 5B32C 5CHLB 2F8NG 5DNMB 1TZYC 5B32B 3WKJB 5JRGD 4CAYB 3UT9C 1TZYB 3X1SC 4UUZB 3X1SB 3UT9B 3AZMA 4J8XB 4WU9A 5G49A 3A6NC 5B2IA 3B6GD 5GXQA 3MVDB 4AWLC 5DNMA 5B32A 3WKJA 4AWLB 4G91C 4UUZA 3UTBB 2PYOC 4KGCC 4H9QB 3UT9A 1AOIC 4J8WD 4J8XA 4KGCB 2PYOB 3W97A 1P3AC 3O62C 1P3AB 3AZLB 3O62B 3MVDA 3TU4D 1P3KD 2HIOD 3AZID 3UTBA 4H9QA 4KGCA 5JRGC 5JRGB 4J8VD 5KDMB 3AZLA 5AV6D 5CPJC 3KWQC 3REJD 1U35D 3MGQD 3KWQB 4ZUXA 3B6GC 3X1UC 3AV2A 3B6GB 5AV9D 5GT0D 5JRGA 5KDMA 4E45A 3AN2D 4J8WB 2YFVB 3AFAD 5B1LC 3B6GA 1P3KC 4Z66D 5B24C 1P3KB 4WV4B 3AZIB 3VH5T 5BO0A 5B24B 4J8WA 4J8VC 4J8VB 3REID 3UTAD 3REJC 5AV6B 3REJB 1H3OB 1KX3D 2AROD 3MGQB 3TU4A 1P3KA 3AZIA 5AV9C 5AV9B 3WAAD 5GT0B 4ZBJC 5BNVB 3MNNC 4J8VA 5CP6D 3AN2C 3MNNB 3B0BA 3B0CT 5AV6A 3AN2B 3W99C 3AFAB 1H3OA 3REJA 1U35A 3MGQA 2CWEA 1EQZC 2F8ND 1P3GD 1EQZB 5AV9A 4QLCC 4X23C 4J8UC 5GT0A 4X23B 1HQ3C 3AN2A 3X1VC 1HQ3B 3AFAA 2NZDD 3REIC 1P3MD 3REIB 1R4VA 3V9RA 3AV1D 4Z66A 1KX3B 1KX5C 2AROB 1F1EA 5FUGB 3WAAC 3WA9C 3WAAB 4XZQD 5CP6B 3REIA 3UTAA 5C3IC 5B0ZC 4HGAC 5C3IB 3B0DC 5B0ZB 2AROA 4HGAB 3MGSD 5FUGA 3REKD 1KX3A 2F8NB 4NE5A 2CV5D 1P3GB 4Z5TC 3WAAA 3X1TC 1P34D 5DNND 3X1TB 5AV8C 4KHAA 4CSRB 5CP6A 5CPKC 2NZDB 1P3ID 2F8NA 1P3GA 4CSRA 4LD9D 1P3FD 2L5AA 2NZDA 4R8PD 3AV1A 3LZ0D 3B6FC 1B67A 3REKB 1ULYA 2CV5B 3C1BD 4XZQA 4YM6C 5CPID 3C1CC 3MGRD 4YM6B 5B0YC 1P3IB 3MGSA 3REKA 5GT3C 2CV5A 3KUYD 5GT3B 3WTPD 3LELD 1P34A 3VH5W 5DNNA 5AY8D 4LD9B 3KXBD 3AZMC 3AZND 4WU9C 1P3FB 1P3PD 3AZMB 4WU9B 1P3IA 5G49B 5GXQC 5GXQB 5DNMC 1P3BD 3WKJC 5E5AD 4LD9A 4J8XC 1P3FA 3AZHD 5CPIC 3W97C 2FJ7D 3C1BB 1KU5A 5CPIB 3W97B 3MGRB 4R8PA 3MVDC 3LZ0A 1M19D 3UTBC 3KUYB 3WTPB 3C1BA 5CPIA 3MGRA 3AZLC 1N1JA 3KXBB 3LJAD 1P3PB 5B31G 1S32D 5AV5D 5BS7A 4ZUXC 3AV2C 4ZUXB 3WTPE 1BH9A 3AV2B 5E5AC 3KUYA 3WTPA 3LELA 5E5AB 5AY8A 5JA4B 3KXBA 2FJ7C 3W98D 3AZNA 1M1AD 1P3PA 2FJ7B 5AVCD 1M18D 1P3BA 5E5AA 4DRAA 1M19B 5JA4A 5BO0B 3LZ1D 4J8WC 3AZHA 2FJ7A 4YS3D 3LJAB 3TU4C 1S32B 2HIOC 3AZIC 3TU4B 1M19A 1P3OD 2HIOB 3AZJD 1ZLAD 1F66D 5B2JD 5AV6C 3W98B 1U35C 3LJAA 4G92B 4H9RB 1M1AB 3MGQC 1S32A 5AV5A 1U35B 4H9SA 2HIOA 3VH5A 5GT0C 5AVCB 1M18B 2F8NK 1TAFA 4JJND 3LZ1B 2F8NH 3AFAC 1M1AA 4H9RA 4YS3C 3W98A 5BT1D 5B40D 1KX4D 3RELD 4YS3B 2HUEB 5AVCA 4Z66C 3V9RB 1M18A 3VH6W 4Z66B 2NQBD 1ID3D 3AZJB 3LZ1A 1ZLAB 3UTAC 4YS3A 3UTAB 1KX3C 2AROC 4WU8D 1P3OA 3AZJA 2LY8A 5AVBD 3AZGD 5CP6C 1ZLAA 4WZSB 5B31D 1F66A 5B2JA 4KHAB 4JJNB 5B40C 5B40B 1KX4B 1P3GC 3AYWD 5B1MD 2NQBB 4JJNA 2NZDC 1P3MC 5B40A 1P3MB 3RELA 1KX4A 3AV1C 5B33D 3AV1B 4WU8B 2NQBA 3AZED 1ID3A 4XZQC 4H9PB 4Z2MG 5B31C 4XZQB 1P3MA 3NQUB 5B31B 3MGSC 3REKC 4WU8A 2CV5C 3MGSB 5GSUD 1Q9CA 3AYWB 1P34C 4H9PA 5DNNC 5AVBA 3MGPD 4KUDD 3AZGA 1P34B 5DNNB 3NQUA 5B1MB 5B31A 1P3IC 1P3LD 3REHD 5B33B 3AYWA 4EO5B 2RVQD 4LD9C 5B1MA 1P3FC 3VH6A 4R8PC 3AZKD 3LZ0C 5B33A 4R8PB 3LZ0B 1TZYD 3AZEA 5GSUB 3X1SD 3C1BC 1BFMA 4KUDB 3MGRC 2JSSA 1HTAA 3B0CW 3A6ND 1N1JB 5BS7C 1P3LB 3KUYC 5GSUA 3WTPC 1BH9B 3LELC 1JFIB 3AZFD 2PYOD 5AY8C 3MGPA 3LELB 1AOID 4NFTA 4KUDA 5AY8B 3KXBC 3AZNC 1P3AD 1P3PC 3O62D 3AZNB 1P3LA 3REHA 3AZKB 1P3BC 1JFIA 1P3BB 1B6WA 3AZHC 3AZHB 5CPJD 3KWQD 4Z2MH 3A6NB 3AZKA 3X1UD 1M19C 3R45B 4CAYA 1TZYA 4WNNB 3AZFC 3W96D 3X1SA 4G91B 3AZFB 1AOIB 3LJAC 3A6NA 1S32C 5B1LD 5AV5C 4H9SC 5AV5B 3R45A 5B24D 4WNNA 4NE6A 3KSYA 3AZFA 2PYOA 1AOIA 3W98C 4G92C 1P3AA 1M1AC 1TAFB 3O62A 5CPJB 5AVCC 1M18C 3X1UB 3W96C 3MNND 3LZ1C 3W96B
chains in the Genus database with same CATH superfamily
5CPJA 3KWQA 3W99D 2HUEC 1EQZD 3X1UA 5B1LB 4QLCD 4X23D 2DQNC 4J8UD 1P3OC 4XUJD 3AZJC 1P3OB 3W96A 1HQ3D 2YFVA 5B32G 1ZLAC 3X1VD 1F66C 5B2JC 1F66B 5B2JB 5B1LA 1KX5D 5B24A 3WA9D 2W8SA 2BYMB 4ZBJB 4JJNC 3F6TA 2Y2HA 3NQJB 4DRBA 5BT1C 5B0ZD 1KX4C 3RELC 4H9OB 3W99B 3RELB 4Z5TD 4XUJC 4QLCB 5BNVA 4J8UB 3X1TD 1ID3C 2BYMA 2NQBC 4XUJB 3MNNA 1ID3B 5AV8D 2Y2OA 3NQJA 5CPKD 3X1VB 4H9OA 3W99A 1EQZA 4QLCA 4WU8C 4X23A 4J8UA 4XUJA 1KX5B 4E44A 5F99D 5AVBC 1HQ3A 2BYKB 3WA9B 3AZGC 3IP4C 3X1VA 5AVBB 3AZGB 1A7WA 3B6FD 3B0DB 1KX5A 3AYWC 2BYKA 3WA9A 4Z5TB 5B1MC 1T3UA 3AL0C 4YM6D 5BNXB 4H9NB 5AV8B 3C1CD 5CPKB 5B0ZA 5B0YD 1BH8B 5B33C 4EO5C 5GT3D 4Z5TA 3X1TA 3AZEC 1WWSA 1WWIA 5F99C 5BNXA 4H9NA 5AV8A 3AZEB 5F99B 5CPKA 3AZMD 4WU9D 1BH8A 4NE3A 2Y2LA 