3WAAB

The nucleosome containing human h2a.z.2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaB00
1KX4B 5B1LB 3X1VD 4Z2MG 4J8VC 4NE5A 5B32B 3C1CD 2F8NB 4H9OB 3LELB 5AV5A 3AZKB 4ZBJC 5GXQA 1P3PB 4H9QB 3TU4A 1HTAA 4H9NB 3MGRB 3MGSB 2CV5D 4WU8B 3X1UA 4H9SC 3AZMA 4G92C 1Q9CA 4ZUXB 3X1VA 4JJND 3RELD 3V9RB 4J8WB 1P3FB 5AV5C 5GXQC 3C1CA 3W99B 3WKJD 3TU4C 4J8UB 1AOIB 1A7WA 4YS3D 2NZDD 3X1UC 4KHAB 2FJ7D 3AZMC 2CV5A 5CPID 3X1VC 2PYOA 3A6NB 4Z66B 3AZHA 4JJNA 3AV1B 3C1CC 2NQBD 3MGPA 5C3IB 3KWQD 1M19B 3WKJA 5B33B 5JRGA 3REJD 2CV5C 5B1MD 1P3KD 1EQZA 1P3MB 1JFIB 2FJ7A 3REIB 1BH9B 5AV9D 4JJNC 3B0CT 3AZHC 5CPIA 3LJAD 1ID3D 3RELC 3MGQA 3MGPC 5E5AD 3KUYD 4WNNA 1WWSA 2NQBA 4KGCB 5F99D 1TAFA 5AVBD 4NE6A 5AV8A 1KX4D 3WKJC 1P34B 4R8PD 5JRGC 1HQ3D 3KWQA 1B67A 2NZDC 5FUGB 1N1JA 3C1BB 2FJ7C 4EO5C 3AZGB 5CPIC 4AWLC 3AZKD 5B1MA 3MGQC 1P3PD 3UTBB 4CAYA 3X1TA 5AV9A 1ID3A 5CPJD 2NQBC 5AV8C 5CP6A 3W97D 3AFAA 3MVDB 5F99A 5AVBA 3KWQC 4E44A 4ZUXD 4R8PA 5B2IB 1F66A 3UT9D 4CSRB 3REJC 1HQ3A 1KX3D 3AZJD 3X1SB 4J8XD 5B1MC 3AV2B 5BO0A 3AZLD 5B0ZD 3X1TC 5AV9C 1ID3C 5CP6C 5E5AC 3AFAC 3O62D 5CPJA 2IO5B 5AVBC 5F99C 3W97A 4R8PC 3VH5W 5JA4A 5B24D 3LZ1A 5GT3B 1HQ3C 3AZED 2AROB 3UTAB 3AV1D 1KU5A 3UT9A 1KX3A 3AZJA 5DNMD 4J8XA 3AZKC 3AZLA 3AN2D 5B0ZA 2F8NH 3WTPB 5B40B 5CPJC 3AYWB 3NQUB 1ZLAD 3W96B 3W97C 3O62A 1S32D 5AVCB 1P3MD 3REID 1TZYD 5B24A 3UT9C 5KDMB 1KX3C 3AZEA 4G91B 3AZJC 1M1AD 4J8XC 1P3BA 1EQZB 5B2JB 1P3GB 3AZLC 4LD9D 5B0ZC 5DNMA 3AN2A 3B0DB 3AZNB 3O62C 3R45B 4H9SA 1P3ID 1ZLAA 4H9PA 1BH8B 1M18B 5BNXA 1S32A 3B6GB 5B24C 3AZEC 1TZYA 3WA9B 1P3BC 5AY8B 4YM6B 1M1AA 3MVDD 2YFWA 5DNMC 5GT0B 2BYMB 3AN2C 2BYKB 4X23D 4LD9A 4XUJB 3W98D 5B2ID 3REHD 1KX5B 1ZLAC 5B0YB 3NQJA 2HIOB 1S32C 1P3IA 3MNND 1P3MC 3REIC 1TZYC 5BS7A 3LZ0D 1P3OB 5B31D 1M1AC 1ULYA 4Z2MH 4H9RA 5DNNB 4LD9C 5CPKD 3B6FB 4X23A 3W98A 3REHA 1P3IC 4DRAA 3KXBD 5BS7C 5G49A 3MNNA 1B6WA 3RELA 1U35B 3AZID 3WTPD 4Z5TB 4NFTA 3LZ0A 5GSUD 3W96D 5B31A 4XZQD 3REKB 3MVDC 4X23C 4WU9B 4YS3A 1P3AD 4QLCD 5AV6B 5CPKA 3REHC 3W98C 2NZDA 4WZSB 3AZFD 4J8VB 3MNNC 1H3OB 1P3LD 3KXBA 3LZ0C 3WAAB 5B31C 3AZIA 5B31G 4UUZA 4ZBJB 5B1LD 3AZND 3VH5A 5GSUA 5BNVA 1M18D 4YS3C 4KUDB 5CPKC 5B32D 2F8ND 3REJA 3VH5T 3LELD 1P3AA 4QLCA 3WA9D 5BT1D 1P3KA 3KXBC 3AZFA 5GT0D 3MGRD 2YFVA 3LJAA 3MGSD 1P3LA 5AV5B 3AZIC 5GXQB 5E5AA 3WTPC 3KUYA 4WU8D 4HGAC 3TU4B 5GSUC 2YFWB 3W96C 4XZQC 1KX4A 5B1LA 4J8WD 3X1UB 1P3AC 4QLCC 1P3FD 5B32A 3AZMB 1P3KC 3W99D 4H9OA 1P3OD 2F8NA 3LELA 3X1VB 4J8UD 3AZFC 2LY8A 3AZKA 3LJAC 1AOID 1P3LC 1P3PA 4H9QA 3C1CB 4E45A 3KUYC 4H9NA 3MGRA 3MGSA 3B6FD 3VH6A 1KX4C 5B1LC 4WU8A 3A6ND 4ZUXA 4Z66D 5B32C 3V9RA 2CV5B 4J8WA 1U35D 3LELC 1P3FA 4Z5TD 2PYOB 5BT1C 3W99A 1P3PC 1M19D 3AZHB 2HUEB 4JJNB 5B33D 4J8UA 3RELB 3MGRC 3MGPB 3MGSC 1AOIA 4WU8C 4KHAA 2RVQD 3WKJB 5JRGB 4ZUXC 4J8VD 4J8WC 1P3FC 3A6NA 3KSYA 4Z66A 3AV1A 2FJ7B 3WAAD 3W99C 4EO5B 4KGCD 5CPIB 4WV4B 4AWLB 4J8UC 1P34D 3MGQB 1AOIC 1M19A 4WNNB 4KUDD 5B33A 2NQBB 1TAFB 5AV8B 3C1BD 3B6FC 3VH6W 3AZGD 3KWQB 1P3MA 1JFIA 3REIA 3UTBD 3A6NC 1BH9A 1N1JB 4NE3A 4Z66C 3AV1C 1U35C 5B1MB 4Z5TC 4KGCA 5C3IC 4CAYB 3X1TB 5AV9B 1M19C 1ID3B 5B33C 1P34A 5CP6B 3AFAB 3X1SD 3AZMD 5AVBB 2RVQC 5FUGA 5F99B 3AV2D 3C1BA 4R8PB 3AZGA 1BFMA 1F66B 1HQ3B 3UTBA 5BO0B 3WAAC 4KGCC 1P34C 3MVDA 5GT3D 4KUDC 5CPJB 2AROD 4M6BA 3UTAD 5B2IA 3C1BC 4CSRA 3W97B 3AZGC 3X1SA 5JA4B 3LZ1B 2PYOD 3AV2A 3AZHD 3UTBC 3UT9B 5B40D 3MGPD 3AYWD 1KX3B 3AZJB 1WWIA 4J8XB 3AZLB 5B0ZB 5AVCD 5JRGD 5B2IC 5GT3A 3O62B 1EQZD 2AROA 3X1SC 3UTAA 5B2JD 3AV2C 1P3GD 5B24B 3MGQD 3AZEB 1P3BB 3WTPA 5B40A 5AV8D 3NQUA 3AYWA 2IO5C 5DNMB 3W96A 4XZQA 3AN2B 3B6GD 5AVCA 5GT3C 2AROC 1ZLAB 3UTAC 4H9PB 4DRBA 5AY8D 4G92B 5BNXB 5KDMA 4YM6D 1S32B 2PYOC 5B2JA 1P3GA 3X1TD 1TZYB 2HUEC 2JSSA 4XUJD 5B40C 3AYWC 5CP6D 1R4VA 1KX5D 3AFAD 1M1AB 5B0YD 3AZNA 3R45A 2HIOD 4LD9B 5AVCC 5CHLB 1BH8A 1M18A 1F66D 2L5AA 3B6GA 3NQJB 1P3IB 4G91C 1EQZC 3WA9A 5AY8A 5DNND 5B2JC 1P3GC 4YM6A 5GT0A 2BYMA 1F1EA 2BYKA 4H9RB 3B0DC 4XUJA 3AZNC 1KX5A 5B0YA 1M18C 3LZ1D 3VH6T 2HIOA 3B0BA 4X23B 3B6GC 5B32G 2F8NG 3W98B 3REHB 3WA9C 5AY8C 1P3OA 3B0CW 3REKD 5G49B 4YM6C 5GT0C 3MNNB 5DNNA 4WU9D 3LZ0B 4XUJC 5AV6D 5B31B 1KX5C 3B6FA 5B0YC 2HIOC 4YS3B 2F8NK 5CPKB 2NZDB 1F66C 1P3OC 1U35A 1P3BD 4Z5TA 5DNNC 3KXBB 3REKA 3AZIB 4UUZB 4WU9A 4HGAB 5AV6A 5GSUB 5BNVB 4XZQB 3LZ1C 4J8VA 3REJB 1P3AB 1H3OA 5AV5D 4QLCB 1P3KB 5GXQD 3WAAA 3TU4D 3AZFB 3REKC 2YFVB 3LJAB 1P3LB 5E5AB 3KUYB 3X1UD 4WU9C 2CWEA 3WTPE 5AV6C 4KUDA
