3KWQD

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kwqD00
1M19C 2NQBB 3VH5A 1U35B 4H9PA 4JJNB 1M18B 3LJAA 4HGAB 1F1EA 3KUYC 5B31A 4NE5A 3C1CC 4H9RB 1EQZA 4QLCA 3V9RA 3UTBC 3B0BA 1JFIA 3REJA 3AZGB 4YS3B 4LD9A 3AV1C 1TAFA 4Z66A 4AWLC 3VH6W 2PYOA 1HTAA 5AVBB 5FUGB 1P3LD 3MGPA 4WNNA 5B32C 5DNNC 3X1UC 5GT0D 5CHLB 1P34B 3AZEA 3A6NA 3WTPD 4UUZA 4X23B 2FJ7A 5B40C 5F99C 5AVCB 5GSUD 3LELA 5CPIC 5AV6A 3LZ1B 2HIOD 5B40D 3X1VA 3KWQA 4KHAB 2YFWB 1KX5A 5JRGB 3AZNB 3AFAC 3AZKA 5B24C 4M6BA 1ZLAD 3W97A 5B1MD 5GT3A 3REKC 3MGSD 3MNNA 4J8XC 3MGQC 3AV2B 4XZQA 5AV5D 1M1AD 1P3IC 2AROD 2F8ND 5KDMA 3MVDD 1TZYD 1P3KA 1AOIB 1ID3C 4XUJA 5E5AB 5GXQA 5JA4B 3W96B 5CPJD 3AZJC 2L5AA 5BS7C 1P3PD 4Z5TD 5CPKA 2IO5C 1F66D 3KXBA 3AN2A 3X1TC 1P3AD 5B32G 5BNXA 3X1TD 3B6FC 3REIA 3MGRA 3WTPE 5B2ID 3AYWD 5DNMD 5B2JD 3NQJA 2LY8A 3LJAC 2NQBC 1P3LB 4JJNC 5CP6A 3LJAD 3R45A 1P3OA 4HGAC 5GT0B 4J8WA 4QLCC 1EQZC 3WKJD 5B32B 5B31D 2F8NG 3REHD 3WTPB 3WAAA 1EQZD 3REJD 3AZGC 3B6GA 4YS3C 1B67A 4LD9D 2HIOB 5B40B 3MGPC 4KUDA 1WWSA 4Z66D 4H9OA 5GSUA 2PYOD 5AVBC 1ZLAB 4G92B 5BO0A 5B1MB 3AZEC 3MGSB 4H9QB 2CV5A 5AV8A 1P34C 5AV5B 3A6ND 1M1AB 4X23C 2FJ7D 2NZDA 2AROB 4ZBJB 3VH6A 2F8NB 3MVDB 3KSYA 3LZ0A 5AVCC 3NQUB 3LELD 1KX5C 5AV6D 3LZ1C 3X1VD 3KWQD 5CPJB 3W98A 1TZYA 1ID3B 1P3PB 1KX5D 4Z5TB 5JRGC 3RELA 3AZKD 3W97D 1F66B 1P3AB 4CSRA 4XZQC 5GT3D 4ZUXA 3MNND 5B31G 1P3KC 4XZQD 3X1TB 5B0YA 5GXQC 1P3BA 1P3KD 1AOIC 5AY8A 4XUJD 2RVQC 5B2IB 3AYWB 5DNMB 5B2JB 3KXBC 4J8UD 1A7WA 5CPKD 4H9PB 3AN2D 5B0ZA 2YFVA 3LJAB 3REIC 3MGRC 1N1JA 3AZLA 5B31B 3REID 3MGRD 1EQZB 4QLCB 3V9RB 1JFIB 3WKJA 4WZSB 3REJB 3REHA 4LD9B 5G49A 1TAFB 3O62A 3B0CT 4Z66B 2PYOB 1P3LC 1BH8A 3MGPB 4WNNB 5CP6D 2BYMA 4WU8A 1P3OD 5GT0C 4J8WD 4WU9A 1B6WA 3AZEB 1KX4A 3A6NB 2FJ7B 4UUZB 3WTPC 3WAAD 5GSUC 3LELB 3B6GD 5AV6B 2HIOC 4KUDD 3X1VB 3KWQB 1P3FD 1KX5B 3AZKB 1ZLAC 3W99A 4G92C 3W97B 5B1MC 5GT3B 3MGSC 3MNNB 4YM6A 2CV5D 4Z2MH 5AV8D 4XZQB 5AV5C 1M1AC 2NZDD 3WA9A 2AROC 4H9NA 4ZBJC 5KDMB 1P3KB 3MVDC 1TZYC 3LZ0D 4XUJB 3RELC 3AZIA 5GXQB 5BT1D 1KX3A 3W98D 5CPJC 1P3PC 3RELD 4Z5TC 1P3GA 4J8VA 5CPKB 4NE6A 1P3MA 4R8PA 1F66C 3KXBB 4J8UA 4ZUXD 3AN2B 2BYKA 1P3AC 5BNXB 5B0YD 3C1BA 5B1LA 3REIB 1S32A 3MGRB 5C3IB 1P3BD 5AY8D 3UT9A 3X1SA 5B2IC 3AYWC 5B33A 5DNMC 5B2JC 3UTAA 3NQJB 5B0ZD 5CP6B 1P3OB 3R45B 4J8WB 1H3OA 3AZLD 3WKJC 5B31C 3REHC 1HQ3A 3WAAB 3O62C 3TU4A 4KGCA 3REJC 3B6GB 3AZMA 4LD9C 3B0CW 4KUDB 3O62D 1KU5A 3AZFD 4H9OB 5GSUB 4Z66C 1M19A 2PYOC 1P3FA 5BO0B 4WU8D 4WU9D 2CV5B 3KUYA 5AV8B 1KX4D 3C1CA 3A6NC 2FJ7C 2NZDB 3UTBA 1BH9A 5AV9D 2HUEB 3LZ0B 3AZHA 3LELC 5AV6C 3VH6T 1U35D 3AV1A 3X1VC 5BNVA 3KWQC 3W98B 1TZYB 2CWEA 3RELB 3AZKC 3B0DB 3W99D 3W97C 5DNNA 