5B2ID 5GXQD 2JE5A 5DNMD 3B6FB 5B32D 3WKJD 5GSUC 2Y2PA 5F99A 3MGPC 3UT9D 4KUDC 4J8XD 3W97D 3MGPB 2ZY5A 4M6BA 3C1CB 2YFWB 1P3LC 4UPKA 5B0YB 3MVDD 3REHC 3B6FA 3VH6T 3REHB 3UTBD 2RVQC 4KGCD 4YM6A 3C1CA 2YFWA 3AZLD 5B0YA 5B2IC 4ZUXD 3AZKC 2IO5C 3AV2D 5B2IB 5GT3A 2IO5B 2Y2KA 5B32C 5CHLB 2F8NG 5DNMB 1TZYC 5B32B 3WKJB 5JRGD 4CAYB 3UT9C 1TZYB 3X1SC 4UUZB 3EPLA 3X1SB 3UT9B 3AZMA 4J8XB 4WU9A 2J8PA 5G49A 3A6NC 5B2IA 3B6GD 5GXQA 3MVDB 4AWLC 5DNMA 5B32A 3WKJA 4AWLB 4G91C 4UUZA 3UTBB 2PYOC 4KGCC 4H9QB 3UT9A 1AOIC 4J8WD 4J8XA 3EPJA 2PYOB 3W97A 4KGCB 1P3AC 3O62C 1P3AB 3AZLB 3O62B 3MVDA 3TU4D 1P3KD 2HIOD 3AZID 2BG1A 3UTBA 4H9QA 4KGCA 5JRGC 3EPHA 5JRGB 4J8VD 5KDMB 3AZLA 5AV6D 5CPJC 3KWQC 3REJD 1U35D 3MGQD 3KWQB 2F2AC 4ZUXA 3B6GC 1Z2CB 3X1UC 3AV2A 3B6GB 5AV9D 5GT0D 2ZY3A 5JRGA 5KDMA 4E45A 3AN2D 4J8WB 2YFVB 3AFAD 3H0RC 2UWXA 5B1LC 3B6GA 1P3KC 4Z66D 5B24C 1P3KB 4WV4B 1W2EA 3AZIB 3VH5T 5BO0A 5B24B 4J8WA 4J8VC 4J8VB 3REID 3UTAD 3REJC 5AV6B 4DQYB 3REJB 1H3OB 3H0MC 1KX3D 2AROD 3MGQB 3TU4A 1P3KA 3AZIA 5AV9C 5AV9B 3WAAD 5GT0B 4ZBJC 5BNVB 3MNNC 4J8VA 5CP6D 3AN2C 3MNNB 3B0BA 3B0CT 5AV6A 3AN2B 3W99C 3AFAB 1H3OA 3REJA 1U35A 3MGQA 2CWEA 1EQZC 2F8ND 1P3GD 1EQZB 5AV9A 4QLCC 4X23C 4J8UC 5GT0A 2G5IC 4X23B 1HQ3C 3AN2A 3X1VC 2ZM5A 1HQ3B 3AFAA 2NZDD 3REIC 1P3MD 3REIB 1R4VA 3V9RA 3AV1D 4Z66A 1KX3B 1KX5C 2AROB 1F1EA 5FUGB 3KFUG 3WAAC 3WA9C 3WAAB 4XZQD 5CP6B 3P5JB 3REIA 3UTAA 5C3IC 5B0ZC 4HGAC 5C3IB 3B0DC 5B0ZB 2AROA 4HGAB 3MGSD 5FUGA 3REKD 1KX3A 2F8NB 4NE5A 2CV5D 1P3GB 4Z5TC 2Y2GA 3WAAA 3X1TC 1P34D 5DNND 3X1TB 5AV8C 4KHAA 4CSRB 5CP6A 5CPKC 2NZDB 3A1KA 1P3ID 2JCHA 2F8NA 1P3GA 2VQRA 4CSRA 4LD9D 1P3FD 2L5AA 2NZDA 2XD5A 4R8PD 3AV1A 3LZ0D 3B6FC 1B67A 3REKB 1ULYA 2CV5B 3C1BD 4XZQA 4YM6C 5CPID 3C1CC 3MGRD 4YM6B 5B0YC 1P3IB 3MGSA 3REKA 2ZY2A 5GT3C 2CV5A 3KUYD 5GT3B 3WTPD 3LELD 1P34A 3VH5W 5DNNA 5AY8D 4LD9B 3KXBD 3AZMC 3AZND 4WU9C 1P3FB 1P3PD 3AZMB 4WU9B 2Y2QA 1P3IA 5G49B 5GXQC 5GXQB 5DNMC 1P3BD 3WKJC 5E5AD 4LD9A 4J8XC 1P3FA 3AZHD 5CPIC 3W97C 2FJ7D 3C1BB 1KU5A 5CPIB 3W97B 3MGRB 2FFFB 4R8PA 3MVDC 3LZ0A 1M19D 3UTBC 3KUYB 3WTPB 3C1BA 5CPIA 3MGRA 3AZLC 1N1JA 3KXBB 3LJAD 1P3PB 5B31G 1S32D 5AV5D 5BS7A 4ZUXC 3AV2C 4ZUXB 3WTPE 1BH9A 3AV2B 5E5AC 3KUYA 3WTPA 3LELA 5E5AB 5AY8A 5JA4B 3KXBA 2FJ7C 3W98D 3AZNA 1M1AD 1P3PA 2FJ7B 5AVCD 1M18D 1P3BA 2XD1A 5E5AA 4DRAA 1M19B 3EG5B 5JA4A 5BO0B 3LZ1D 4J8WC 3AZHA 2DF4C 2FJ7A 4YS3D 3LJAB 3TU4C 1S32B 2HIOC 3AZIC 3TU4B 2Y2MA 1P3OD 1M19A 2HIOB 3AZJD 4WJ3C 1ZLAD 1F66D 5B2JD 5AV6C 3W98B 1U35C 3LJAA 4G92B 4H9RB 1M1AB 3MGQC 1S32A 5AV5A 1U35B 2ZY4A 4H9SA 2HIOA 3VH5A 5GT0C 5AVCB 1M18B 2F8NK 1TAFA 4JJND 3LZ1B 2F8NH 3AFAC 1M1AA 4H9RA 4YS3C 3W98A 5BT1D 5B40D 1KX4D 3RELD 4YS3B 2HUEB 5AVCA 4Z66C 3V9RB 1M18A 3VH6W 4Z66B 2NQBD 1ID3D 3AZJB 3LZ1A 1ZLAB 3UTAC 4YS3A 3UTAB 1KX3C 2AROC 2RIQA 4WU8D 1P3OA 3AZJA 2LY8A 5AVBD 3AZGD 5CP6C 1ZLAA 4WZSB 5B31D 1F66A 5B2JA 4KHAB 4JJNB 5B40C 5B40B 3H0LC 1KX4B 1P3GC 3AYWD 5B1MD 2NQBB 4JJNA 2NZDC 1P3MC 5B40A 1P3MB 3RELA 1KX4A 3AV1C 5B33D 3AV1B 4WU8B 2NQBA 3AZED 1ID3A 4XZQC 4H9PB 4Z2MG 5B31C 2Y2NA 4XZQB 1P3MA 3NQUB 5B31B 3MGSC 3REKC 4WU8A 2CV5C 3MGSB 5GSUD 1Q9CA 3AYWB 1P34C 4H9PA 5DNNC 5AVBA 3MGPD 4KUDD 3AZGA 1P34B 5DNNB 3NQUA 5B1MB 5B31A 1P3IC 1P3LD 3REHD 5B33B 3AYWA 4EO5B 2RVQD 4LD9C 5B1MA 1P3FC 3A1IA 3VH6A 4R8PC 3AZKD 3LZ0C 2Y2JA 5B33A 4R8PB 3LZ0B 1TZYD 3AZEA 5GSUB 3X1SD 3C1BC 3EPKA 1BFMA 4KUDB 3MGRC 2JSSA 1HTAA 3B0CW 3A6ND 1N1JB 5BS7C 1P3LB 3KUYC 5GSUA 3WTPC 1BH9B 3LELC 1JFIB 3AZFD 2PYOD 5AY8C 3MGPA 2Y2IA 3LELB 4NFTA 1AOID 4KUDA 5AY8B 3KXBC 3AZNC 1P3AD 1P3PC 3O62D 3AZNB 1P3LA 3REHA 3AZKB 1P3BC 1JFIA 1P3BB 1B6WA 3AZHC 3AZHB 5CPJD 3FDDA 3KWQD 2G5HC 4Z2MH 3A6NB 3AZKA 3X1UD 1M19C 3R45B 4CAYA 1TZYA 4WNNB 3AZFC 3W96D 3X1SA 4G91B 3AZFB 1AOIB 3LJAC 3A6NA 1S32C 5B1LD 5AV5C 4H9SC 5AV5B 3R45A 5B24D 4WNNA 4NE6A 3KSYA 3AZFA 2PYOA 1AOIA 3W98C 4G92C 1P3AA 1M1AC 1TAFB 3O62A 5CPJB 1PZRA 5AVCC 1M18C 3X1UB 3W96C 3MNND 3LZ1C 3W96B
chains in the Genus database with same CATH topology