chains in the Genus database with same CATH superfamily
1KX4B 5B1LB 3X1VD 2ZM5A 4Z2MG 4J8VC 4NE5A 5B32B 3C1CD 2F8NB 4H9OB 3LELB 5AV5A 3AZKB 4ZBJC 5GXQA 1P3PB 4H9QB 3TU4A 3P5JB 1HTAA 4H9NB 3MGRB 3MGSB 2CV5D 4WU8B 3X1UA 4H9SC 3AZMA 4G92C 1Q9CA 4ZUXB 3X1VA 4JJND 3RELD 3V9RB 4J8WB 1P3FB 5AV5C 5GXQC 3C1CA 3W99B 2JE5A 3WKJD 3TU4C 4J8UB 3EPHA 1AOIB 1A7WA 4YS3D 2NZDD 3X1UC 4KHAB 2FJ7D 3AZMC 2CV5A 5CPID 3X1VC 1Z2CB 2PYOA 3A6NB 4Z66B 3AZHA 4JJNA 2XD1A 3AV1B 3C1CC 2NQBD 3MGPA 5C3IB 3KWQD 1M19B 3WKJA 5B33B 5JRGA 3REJD 3H0MC 2CV5C 1PZRA 5B1MD 1P3KD 1EQZA 1P3MB 1JFIB 2FJ7A 3REIB 1BH9B 5AV9D 4JJNC 3B0CT 3AZHC 5CPIA 3LJAD 1ID3D 3RELC 3MGQA 3MGPC 5E5AD 3KUYD 4WNNA 1WWSA 2NQBA 4KGCB 5AVBD 5F99D 1TAFA 4NE6A 5AV8A 2G5IC 1KX4D 3WKJC 1P34B 4R8PD 1T3UA 5JRGC 1HQ3D 3KWQA 1B67A 2NZDC 5FUGB 2Y2JA 1N1JA 3C1BB 2FJ7C 4EO5C 3AZGB 2J8PA 5CPIC 4AWLC 5B1MA 3AZKD 3MGQC 1P3PD 3UTBB 2ZY4A 4CAYA 5AV9A 3X1TA 1ID3A 5CPJD 2NQBC 5AV8C 5CP6A 3W97D 3AFAA 3MVDB 5F99A 5AVBA 3KWQC 4E44A 4ZUXD 4R8PA 5B2IB 1F66A 3UT9D 4CSRB 3REJC 1HQ3A 1KX3D 3AZJD 3X1SB 4J8XD 5B1MC 3AV2B 5BO0A 3AZLD 5B0ZD 3X1TC 5AV9C 1ID3C 5CP6C 5E5AC 3AFAC 3O62D 5CPJA 2IO5B 5AVBC 5F99C 3W97A 4R8PC 3VH5W 5JA4A 5B24D 3LZ1A 5GT3B 1HQ3C 3AZED 2AROB 3UTAB 3AV1D 1KU5A 3UT9A 1KX3A 3AZJA 3A1KA 5DNMD 4J8XA 3AZKC 3AZLA 3AN2D 5B0ZA 2F8NH 3WTPB 5B40B 5CPJC 3AYWB 3NQUB 1ZLAD 3W96B 3W97C 3O62A 1S32D 2BG1A 3KFUG 5AVCB 1P3MD 3REID 1TZYD 5B24A 3UT9C 5KDMB 1KX3C 3AZEA 4G91B 3AZJC 1M1AD 4J8XC 1P3BA 1EQZB 3A1IA 5B2JB 1P3GB 3AZLC 4LD9D 5B0ZC 2ZY2A 5DNMA 2XD5A 3AN2A 3B0DB 3AZNB 3O62C 3R45B 4H9SA 1P3ID 1ZLAA 4H9PA 1BH8B 1M18B 5BNXA 1S32A 3B6GB 5B24C 3AZEC 1TZYA 3WA9B 1P3BC 5AY8B 4YM6B 1M1AA 3MVDD 2YFWA 5DNMC 5GT0B 2BYMB 3AN2C 2BYKB 4X23D 4LD9A 4XUJB 3W98D 5B2ID 3REHD 1KX5B 1ZLAC 5B0YB 3NQJA 2HIOB 1S32C 1P3IA 3MNND 1P3MC 3REIC 1TZYC 5BS7A 3LZ0D 1P3OB 5B31D 2DF4C 1ULYA 1M1AC 4Z2MH 4H9RA 5DNNB 4LD9C 5CPKD 3B6FB 4X23A 3W98A 3REHA 1P3IC 4DRAA 2UWXA 3KXBD 5BS7C 3EPJA 5G49A 3MNNA 1B6WA 3RELA 1U35B 3AZID 3WTPD 4Z5TB 4NFTA 3LZ0A 5GSUD 3W96D 5B31A 4XZQD 3REKB 3MVDC 4X23C 4WU9B 4YS3A 1P3AD 4QLCD 5AV6B 5CPKA 3REHC 3W98C 2NZDA 2Y2HA 2Y2OA 4WZSB 3EPLA 3AZFD 4J8VB 3MNNC 1H3OB 1P3LD 3KXBA 3LZ0C 3WAAB 5B31C 3AZIA 5B31G 4UUZA 4ZBJB 5B1LD 3EPKA 3AZND 3F6TA 3VH5A 5GSUA 5BNVA 3AL0C 1M18D 4YS3C 4KUDB 2F2AC 5CPKC 2Y2MA 5B32D 2F8ND 3REJA 3VH5T 3LELD 1P3AA 4QLCA 3WA9D 5BT1D 1P3KA 3KXBC 3AZFA 5GT0D 3MGRD 2YFVA 3LJAA 3MGSD 1P3LA 5AV5B 3AZIC 5GXQB 5E5AA 3WTPC 3KUYA 4WU8D 4HGAC 3TU4B 5GSUC 2YFWB 3W96C 4XZQC 1KX4A 5B1LA 2Y2NA 4J8WD 3X1UB 1P3AC 4QLCC 1P3FD 1W2EA 5B32A 3AZMB 1P3KC 3W99D 4H9OA 1P3OD 2F8NA 3LELA 3X1VB 4J8UD 3AZFC 2LY8A 3AZKA 3LJAC 1AOID 1P3LC 1P3PA 4H9QA 3C1CB 4E45A 3KUYC 4H9NA 3MGRA 3MGSA 3B6FD 3VH6A 1KX4C 5B1LC 4WU8A 3A6ND 4ZUXA 4Z66D 5B32C 3V9RA 2CV5B 4J8WA 1U35D 3LELC 1P3FA 4Z5TD 2PYOB 5BT1C 3W99A 1P3PC 1M19D 3AZHB 2HUEB 4JJNB 5B33D 4J8UA 3RELB 3MGRC 3MGPB 3MGSC 1AOIA 4WU8C 4KHAA 2RVQD 3WKJB 5JRGB 4ZUXC 4J8VD 4J8WC 3H0RC 1P3FC 3A6NA 3KSYA 4Z66A 3AV1A 2FJ7B 3WAAD 3W99C 4EO5B 4KGCD 5CPIB 4WV4B 4AWLB 2RIQA 4J8UC 1P34D 3MGQB 1AOIC 1M19A 4WNNB 4KUDD 5B33A 2NQBB 1TAFB 5AV8B 3C1BD 3B6FC 3VH6W 3AZGD 3KWQB 1P3MA 1JFIA 2Y2KA 2Y2QA 3REIA 3UTBD 3A6NC 1BH9A 1N1JB 4NE3A 4Z66C 3AV1C 1U35C 2G5HC 5B1MB 4Z5TC 4KGCA 5C3IC 4CAYB 3X1TB 5AV9B 1M19C 1ID3B 5B33C 1P34A 5CP6B 3AFAB 3X1SD 3AZMD 5AVBB 2RVQC 5FUGA 5F99B 3AV2D 3C1BA 4R8PB 3AZGA 1BFMA 1F66B 1HQ3B 3UTBA 4WJ3C 5BO0B 3WAAC 4KGCC 2DQNC 1P34C 3MVDA 5GT3D 4KUDC 5CPJB 2AROD 3FDDA 4M6BA 3H0LC 3UTAD 5B2IA 3C1BC 4CSRA 3W97B 3AZGC 3X1SA 5JA4B 3LZ1B 2PYOD 3AV2A 3AZHD 3UTBC 3UT9B 5B40D 3MGPD 2Y2IA 3AYWD 1KX3B 3IP4C 3AZJB 1WWIA 4J8XB 3AZLB 4UPKA 5B0ZB 5AVCD 5JRGD 5B2IC 5GT3A 3O62B 1EQZD 2AROA 3X1SC 3UTAA 5B2JD 3AV2C 1P3GD 2ZY5A 5B24B 3MGQD 3AZEB 1P3BB 3WTPA 5B40A 5AV8D 3NQUA 3AYWA 2IO5C 5DNMB 3W96A 4XZQA 3AN2B 3B6GD 5AVCA 5GT3C 2Y2GA 2AROC 1ZLAB 3UTAC 4H9PB 4DRBA 5AY8D 2JCHA 4G92B 5BNXB 5KDMA 4YM6D 1S32B 2PYOC 5B2JA 1P3GA 3X1TD 1TZYB 2HUEC 2JSSA 4XUJD 5B40C 3AYWC 5CP6D 1R4VA 1KX5D 3AFAD 1M1AB 5B0YD 3AZNA 3R45A 2HIOD 4LD9B 5AVCC 5CHLB 1BH8A 1M18A 1F66D 2L5AA 3B6GA 3NQJB 1P3IB 4G91C 1EQZC 3WA9A 5AY8A 5DNND 5B2JC 1P3GC 4YM6A 5GT0A 2BYMA 1F1EA 2BYKA 3EG5B 4H9RB 3B0DC 4XUJA 3AZNC 1KX5A 5B0YA 1M18C 3LZ1D 3VH6T 2HIOA 3B0BA 4X23B 3B6GC 2FFFB 5B32G 2F8NG 3W98B 3REHB 3WA9C 5AY8C 1P3OA 3B0CW 3REKD 5G49B 4YM6C 5GT0C 3MNNB 5DNNA 4WU9D 3LZ0B 4XUJC 2Y2LA 5AV6D 5B31B 1KX5C 3B6FA 5B0YC 2ZY3A 2HIOC 4YS3B 2F8NK 5CPKB 2NZDB 1F66C 2VQRA 1P3OC 1U35A 1P3BD 2W8SA 4Z5TA 5DNNC 3KXBB 3REKA 4DQYB 3AZIB 4UUZB 4WU9A 4HGAB 5AV6A 5GSUB 5BNVB 4XZQB 3LZ1C 4J8VA 3REJB 1P3AB 1H3OA 5AV5D 4QLCB 1P3KB 5GXQD 3WAAA 3TU4D 3AZFB 3REKC 2YFVB 3LJAB 1P3LB 2Y2PA 5E5AB 3KUYB 3X1UD 4WU9C 2CWEA 3WTPE 5AV6C 4KUDA