4CSRB 4ZUXB 5GT3C 4H9SA 4YM6D 3MNNC 3X1UA 4CAYA 5B0YB 3WA9D 1P3BB 5F99A 5AY8B 5CPIA 4XUJC 3AZID 1KX3D 4J8UC 3AFAA 4J8VD 1P3GD 5B24A 5CPKC 1P3MD 4R8PD 3REKA 5B0ZB 3AN2C 2YFVB 4J8XA 2F8NH 3MGQA 1N1JB 3AZLB 3C1BD 1P3IA 5B1LD 1S32D 3VH5T 5C3IC 3WKJB 3REHB 3UT9D 3X1SD 3AZJA 5G49B 5B33D 3O62B 5BS7A 3UTAD 1R4VA 1BH8B 4G91C 5CP6C 2BYMB 4WU8B 3AZFA 1P3OC 4J8WC 4WU9B 3B6FA 1KX4B 1HQ3D 3WAAC 3TU4D 4KGCD 3B6GC 3AZMD 2JSSA 1P3FC 4KUDC 5AV9A 1M19D 2NQBA 1U35A 3W99B 4JJNA 1M18A 4YM6B 2CV5C 3KUYD 3AZHC 5AV8C 3C1CD 4H9RA 2NZDC 3WA9B 4H9NB 3UTBD 3AZHD 2HUEC 3LZ0C 3AZGA 4YS3A 3AZIB 5BT1C 1KX3B 3AV1D 3W98C 4H9SC 5AVBA 5FUGA 4J8VB 1P3GB 3B0DC 1P3MB 5B32D 4R8PB 5DNND 4J8UB 4ZUXC 2BYKB 3X1UD 1P34A 5B0YC 3C1BB 4X23A 5B1LB 1S32B 5F99D 1P3BC 5AVCA 5AY8C 5CPID 3LZ1A 3UT9B 3X1SB 4KHAA 5B33B 2YFWA 4EO5B 3UTAB 5JRGA 3AZNA 3AFAD 5B24D 3REKD 5B0ZC 4J8XD 3MGQD 4WV4B 3AV2A 1H3OB 4G91B 3AZLC 3VH5W 1P3ID 1HQ3B 1AOIA 1ID3D 3TU4B 4KGCB 5E5AA 3AZMB 4DRAA 3W96A 5JA4A 4NFTA 3AZJD 3AZFC 4NE3A 1M19B 1P3FB 1ULYA 4WU8C 1Q9CA 4WU9C 3KUYB 3B6FD 3C1CB 1KX4C 3UTBB 1BH9B 3AZHB 5AV9C 1U35C 3AV1B 5BNVB 4AWLB 1M18C 2NQBD 1P3LA 3W99C 4JJND 5DNNB 1M18D 4YM6C 1BFMA 3X1UB 5GT0A 4QLCD 4CAYB 5B32A 3WTPA 3WA9C 5F99B 3AZGD 5CPIB 4YS3D 3AZIC 2HIOA 5B40A 3MGPD 1KX3C 5AVBD 3AFAB 1P3GC 4J8VC 5B24B 1ZLAA 1P3MC 4R8PC 3REKB 5B1MA 3AZED 3MGSA 4J8XB 3MGQB 4H9QA 1P34D 2F8NK 5AV5A 3C1BC 4X23D 1P3IB 1M1AA 5B1LC 2AROA 1S32C 1WWIA 2F8NA 3MVDA 4E44A 5AVCD 3NQUA 3AZNC 3LZ1D 3UT9C 3X1SC 4E45A 3AZJB 5CPJA 5B33C 4EO5C 1ID3A 3UTAC 1P3PA 4Z5TA 5JRGD 3AZND 3AV2C 2IO5B 1F66A 1P3AA 3AZFB 3AV2D 3X1TA 3B6FB 4DRBA 5GXQD 5E5AC 1HQ3C 3W96C 4Z2MG 1AOID 3TU4C 4KGCC 5E5AD 2RVQD 3AZMC 3W96D 5B2IA 3AYWA 5DNMA 5B2JA 3KXBD 5AV9B
chains in the Genus database with same CATH superfamily
1M19C 2NQBB 3VH5A 1U35B 4H9PA 4JJNB 1M18B 3LJAA 4HGAB 1F1EA 3KUYC 5B31A 4NE5A 3C1CC 4H9RB 1EQZA 4QLCA 3V9RA 3UTBC 3B0BA 1JFIA 3REJA 3AZGB 4YS3B 4LD9A 3AV1C 1TAFA 2Y2LA 4Z66A 4AWLC 3VH6W 2PYOA 1HTAA 5AVBB 5FUGB 1P3LD 3MGPA 4WNNA 5B32C 5DNNC 3X1UC 5GT0D 5CHLB 1P34B 3AZEA 3A6NA 3WTPD 4UUZA 4X23B 2FJ7A 5B40C 5F99C 5AVCB 5GSUD 3LELA 5CPIC 5AV6A 3LZ1B 2HIOD 5B40D 3X1VA 3KWQA 4KHAB 2YFWB 1KX5A 5JRGB 3AZNB 2XD1A 3AFAC 3AZKA 5B24C 4M6BA 1ZLAD 3W97A 5B1MD 5GT3A 3REKC 3MGSD 3MNNA 4J8XC 3MGQC 3AV2B 4XZQA 5AV5D 1M1AD 1P3IC 2AROD 2F8ND 5KDMA 3MVDD 1TZYD 1P3KA 1AOIB 1ID3C 4XUJA 5E5AB 5GXQA 5JA4B 3W96B 5CPJD 3AZJC 2L5AA 5BS7C 1P3PD 4Z5TD 5CPKA 2IO5C 1F66D 3KXBA 3AN2A 3X1TC 1P3AD 5B32G 5BNXA 3X1TD 3B6FC 3REIA 3MGRA 2G5HC 3WTPE 5B2ID 3AYWD 5DNMD 5B2JD 3NQJA 2LY8A 3LJAC 2NQBC 1P3LB 4JJNC 5CP6A 3LJAD 3R45A 1P3OA 4HGAC 5GT0B 4J8WA 4QLCC 1EQZC 3WKJD 5B32B 5B31D 2F8NG 