5CPJA 3KWQA 3W99D 2HUEC 1EQZD 3X1UA 5B1LB 4QLCD 4X23D 2DQNC 4J8UD 1P3OC 4XUJD 3AZJC 1P3OB 3W96A 1HQ3D 2YFVA 5B32G 1ZLAC 3X1VD 1F66C 5B2JC 1F66B 5B2JB 5B1LA 1KX5D 5B24A 3WA9D 2W8SA 2BYMB 4ZBJB 4JJNC 3F6TA 2Y2HA 3NQJB 4DRBA 5BT1C 5B0ZD 1KX4C 3RELC 4H9OB 3W99B 3RELB 4Z5TD 4XUJC 4QLCB 5BNVA 4J8UB 3X1TD 1ID3C 2BYMA 2NQBC 4XUJB 3MNNA 1ID3B 5AV8D 2Y2OA 3NQJA 5CPKD 3X1VB 4H9OA 3W99A 1EQZA 4QLCA 4WU8C 4X23A 4J8UA 4XUJA 1KX5B 4E44A 5F99D 5AVBC 1HQ3A 2BYKB 3WA9B 3AZGC 3IP4C 3X1VA 5AVBB 3AZGB 1A7WA 3B6FD 3B0DB 1KX5A 3AYWC 2BYKA 3WA9A 4Z5TB 5B1MC 1T3UA 3AL0C 4YM6D 5BNXB 4H9NB 5AV8B 3C1CD 5CPKB 5B0ZA 5B0YD 1BH8B 5B33C 4EO5C 5GT3D 4Z5TA 3X1TA 3AZEC 1WWSA 1WWIA 5F99C 5BNXA 4H9NA 5AV8A 3AZEB 5F99B 5CPKA 3AZMD 4WU9D 1BH8A 4NE3A 2Y2LA 5B2ID 5GXQD 2JE5A 5DNMD 3B6FB 5B32D 3WKJD 5GSUC 2Y2PA 5F99A 3MGPC 3UT9D 4KUDC 4J8XD 3W97D 3MGPB 2ZY5A 4M6BA 3C1CB 2YFWB 1P3LC 4UPKA 5B0YB 3MVDD 3REHC 3B6FA 3VH6T 3REHB 3UTBD 2RVQC 4KGCD 4YM6A 3C1CA 2YFWA 3AZLD 5B0YA 5B2IC 4ZUXD 3AZKC 2IO5C 3AV2D 5B2IB 5GT3A 2IO5B 2Y2KA 5B32C 5CHLB 2F8NG 5DNMB 1TZYC 5B32B 3WKJB 5JRGD 4CAYB 3UT9C 1TZYB 3X1SC 4UUZB 3EPLA 3X1SB 3UT9B 3AZMA 4J8XB 4WU9A 2J8PA 5G49A 3A6NC 5B2IA 3B6GD 5GXQA 3MVDB 4AWLC 5DNMA 5B32A 3WKJA 4AWLB 4G91C 4UUZA 3UTBB 2PYOC 4KGCC 4H9QB 3UT9A 1AOIC 4J8WD 4J8XA 3EPJA 2PYOB 3W97A 4KGCB 1P3AC 3O62C 1P3AB 3AZLB 3O62B 3MVDA 3TU4D 1P3KD 2HIOD 3AZID 2BG1A 3UTBA 4H9QA 4KGCA 5JRGC 3EPHA 5JRGB 4J8VD 5KDMB 3AZLA 5AV6D 5CPJC 3KWQC 3REJD 1U35D 3MGQD 3KWQB 2F2AC 4ZUXA 3B6GC 1Z2CB 3X1UC 3AV2A 3B6GB 5AV9D 5GT0D 2ZY3A 5JRGA 5KDMA 4E45A 3AN2D 4J8WB 2YFVB 3AFAD 3H0RC 2UWXA 5B1LC 3B6GA 1P3KC 4Z66D 5B24C 1P3KB 4WV4B 1W2EA 3AZIB 3VH5T 5BO0A 5B24B 4J8WA 4J8VC 4J8VB 3REID 3UTAD 3REJC 5AV6B 4DQYB 3REJB 1H3OB 3H0MC 1KX3D 2AROD 3MGQB 3TU4A 1P3KA 3AZIA 5AV9C 5AV9B 3WAAD 5GT0B 4ZBJC 5BNVB 3MNNC 4J8VA 5CP6D 3AN2C 3MNNB 3B0BA 3B0CT 5AV6A 3AN2B 3W99C 3AFAB 1H3OA 3REJA 1U35A 3MGQA 2CWEA 1EQZC 2F8ND 1P3GD 1EQZB 5AV9A 4QLCC 4X23C 4J8UC 5GT0A 2G5IC 4X23B 1HQ3C 3AN2A 3X1VC 2ZM5A 1HQ3B 3AFAA 2NZDD 3REIC 1P3MD 3REIB 1R4VA 3V9RA 3AV1D 4Z66A 1KX3B 1KX5C 2AROB 1F1EA 5FUGB 3KFUG 3WAAC 3WA9C 3WAAB 4XZQD 5CP6B 3P5JB 3REIA 3UTAA 5C3IC 5B0ZC 4HGAC 5C3IB 3B0DC 5B0ZB 2AROA 4HGAB 3MGSD 5FUGA 3REKD 1KX3A 2F8NB 4NE5A 2CV5D 1P3GB 4Z5TC 2Y2GA 3WAAA 3X1TC 1P34D 5DNND 3X1TB 5AV8C 4KHAA 4CSRB 5CP6A 5CPKC 2NZDB 3A1KA 1P3ID 2JCHA 2F8NA 1P3GA 2VQRA 4CSRA 4LD9D 1P3FD 2L5AA 2NZDA 2XD5A 4R8PD 3AV1A 3LZ0D 3B6FC 1B67A 3REKB 1ULYA 2CV5B 3C1BD 4XZQA 4YM6C 5CPID 3C1CC 3MGRD 4YM6B 5B0YC 1P3IB 3MGSA 3REKA 2ZY2A 5GT3C 2CV5A 3KUYD 5GT3B 3WTPD 3LELD 1P34A 3VH5W 5DNNA 5AY8D 4LD9B 3KXBD 3AZMC 3AZND 4WU9C 1P3FB 1P3PD 3AZMB 4WU9B 2Y2QA 1P3IA 5G49B 5GXQC 5GXQB 5DNMC 1P3BD 3WKJC 5E5AD 4LD9A 4J8XC 1P3FA 3AZHD 5CPIC 3W97C 2FJ7D 3C1BB 1KU5A 5CPIB 3W97B 3MGRB 2FFFB 4R8PA 3MVDC 3LZ0A 1M19D 3UTBC 3KUYB 3WTPB 3C1BA 5CPIA 3MGRA 3AZLC 1N1JA 3KXBB 3LJAD 1P3PB 5B31G 1S32D 5AV5D 5BS7A 4ZUXC 3AV2C 4ZUXB 3WTPE 1BH9A 3AV2B 5E5AC 3KUYA 3WTPA 3LELA 5E5AB 5AY8A 5JA4B 3KXBA 2FJ7C 3W98D 3AZNA 1M1AD 1P3PA 2FJ7B 5AVCD 1M18D 1P3BA 2XD1A 5E5AA 4DRAA 1M19B 3EG5B 5JA4A 5BO0B 3LZ1D 4J8WC 3AZHA 2DF4C 2FJ7A 4YS3D 3LJAB 3TU4C 1S32B 2HIOC 3AZIC 3TU4B 2Y2MA 1P3OD 1M19A 2HIOB 3AZJD 4WJ3C 1ZLAD 1F66D 5B2JD 5AV6C 3W98B 1U35C 3LJAA 4G92B 4H9RB 1M1AB 3MGQC 1S32A 5AV5A 1U35B 2ZY4A 4H9SA 2HIOA 3VH5A 5GT0C 5AVCB 1M18B 2F8NK 1TAFA 4JJND 3LZ1B 2F8NH 3AFAC 1M1AA 4H9RA 4YS3C 3W98A 5BT1D 5B40D 1KX4D 3RELD 4YS3B 2HUEB 5AVCA 4Z66C 3V9RB 1M18A 3VH6W 4Z66B 2NQBD 1ID3D 3AZJB 3LZ1A 1ZLAB 3UTAC 4YS3A 3UTAB 1KX3C 2AROC 2RIQA 4WU8D 1P3OA 3AZJA 2LY8A 5AVBD 3AZGD 5CP6C 1ZLAA 4WZSB 5B31D 1F66A 5B2JA 4KHAB 4JJNB 5B40C 5B40B 3H0LC 1KX4B 1P3GC 3AYWD 5B1MD 2NQBB 4JJNA 2NZDC 1P3MC 5B40A 1P3MB 3RELA 1KX4A 3AV1C 5B33D 3AV1B 4WU8B 2NQBA 3AZED 1ID3A 4XZQC 4H9PB 4Z2MG 5B31C 2Y2NA 4XZQB 1P3MA 3NQUB 5B31B 3MGSC 3REKC 4WU8A 2CV5C 3MGSB 5GSUD 1Q9CA 3AYWB 1P34C 4H9PA 5DNNC 5AVBA 3MGPD 4KUDD 3AZGA 1P34B 5DNNB 3NQUA 5B1MB 5B31A 1P3IC 1P3LD 3REHD 5B33B 3AYWA 4EO5B 2RVQD 4LD9C 5B1MA 1P3FC 3A1IA 3VH6A 4R8PC 3AZKD 3LZ0C 2Y2JA 5B33A 4R8PB 3LZ0B 1TZYD 3AZEA 5GSUB 3X1SD 3C1BC 3EPKA 1BFMA 4KUDB 3MGRC 2JSSA 1HTAA 3B0CW 3A6ND 1N1JB 5BS7C 1P3LB 3KUYC 5GSUA 3WTPC 1BH9B 3LELC 1JFIB 3AZFD 2PYOD 5AY8C 3MGPA 2Y2IA 3LELB 4NFTA 1AOID 4KUDA 5AY8B 3KXBC 3AZNC 1P3AD 1P3PC 3O62D 3AZNB 1P3LA 3REHA 3AZKB 1P3BC 1JFIA 1P3BB 1B6WA 3AZHC 3AZHB 5CPJD 3FDDA 3KWQD 2G5HC 4Z2MH 3A6NB 3AZKA 3X1UD 