chains in the Genus database with same CATH topology
1KX4B 5B1LB 3X1VD 2ZM5A 4Z2MG 4J8VC 4NE5A 5B32B 3C1CD 2F8NB 4H9OB 3LELB 5AV5A 3AZKB 4ZBJC 5GXQA 1P3PB 4H9QB 3TU4A 3P5JB 1HTAA 4H9NB 3MGRB 3MGSB 2CV5D 4WU8B 3X1UA 4H9SC 3AZMA 4G92C 1Q9CA 4ZUXB 3X1VA 4JJND 3RELD 3V9RB 4J8WB 1P3FB 5AV5C 5GXQC 3C1CA 3W99B 2JE5A 3WKJD 3TU4C 4J8UB 3EPHA 1AOIB 1A7WA 4YS3D 2NZDD 3X1UC 4KHAB 2FJ7D 3AZMC 2CV5A 5CPID 3X1VC 1Z2CB 2PYOA 3A6NB 4Z66B 3AZHA 4JJNA 2XD1A 3AV1B 3C1CC 2NQBD 3MGPA 5C3IB 3KWQD 1M19B 3WKJA 5B33B 5JRGA 3REJD 3H0MC 2CV5C 1PZRA 5B1MD 1P3KD 1EQZA 1P3MB 1JFIB 2FJ7A 3REIB 1BH9B 5AV9D 4JJNC 3B0CT 3AZHC 5CPIA 3LJAD 1ID3D 3RELC 3MGQA 3MGPC 5E5AD 3KUYD 4WNNA 1WWSA 2NQBA 4KGCB 5AVBD 5F99D 1TAFA 4NE6A 5AV8A 2G5IC 1KX4D 3WKJC 1P34B 4R8PD 1T3UA 5JRGC 1HQ3D 3KWQA 1B67A 2NZDC 5FUGB 2Y2JA 1N1JA 3C1BB 2FJ7C 4EO5C 3AZGB 2J8PA 5CPIC 4AWLC 5B1MA 3AZKD 3MGQC 1P3PD 3UTBB 2ZY4A 4CAYA 5AV9A 3X1TA 1ID3A 5CPJD 2NQBC 5AV8C 5CP6A 3W97D 3AFAA 3MVDB 5F99A 5AVBA 3KWQC 4E44A 4ZUXD 4R8PA 5B2IB 1F66A 3UT9D 4CSRB 3REJC 1HQ3A 1KX3D 3AZJD 3X1SB 4J8XD 5B1MC 3AV2B 5BO0A 3AZLD 5B0ZD 3X1TC 5AV9C 1ID3C 5CP6C 5E5AC 3AFAC 3O62D 5CPJA 2IO5B 5AVBC 5F99C 3W97A 4R8PC 3VH5W 5JA4A 5B24D 3LZ1A 5GT3B 1HQ3C 3AZED 2AROB 3UTAB 3AV1D 1KU5A 3UT9A 1KX3A 3AZJA 3A1KA 5DNMD 4J8XA 3AZKC 3AZLA 3AN2D 5B0ZA 2F8NH 3WTPB 5B40B 5CPJC 3AYWB 3NQUB 1ZLAD 3W96B 3W97C 3O62A 1S32D 2BG1A 3KFUG 5AVCB 1P3MD 3REID 1TZYD 5B24A 3UT9C 5KDMB 1KX3C 3AZEA 4G91B 3AZJC 1M1AD 4J8XC 1P3BA 1EQZB 3A1IA 5B2JB 1P3GB 3AZLC 4LD9D 5B0ZC 2ZY2A 5DNMA 2XD5A 3AN2A 3B0DB 3AZNB 3O62C 3R45B 4H9SA 1P3ID 1ZLAA 4H9PA 1BH8B 1M18B 5BNXA 1S32A 3B6GB 5B24C 3AZEC 1TZYA 3WA9B 1P3BC 5AY8B 4YM6B 1M1AA 3MVDD 2YFWA 5DNMC 5GT0B 2BYMB 3AN2C 2BYKB 4X23D 4LD9A 4XUJB 3W98D 5B2ID 3REHD 1KX5B 1ZLAC 5B0YB 3NQJA 2HIOB 1S32C 1P3IA 3MNND 1P3MC 3REIC 1TZYC 5BS7A 3LZ0D 1P3OB 5B31D 2DF4C 1ULYA 1M1AC 4Z2MH 4H9RA 5DNNB 4LD9C 5CPKD 3B6FB 4X23A 3W98A 3REHA 1P3IC 4DRAA 2UWXA 3KXBD 5BS7C 3EPJA 5G49A 3MNNA 1B6WA 3RELA 1U35B 3AZID 3WTPD 4Z5TB 4NFTA 3LZ0A 5GSUD 3W96D 5B31A 4XZQD 3REKB 3MVDC 4X23C 4WU9B 4YS3A 1P3AD 4QLCD 5AV6B 5CPKA 3REHC 3W98C 2NZDA 2Y2HA 2Y2OA 4WZSB 3EPLA 3AZFD 4J8VB 3MNNC 1H3OB 1P3LD 3KXBA 3LZ0C 3WAAB 5B31C 3AZIA 5B31G 4UUZA 4ZBJB 5B1LD 3EPKA 3AZND 3F6TA 3VH5A 5GSUA 5BNVA 3AL0C 1M18D 4YS3C 4KUDB 2F2AC 5CPKC 2Y2MA 5B32D 2F8ND 3REJA 3VH5T 3LELD 1P3AA 4QLCA 3WA9D 5BT1D 1P3KA 3KXBC 3AZFA 5GT0D 3MGRD 2YFVA 3LJAA 3MGSD 1P3LA 5AV5B 3AZIC 5GXQB 5E5AA 3WTPC 3KUYA 4WU8D 4HGAC 3TU4B 5GSUC 2YFWB 3W96C 4XZQC 1KX4A 5B1LA 2Y2NA 4J8WD 3X1UB 1P3AC 4QLCC 1P3FD 1W2EA 5B32A 3AZMB 1P3KC 3W99D 4H9OA 1P3OD 2F8NA 3LELA 3X1VB 4J8UD 3AZFC 2LY8A 3AZKA 3LJAC 1AOID 1P3LC 1P3PA 4H9QA 3C1CB 4E45A 3KUYC 4H9NA 3MGRA 3MGSA 3B6FD 3VH6A 1KX4C 5B1LC 4WU8A 3A6ND 4ZUXA 4Z66D 5B32C 3V9RA 2CV5B 4J8WA 1U35D 3LELC 1P3FA 4Z5TD 2PYOB 5BT1C 3W99A 1P3PC 1M19D 3AZHB 2HUEB 4JJNB 5B33D 4J8UA 3RELB 3MGRC 3MGPB 3MGSC 1AOIA 4WU8C 4KHAA 2RVQD 3WKJB 5JRGB 4ZUXC 4J8VD 4J8WC 3H0RC 1P3FC 3A6NA 3KSYA 4Z66A 3AV1A 2FJ7B 3WAAD 3W99C 4EO5B 4KGCD 5CPIB 4WV4B 4AWLB 2RIQA 4J8UC 1P34D 3MGQB 1AOIC 1M19A 4WNNB 4KUDD 5B33A 2NQBB 1TAFB 5AV8B 3C1BD 3B6FC 3VH6W 3AZGD 3KWQB 1P3MA 1JFIA 2Y2KA 2Y2QA 3REIA 3UTBD 3A6NC 1BH9A 1N1JB 4NE3A 4Z66C 3AV1C 1U35C 2G5HC 5B1MB 4Z5TC 4KGCA 5C3IC 4CAYB 3X1TB 5AV9B 1M19C 1ID3B 5B33C 1P34A 5CP6B 3AFAB 3X1SD 3AZMD 5AVBB 2RVQC 5FUGA 5F99B 3AV2D 3C1BA 4R8PB 3AZGA 1BFMA 1F66B 1HQ3B 3UTBA 4WJ3C 5BO0B 3WAAC 4KGCC 2DQNC 1P34C 3MVDA 5GT3D 4KUDC 5CPJB 2AROD 3FDDA 4M6BA 3H0LC 3UTAD 5B2IA 3C1BC 4CSRA 3W97B 3AZGC 3X1SA 5JA4B 3LZ1B 2PYOD 3AV2A 3AZHD 3UTBC 3UT9B 5B40D 3MGPD 2Y2IA 3AYWD 1KX3B 3IP4C 3AZJB 1WWIA 4J8XB 3AZLB 4UPKA 5B0ZB 5AVCD 5JRGD 5B2IC 5GT3A 3O62B 1EQZD 2AROA 3X1SC 3UTAA 5B2JD 3AV2C 1P3GD 2ZY5A 5B24B 3MGQD 3AZEB 1P3BB 3WTPA 5B40A 5AV8D 3NQUA 3AYWA 2IO5C 5DNMB 3W96A 4XZQA 