3REHD 3WTPB 3WAAA 1EQZD 2Y2MA 3REJD 3AZGC 3B6GA 4YS3C 1B67A 4LD9D 2HIOB 5B40B 3MGPC 4KUDA 1WWSA 4Z66D 4H9OA 5GSUA 2PYOD 2RIQA 5AVBC 1ZLAB 4G92B 5BO0A 5B1MB 3AZEC 3MGSB 4H9QB 2CV5A 5AV8A 1P34C 5AV5B 3A6ND 1M1AB 4X23C 2FJ7D 2NZDA 2AROB 4ZBJB 3VH6A 2F8NB 3MVDB 3KSYA 3LZ0A 5AVCC 3NQUB 3LELD 1KX5C 5AV6D 3LZ1C 3X1VD 3KWQD 5CPJB 3W98A 1TZYA 1ID3B 1P3PB 1KX5D 2Y2NA 4Z5TB 5JRGC 3RELA 3AZKD 3W97D 1F66B 1P3AB 4CSRA 4XZQC 5GT3D 4ZUXA 3MNND 5B31G 1Z2CB 2DQNC 1P3KC 4XZQD 3X1TB 5B0YA 3F6TA 5GXQC 1P3BA 2F2AC 1P3KD 1AOIC 5AY8A 4XUJD 2RVQC 2DF4C 5B2IB 3AYWB 5DNMB 5B2JB 3KXBC 4J8UD 1A7WA 5CPKD 4H9PB 3AN2D 5B0ZA 2YFVA 3LJAB 3REIC 3MGRC 1N1JA 3AZLA 5B31B 2Y2PA 2UWXA 3REID 3MGRD 1EQZB 4QLCB 3V9RB 1JFIB 3WKJA 1PZRA 4WZSB 3REJB 3REHA 4LD9B 5G49A 1TAFB 3O62A 3B0CT 4Z66B 2PYOB 3H0MC 1P3LC 1BH8A 3MGPB 4WNNB 5CP6D 2BYMA 4WU8A 1P3OD 5GT0C 4J8WD 4WU9A 1B6WA 2Y2HA 3AZEB 1KX4A 3A6NB 2FJ7B 4UUZB 3WTPC 3WAAD 5GSUC 3LELB 3B6GD 2G5IC 5AV6B 2HIOC 4KUDD 3X1VB 3KWQB 1P3FD 2ZY3A 1KX5B 3AZKB 1ZLAC 3W99A 4G92C 3W97B 5B1MC 5GT3B 3MGSC 3MNNB 4YM6A 2FFFB 2CV5D 4Z2MH 5AV8D 4XZQB 5AV5C 1M1AC 2NZDD 3WA9A 2AROC 4H9NA 4ZBJC 3KFUG 5KDMB 1P3KB 3MVDC 1TZYC 3LZ0D 4XUJB 3EPLA 2ZY5A 3RELC 3AZIA 5GXQB 5BT1D 1KX3A 3W98D 5CPJC 1P3PC 3RELD 4Z5TC 1P3GA 4J8VA 3EPHA 2W8SA 5CPKB 4NE6A 1P3MA 4R8PA 1F66C 3KXBB 4J8UA 4ZUXD 3AN2B 2BYKA 1P3AC 5BNXB 5B0YD 3C1BA 5B1LA 3REIB 1S32A 3MGRB 5C3IB 1P3BD 5AY8D 3UT9A 3X1SA 2J8PA 5B2IC 3AYWC 5B33A 5DNMC 5B2JC 3UTAA 3NQJB 3A1IA 3AL0C 5B0ZD 5CP6B 2ZY4A 1P3OB 3R45B 2XD5A 4J8WB 1H3OA 3AZLD 3WKJC 5B31C 3REHC 1HQ3A 3WAAB 3O62C 3TU4A 4KGCA 3REJC 3B6GB 3AZMA 4LD9C 3B0CW 4KUDB 3O62D 1KU5A 3AZFD 4WJ3C 4H9OB 5GSUB 4Z66C 1M19A 2PYOC 1P3FA 5BO0B 4WU8D 4DQYB 4WU9D 2CV5B 3KUYA 5AV8B 1KX4D 3C1CA 3A6NC 2FJ7C 2NZDB 3UTBA 1BH9A 5AV9D 2HUEB 3LZ0B 3AZHA 3LELC 5AV6C 3VH6T 1U35D 3AV1A 3X1VC 5BNVA 3KWQC 3W98B 2Y2OA 1TZYB 2CWEA 3RELB 3A1KA 3AZKC 2Y2KA 3B0DB 3W99D 3W97C 5DNNA 4CSRB 4ZUXB 5GT3C 4H9SA 4YM6D 3MNNC 3X1UA 4CAYA 5B0YB 3WA9D 1P3BB 5F99A 5AY8B 5CPIA 4XUJC 3AZID 1KX3D 1W2EA 4J8UC 3AFAA 4J8VD 1P3GD 5B24A 5CPKC 1P3MD 4R8PD 3REKA 5B0ZB 3AN2C 2YFVB 4J8XA 2F8NH 3MGQA 3EG5B 1N1JB 3AZLB 3C1BD 1P3IA 5B1LD 2Y2JA 1S32D 3VH5T 5C3IC 3WKJB 3REHB 3UT9D 3X1SD 3AZJA 5G49B 5B33D 3O62B 5BS7A 3UTAD 1R4VA 1BH8B 4G91C 5CP6C 2BYMB 4WU8B 3AZFA 1T3UA 1P3OC 4J8WC 3FDDA 4WU9B 3H0RC 3B6FA 1KX4B 1HQ3D 3WAAC 3TU4D 4KGCD 3B6GC 3AZMD 2JSSA 1P3FC 4KUDC 5AV9A 2ZM5A 1M19D 2NQBA 1U35A 3W99B 4JJNA 1M18A 4YM6B 2CV5C 3KUYD 3AZHC 5AV8C 3C1CD 4H9RA 2VQRA 2NZDC 3WA9B 4H9NB 3UTBD 3AZHD 2HUEC 3LZ0C 3AZGA 4YS3A 3AZIB 5BT1C 1KX3B 3AV1D 3W98C 4H9SC 5AVBA 5FUGA 4J8VB 1P3GB 3B0DC 1P3MB 5B32D 4R8PB 5DNND 4J8UB 4ZUXC 2BYKB 