1M19C 3R45B 4CAYA 1TZYA 4WNNB 3AZFC 3W96D 3X1SA 4G91B 3AZFB 1AOIB 3LJAC 3A6NA 1S32C 5B1LD 5AV5C 4H9SC 5AV5B 3R45A 5B24D 4WNNA 4NE6A 3KSYA 3AZFA 2PYOA 1AOIA 3W98C 4G92C 1P3AA 1M1AC 1TAFB 3O62A 5CPJB 1PZRA 5AVCC 1M18C 3X1UB 3W96C 3MNND 3LZ1C 3W96B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ A;  3KWQ A;  3W99 D;  2HUE C;  1EQZ D;  3X1U A;  5B1L B;  4QLC D;  4X23 D;  4J8U D;  1P3O C;  4XUJ D;  3AZJ C;  1P3O B;  3W96 A;  1HQ3 D;  2YFV A;  5B32 G;  1ZLA C;  3X1V D;  1F66 C;  5B2J C;  1F66 B;  5B2J B;  5B1L A;  1KX5 D;  5B24 A;  3WA9 D;  2BYM B;  4ZBJ B;  4JJN C;  3NQJ B;  4DRB A;  5BT1 C;  5B0Z D;  1KX4 C;  3REL C;  4H9O B;  3W99 B;  3REL B;  4Z5T D;  4XUJ C;  4QLC B;  5BNV A;  4J8U B;  3X1T D;  1ID3 C;  2BYM A;  2NQB C;  4XUJ B;  3MNN A;  1ID3 B;  5AV8 D;  5CPK D;  3NQJ A;  3X1V B;  4H9O A;  3W99 A;  1EQZ A;  4QLC A;  4WU8 C;  4X23 A;  4J8U A;  4XUJ A;  1KX5 B;  4E44 A;  5F99 D;  5AVB C;  1HQ3 A;  2BYK B;  3WA9 B;  3AZG C;  3X1V A;  5AVB B;  3AZG B;  1A7W A;  3B6F D;  3B0D B;  1KX5 A;  3AYW C;  2BYK A;  3WA9 A;  4Z5T B;  5B1M C;  4YM6 D;  5BNX B;  4H9N B;  5AV8 B;  3C1C D;  5CPK B;  5B0Z A;  5B0Y D;  1BH8 B;  5B33 C;  4EO5 C;  5GT3 D;  4Z5T A;  3X1T A;  3AZE C;  1WWS A;  1WWI A;  5F99 C;  5BNX A;  4H9N A;  5AV8 A;  3AZE B;  5F99 B;  5CPK A;  3AZM D;  4WU9 D;  1BH8 A;  4NE3 A;  5B2I D;  5GXQ D;  5DNM D;  3B6F B;  5B32 D;  3WKJ D;  5GSU C;  5F99 A;  3MGP C;  3UT9 D;  4KUD C;  4J8X D;  3W97 D;  3MGP B;  4M6B A;  3C1C B;  2YFW B;  1P3L C;  5B0Y B;  3MVD D;  3REH C;  3B6F A;  3VH6 T;  3REH B;  3UTB D;  2RVQ C;  4KGC D;  4YM6 A;  3C1C A;  2YFW A;  3AZL D;  5B0Y A;  5B2I C;  4ZUX D;  3AZK C;  2IO5 C;  3AV2 D;  5B2I B;  5GT3 A;  2IO5 B;  5B32 C;  5CHL B;  2F8N G;  5DNM B;  1TZY C;  5B32 B;  3WKJ B;  5JRG D;  4CAY B;  3UT9 C;  1TZY B;  3X1S C;  4UUZ B;  3X1S B;  3UT9 B;  3AZM A;  4J8X B;  4WU9 A;  5G49 A;  3A6N C;  5B2I A;  3B6G D;  5GXQ A;  3MVD B;  4AWL C;  5DNM A;  5B32 A;  3WKJ A;  4AWL B;  4G91 C;  4UUZ A;  3UTB B;  2PYO C;  4KGC C;  4H9Q B;  3UT9 A;  1AOI C;  4J8W D;  4J8X A;  4KGC B;  2PYO B;  3W97 A;  1P3A C;  3O62 C;  1P3A B;  3AZL B;  3O62 B;  3MVD A;  3TU4 D;  1P3K D;  2HIO D;  3AZI D;  3UTB A;  4H9Q A;  4KGC A;  5JRG C;  5JRG B;  4J8V D;  5KDM B;  3AZL A;  5AV6 D;  5CPJ C;  3KWQ C;  3REJ D;  1U35 D;  3MGQ D;  3KWQ B;  4ZUX A;  3B6G C;  3X1U C;  3AV2 A;  3B6G B;  5AV9 D;  5GT0 D;  5JRG A;  5KDM A;  4E45 A;  3AN2 D;  4J8W B;  2YFV B;  3AFA D;  5B1L C;  3B6G A;  1P3K C;  4Z66 D;  5B24 C;  1P3K B;  4WV4 B;  3AZI B;  3VH5 T;  5BO0 A;  5B24 B;  4J8W A;  4J8V C;  4J8V B;  3REI D;  3UTA D;  3REJ C;  5AV6 B;  3REJ B;  1H3O B;  1KX3 D;  2ARO D;  3MGQ B;  3TU4 A;  1P3K A;  3AZI A;  5AV9 C;  5AV9 B;  3WAA D;  5GT0 B;  4ZBJ C;  5BNV B;  3MNN C;  4J8V A;  5CP6 D;  3AN2 C;  3MNN B;  3B0B A;  3B0C T;  5AV6 A;  3AN2 B;  3W99 C;  3AFA B;  1H3O A;  3REJ A;  1U35 A;  3MGQ A;  2CWE A;  1EQZ C;  2F8N D;  1P3G D;  1EQZ B;  5AV9 A;  4QLC C;  4X23 C;  4J8U C;  5GT0 A;  4X23 B;  1HQ3 C;  3AN2 A;  3X1V C;  1HQ3 B;  3AFA A;  2NZD D;  3REI C;  1P3M D;  3REI B;  1R4V A;  3V9R A;  3AV1 D;  4Z66 A;  1KX3 B;  1KX5 C;  2ARO B;  1F1E A;  5FUG B;  3WAA C;  3WA9 C;  3WAA B;  4XZQ D;  5CP6 B;  3REI A;  3UTA A;  5C3I C;  5B0Z C;  4HGA C;  5C3I B;  3B0D C;  5B0Z B;  2ARO A;  4HGA B;  3MGS D;  5FUG A;  3REK D;  1KX3 A;  2F8N B;  4NE5 A;  2CV5 D;  1P3G B;  4Z5T C;  3WAA A;  3X1T C;  1P34 D;  5DNN D;  3X1T B;  5AV8 C;  4KHA A;  4CSR B;  5CP6 A;  5CPK C;  2NZD B;  1P3I D;  2F8N A;  1P3G A;  4CSR A;  4LD9 D;  1P3F D;  2L5A A;  2NZD A;  4R8P D;  3AV1 A;  3LZ0 D;  3B6F C;  1B67 A;  3REK B;  1ULY A;  2CV5 B;  3C1B D;  4XZQ A;  4YM6 C;  5CPI D;  3C1C C;  3MGR D;  4YM6 B;  5B0Y C;  1P3I B;  3MGS A;  3REK A;  5GT3 C;  2CV5 A;  3KUY D;  5GT3 B;  3WTP D;  3LEL D;  1P34 A;  3VH5 W;  5DNN A;  5AY8 D;  4LD9 B;  3KXB D;  3AZM C;  3AZN D;  4WU9 C;  1P3F B;  1P3P D;  3AZM B;  4WU9 B;  1P3I A;  5G49 B;  5GXQ C;  5GXQ B;  5DNM C;  1P3B D;  3WKJ C;  5E5A D;  4LD9 A;  4J8X C;  1P3F A;  3AZH D;  5CPI C;  3W97 C;  2FJ7 D;  3C1B B;  1KU5 A;  5CPI B;  3W97 B;  3MGR B;  4R8P A;  3MVD C;  3LZ0 A;  1M19 D;  3UTB C;  3KUY B;  3WTP