3AN2B 3B6GD 5AVCA 5GT3C 2Y2GA 2AROC 1ZLAB 3UTAC 4H9PB 4DRBA 5AY8D 2JCHA 4G92B 5BNXB 5KDMA 4YM6D 1S32B 2PYOC 5B2JA 1P3GA 3X1TD 1TZYB 2HUEC 2JSSA 4XUJD 5B40C 3AYWC 5CP6D 1R4VA 1KX5D 3AFAD 1M1AB 5B0YD 3AZNA 3R45A 2HIOD 4LD9B 5AVCC 5CHLB 1BH8A 1M18A 1F66D 2L5AA 3B6GA 3NQJB 1P3IB 4G91C 1EQZC 3WA9A 5AY8A 5DNND 5B2JC 1P3GC 4YM6A 5GT0A 2BYMA 1F1EA 2BYKA 3EG5B 4H9RB 3B0DC 4XUJA 3AZNC 1KX5A 5B0YA 1M18C 3LZ1D 3VH6T 2HIOA 3B0BA 4X23B 3B6GC 2FFFB 5B32G 2F8NG 3W98B 3REHB 3WA9C 5AY8C 1P3OA 3B0CW 3REKD 5G49B 4YM6C 5GT0C 3MNNB 5DNNA 4WU9D 3LZ0B 4XUJC 2Y2LA 5AV6D 5B31B 1KX5C 3B6FA 5B0YC 2ZY3A 2HIOC 4YS3B 2F8NK 5CPKB 2NZDB 1F66C 2VQRA 1P3OC 1U35A 1P3BD 2W8SA 4Z5TA 5DNNC 3KXBB 3REKA 4DQYB 3AZIB 4UUZB 4WU9A 4HGAB 5AV6A 5GSUB 5BNVB 4XZQB 3LZ1C 4J8VA 3REJB 1P3AB 1H3OA 5AV5D 4QLCB 1P3KB 5GXQD 3WAAA 3TU4D 3AZFB 3REKC 2YFVB 3LJAB 1P3LB 2Y2PA 5E5AB 3KUYB 3X1UD 4WU9C 2CWEA 3WTPE 5AV6C 4KUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX4 B;  5B1L B;  3X1V D;  4Z2M G;  4J8V C;  4NE5 A;  5B32 B;  3C1C D;  2F8N B;  4H9O B;  3LEL B;  5AV5 A;  3AZK B;  4ZBJ C;  5GXQ A;  1P3P B;  4H9Q B;  3TU4 A;  1HTA A;  4H9N B;  3MGR B;  3MGS B;  2CV5 D;  4WU8 B;  3X1U A;  4H9S C;  3AZM A;  4G92 C;  1Q9C A;  4ZUX B;  3X1V A;  4JJN D;  3REL D;  3V9R B;  4J8W B;  1P3F B;  5AV5 C;  5GXQ C;  3C1C A;  3W99 B;  3WKJ D;  3TU4 C;  4J8U B;  1AOI B;  1A7W A;  4YS3 D;  2NZD D;  3X1U C;  4KHA B;  2FJ7 D;  3AZM C;  2CV5 A;  5CPI D;  3X1V C;  2PYO A;  3A6N B;  4Z66 B;  3AZH A;  4JJN A;  3AV1 B;  3C1C C;  2NQB D;  3MGP A;  5C3I B;  3KWQ D;  1M19 B;  3WKJ A;  5B33 B;  5JRG A;  3REJ D;  2CV5 C;  5B1M D;  1P3K D;  1EQZ A;  1P3M B;  1JFI B;  2FJ7 A;  3REI B;  1BH9 B;  5AV9 D;  4JJN C;  3B0C T;  3AZH C;  5CPI A;  3LJA D;  1ID3 D;  3REL C;  3MGQ A;  3MGP C;  5E5A D;  3KUY D;  4WNN A;  1WWS A;  2NQB A;  4KGC B;  5F99 D;  1TAF A;  5AVB D;  4NE6 A;  5AV8 A;  1KX4 D;  3WKJ C;  1P34 B;  4R8P D;  5JRG C;  1HQ3 D;  3KWQ A;  1B67 A;  2NZD C;  5FUG B;  1N1J A;  3C1B B;  2FJ7 C;  4EO5 C;  3AZG B;  5CPI C;  4AWL C;  3AZK D;  5B1M A;  3MGQ C;  1P3P D;  3UTB B;  4CAY A;  3X1T A;  5AV9 A;  1ID3 A;  5CPJ D;  2NQB C;  5AV8 C;  5CP6 A;  3W97 D;  3AFA A;  3MVD B;  5F99 A;  5AVB A;  3KWQ C;  4E44 A;  4ZUX D;  4R8P A;  5B2I B;  1F66 A;  3UT9 D;  4CSR B;  3REJ C;  1HQ3 A;  1KX3 D;  3AZJ D;  3X1S B;  4J8X D;  5B1M C;  3AV2 B;  5BO0 A;  3AZL D;  5B0Z D;  3X1T C;  5AV9 C;  1ID3 C;  5CP6 C;  5E5A C;  3AFA C;  3O62 D;  5CPJ A;  2IO5 B;  5AVB C;  5F99 C;  3W97 A;  4R8P C;  3VH5 W;  5JA4 A;  5B24 D;  3LZ1 A;  5GT3 B;  1HQ3 C;  3AZE D;  2ARO B;  3UTA B;  3AV1 D;  1KU5 A;  3UT9 A;  1KX3 A;  3AZJ A;  5DNM D;  4J8X A;  3AZK C;  3AZL A;  3AN2 D;  5B0Z A;  2F8N H;  3WTP B;  5B40 B;  5CPJ C;  3AYW B;  3NQU B;  1ZLA D;  3W96 B;  3W97 C;  3O62 A;  1S32 D;  5AVC B;  1P3M D;  3REI D;  1TZY D;  5B24 A;  3UT9 C;  5KDM B;  1KX3 C;  3AZE A;  4G91 B;  3AZJ C;  1M1A D;  4J8X C;  1P3B A;  1EQZ B;  5B2J B;  1P3G B;  3AZL C;  4LD9 D;  5B0Z C;  5DNM A;  3AN2 A;  3B0D B;  3AZN B;  3O62 C;  3R45 B;  4H9S A;  1P3I D;  1ZLA A;  4H9P A;  1BH8 B;  1M18 B;  5BNX A;  1S32 A;  3B6G B;  5B24 C;  3AZE C;  1TZY A;  3WA9 B;  1P3B C;  5AY8 B;  4YM6 B;  1M1A A;  3MVD D;  2YFW A;  5DNM C;  5GT0 B;  2BYM B;  3AN2 C;  2BYK B;  4X23 D;  4LD9 A;  4XUJ B;  3W98 D;  5B2I D;  3REH D;  1KX5 B;  1ZLA C;  5B0Y B;  3NQJ A;  2HIO B;  1S32 C;  1P3I A;  3MNN D;  1P3M C;  3REI C;  1TZY C;  5BS7 A;  3LZ0 D;  1P3O B;  5B31 D;  1M1A C;  1ULY A;  4Z2M H;  4H9R A;  5DNN B;  4LD9 C;  5CPK D;  3B6F B;  4X23 A;  3W98 A;  3REH A;  1P3I C;  4DRA A;  3KXB D;  5BS7 C;  5G49 A;  3MNN A;  1B6W A;  3REL A;  1U35 B;  3AZI D;  3WTP D;  4Z5T B;  4NFT A;  3LZ0 A;  5GSU D;  3W96 D;  5B31 A;  4XZQ D;  3REK B;  3MVD C;  4X23 C;  4WU9 B;  4YS3 A;  1P3A D;  4QLC D;  5AV6 B;  5CPK A;  3REH C;  3W98 C;  2NZD A;  4WZS B;  3AZF D;  4J8V B;  3MNN C;  1H3O B;  1P3L D;  3KXB A;  3LZ0 C;  3WAA B;  5B31 C;  3AZI A;  5B31 G;  4UUZ A;  4ZBJ B;  5B1L D;  3AZN D;  3VH5 A;  5GSU A;  5BNV A;  1M18 D;  4YS3 C;  4KUD B;  5CPK C;  5B32 D;  2F8N D;  3REJ A;  3VH5 T;  3LEL D;  1P3A A;  4QLC A;  3WA9 D;  5BT1 D;  1P3K A;  3KXB C;  3AZF A;  5GT0 D;  3MGR D;  2YFV A;  3LJA A;  3MGS D;  1P3L A;  5AV5 B;  3AZI C;  5GXQ B;  5E5A A;  3WTP C;  3KUY A;  4WU8 D;  4HGA C;  3TU4 B;  