3X1UD 1P34A 2Y2GA 5B0YC 3C1BB 4X23A 5B1LB 1S32B 5F99D 1P3BC 5AVCA 5AY8C 5CPID 3LZ1A 3UT9B 3X1SB 4KHAA 5B33B 2YFWA 4EO5B 3UTAB 5JRGA 3AZNA 3AFAD 5B24D 3REKD 5B0ZC 4J8XD 3MGQD 4WV4B 3AV2A 3IP4C 1H3OB 4G91B 3EPKA 3AZLC 3VH5W 1P3ID 1HQ3B 1AOIA 1ID3D 3TU4B 4KGCB 5E5AA 3AZMB 4DRAA 3W96A 5JA4A 4NFTA 3AZJD 3AZFC 4NE3A 1M19B 1P3FB 1ULYA 4WU8C 1Q9CA 4WU9C 3KUYB 2Y2IA 3B6FD 3C1CB 1KX4C 3UTBB 1BH9B 3AZHB 5AV9C 1U35C 3AV1B 5BNVB 4AWLB 1M18C 2NQBD 1P3LA 3W99C 4JJND 5DNNB 1M18D 4YM6C 1BFMA 3H0LC 5GT0A 3X1UB 4QLCD 4CAYB 5B32A 3WTPA 3WA9C 5F99B 3AZGD 5CPIB 4YS3D 3AZIC 2HIOA 5B40A 3MGPD 1KX3C 2Y2QA 5AVBD 3AFAB 3EPJA 4J8VC 5B24B 1P3GC 1ZLAA 1P3MC 2JE5A 4R8PC 3REKB 5B1MA 3AZED 3MGSA 4J8XB 3MGQB 4H9QA 1P34D 2F8NK 5AV5A 3C1BC 4X23D 1P3IB 1M1AA 5B1LC 2AROA 1S32C 1WWIA 2F8NA 3MVDA 4E44A 5AVCD 3NQUA 3AZNC 3LZ1D 3UT9C 3X1SC 4E45A 3AZJB 5CPJA 5B33C 4EO5C 1ID3A 3UTAC 1P3PA 2BG1A 4Z5TA 5JRGD 3AZND 3AV2C 2IO5B 2JCHA 1F66A 1P3AA 3AZFB 3AV2D 3X1TA 3B6FB 4DRBA 5GXQD 5E5AC 3P5JB 1HQ3C 3W96C 4Z2MG 1AOID 3TU4C 4KGCC 5E5AD 2RVQD 3AZMC 3W96D 5B2IA 3AYWA 4UPKA 5DNMA 5B2JA 3KXBD 5AV9B 2ZY2A
chains in the Genus database with same CATH topology
1M19C 2NQBB 3VH5A 1U35B 4H9PA 4JJNB 1M18B 3LJAA 4HGAB 1F1EA 3KUYC 5B31A 4NE5A 3C1CC 4H9RB 1EQZA 4QLCA 3V9RA 3UTBC 3B0BA 1JFIA 3REJA 3AZGB 4YS3B 4LD9A 3AV1C 1TAFA 2Y2LA 4Z66A 4AWLC 3VH6W 2PYOA 1HTAA 5AVBB 5FUGB 1P3LD 3MGPA 4WNNA 5B32C 5DNNC 3X1UC 5GT0D 5CHLB 1P34B 3AZEA 3A6NA 3WTPD 4UUZA 4X23B 2FJ7A 5B40C 5F99C 5AVCB 5GSUD 3LELA 5CPIC 5AV6A 3LZ1B 2HIOD 5B40D 3X1VA 3KWQA 4KHAB 2YFWB 1KX5A 5JRGB 3AZNB 2XD1A 3AFAC 3AZKA 5B24C 4M6BA 1ZLAD 3W97A 5B1MD 5GT3A 3REKC 3MGSD 3MNNA 4J8XC 3MGQC 3AV2B 4XZQA 5AV5D 1M1AD 1P3IC 2AROD 2F8ND 5KDMA 3MVDD 1TZYD 1P3KA 1AOIB 1ID3C 4XUJA 5E5AB 5GXQA 5JA4B 3W96B 5CPJD 3AZJC 2L5AA 5BS7C 1P3PD 4Z5TD 5CPKA 2IO5C 1F66D 3KXBA 3AN2A 3X1TC 1P3AD 5B32G 5BNXA 3X1TD 3B6FC 3REIA 3MGRA 2G5HC 3WTPE 5B2ID 3AYWD 5DNMD 5B2JD 3NQJA 2LY8A 3LJAC 2NQBC 1P3LB 4JJNC 5CP6A 3LJAD 3R45A 1P3OA 4HGAC 5GT0B 4J8WA 4QLCC 1EQZC 3WKJD 5B32B 5B31D 2F8NG 3REHD 3WTPB 3WAAA 1EQZD 2Y2MA 3REJD 3AZGC 3B6GA 4YS3C 1B67A 4LD9D 2HIOB 5B40B 3MGPC 4KUDA 1WWSA 4Z66D 4H9OA 5GSUA 2PYOD 2RIQA 5AVBC 1ZLAB 4G92B 5BO0A 5B1MB 3AZEC 3MGSB 4H9QB 2CV5A 5AV8A 1P34C 5AV5B 3A6ND 1M1AB 4X23C 2FJ7D 2NZDA 2AROB 4ZBJB 3VH6A 2F8NB 3MVDB 3KSYA 3LZ0A 5AVCC 3NQUB 3LELD 1KX5C 5AV6D 3LZ1C 3X1VD 3KWQD 5CPJB 3W98A 1TZYA 1ID3B 1P3PB 1KX5D 2Y2NA 4Z5TB 5JRGC 3RELA 3AZKD 3W97D 1F66B 1P3AB 4CSRA 4XZQC 5GT3D 4ZUXA 3MNND 5B31G 1Z2CB 2DQNC 1P3KC 4XZQD 3X1TB 5B0YA 3F6TA 5GXQC 1P3BA 2F2AC 1P3KD 1AOIC 5AY8A 4XUJD 2RVQC 2DF4C 5B2IB 3AYWB 5DNMB 5B2JB 3KXBC 4J8UD 1A7WA 5CPKD 4H9PB 3AN2D 