B;  3C1B A;  5CPI A;  3MGR A;  3AZL C;  1N1J A;  3KXB B;  3LJA D;  1P3P B;  5B31 G;  1S32 D;  5AV5 D;  5BS7 A;  4ZUX C;  3AV2 C;  4ZUX B;  3WTP E;  1BH9 A;  3AV2 B;  5E5A C;  3KUY A;  3WTP A;  3LEL A;  5E5A B;  5AY8 A;  5JA4 B;  3KXB A;  2FJ7 C;  3W98 D;  3AZN A;  1M1A D;  1P3P A;  2FJ7 B;  5AVC D;  1M18 D;  1P3B A;  5E5A A;  4DRA A;  1M19 B;  5JA4 A;  5BO0 B;  3LZ1 D;  4J8W C;  3AZH A;  2FJ7 A;  4YS3 D;  3LJA B;  3TU4 C;  1S32 B;  2HIO C;  3AZI C;  3TU4 B;  1M19 A;  1P3O D;  2HIO B;  3AZJ D;  1ZLA D;  1F66 D;  5B2J D;  5AV6 C;  3W98 B;  1U35 C;  3LJA A;  4G92 B;  4H9R B;  1M1A B;  3MGQ C;  1S32 A;  5AV5 A;  1U35 B;  4H9S A;  2HIO A;  3VH5 A;  5GT0 C;  5AVC B;  1M18 B;  2F8N K;  1TAF A;  4JJN D;  3LZ1 B;  2F8N H;  3AFA C;  1M1A A;  4H9R A;  4YS3 C;  3W98 A;  5BT1 D;  5B40 D;  1KX4 D;  3REL D;  4YS3 B;  2HUE B;  5AVC A;  4Z66 C;  3V9R B;  1M18 A;  3VH6 W;  4Z66 B;  2NQB D;  1ID3 D;  3AZJ B;  3LZ1 A;  1ZLA B;  3UTA C;  4YS3 A;  3UTA B;  1KX3 C;  2ARO C;  4WU8 D;  1P3O A;  3AZJ A;  2LY8 A;  5AVB D;  3AZG D;  5CP6 C;  1ZLA A;  4WZS B;  5B31 D;  1F66 A;  5B2J A;  4KHA B;  4JJN B;  5B40 C;  5B40 B;  1KX4 B;  1P3G C;  3AYW D;  5B1M D;  2NQB B;  4JJN A;  2NZD C;  1P3M C;  5B40 A;  1P3M B;  3REL A;  1KX4 A;  3AV1 C;  5B33 D;  3AV1 B;  4WU8 B;  2NQB A;  3AZE D;  1ID3 A;  4XZQ C;  4H9P B;  4Z2M G;  5B31 C;  4XZQ B;  1P3M A;  3NQU B;  5B31 B;  3MGS C;  3REK C;  4WU8 A;  2CV5 C;  3MGS B;  5GSU D;  1Q9C A;  3AYW B;  1P34 C;  4H9P A;  5DNN C;  5AVB A;  3MGP D;  4KUD D;  3AZG A;  1P34 B;  5DNN B;  3NQU A;  5B1M B;  5B31 A;  1P3I C;  1P3L D;  3REH D;  5B33 B;  3AYW A;  4EO5 B;  2RVQ D;  4LD9 C;  5B1M A;  1P3F C;  3VH6 A;  4R8P C;  3AZK D;  3LZ0 C;  5B33 A;  4R8P B;  3LZ0 B;  1TZY D;  3AZE A;  5GSU B;  3X1S D;  3C1B C;  1BFM A;  4KUD B;  3MGR C;  2JSS A;  1HTA A;  3B0C W;  3A6N D;  1N1J B;  5BS7 C;  1P3L B;  3KUY C;  5GSU A;  3WTP C;  1BH9 B;  3LEL C;  1JFI B;  3AZF D;  2PYO D;  5AY8 C;  3MGP A;  3LEL B;  1AOI D;  4NFT A;  4KUD A;  5AY8 B;  3KXB C;  3AZN C;  1P3A D;  1P3P C;  3O62 D;  3AZN B;  1P3L A;  3REH A;  3AZK B;  1P3B C;  1JFI A;  1P3B B;  1B6W A;  3AZH C;  3AZH B;  5CPJ D;  3KWQ D;  4Z2M H;  3A6N B;  3AZK A;  3X1U D;  1M19 C;  3R45 B;  4CAY A;  1TZY A;  4WNN B;  3AZF C;  3W96 D;  3X1S A;  4G91 B;  3AZF B;  1AOI B;  3LJA C;  3A6N A;  1S32 C;  5B1L D;  5AV5 C;  4H9S C;  5AV5 B;  3R45 A;  5B24 D;  4WNN A;  4NE6 A;  3KSY A;  3AZF A;  2PYO A;  1AOI A;  3W98 C;  4G92 C;  1P3A A;  1M1A C;  1TAF B;  3O62 A;  5CPJ B;  5AVC C;  1M18 C;  3X1U B;  3W96 C;  3MNN D;  3LZ1 C;  3W96 B; 
#chains in the Genus database with same CATH topology
 5CPJ A;  3KWQ A;  3W99 D;  2HUE C;  1EQZ D;  3X1U A;  5B1L B;  4QLC D;  4X23 D;  2DQN C;  4J8U D;  1P3O C;  4XUJ D;  3AZJ C;  1P3O B;  3W96 A;  1HQ3 D;  2YFV A;  5B32 G;  1ZLA C;  3X1V D;  1F66 C;  5B2J C;  1F66 B;  5B2J B;  5B1L A;  1KX5 D;  5B24 A;  3WA9 D;  2W8S A;  2BYM B;  4ZBJ B;  4JJN C;  3F6T A;  2Y2H A;  3NQJ B;  4DRB A;  5BT1 C;  5B0Z D;  1KX4 C;  3REL C;  4H9O B;  3W99 B;  3REL B;  4Z5T D;  4XUJ C;  4QLC B;  5BNV A;  4J8U B;  3X1T D;  1ID3 C;  2BYM A;  2NQB C;  4XUJ B;  3MNN A;  1ID3 B;  5AV8 D;  2Y2O A;  3NQJ A;  5CPK D;  3X1V B;  4H9O A;  3W99 A;  1EQZ A;  4QLC A;  4WU8 C;  4X23 A;  4J8U A;  4XUJ A;  1KX5 B;  4E44 A;  5F99 D;  5AVB C;  1HQ3 A;  2BYK B;  3WA9 B;  3AZG C;  3IP4 C;  3X1V A;  5AVB B;  3AZG B;  1A7W A;  3B6F D;  3B0D B;  1KX5 A;  3AYW C;  2BYK A;  3WA9 A;  4Z5T B;  5B1M C;  1T3U A;  3AL0 C;  4YM6 D;  5BNX B;  4H9N B;  5AV8 B;  3C1C D;  5CPK B;  5B0Z A;  5B0Y D;  1BH8 B;  5B33 C;  4EO5 C;  5GT3 D;  4Z5T A;  3X1T A;  3AZE C;  1WWS A;  1WWI A;  5F99 C;  5BNX A;  4H9N A;  5AV8 A;  3AZE B;  5F99 B;  5CPK A;  3AZM D;  4WU9 D;  1BH8 A;  4NE3 A;  2Y2L A;  5B2I D;  5GXQ D;  2JE5 A;  5DNM D;  3B6F B;  5B32 D;  3WKJ D;  5GSU C;  2Y2P A;  5F99 A;  3MGP C;  3UT9 D;  4KUD C;  4J8X D;  3W97 D;  3MGP B;  2ZY5 A;  4M6B A;  3C1C B;  2YFW B;  1P3L C;  4UPK A;  5B0Y B;  3MVD D;  3REH C;  3B6F A;  3VH6 T;  3REH B;  3UTB D;  2RVQ C;  4KGC D;  4YM6 A;  3C1C A;  2YFW A;  3AZL D;  5B0Y A;  5B2I C;  4ZUX D;  3AZK C;  2IO5 C;  3AV2 D;  5B2I B;  5GT3 A;  2IO5 