5GSU C;  2YFW B;  3W96 C;  4XZQ C;  1KX4 A;  5B1L A;  4J8W D;  3X1U B;  1P3A C;  4QLC C;  1P3F D;  5B32 A;  3AZM B;  1P3K C;  3W99 D;  4H9O A;  1P3O D;  2F8N A;  3LEL A;  3X1V B;  4J8U D;  3AZF C;  2LY8 A;  3AZK A;  3LJA C;  1AOI D;  1P3L C;  1P3P A;  4H9Q A;  3C1C B;  4E45 A;  3KUY C;  4H9N A;  3MGR A;  3MGS A;  3B6F D;  3VH6 A;  1KX4 C;  5B1L C;  4WU8 A;  3A6N D;  4ZUX A;  4Z66 D;  5B32 C;  3V9R A;  2CV5 B;  4J8W A;  1U35 D;  3LEL C;  1P3F A;  4Z5T D;  2PYO B;  5BT1 C;  3W99 A;  1P3P C;  1M19 D;  3AZH B;  2HUE B;  4JJN B;  5B33 D;  4J8U A;  3REL B;  3MGR C;  3MGP B;  3MGS C;  1AOI A;  4WU8 C;  4KHA A;  2RVQ D;  3WKJ B;  5JRG B;  4ZUX C;  4J8V D;  4J8W C;  1P3F C;  3A6N A;  3KSY A;  4Z66 A;  3AV1 A;  2FJ7 B;  3WAA D;  3W99 C;  4EO5 B;  4KGC D;  5CPI B;  4WV4 B;  4AWL B;  4J8U C;  1P34 D;  3MGQ B;  1AOI C;  1M19 A;  4WNN B;  4KUD D;  5B33 A;  2NQB B;  1TAF B;  5AV8 B;  3C1B D;  3B6F C;  3VH6 W;  3AZG D;  3KWQ B;  1P3M A;  1JFI A;  3REI A;  3UTB D;  3A6N C;  1BH9 A;  1N1J B;  4NE3 A;  4Z66 C;  3AV1 C;  1U35 C;  5B1M B;  4Z5T C;  4KGC A;  5C3I C;  4CAY B;  3X1T B;  5AV9 B;  1M19 C;  1ID3 B;  5B33 C;  1P34 A;  5CP6 B;  3AFA B;  3X1S D;  3AZM D;  5AVB B;  2RVQ C;  5FUG A;  5F99 B;  3AV2 D;  3C1B A;  4R8P B;  3AZG A;  1BFM A;  1F66 B;  1HQ3 B;  3UTB A;  5BO0 B;  3WAA C;  4KGC C;  1P34 C;  3MVD A;  5GT3 D;  4KUD C;  5CPJ B;  2ARO D;  4M6B A;  3UTA D;  5B2I A;  3C1B C;  4CSR A;  3W97 B;  3AZG C;  3X1S A;  5JA4 B;  3LZ1 B;  2PYO D;  3AV2 A;  3AZH D;  3UTB C;  3UT9 B;  5B40 D;  3MGP D;  3AYW D;  1KX3 B;  3AZJ B;  1WWI A;  4J8X B;  3AZL B;  5B0Z B;  5AVC D;  5JRG D;  5B2I C;  5GT3 A;  3O62 B;  1EQZ D;  2ARO A;  3X1S C;  3UTA A;  5B2J D;  3AV2 C;  1P3G D;  5B24 B;  3MGQ D;  3AZE B;  1P3B B;  3WTP A;  5B40 A;  5AV8 D;  3NQU A;  3AYW A;  2IO5 C;  5DNM B;  3W96 A;  4XZQ A;  3AN2 B;  3B6G D;  5AVC A;  5GT3 C;  2ARO C;  1ZLA B;  3UTA C;  4H9P B;  4DRB A;  5AY8 D;  4G92 B;  5BNX B;  5KDM A;  4YM6 D;  1S32 B;  2PYO C;  5B2J A;  1P3G A;  3X1T D;  1TZY B;  2HUE C;  2JSS A;  4XUJ D;  5B40 C;  3AYW C;  5CP6 D;  1R4V A;  1KX5 D;  3AFA D;  1M1A B;  5B0Y D;  3AZN A;  3R45 A;  2HIO D;  4LD9 B;  5AVC C;  5CHL B;  1BH8 A;  1M18 A;  1F66 D;  2L5A A;  3B6G A;  3NQJ B;  1P3I B;  4G91 C;  1EQZ C;  3WA9 A;  5AY8 A;  5DNN D;  5B2J C;  1P3G C;  4YM6 A;  5GT0 A;  2BYM A;  1F1E A;  2BYK A;  4H9R B;  3B0D C;  4XUJ A;  3AZN C;  1KX5 A;  5B0Y A;  1M18 C;  3LZ1 D;  3VH6 T;  2HIO A;  3B0B A;  4X23 B;  3B6G C;  5B32 G;  2F8N G;  3W98 B;  3REH B;  3WA9 C;  5AY8 C;  1P3O A;  3B0C W;  3REK D;  5G49 B;  4YM6 C;  5GT0 C;  3MNN B;  5DNN A;  4WU9 D;  3LZ0 B;  4XUJ C;  5AV6 D;  5B31 B;  1KX5 C;  3B6F A;  5B0Y C;  2HIO C;  4YS3 B;  2F8N K;  5CPK B;  2NZD B;  1F66 C;  1P3O C;  1U35 A;  1P3B D;  4Z5T A;  5DNN C;  3KXB B;  3REK A;  3AZI B;  4UUZ B;  4WU9 A;  4HGA B;  5AV6 A;  5GSU B;  5BNV B;  4XZQ B;  3LZ1 C;  4J8V A;  3REJ B;  1P3A B;  1H3O A;  5AV5 D;  4QLC B;  1P3K B;  5GXQ D;  3WAA A;  3TU4 D;  3AZF B;  3REK C;  2YFV B;  3LJA B;  1P3L B;  5E5A B;  3KUY B;  3X1U D;  4WU9 C;  2CWE A;  3WTP E;  5AV6 C;  4KUD A; 
#chains in the Genus database with same CATH topology
 1KX4 B;  5B1L B;  3X1V D;  2ZM5 A;  4Z2M G;  4J8V C;  4NE5 A;  5B32 B;  3C1C D;  2F8N B;  4H9O B;  3LEL B;  5AV5 A;  3AZK B;  4ZBJ C;  5GXQ A;  1P3P B;  4H9Q B;  3TU4 A;  3P5J B;  1HTA A;  4H9N B;  3MGR B;  3MGS B;  2CV5 D;  4WU8 B;  3X1U A;  4H9S C;  3AZM A;  4G92 C;  1Q9C A;  4ZUX B;  3X1V A;  4JJN D;  3REL D;  3V9R B;  4J8W B;  1P3F B;  5AV5 C;  5GXQ C;  3C1C A;  3W99 B;  2JE5 A;  3WKJ D;  3TU4 C;  4J8U B;  3EPH A;  1AOI B;  1A7W A;  4YS3 D;  2NZD D;  3X1U C;  4KHA B;  2FJ7 D;  3AZM C;  2CV5 A;  5CPI D;  3X1V C;  1Z2C B;  2PYO A;  3A6N B;  4Z66 B;  3AZH A;  4JJN A;  2XD1 A;  3AV1 B;  3C1C C;  2NQB D;  3MGP A;  5C3I B;  3KWQ D;  1M19 B;  3WKJ A;  5B33 B;  5JRG A;  3REJ D;  3H0M C;  2CV5 C;  1PZR A;  5B1M D;  1P3K D;  1EQZ A;  1P3M B;  1JFI B;  2FJ7 A;  3REI B;  1BH9 B;  5AV9 D;  4JJN C;  3B0C T;  3AZH C;  5CPI A;  3LJA D;  1ID3 D;  3REL C;  3MGQ A;  3MGP C;  5E5A D;  3KUY D;  4WNN A;  1WWS A;  2NQB A;  4KGC B;  5AVB D;  5F99 D;  1TAF A;  4NE6 A;  5AV8 A;  2G5I C;  1KX4 D;  3WKJ C;  1P34 B;  4R8P D;  1T3U A;  5JRG C;  1HQ3 D;  3KWQ A;  1B67 A;  2NZD C;  5FUG B;  2Y2J A;  1N1J A;  