5B0ZA 2YFVA 3LJAB 3REIC 3MGRC 1N1JA 3AZLA 5B31B 2Y2PA 2UWXA 3REID 3MGRD 1EQZB 4QLCB 3V9RB 1JFIB 3WKJA 1PZRA 4WZSB 3REJB 3REHA 4LD9B 5G49A 1TAFB 3O62A 3B0CT 4Z66B 2PYOB 3H0MC 1P3LC 1BH8A 3MGPB 4WNNB 5CP6D 2BYMA 4WU8A 1P3OD 5GT0C 4J8WD 4WU9A 1B6WA 2Y2HA 3AZEB 1KX4A 3A6NB 2FJ7B 4UUZB 3WTPC 3WAAD 5GSUC 3LELB 3B6GD 2G5IC 5AV6B 2HIOC 4KUDD 3X1VB 3KWQB 1P3FD 2ZY3A 1KX5B 3AZKB 1ZLAC 3W99A 4G92C 3W97B 5B1MC 5GT3B 3MGSC 3MNNB 4YM6A 2FFFB 2CV5D 4Z2MH 5AV8D 4XZQB 5AV5C 1M1AC 2NZDD 3WA9A 2AROC 4H9NA 4ZBJC 3KFUG 5KDMB 1P3KB 3MVDC 1TZYC 3LZ0D 4XUJB 3EPLA 2ZY5A 3RELC 3AZIA 5GXQB 5BT1D 1KX3A 3W98D 5CPJC 1P3PC 3RELD 4Z5TC 1P3GA 4J8VA 3EPHA 2W8SA 5CPKB 4NE6A 1P3MA 4R8PA 1F66C 3KXBB 4J8UA 4ZUXD 3AN2B 2BYKA 1P3AC 5BNXB 5B0YD 3C1BA 5B1LA 3REIB 1S32A 3MGRB 5C3IB 1P3BD 5AY8D 3UT9A 3X1SA 2J8PA 5B2IC 3AYWC 5B33A 5DNMC 5B2JC 3UTAA 3NQJB 3A1IA 3AL0C 5B0ZD 5CP6B 2ZY4A 1P3OB 3R45B 2XD5A 4J8WB 1H3OA 3AZLD 3WKJC 5B31C 3REHC 1HQ3A 3WAAB 3O62C 3TU4A 4KGCA 3REJC 3B6GB 3AZMA 4LD9C 3B0CW 4KUDB 3O62D 1KU5A 3AZFD 4WJ3C 4H9OB 5GSUB 4Z66C 1M19A 2PYOC 1P3FA 5BO0B 4WU8D 4DQYB 4WU9D 2CV5B 3KUYA 5AV8B 1KX4D 3C1CA 3A6NC 2FJ7C 2NZDB 3UTBA 1BH9A 5AV9D 2HUEB 3LZ0B 3AZHA 3LELC 5AV6C 3VH6T 1U35D 3AV1A 3X1VC 5BNVA 3KWQC 3W98B 2Y2OA 1TZYB 2CWEA 3RELB 3A1KA 3AZKC 2Y2KA 3B0DB 3W99D 3W97C 5DNNA 4CSRB 4ZUXB 5GT3C 4H9SA 4YM6D 3MNNC 3X1UA 4CAYA 5B0YB 3WA9D 1P3BB 5F99A 5AY8B 5CPIA 4XUJC 3AZID 1KX3D 1W2EA 4J8UC 3AFAA 4J8VD 1P3GD 5B24A 5CPKC 1P3MD 4R8PD 3REKA 5B0ZB 3AN2C 2YFVB 4J8XA 2F8NH 3MGQA 3EG5B 1N1JB 3AZLB 3C1BD 1P3IA 5B1LD 2Y2JA 1S32D 3VH5T 5C3IC 3WKJB 3REHB 3UT9D 3X1SD 3AZJA 5G49B 5B33D 3O62B 5BS7A 3UTAD 1R4VA 1BH8B 4G91C 5CP6C 2BYMB 4WU8B 3AZFA 1T3UA 1P3OC 4J8WC 3FDDA 4WU9B 3H0RC 3B6FA 1KX4B 1HQ3D 3WAAC 3TU4D 4KGCD 3B6GC 3AZMD 2JSSA 1P3FC 4KUDC 5AV9A 2ZM5A 1M19D 2NQBA 1U35A 3W99B 4JJNA 1M18A 4YM6B 2CV5C 3KUYD 3AZHC 5AV8C 3C1CD 4H9RA 2VQRA 2NZDC 3WA9B 4H9NB 3UTBD 3AZHD 2HUEC 3LZ0C 3AZGA 4YS3A 3AZIB 5BT1C 1KX3B 3AV1D 3W98C 4H9SC 5AVBA 5FUGA 4J8VB 1P3GB 3B0DC 1P3MB 5B32D 4R8PB 5DNND 4J8UB 4ZUXC 2BYKB 3X1UD 1P34A 2Y2GA 5B0YC 3C1BB 4X23A 5B1LB 1S32B 5F99D 1P3BC 5AVCA 5AY8C 5CPID 3LZ1A 3UT9B 3X1SB 4KHAA 5B33B 2YFWA 4EO5B 3UTAB 5JRGA 3AZNA 3AFAD 5B24D 3REKD 5B0ZC 4J8XD 3MGQD 4WV4B 3AV2A 3IP4C 1H3OB 4G91B 3EPKA 3AZLC 3VH5W 1P3ID 1HQ3B 1AOIA 1ID3D 3TU4B 4KGCB 5E5AA 3AZMB 4DRAA 3W96A 5JA4A 4NFTA 3AZJD 3AZFC 4NE3A 1M19B 1P3FB 1ULYA 4WU8C 1Q9CA 4WU9C 3KUYB 2Y2IA 3B6FD 3C1CB 1KX4C 3UTBB 1BH9B 3AZHB 5AV9C 1U35C 3AV1B 5BNVB 4AWLB 1M18C 2NQBD 1P3LA 3W99C 4JJND 5DNNB 1M18D 4YM6C 1BFMA 3H0LC 5GT0A 3X1UB 4QLCD 4CAYB 5B32A 3WTPA 3WA9C 5F99B 3AZGD 5CPIB 4YS3D 3AZIC 2HIOA 5B40A 3MGPD 1KX3C 2Y2QA 5AVBD 