B;  2Y2K A;  5B32 C;  5CHL B;  2F8N G;  5DNM B;  1TZY C;  5B32 B;  3WKJ B;  5JRG D;  4CAY B;  3UT9 C;  1TZY B;  3X1S C;  4UUZ B;  3EPL A;  3X1S B;  3UT9 B;  3AZM A;  4J8X B;  4WU9 A;  2J8P A;  5G49 A;  3A6N C;  5B2I A;  3B6G D;  5GXQ A;  3MVD B;  4AWL C;  5DNM A;  5B32 A;  3WKJ A;  4AWL B;  4G91 C;  4UUZ A;  3UTB B;  2PYO C;  4KGC C;  4H9Q B;  3UT9 A;  1AOI C;  4J8W D;  4J8X A;  3EPJ A;  2PYO B;  3W97 A;  4KGC B;  1P3A C;  3O62 C;  1P3A B;  3AZL B;  3O62 B;  3MVD A;  3TU4 D;  1P3K D;  2HIO D;  3AZI D;  2BG1 A;  3UTB A;  4H9Q A;  4KGC A;  5JRG C;  3EPH A;  5JRG B;  4J8V D;  5KDM B;  3AZL A;  5AV6 D;  5CPJ C;  3KWQ C;  3REJ D;  1U35 D;  3MGQ D;  3KWQ B;  2F2A C;  4ZUX A;  3B6G C;  1Z2C B;  3X1U C;  3AV2 A;  3B6G B;  5AV9 D;  5GT0 D;  2ZY3 A;  5JRG A;  5KDM A;  4E45 A;  3AN2 D;  4J8W B;  2YFV B;  3AFA D;  3H0R C;  2UWX A;  5B1L C;  3B6G A;  1P3K C;  4Z66 D;  5B24 C;  1P3K B;  4WV4 B;  1W2E A;  3AZI B;  3VH5 T;  5BO0 A;  5B24 B;  4J8W A;  4J8V C;  4J8V B;  3REI D;  3UTA D;  3REJ C;  5AV6 B;  4DQY B;  3REJ B;  1H3O B;  3H0M C;  1KX3 D;  2ARO D;  3MGQ B;  3TU4 A;  1P3K A;  3AZI A;  5AV9 C;  5AV9 B;  3WAA D;  5GT0 B;  4ZBJ C;  5BNV B;  3MNN C;  4J8V A;  5CP6 D;  3AN2 C;  3MNN B;  3B0B A;  3B0C T;  5AV6 A;  3AN2 B;  3W99 C;  3AFA B;  1H3O A;  3REJ A;  1U35 A;  3MGQ A;  2CWE A;  1EQZ C;  2F8N D;  1P3G D;  1EQZ B;  5AV9 A;  4QLC C;  4X23 C;  4J8U C;  5GT0 A;  2G5I C;  4X23 B;  1HQ3 C;  3AN2 A;  3X1V C;  2ZM5 A;  1HQ3 B;  3AFA A;  2NZD D;  3REI C;  1P3M D;  3REI B;  1R4V A;  3V9R A;  3AV1 D;  4Z66 A;  1KX3 B;  1KX5 C;  2ARO B;  1F1E A;  5FUG B;  3KFU G;  3WAA C;  3WA9 C;  3WAA B;  4XZQ D;  5CP6 B;  3P5J B;  3REI A;  3UTA A;  5C3I C;  5B0Z C;  4HGA C;  5C3I B;  3B0D C;  5B0Z B;  2ARO A;  4HGA B;  3MGS D;  5FUG A;  3REK D;  1KX3 A;  2F8N B;  4NE5 A;  2CV5 D;  1P3G B;  4Z5T C;  2Y2G A;  3WAA A;  3X1T C;  1P34 D;  5DNN D;  3X1T B;  5AV8 C;  4KHA A;  4CSR B;  5CP6 A;  5CPK C;  2NZD B;  3A1K A;  1P3I D;  2JCH A;  2F8N A;  1P3G A;  2VQR A;  4CSR A;  4LD9 D;  1P3F D;  2L5A A;  2NZD A;  2XD5 A;  4R8P D;  3AV1 A;  3LZ0 D;  3B6F C;  1B67 A;  3REK B;  1ULY A;  2CV5 B;  3C1B D;  4XZQ A;  4YM6 C;  5CPI D;  3C1C C;  3MGR D;  4YM6 B;  5B0Y C;  1P3I B;  3MGS A;  3REK A;  2ZY2 A;  5GT3 C;  2CV5 A;  3KUY D;  5GT3 B;  3WTP D;  3LEL D;  1P34 A;  3VH5 W;  5DNN A;  5AY8 D;  4LD9 B;  3KXB D;  3AZM C;  3AZN D;  4WU9 C;  1P3F B;  1P3P D;  3AZM B;  4WU9 B;  2Y2Q A;  1P3I A;  5G49 B;  5GXQ C;  5GXQ B;  5DNM C;  1P3B D;  3WKJ C;  5E5A D;  4LD9 A;  4J8X C;  1P3F A;  3AZH D;  5CPI C;  3W97 C;  2FJ7 D;  3C1B B;  1KU5 A;  5CPI B;  3W97 B;  3MGR B;  2FFF B;  4R8P A;  3MVD C;  3LZ0 A;  1M19 D;  3UTB C;  3KUY B;  3WTP B;  3C1B A;  5CPI A;  3MGR A;  3AZL C;  1N1J A;  3KXB B;  3LJA D;  1P3P B;  5B31 G;  1S32 D;  5AV5 D;  5BS7 A;  4ZUX C;  3AV2 C;  4ZUX B;  3WTP E;  1BH9 A;  3AV2 B;  5E5A C;  3KUY A;  3WTP A;  3LEL A;  5E5A B;  5AY8 A;  5JA4 B;  3KXB A;  2FJ7 C;  3W98 D;  3AZN A;  1M1A D;  1P3P A;  2FJ7 B;  5AVC D;  1M18 D;  1P3B A;  2XD1 A;  5E5A A;  4DRA A;  1M19 B;  3EG5 B;  5JA4 A;  5BO0 B;  3LZ1 D;  4J8W C;  3AZH A;  2DF4 C;  2FJ7 A;  4YS3 D;  3LJA B;  3TU4 C;  1S32 B;  2HIO C;  3AZI C;  3TU4 B;  2Y2M A;  1P3O D;  1M19 A;  2HIO B;  3AZJ D;  4WJ3 C;  1ZLA D;  1F66 D;  5B2J D;  5AV6 C;  3W98 B;  1U35 C;  3LJA A;  4G92 B;  4H9R B;  1M1A B;  3MGQ C;  1S32 A;  5AV5 A;  1U35 B;  2ZY4 A;  4H9S A;  2HIO A;  3VH5 A;  5GT0 C;  5AVC B;  1M18 B;  2F8N K;  1TAF A;  4JJN D;  3LZ1 B;  2F8N H;  3AFA C;  1M1A A;  4H9R A;  4YS3 C;  3W98 A;  5BT1 D;  5B40 D;  1KX4 D;  3REL D;  4YS3 B;  2HUE B;  5AVC A;  4Z66 C;  3V9R B;  1M18 A;  3VH6 W;  4Z66 B;  2NQB D;  1ID3 D;  3AZJ B;  3LZ1 A;  1ZLA B;  3UTA C;  4YS3 A;  3UTA B;  1KX3 C;  2ARO C;  2RIQ A;  4WU8 D;  1P3O A;  3AZJ A;  2LY8 A;  5AVB D;  3AZG D;  5CP6 C;  1ZLA A;  4WZS B;  5B31 D;  1F66 A;  5B2J A;  4KHA B;  4JJN B;  5B40 C;  5B40 B;  3H0L C;  1KX4 B;  1P3G C;  3AYW D;  5B1M D;  2NQB B;  4JJN A;  2NZD C;  1P3M C;  5B40 A;  1P3M B;  3REL A;  1KX4 A;  3AV1 C;  5B33 D;  3AV1 B;  4WU8 B;  2NQB A;  3AZE D;  1ID3 A;  4XZQ C;  4H9P B;  4Z2M G;  5B31 C;  2Y2N A;  4XZQ B;  1P3M A;  3NQU