3C1B B;  2FJ7 C;  4EO5 C;  3AZG B;  2J8P A;  5CPI C;  4AWL C;  5B1M A;  3AZK D;  3MGQ C;  1P3P D;  3UTB B;  2ZY4 A;  4CAY A;  5AV9 A;  3X1T A;  1ID3 A;  5CPJ D;  2NQB C;  5AV8 C;  5CP6 A;  3W97 D;  3AFA A;  3MVD B;  5F99 A;  5AVB A;  3KWQ C;  4E44 A;  4ZUX D;  4R8P A;  5B2I B;  1F66 A;  3UT9 D;  4CSR B;  3REJ C;  1HQ3 A;  1KX3 D;  3AZJ D;  3X1S B;  4J8X D;  5B1M C;  3AV2 B;  5BO0 A;  3AZL D;  5B0Z D;  3X1T C;  5AV9 C;  1ID3 C;  5CP6 C;  5E5A C;  3AFA C;  3O62 D;  5CPJ A;  2IO5 B;  5AVB C;  5F99 C;  3W97 A;  4R8P C;  3VH5 W;  5JA4 A;  5B24 D;  3LZ1 A;  5GT3 B;  1HQ3 C;  3AZE D;  2ARO B;  3UTA B;  3AV1 D;  1KU5 A;  3UT9 A;  1KX3 A;  3AZJ A;  3A1K A;  5DNM D;  4J8X A;  3AZK C;  3AZL A;  3AN2 D;  5B0Z A;  2F8N H;  3WTP B;  5B40 B;  5CPJ C;  3AYW B;  3NQU B;  1ZLA D;  3W96 B;  3W97 C;  3O62 A;  1S32 D;  2BG1 A;  3KFU G;  5AVC B;  1P3M D;  3REI D;  1TZY D;  5B24 A;  3UT9 C;  5KDM B;  1KX3 C;  3AZE A;  4G91 B;  3AZJ C;  1M1A D;  4J8X C;  1P3B A;  1EQZ B;  3A1I A;  5B2J B;  1P3G B;  3AZL C;  4LD9 D;  5B0Z C;  2ZY2 A;  5DNM A;  2XD5 A;  3AN2 A;  3B0D B;  3AZN B;  3O62 C;  3R45 B;  4H9S A;  1P3I D;  1ZLA A;  4H9P A;  1BH8 B;  1M18 B;  5BNX A;  1S32 A;  3B6G B;  5B24 C;  3AZE C;  1TZY A;  3WA9 B;  1P3B C;  5AY8 B;  4YM6 B;  1M1A A;  3MVD D;  2YFW A;  5DNM C;  5GT0 B;  2BYM B;  3AN2 C;  2BYK B;  4X23 D;  4LD9 A;  4XUJ B;  3W98 D;  5B2I D;  3REH D;  1KX5 B;  1ZLA C;  5B0Y B;  3NQJ A;  2HIO B;  1S32 C;  1P3I A;  3MNN D;  1P3M C;  3REI C;  1TZY C;  5BS7 A;  3LZ0 D;  1P3O B;  5B31 D;  2DF4 C;  1ULY A;  1M1A C;  4Z2M H;  4H9R A;  5DNN B;  4LD9 C;  5CPK D;  3B6F B;  4X23 A;  3W98 A;  3REH A;  1P3I C;  4DRA A;  2UWX A;  3KXB D;  5BS7 C;  3EPJ A;  5G49 A;  3MNN A;  1B6W A;  3REL A;  1U35 B;  3AZI D;  3WTP D;  4Z5T B;  4NFT A;  3LZ0 A;  5GSU D;  3W96 D;  5B31 A;  4XZQ D;  3REK B;  3MVD C;  4X23 C;  4WU9 B;  4YS3 A;  1P3A D;  4QLC D;  5AV6 B;  5CPK A;  3REH C;  3W98 C;  2NZD A;  2Y2H A;  2Y2O A;  4WZS B;  3EPL A;  3AZF D;  4J8V B;  3MNN C;  1H3O B;  1P3L D;  3KXB A;  3LZ0 C;  3WAA B;  5B31 C;  3AZI A;  5B31 G;  4UUZ A;  4ZBJ B;  5B1L D;  3EPK A;  3AZN D;  3F6T A;  3VH5 A;  5GSU A;  5BNV A;  3AL0 C;  1M18 D;  4YS3 C;  4KUD B;  2F2A C;  5CPK C;  2Y2M A;  5B32 D;  2F8N D;  3REJ A;  3VH5 T;  3LEL D;  1P3A A;  4QLC A;  3WA9 D;  5BT1 D;  1P3K A;  3KXB C;  3AZF A;  5GT0 D;  3MGR D;  2YFV A;  3LJA A;  3MGS D;  1P3L A;  5AV5 B;  3AZI C;  5GXQ B;  5E5A A;  3WTP C;  3KUY A;  4WU8 D;  4HGA C;  3TU4 B;  5GSU C;  2YFW B;  3W96 C;  4XZQ C;  1KX4 A;  5B1L A;  2Y2N A;  4J8W D;  3X1U B;  1P3A C;  4QLC C;  1P3F D;  1W2E A;  5B32 A;  3AZM B;  1P3K C;  3W99 D;  4H9O A;  1P3O D;  2F8N A;  3LEL A;  3X1V B;  4J8U D;  3AZF C;  2LY8 A;  3AZK A;  3LJA C;  1AOI D;  1P3L C;  1P3P A;  4H9Q A;  3C1C B;  4E45 A;  3KUY C;  4H9N A;  3MGR A;  3MGS A;  3B6F D;  3VH6 A;  1KX4 C;  5B1L C;  4WU8 A;  3A6N D;  4ZUX A;  4Z66 D;  5B32 C;  3V9R A;  2CV5 B;  4J8W A;  1U35 D;  3LEL C;  1P3F A;  4Z5T D;  2PYO B;  5BT1 C;  3W99 A;  1P3P C;  1M19 D;  3AZH B;  2HUE B;  4JJN B;  5B33 D;  4J8U A;  3REL B;  3MGR C;  3MGP B;  3MGS C;  1AOI A;  4WU8 C;  4KHA A;  2RVQ D;  3WKJ B;  5JRG B;  4ZUX C;  4J8V D;  4J8W C;  3H0R C;  1P3F C;  3A6N A;  3KSY A;  4Z66 A;  3AV1 A;  2FJ7 B;  3WAA D;  3W99 C;  4EO5 B;  4KGC D;  5CPI B;  4WV4 B;  4AWL B;  2RIQ A;  4J8U C;  1P34 D;  3MGQ B;  1AOI C;  1M19 A;  4WNN B;  4KUD D;  5B33 A;  2NQB B;  1TAF B;  5AV8 B;  3C1B D;  3B6F C;  3VH6 W;  3AZG D;  3KWQ B;  1P3M A;  1JFI A;  2Y2K A;  2Y2Q A;  3REI A;  3UTB D;  3A6N C;  1BH9 A;  1N1J B;  4NE3 A;  4Z66 C;  3AV1 C;  1U35 C;  2G5H C;  5B1M B;  4Z5T C;  4KGC A;  5C3I C;  4CAY B;  3X1T B;  5AV9 B;  1M19 C;  1ID3 B;  5B33 C;  1P34 A;  5CP6 B;  3AFA B;  3X1S D;  3AZM D;  5AVB B;  2RVQ C;  5FUG A;  5F99 B;  3AV2 D;  3C1B A;  4R8P B;  3AZG A;  1BFM A;  1F66 B;  1HQ3 B;  3UTB A;  4WJ3 C;  5BO0 B;  3WAA C;  4KGC C;  2DQN C;  1P34 C;  3MVD A;  5GT3 D;  4KUD C;  5CPJ B;  2ARO D;  3FDD A;  4M6B A;  3H0L C;  3UTA D;  5B2I A;  3C1B C;  4CSR A;  3W97 B;  3AZG C;  3X1S A;  5JA4 B;  3LZ1 B;  2PYO D;  3AV2 A;  3AZH D;  3UTB C;  3UT9 B;  5B40 D;  3MGP D;  2Y2I A;  3AYW D;  1KX3 B;  3IP4 C;  3AZJ B;  1WWI A;  4J8X B;  3AZL B;  4UPK A;  5B0Z B;  5AVC D;  5JRG D;  5B2I C;  5GT3 A;  3O62 B;  1EQZ D;  2ARO A;  3X1S C;  3UTA A;  5B2J D;  3AV2 C;  1P3G D;  2ZY5 A;  5B24 B;  3MGQ D;  3AZE B;  1P3B B;  3WTP A;  5B40 A;  5AV8 D;  3NQU A;  3AYW A;  2IO5 C;  5DNM B;  3W96 A;  4XZQ A;  3AN2 B;  3B6G D;  5AVC A;  5GT3 C;  2Y2G A;  2ARO C;  1ZLA B;  3UTA C;  4H9P B;  4DRB A;  5AY8 D;  2JCH A;  4G92 B;  5BNX B;  5KDM A;  4YM6 D;  1S32 B;  2PYO C;  5B2J A;  1P3G A;  3X1T D;  1TZY B;  2HUE C;  2JSS A;  4XUJ D;  5B40 C;  3AYW C;  5CP6 D;  1R4V A;  1KX5 D;  3AFA D;  1M1A B;  5B0Y D;  3AZN A;  3R45 A;  2HIO D;  4LD9 B;  5AVC C;  5CHL B;  1BH8 A;  1M18 A;  1F66 D;  2L5A A;  3B6G A;  3NQJ B;  1P3I B;  4G91 C;  1EQZ C;  3WA9 A;  5AY8 A;  5DNN D;  5B2J C;  1P3G C;  4YM6 A;  5GT0 A;  2BYM A;  1F1E A;  2BYK A;  3EG5 B;  4H9R B;  3B0D C;  4XUJ A;  3AZN C;  1KX5 A;  5B0Y A;  1M18 C;  3LZ1 D;  3VH6 T;  2HIO A;  3B0B A;  4X23 B;  3B6G C;  2FFF B;  5B32 G;  2F8N G;  3W98 B;  3REH B;  3WA9 C;  5AY8 C;  1P3O A;  3B0C W;  3REK D;  5G49 B;  4YM6 C;  5GT0 C;  3MNN B;  5DNN A;  4WU9 D;  3LZ0 B;  4XUJ C;  2Y2L A;  5AV6 D;  5B31 B;  1KX5 C;  3B6F A;  5B0Y C;  2ZY3 A;  2HIO C;  4YS3 B;  2F8N K;  5CPK B;  2NZD B;  1F66 C;  2VQR A;  1P3O C;  1U35 A;  1P3B D;  2W8S A;  4Z5T A;  5DNN C;  3KXB B;  3REK A;  4DQY B;  3AZI B;  4UUZ B;  4WU9 A;  4HGA B;  5AV6 A;  5GSU B;  5BNV B;  4XZQ B;  3LZ1 C;  4J8V A;  3REJ B;  1P3A B;  1H3O A;  5AV5 D;  4QLC B;  1P3K B;  5GXQ D;  3WAA A;  3TU4 D;  3AZF B;  3REK C;  2YFV B;  3LJA B;  1P3L B;  2Y2P A;  5E5A B;  3KUY B;  3X1U D;  4WU9 C;  2CWE A;  3WTP E;  5AV6 C;  4KUD A; 
#chains in the Genus database with same CATH homology
 1KX4 B;  5B1L B;  3X1V D;  2ZM5 A;  4Z2M G;  4J8V C;  4NE5 A;  5B32 B;  3C1C D;  2F8N B;  4H9O B;  3LEL B;  5AV5 A;  3AZK B;  4ZBJ C;  5GXQ A;  1P3P B;  4H9Q B;  3TU4 A;  3P5J B;  1HTA A;  4H9N B;  3MGR B;  3MGS B;  2CV5 D;  4WU8 B;  3X1U A;  4H9S C;  3AZM A;  4G92 C;  1Q9C A;  4ZUX B;  3X1V A;  4JJN D;  3REL D;  3V9R B;  4J8W B;  1P3F B;  5AV5 C;  5GXQ C;  3C1C A;  3W99 B;  2JE5 A;  3WKJ D;  3TU4 C;  4J8U B;  3EPH A;  1AOI B;  1A7W A;  4YS3 D;  2NZD D;  3X1U C;  4KHA B;  2FJ7 D;  3AZM C;  2CV5 A;  5CPI D;  3X1V C;  1Z2C B;  2PYO A;  3A6N B;  4Z66 B;  3AZH A;  4JJN A;  2XD1 A;  3AV1 B;  3C1C C;  2NQB D;  3MGP A;  5C3I B;  3KWQ D;  1M19 B;  3WKJ A;  5B33 B;  5JRG A;  3REJ D;  3H0M C;  2CV5 C;  1PZR A;  5B1M D;  1P3K D;  1EQZ A;  1P3M B;  1JFI B;  2FJ7 A;  3REI B;  1BH9 B;  5AV9 D;  4JJN C;  3B0C T;  3AZH C;  5CPI A;  3LJA D;  1ID3 D;  3REL C;  3MGQ A;  3MGP C;  5E5A D;  3KUY D;  4WNN A;  1WWS A;  2NQB A;  4KGC B;  5AVB D;  5F99 D;  1TAF A;  4NE6 A;  5AV8 A;  2G5I C;  1KX4 D;  3WKJ C;  1P34 B;  4R8P D;  1T3U A;  5JRG C;  1HQ3 D;  3KWQ A;  1B67 A;  2NZD C;  5FUG B;  2Y2J A;  1N1J A;  3C1B B;  2FJ7 C;  4EO5 C;  3AZG B;  2J8P A;  5CPI C;  4AWL C;  5B1M A;  3AZK D;  3MGQ C;  1P3P D;  3UTB B;  2ZY4 A;  4CAY A;  5AV9 A;  3X1T A;  1ID3 A;  5CPJ D;  2NQB C;  5AV8 C;  5CP6 A;  3W97 D;  3AFA A;  3MVD B;  5F99 A;  5AVB A;  3KWQ C;  4E44 A;  4ZUX D;  4R8P A;  5B2I B;  1F66 A;  3UT9 D;  4CSR B;  3REJ C;  1HQ3 A;  1KX3 D;  3AZJ D;  3X1S B;  4J8X D;  5B1M C;  3AV2 B;  5BO0 A;  3AZL D;  5B0Z D;  3X1T C;  5AV9 C;  1ID3 C;  5CP6 C;  5E5A C;  3AFA C;  3O62 D;  5CPJ A;  2IO5 B;  5AVB C;  5F99 C;  3W97 A;  4R8P C;  3VH5 W;  5JA4 A;  5B24 D;  3LZ1 A;  5GT3 B;  1HQ3 C;  3AZE D;  2ARO B;  3UTA B;  3AV1 D;  1KU5 A;  3UT9 A;  1KX3 A;  3AZJ A;  3A1K A;  5DNM D;  4J8X A;  3AZK C;  3AZL A;  3AN2 D;  5B0Z A;  2F8N H;  3WTP B;  5B40 B;  5CPJ C;  3AYW B;  3NQU B;  1ZLA D;  3W96 B;  3W97 C;  3O62 A;  1S32 D;  2BG1 A;  3KFU G;  5AVC B;  1P3M D;  3REI D;  1TZY D;  5B24 A;  3UT9 C;  5KDM B;  1KX3 C;  3AZE A;  4G91 B;  3AZJ C;  1M1A D;  4J8X C;  1P3B A;  1EQZ B;  3A1I A;  5B2J B;  1P3G B;  3AZL C;  4LD9 D;  5B0Z C;  2ZY2 A;  5DNM A;  2XD5 A;  3AN2 A;  3B0D B;  3AZN B;  3O62 C;  3R45 B;  4H9S A;  1P3I D;  1ZLA A;  4H9P A;  1BH8 B;  1M18 B;  5BNX A;  1S32 A;  3B6G B;  5B24 C;  3AZE C;  1TZY A;  3WA9 B;  1P3B C;  5AY8 B;  4YM6 B;  1M1A A;  3MVD D;  2YFW A;  5DNM C;  5GT0 B;  2BYM B;  3AN2 C;  2BYK B;  4X23 D;  4LD9 A;  4XUJ B;  3W98 D;  5B2I D;  3REH D;  1KX5 B;  1ZLA C;  5B0Y B;  3NQJ A;  2HIO B;  1S32 C;  1P3I A;  3MNN D;  1P3M C;  3REI C;  1TZY C;  5BS7 A;  3LZ0 D;  1P3O B;  5B31 D;  2DF4 C;  1ULY A;  1M1A C;  4Z2M H;  4H9R