3AFAB 3EPJA 4J8VC 5B24B 1P3GC 1ZLAA 1P3MC 2JE5A 4R8PC 3REKB 5B1MA 3AZED 3MGSA 4J8XB 3MGQB 4H9QA 1P34D 2F8NK 5AV5A 3C1BC 4X23D 1P3IB 1M1AA 5B1LC 2AROA 1S32C 1WWIA 2F8NA 3MVDA 4E44A 5AVCD 3NQUA 3AZNC 3LZ1D 3UT9C 3X1SC 4E45A 3AZJB 5CPJA 5B33C 4EO5C 1ID3A 3UTAC 1P3PA 2BG1A 4Z5TA 5JRGD 3AZND 3AV2C 2IO5B 2JCHA 1F66A 1P3AA 3AZFB 3AV2D 3X1TA 3B6FB 4DRBA 5GXQD 5E5AC 3P5JB 1HQ3C 3W96C 4Z2MG 1AOID 3TU4C 4KGCC 5E5AD 2RVQD 3AZMC 3W96D 5B2IA 3AYWA 4UPKA 5DNMA 5B2JA 3KXBD 5AV9B 2ZY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 C;  2NQB B;  3VH5 A;  1U35 B;  4H9P A;  4JJN B;  1M18 B;  3LJA A;  4HGA B;  1F1E A;  3KUY C;  5B31 A;  4NE5 A;  3C1C C;  4H9R B;  1EQZ A;  4QLC A;  3V9R A;  3UTB C;  3B0B A;  1JFI A;  3REJ A;  3AZG B;  4YS3 B;  4LD9 A;  3AV1 C;  1TAF A;  4Z66 A;  4AWL C;  3VH6 W;  2PYO A;  1HTA A;  5AVB B;  5FUG B;  1P3L D;  3MGP A;  4WNN A;  5B32 C;  5DNN C;  3X1U C;  5GT0 D;  5CHL B;  1P34 B;  3AZE A;  3A6N A;  3WTP D;  4UUZ A;  4X23 B;  2FJ7 A;  5B40 C;  5F99 C;  5AVC B;  5GSU D;  3LEL A;  5CPI C;  5AV6 A;  3LZ1 B;  2HIO D;  5B40 D;  3X1V A;  3KWQ A;  4KHA B;  2YFW B;  1KX5 A;  5JRG B;  3AZN B;  3AFA C;  3AZK A;  5B24 C;  4M6B A;  1ZLA D;  3W97 A;  5B1M D;  5GT3 A;  3REK C;  3MGS D;  3MNN A;  4J8X C;  3MGQ C;  3AV2 B;  4XZQ A;  5AV5 D;  1M1A D;  1P3I C;  2ARO D;  2F8N D;  5KDM A;  3MVD D;  1TZY D;  1P3K A;  1AOI B;  1ID3 C;  4XUJ A;  5E5A B;  5GXQ A;  5JA4 B;  3W96 B;  5CPJ D;  3AZJ C;  2L5A A;  5BS7 C;  1P3P D;  4Z5T D;  5CPK A;  2IO5 C;  1F66 D;  3KXB A;  3AN2 A;  3X1T C;  1P3A D;  5B32 G;  5BNX A;  3X1T D;  3B6F C;  3REI A;  3MGR A;  3WTP E;  5B2I D;  3AYW D;  5DNM D;  5B2J D;  3NQJ A;  2LY8 A;  3LJA C;  2NQB C;  1P3L B;  4JJN C;  5CP6 A;  3LJA D;  3R45 A;  1P3O A;  4HGA C;  5GT0 B;  4J8W A;  4QLC C;  1EQZ C;  3WKJ D;  5B32 B;  5B31 D;  2F8N G;  3REH D;  3WTP B;  3WAA A;  1EQZ D;  3REJ D;  3AZG C;  3B6G A;  4YS3 C;  1B67 A;  4LD9 D;  2HIO B;  5B40 B;  3MGP C;  4KUD A;  1WWS A;  4Z66 D;  4H9O A;  5GSU A;  2PYO D;  5AVB C;  1ZLA B;  4G92 B;  5BO0 A;  5B1M B;  3AZE C;  3MGS B;  4H9Q B;  2CV5 A;  5AV8 A;  1P34 C;  5AV5 B;  3A6N D;  1M1A B;  4X23 C;  2FJ7 D;  2NZD A;  2ARO B;  4ZBJ B;  3VH6 A;  2F8N B;  3MVD B;  3KSY A;  3LZ0 A;  5AVC C;  3NQU B;  3LEL D;  1KX5 C;  5AV6 D;  3LZ1 C;  3X1V D;  3KWQ D;  5CPJ B;  3W98 A;  1TZY A;  1ID3 B;  1P3P B;  1KX5 D;  4Z5T B;  5JRG C;  3REL A;  3AZK D;  3W97 D;  1F66 B;  1P3A B;  4CSR A;  4XZQ C;  5GT3 D;  4ZUX A;  3MNN D;  5B31 G;  1P3K C;  4XZQ D;  3X1T B;  5B0Y A;  5GXQ C;  1P3B A;  1P3K D;  1AOI C;  5AY8 A;  4XUJ D;  2RVQ C;  5B2I B;  3AYW B;  5DNM B;  5B2J B;  3KXB C;  4J8U D;  1A7W A;  5CPK