B;  5B31 B;  3MGS C;  3REK C;  4WU8 A;  2CV5 C;  3MGS B;  5GSU D;  1Q9C A;  3AYW B;  1P34 C;  4H9P A;  5DNN C;  5AVB A;  3MGP D;  4KUD D;  3AZG A;  1P34 B;  5DNN B;  3NQU A;  5B1M B;  5B31 A;  1P3I C;  1P3L D;  3REH D;  5B33 B;  3AYW A;  4EO5 B;  2RVQ D;  4LD9 C;  5B1M A;  1P3F C;  3A1I A;  3VH6 A;  4R8P C;  3AZK D;  3LZ0 C;  2Y2J A;  5B33 A;  4R8P B;  3LZ0 B;  1TZY D;  3AZE A;  5GSU B;  3X1S D;  3C1B C;  3EPK A;  1BFM A;  4KUD B;  3MGR C;  2JSS A;  1HTA A;  3B0C W;  3A6N D;  1N1J B;  5BS7 C;  1P3L B;  3KUY C;  5GSU A;  3WTP C;  1BH9 B;  3LEL C;  1JFI B;  3AZF D;  2PYO D;  5AY8 C;  3MGP A;  2Y2I A;  3LEL B;  4NFT A;  1AOI D;  4KUD A;  5AY8 B;  3KXB C;  3AZN C;  1P3A D;  1P3P C;  3O62 D;  3AZN B;  1P3L A;  3REH A;  3AZK B;  1P3B C;  1JFI A;  1P3B B;  1B6W A;  3AZH C;  3AZH B;  5CPJ D;  3FDD A;  3KWQ D;  2G5H C;  4Z2M H;  3A6N B;  3AZK A;  3X1U D;  1M19 C;  3R45 B;  4CAY A;  1TZY A;  4WNN B;  3AZF C;  3W96 D;  3X1S A;  4G91 B;  3AZF B;  1AOI B;  3LJA C;  3A6N A;  1S32 C;  5B1L D;  5AV5 C;  4H9S C;  5AV5 B;  3R45 A;  5B24 D;  4WNN A;  4NE6 A;  3KSY A;  3AZF A;  2PYO A;  1AOI A;  3W98 C;  4G92 C;  1P3A A;  1M1A C;  1TAF B;  3O62 A;  5CPJ B;  1PZR A;  5AVC C;  1M18 C;  3X1U B;  3W96 C;  3MNN D;  3LZ1 C;  3W96 B; 
#chains in the Genus database with same CATH homology
 5CPJ A;  3KWQ A;  3W99 D;  2HUE C;  1EQZ D;  3X1U A;  5B1L B;  4QLC D;  4X23 D;  2DQN C;  4J8U D;  1P3O C;  4XUJ D;  3AZJ C;  1P3O B;  3W96 A;  1HQ3 D;  2YFV A;  5B32 G;  1ZLA C;  3X1V D;  1F66 C;  5B2J C;  1F66 B;  5B2J B;  5B1L A;  1KX5 D;  5B24 A;  3WA9 D;  2W8S A;  2BYM B;  4ZBJ B;  4JJN C;  3F6T A;  2Y2H A;  3NQJ B;  4DRB A;  5BT1 C;  5B0Z D;  1KX4 C;  3REL C;  4H9O B;  3W99 B;  3REL B;  4Z5T D;  4XUJ C;  4QLC B;  5BNV A;  4J8U B;  3X1T D;  1ID3 C;  2BYM A;  2NQB C;  4XUJ B;  3MNN A;  1ID3 B;  5AV8 D;  2Y2O A;  3NQJ A;  5CPK D;  3X1V B;  4H9O A;  3W99 A;  1EQZ A;  4QLC A;  4WU8 C;  4X23 A;  4J8U A;  4XUJ A;  1KX5 B;  4E44 A;  5F99 D;  5AVB C;  1HQ3 A;  2BYK B;  3WA9 B;  3AZG C;  3IP4 C;  3X1V A;  5AVB B;  3AZG B;  1A7W A;  3B6F D;  3B0D B;  1KX5 A;  3AYW C;  2BYK A;  3WA9 A;  4Z5T B;  5B1M C;  1T3U A;  3AL0 C;  4YM6 D;  5BNX B;  4H9N B;  5AV8 B;  3C1C D;  5CPK B;  5B0Z A;  5B0Y D;  1BH8 B;  5B33 C;  4EO5 C;  5GT3 D;  4Z5T A;  3X1T A;  3AZE C;  1WWS A;  1WWI A;  5F99 C;  5BNX A;  4H9N A;  5AV8 A;  3AZE B;  5F99 B;  5CPK A;  3AZM D;  4WU9 D;  1BH8 A;  4NE3 A;  2Y2L A;  5B2I D;  5GXQ D;  2JE5 A;  5DNM D;  3B6F B;  5B32 D;  3WKJ D;  5GSU C;  2Y2P A;  5F99 A;  3MGP C;  3UT9 D;  4KUD C;  4J8X D;  3W97 D;  3MGP B;  2ZY5 A;  4M6B A;  3C1C B;  2YFW B;  1P3L C;  4UPK A;  5B0Y B;  3MVD D;  3REH C;  3B6F A;  3VH6 T;  3REH B;  3UTB D;  2RVQ C;  4KGC D;  4YM6 A;  3C1C A;  2YFW A;  3AZL D;  5B0Y A;  5B2I C;  4ZUX D;  3AZK C;  2IO5 C;  3AV2 D;  5B2I B;  5GT3 A;  2IO5 B;  2Y2K A;  5B32 C;  5CHL B;  2F8N G;  5DNM B;  1TZY C;  5B32 B;  3WKJ B;  5JRG D;  4CAY B;  3UT9 C;  1TZY B;  3X1S C;  4UUZ B;  3EPL A;  3X1S B;  3UT9 B;  3AZM A;  4J8X B;  4WU9 A;  2J8P A;  5G49 A;  3A6N C;  5B2I A;  3B6G D;  5GXQ A;  3MVD B;  4AWL C;  5DNM A;  5B32 A;  3WKJ A;  4AWL B;  4G91 C;  4UUZ A;  3UTB B;  2PYO C;  4KGC C;  4H9Q B;  3UT9 A;  1AOI C;  4J8W D;  4J8X A;  3EPJ A;  2PYO B;  3W97 A;  4KGC B;  1P3A C;  3O62 C;  1P3A B;  3AZL B;  3O62 B;  3MVD A;  3TU4 D;  1P3K D;  2HIO D;  3AZI D;  2BG1 A;  3UTB A;  4H9Q A;  4KGC A;  5JRG C;  3EPH A;  5JRG B;  4J8V D;  5KDM B;  3AZL A;  5AV6 D;  5CPJ C;  3KWQ C;  3REJ D;  1U35 D;  3MGQ D;  3KWQ B;  2F2A C;  4ZUX A;  3B6G C;  1Z2C B;  3X1U C;  3AV2 A;  3B6G B;  5AV9 D;  5GT0 D;  2ZY3 A;  5JRG A;  5KDM A;  4E45 A;  3AN2 D;  4J8W B;  2YFV B;  3AFA D;  3H0R C;  2UWX A;  5B1L C;  3B6G A;  1P3K C;  4Z66 D;  5B24 C;  1P3K B;  4WV4 B;  1W2E A;  3AZI B;  3VH5 T;  5BO0 A;  5B24 B;  4J8W A;  4J8V C;  4J8V B;  3REI D;  3UTA D;  3REJ C;  5AV6 B;  4DQY B;  3REJ B;  1H3O B;  3H0M C;  1KX3 D;  2ARO D;  3MGQ B;  3TU4 A;  1P3K A;  3AZI A;  5AV9 C;  5AV9 B;  3WAA D;  5GT0 B;  4ZBJ C;  5BNV B;  3MNN C;  4J8V A;  5CP6 D;  3AN2 C;  3MNN B;  3B0B A;  3B0C T;  5AV6 A;  3AN2 B;  3W99 C;  3AFA B;  1H3O A;  3REJ A;  1U35 A;  3MGQ A;  2CWE A;  1EQZ C;  2F8N D;  1P3G D;  1EQZ B;  5AV9 A;  4QLC C;  4X23 C;  4J8U C;  5GT0 A;  2G5I C;  4X23 B;  1HQ3 C;  3AN2 A;  3X1V C;  2ZM5 A;  1HQ3 B;  3AFA A;  2NZD D;  3REI C;  1P3M D;  3REI B;  1R4V A;  3V9R A;  3AV1 D;  4Z66 A;  1KX3 B;  1KX5 C;  2ARO B;  1F1E A;  5FUG B;  3KFU G;  3WAA C;  3WA9 C;  3WAA B;  4XZQ D;  5CP6 B;  3P5J B;  3REI A;  3UTA A;  5C3I C;  5B0Z C;  4HGA C;  5C3I B;  3B0D C;  5B0Z B;  2ARO A;  4HGA B;  3MGS D;  5FUG A;  3REK D;  1KX3 A;  2F8N B;  4NE5 A;  2CV5 D;  1P3G B;  4Z5T C;  2Y2G A;  3WAA A;  3X1T C;  1P34 D;  5DNN D;  3X1T B;  5AV8 C;  4KHA A;  4CSR B;  5CP6 A;  5CPK C;  2NZD B;  3A1K A;  1P3I D;  2JCH A;  2F8N A;  1P3G A;  2VQR A;  4CSR A;  4LD9 D;  1P3F D;  2L5A A;  2NZD A;  2XD5 A;  4R8P D;  3AV1 A;  3LZ0 D;  3B6F C;  1B67 A;  3REK B;  1ULY A;  2CV5 B;  3C1B D;  4XZQ A;  4YM6 C;  5CPI D;  3C1C C;  3MGR D;  4YM6 B;  5B0Y C;  1P3I B;  3MGS A;  3REK A;  2ZY2 A;  5GT3 C;  2CV5 A;  3KUY D;  5GT3 B;  3WTP D;  3LEL D;  1P34 A;  3VH5 W;  5DNN A;  5AY8 D;  4LD9 B;  3KXB D;  3AZM C;  3AZN D;  4WU9 C;  1P3F B;  1P3P D;  3AZM B;  4WU9 B;  2Y2Q A;  1P3I A;  5G49 B;  5GXQ C;  5GXQ B;  5DNM C;  1P3B D;  3WKJ C;  5E5A D;  4LD9 A;  4J8X C;  1P3F A;  3AZH D;  5CPI C;  3W97 C;  2FJ7 D;  3C1B B;  1KU5 A;  5CPI B;  3W97 B;  3MGR B;  2FFF B;  4R8P A;  3MVD C;  3LZ0 A;  1M19 D;  3UTB C;  3KUY B;  3WTP B;  3C1B A;  5CPI A;  3MGR A;  3AZL C;  1N1J A;  3KXB B;  3LJA D;  1P3P B;  5B31 G;  1S32 D;  5AV5 D;  5BS7 A;  4ZUX C;  3AV2 C;  4ZUX B;  3WTP E;  1BH9 A;  3AV2 B;  5E5A C;  3KUY A;  3WTP A;  3LEL A;  5E5A B;  5AY8 A;  5JA4 B;  3KXB A;  2FJ7 C;  3W98 D;  3AZN A;  1M1A D;  1P3P A;  2FJ7 B;  5AVC D;  1M18 D;  1P3B A;  2XD1 A;  5E5A A;  4DRA A;  1M19 B;  3EG5 B;  5JA4 A;  5BO0 B;  3LZ1 D;  4J8W C;  3AZH A;  2DF4 C;  2FJ7 A;  4YS3 D;  3LJA B;  3TU4 C;  1S32 B;  2HIO C;  3AZI C;  3TU4 B;  2Y2M A;  1P3O D;  1M19 A;  2HIO B;  3AZJ D;  4WJ3 C;  1ZLA D;  1F66 D;  5B2J D;  5AV6 C;  3W98 B;  1U35 C;  3LJA A;  4G92 B;  4H9R B;  1M1A B;  3MGQ C;  1S32 A;  5AV5 A;  1U35 B;  2ZY4 A;  4H9S A;  2HIO A;  3VH5 A;  5GT0 C;  5AVC B;  1M18 B;  2F8N K;  1TAF A;  4JJN D;  3LZ1 B;  2F8N H;  3AFA C;  1M1A A;  4H9R A;  4YS3 C;  3W98 A;  5BT1 D;  5B40 D;  1KX4 D;  3REL D;  4YS3 B;  2HUE B;  5AVC A;  4Z66 C;  3V9R B;  1M18 A;  3VH6 W;  4Z66 B;  2NQB D;  1ID3 D;  3AZJ B;  3LZ1 A;  1ZLA B;  3UTA C;  4YS3 A;  3UTA B;  1KX3 C;  2ARO C;  2RIQ A;  4WU8 D;  1P3O A;  3AZJ A;  2LY8 A;  5AVB D;  3AZG D;  5CP6 C;  1ZLA A;  4WZS B;  5B31 D;  1F66 A;  5B2J A;  4KHA B;  4JJN B;  5B40 C;  5B40 B;  3H0L C;  1KX4 B;  1P3G C;  3AYW D;  5B1M D;  2NQB B;  4JJN A;  2NZD C;  1P3M C;  5B40 A;  1P3M B;  3REL A;  1KX4 A;  3AV1 C;  5B33 D;  3AV1 B;  4WU8 B;  2NQB A;  3AZE D;  1ID3 A;  4XZQ C;  4H9P B;  4Z2M G;  5B31 C;  2Y2N A;  4XZQ B;  1P3M A;  3NQU B;  5B31 B;  3MGS C;  3REK C;  4WU8 A;  2CV5 C;  3MGS B;  5GSU D;  1Q9C A;  3AYW B;  1P34 C;  4H9P A;  5DNN C;  5AVB A;  3MGP D;  4KUD D;  3AZG A;  1P34 B;  5DNN B;  3NQU A;  5B1M B;  5B31 A;  1P3I C;  1P3L D;  3REH D;  5B33 B;  3AYW A;  4EO5 B;  2RVQ D;  4LD9 C;  5B1M A;  1P3F C;  3A1I A;  3VH6 A;  4R8P C;  3AZK D;  3LZ0 C;  2Y2J A;  5B33 A;  4R8P B;  3LZ0 B;  1TZY D;  3AZE A;  5GSU B;  3X1S D;  3C1B C;  3EPK A;  1BFM A;  4KUD B;  3MGR C;  2JSS A;  1HTA A;  3B0C W;  3A6N D;  1N1J B;  5BS7 C;  1P3L B;  3KUY C;  5GSU A;  3WTP C;  1BH9 B;  3LEL C;  1JFI B;  3AZF D;  2PYO D;  5AY8 C;  3MGP A;  2Y2I A;  3LEL B;  4NFT A;  1AOI D;  4KUD A;  5AY8 B;  3KXB C;  3AZN C;  1P3A D;  1P3P C;  3O62 D;  3AZN B;  1P3L A;  3REH A;  3AZK B;  1P3B C;  1JFI A;  1P3B B;  1B6W A;  3AZH C;  3AZH B;  5CPJ D;  3FDD A;  3KWQ D;  2G5H C;  4Z2M H;  3A6N B;  3AZK A;  3X1U D;  1M19 C;  3R45 B;  4CAY A;  1TZY A;  4WNN B;  3AZF C;  3W96 D;  3X1S A;  4G91 B;  3AZF B;  1AOI B;  3LJA C;  3A6N A;  1S32 C;  5B1L D;  5AV5 C;  4H9S C;  5AV5 B;  3R45 A;  5B24 D;  4WNN A;  4NE6 A;  3KSY A;  3AZF A;  2PYO A;  1AOI A;  3W98 C;  4G92 C;  1P3A A;  1M1A C;  1TAF B;  3O62 A;  5CPJ B;  1PZR A;  5AVC C;  1M18 C;  3X1U B;  3W96 C;  3MNN D;  3LZ1 C;  3W96 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...