A;  5DNN B;  4LD9 C;  5CPK D;  3B6F B;  4X23 A;  3W98 A;  3REH A;  1P3I C;  4DRA A;  2UWX A;  3KXB D;  5BS7 C;  3EPJ A;  5G49 A;  3MNN A;  1B6W A;  3REL A;  1U35 B;  3AZI D;  3WTP D;  4Z5T B;  4NFT A;  3LZ0 A;  5GSU D;  3W96 D;  5B31 A;  4XZQ D;  3REK B;  3MVD C;  4X23 C;  4WU9 B;  4YS3 A;  1P3A D;  4QLC D;  5AV6 B;  5CPK A;  3REH C;  3W98 C;  2NZD A;  2Y2H A;  2Y2O A;  4WZS B;  3EPL A;  3AZF D;  4J8V B;  3MNN C;  1H3O B;  1P3L D;  3KXB A;  3LZ0 C;  3WAA B;  5B31 C;  3AZI A;  5B31 G;  4UUZ A;  4ZBJ B;  5B1L D;  3EPK A;  3AZN D;  3F6T A;  3VH5 A;  5GSU A;  5BNV A;  3AL0 C;  1M18 D;  4YS3 C;  4KUD B;  2F2A C;  5CPK C;  2Y2M A;  5B32 D;  2F8N D;  3REJ A;  3VH5 T;  3LEL D;  1P3A A;  4QLC A;  3WA9 D;  5BT1 D;  1P3K A;  3KXB C;  3AZF A;  5GT0 D;  3MGR D;  2YFV A;  3LJA A;  3MGS D;  1P3L A;  5AV5 B;  3AZI C;  5GXQ B;  5E5A A;  3WTP C;  3KUY A;  4WU8 D;  4HGA C;  3TU4 B;  5GSU C;  2YFW B;  3W96 C;  4XZQ C;  1KX4 A;  5B1L A;  2Y2N A;  4J8W D;  3X1U B;  1P3A C;  4QLC C;  1P3F D;  1W2E A;  5B32 A;  3AZM B;  1P3K C;  3W99 D;  4H9O A;  1P3O D;  2F8N A;  3LEL A;  3X1V B;  4J8U D;  3AZF C;  2LY8 A;  3AZK A;  3LJA C;  1AOI D;  1P3L C;  1P3P A;  4H9Q A;  3C1C B;  4E45 A;  3KUY C;  4H9N A;  3MGR A;  3MGS A;  3B6F D;  3VH6 A;  1KX4 C;  5B1L C;  4WU8 A;  3A6N D;  4ZUX A;  4Z66 D;  5B32 C;  3V9R A;  2CV5 B;  4J8W A;  1U35 D;  3LEL C;  1P3F A;  4Z5T D;  2PYO B;  5BT1 C;  3W99 A;  1P3P C;  1M19 D;  3AZH B;  2HUE B;  4JJN B;  5B33 D;  4J8U A;  3REL B;  3MGR C;  3MGP B;  3MGS C;  1AOI A;  4WU8 C;  4KHA A;  2RVQ D;  3WKJ B;  5JRG B;  4ZUX C;  4J8V D;  4J8W C;  3H0R C;  1P3F C;  3A6N A;  3KSY A;  4Z66 A;  3AV1 A;  2FJ7 B;  3WAA D;  3W99 C;  4EO5 B;  4KGC D;  5CPI B;  4WV4 B;  4AWL B;  2RIQ A;  4J8U C;  1P34 D;  3MGQ B;  1AOI C;  1M19 A;  4WNN B;  4KUD D;  5B33 A;  2NQB B;  1TAF B;  5AV8 B;  3C1B D;  3B6F C;  3VH6 W;  3AZG D;  3KWQ B;  1P3M A;  1JFI A;  2Y2K A;  2Y2Q A;  3REI A;  3UTB D;  3A6N C;  1BH9 A;  1N1J B;  4NE3 A;  4Z66 C;  3AV1 C;  1U35 C;  2G5H C;  5B1M B;  4Z5T C;  4KGC A;  5C3I C;  4CAY B;  3X1T B;  5AV9 B;  1M19 C;  1ID3 B;  5B33 C;  1P34 A;  5CP6 B;  3AFA B;  3X1S D;  3AZM D;  5AVB B;  2RVQ C;  5FUG A;  5F99 B;  3AV2 D;  3C1B A;  4R8P B;  3AZG A;  1BFM A;  1F66 B;  1HQ3 B;  3UTB A;  4WJ3 C;  5BO0 B;  3WAA C;  4KGC C;  2DQN C;  1P34 C;  3MVD A;  5GT3 D;  4KUD C;  5CPJ B;  2ARO D;  3FDD A;  4M6B A;  3H0L C;  3UTA D;  5B2I A;  3C1B C;  4CSR A;  3W97 B;  3AZG C;  3X1S A;  5JA4 B;  3LZ1 B;  2PYO D;  3AV2 A;  3AZH D;  3UTB C;  3UT9 B;  5B40 D;  3MGP D;  2Y2I A;  3AYW D;  1KX3 B;  3IP4 C;  3AZJ B;  1WWI A;  4J8X B;  3AZL B;  4UPK A;  5B0Z B;  5AVC D;  5JRG D;  5B2I C;  5GT3 A;  3O62 B;  1EQZ D;  2ARO A;  3X1S C;  3UTA A;  5B2J D;  3AV2 C;  1P3G D;  2ZY5 A;  5B24 B;  3MGQ D;  3AZE B;  1P3B B;  3WTP A;  5B40 A;  5AV8 D;  3NQU A;  3AYW A;  2IO5 C;  5DNM B;  3W96 A;  4XZQ A;  3AN2 B;  3B6G D;  5AVC A;  5GT3 C;  2Y2G A;  2ARO C;  1ZLA B;  3UTA C;  4H9P B;  4DRB A;  5AY8 D;  2JCH A;  4G92 B;  5BNX B;  5KDM A;  4YM6 D;  1S32 B;  2PYO C;  5B2J A;  1P3G A;  3X1T D;  1TZY B;  2HUE C;  2JSS A;  4XUJ D;  5B40 C;  3AYW C;  5CP6 D;  1R4V A;  1KX5 D;  3AFA D;  1M1A B;  5B0Y D;  3AZN A;  3R45 A;  2HIO D;  4LD9 B;  5AVC C;  5CHL B;  1BH8 A;  1M18 A;  1F66 D;  2L5A A;  3B6G A;  3NQJ B;  1P3I B;  4G91 C;  1EQZ C;  3WA9 A;  5AY8 A;  5DNN D;  5B2J C;  1P3G C;  4YM6 A;  5GT0 A;  2BYM A;  1F1E A;  2BYK A;  3EG5 B;  4H9R B;  3B0D C;  4XUJ A;  3AZN C;  1KX5 A;  5B0Y A;  1M18 C;  3LZ1 D;  3VH6 T;  2HIO A;  3B0B A;  4X23 B;  3B6G C;  2FFF B;  5B32 G;  2F8N G;  3W98 B;  3REH B;  3WA9 C;  5AY8 C;  1P3O A;  3B0C W;  3REK D;  5G49 B;  4YM6 C;  5GT0 C;  3MNN B;  5DNN A;  4WU9 D;  3LZ0 B;  4XUJ C;  2Y2L A;  5AV6 D;  5B31 B;  1KX5 C;  3B6F A;  5B0Y C;  2ZY3 A;  2HIO C;  4YS3 B;  2F8N K;  5CPK B;  2NZD B;  1F66 C;  2VQR A;  1P3O C;  1U35 A;  1P3B D;  2W8S A;  4Z5T A;  5DNN C;  3KXB B;  3REK A;  4DQY B;  3AZI B;  4UUZ B;  4WU9 A;  4HGA B;  5AV6 A;  5GSU B;  5BNV B;  4XZQ B;  3LZ1 C;  4J8V A;  3REJ B;  1P3A B;  1H3O A;  5AV5 D;  4QLC B;  1P3K B;  5GXQ D;  3WAA A;  3TU4 D;  3AZF B;  3REK C;  2YFV B;  3LJA B;  1P3L B;  2Y2P A;  5E5A B;  3KUY B;  3X1U D;  4WU9 C;  2CWE A;  3WTP E;  5AV6 C;  4KUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...