D;  4H9P B;  3AN2 D;  5B0Z A;  2YFV A;  3LJA B;  3REI C;  3MGR C;  1N1J A;  3AZL A;  5B31 B;  3REI D;  3MGR D;  1EQZ B;  4QLC B;  3V9R B;  1JFI B;  3WKJ A;  4WZS B;  3REJ B;  3REH A;  4LD9 B;  5G49 A;  1TAF B;  3O62 A;  3B0C T;  4Z66 B;  2PYO B;  1P3L C;  1BH8 A;  3MGP B;  4WNN B;  5CP6 D;  2BYM A;  4WU8 A;  1P3O D;  5GT0 C;  4J8W D;  4WU9 A;  1B6W A;  3AZE B;  1KX4 A;  3A6N B;  2FJ7 B;  4UUZ B;  3WTP C;  3WAA D;  5GSU C;  3LEL B;  3B6G D;  5AV6 B;  2HIO C;  4KUD D;  3X1V B;  3KWQ B;  1P3F D;  1KX5 B;  3AZK B;  1ZLA C;  3W99 A;  4G92 C;  3W97 B;  5B1M C;  5GT3 B;  3MGS C;  3MNN B;  4YM6 A;  2CV5 D;  4Z2M H;  5AV8 D;  4XZQ B;  5AV5 C;  1M1A C;  2NZD D;  3WA9 A;  2ARO C;  4H9N A;  4ZBJ C;  5KDM B;  1P3K B;  3MVD C;  1TZY C;  3LZ0 D;  4XUJ B;  3REL C;  3AZI A;  5GXQ B;  5BT1 D;  1KX3 A;  3W98 D;  5CPJ C;  1P3P C;  3REL D;  4Z5T C;  1P3G A;  4J8V A;  5CPK B;  4NE6 A;  1P3M A;  4R8P A;  1F66 C;  3KXB B;  4J8U A;  4ZUX D;  3AN2 B;  2BYK A;  1P3A C;  5BNX B;  5B0Y D;  3C1B A;  5B1L A;  3REI B;  1S32 A;  3MGR B;  5C3I B;  1P3B D;  5AY8 D;  3UT9 A;  3X1S A;  5B2I C;  3AYW C;  5B33 A;  5DNM C;  5B2J C;  3UTA A;  3NQJ B;  5B0Z D;  5CP6 B;  1P3O B;  3R45 B;  4J8W B;  1H3O A;  3AZL D;  3WKJ C;  5B31 C;  3REH C;  1HQ3 A;  3WAA B;  3O62 C;  3TU4 A;  4KGC A;  3REJ C;  3B6G B;  3AZM A;  4LD9 C;  3B0C W;  4KUD B;  3O62 D;  1KU5 A;  3AZF D;  4H9O B;  5GSU B;  4Z66 C;  1M19 A;  2PYO C;  1P3F A;  5BO0 B;  4WU8 D;  4WU9 D;  2CV5 B;  3KUY A;  5AV8 B;  1KX4 D;  3C1C A;  3A6N C;  2FJ7 C;  2NZD B;  3UTB A;  1BH9 A;  5AV9 D;  2HUE B;  3LZ0 B;  3AZH A;  3LEL C;  5AV6 C;  3VH6 T;  1U35 D;  3AV1 A;  3X1V C;  5BNV A;  3KWQ C;  3W98 B;  1TZY B;  2CWE A;  3REL B;  3AZK C;  3B0D B;  3W99 D;  3W97 C;  5DNN A;  4CSR B;  4ZUX B;  5GT3 C;  4H9S A;  4YM6 D;  3MNN C;  3X1U A;  4CAY A;  5B0Y B;  3WA9 D;  1P3B B;  5F99 A;  5AY8 B;  5CPI A;  4XUJ C;  3AZI D;  1KX3 D;  4J8U C;  3AFA A;  4J8V D;  1P3G D;  5B24 A;  5CPK C;  1P3M D;  4R8P D;  3REK A;  5B0Z B;  3AN2 C;  2YFV B;  4J8X A;  2F8N H;  3MGQ A;  1N1J B;  3AZL B;  3C1B D;  1P3I A;  5B1L D;  1S32 D;  3VH5 T;  5C3I C;  3WKJ B;  3REH B;  3UT9 D;  3X1S D;  3AZJ A;  5G49 B;  5B33 D;  3O62 B;  5BS7 A;  3UTA D;  1R4V A;  1BH8 B;  4G91 C;  5CP6 C;  2BYM B;  4WU8 B;  3AZF A;  1P3O C;  4J8W C;  4WU9 B;  3B6F A;  1KX4 B;  1HQ3 D;  3WAA C;  3TU4 D;  4KGC D;  3B6G C;  3AZM D;  2JSS A;  1P3F C;  4KUD C;  5AV9 A;  1M19 D;  2NQB A;  1U35 A;  3W99 B;  4JJN A;  1M18 A;  4YM6 B;  2CV5 C;  3KUY D;  3AZH C;  5AV8 C;  3C1C D;  4H9R A;  2NZD C;  3WA9 B;  4H9N B;  3UTB D;  3AZH D;  2HUE C;  3LZ0 C;  3AZG A;  4YS3 A;  3AZI B;  5BT1 C;  1KX3 B;  3AV1 D;  3W98 C;  4H9S C;  5AVB A;  5FUG A;  4J8V B;  1P3G B;  3B0D C;  1P3M B;  5B32 D;  4R8P B;  5DNN D;  4J8U B;  4ZUX C;  2BYK B;  3X1U D;  1P34 A;  5B0Y C;  3C1B B;  4X23 A;  5B1L B;  1S32 B;  5F99 D;  1P3B C;  5AVC A;  5AY8 C;  5CPI D;  3LZ1 A;  3UT9 B;  3X1S B;  4KHA A;  5B33 B;  2YFW A;  4EO5 B;  3UTA B;  5JRG A;  3AZN A;  3AFA D;  5B24 D;  3REK D;  5B0Z C;  4J8X D;  3MGQ D;  4WV4 B;  3AV2 A;  1H3O B;  4G91 B;  3AZL C;  3VH5 W;  1P3I D;  1HQ3 B;  1AOI A;  1ID3 D;  3TU4 B;  4KGC B;  5E5A A;  3AZM B;  4DRA A;  3W96 A;  5JA4 A;  4NFT A;  3AZJ D;  3AZF C;  4NE3 A;  1M19 B;  1P3F B;  1ULY A;  4WU8 C;  1Q9C A;  4WU9 C;  3KUY B;  3B6F D;  3C1C B;  1KX4 C;  3UTB B;  1BH9 B;  3AZH B;  5AV9 C;  1U35 C;  3AV1 B;  5BNV B;  4AWL B;  1M18 C;  2NQB D;  1P3L A;  3W99 C;  4JJN D;  5DNN B;  1M18 D;  4YM6 C;  1BFM A;  3X1U B;  5GT0 A;  4QLC D;  4CAY B;  5B32 A;  3WTP A;  3WA9 C;  5F99 B;  3AZG D;  5CPI B;  4YS3 D;  3AZI C;  2HIO A;  5B40 A;  3MGP D;  1KX3 C;  5AVB D;  3AFA B;  1P3G C;  4J8V C;  5B24 B;  1ZLA A;  1P3M C;  4R8P C;  3REK B;  5B1M A;  3AZE D;  3MGS A;  4J8X B;  3MGQ B;  4H9Q A;  1P34 D;  2F8N K;  5AV5 A;  3C1B C;  4X23 D;  1P3I B;  1M1A A;  5B1L C;  2ARO A;  1S32 C;  1WWI A;  2F8N A;  3MVD A;  4E44 A;  5AVC D;  3NQU A;  3AZN C;  3LZ1 D;  3UT9 C;  3X1S C;  4E45 A;  3AZJ B;  5CPJ A;  5B33 C;  4EO5 C;  1ID3 A;  3UTA C;  1P3P A;  4Z5T A;  5JRG D;  3AZN D;  3AV2 C;  2IO5 B;  1F66 A;  1P3A A;  3AZF B;  3AV2 D;  3X1T A;  3B6F B;  4DRB A;  5GXQ D;  5E5A C;  1HQ3 C;  3W96 C;  4Z2M G;  1AOI D;  3TU4 C;  4KGC C;  5E5A D;  2RVQ D;  3AZM C;  3W96 D;  5B2I A;  3AYW A;  5DNM A;  5B2J A;  3KXB D;  5AV9 B; 
#chains in the Genus database with same CATH topology
 1M19 C;  2NQB B;  3VH5 A;  1U35 B;  4H9P A;  4JJN B;  1M18 B;  3LJA A;  4HGA B;  1F1E A;  3KUY C;  5B31 A;  4NE5 A;  3C1C C;  4H9R B;  1EQZ A;  4QLC A;  3V9R A;  3UTB C;  3B0B A;  1JFI A;  3REJ A;  3AZG B;  4YS3 B;  4LD9 A;  3AV1 C;  1TAF A;  2Y2L A;  4Z66 A;  4AWL C;  3VH6 W;  2PYO A;  1HTA A;  5AVB B;  5FUG B;  1P3L D;  3MGP A;  4WNN A;  5B32 C;  5DNN C;  3X1U C;  5GT0 D;  5CHL B;  1P34 B;  3AZE A;  3A6N A;  3WTP D;  4UUZ A;  4X23 B;  2FJ7 A;  5B40 C;  5F99 C;  5AVC B;  5GSU D;  3LEL A;  5CPI C;  5AV6 A;  3LZ1 B;  2HIO D;  5B40 D;  3X1V A;  3KWQ A;  4KHA B;  2YFW B;  1KX5 A;  5JRG B;  3AZN B;  2XD1 A;  3AFA C;  3AZK A;  5B24 C;  4M6B A;  1ZLA D;  3W97 A;  5B1M D;  5GT3 A;  3REK C;  3MGS D;  3MNN A;  4J8X C;  3MGQ C;  3AV2 B;  4XZQ A;  5AV5 D;  1M1A D;  1P3I C;  2ARO D;  2F8N D;  5KDM A;  3MVD D;  1TZY D;  1P3K A;  1AOI B;  1ID3 C;  4XUJ A;  5E5A B;  5GXQ A;  5JA4 B;  3W96 B;  5CPJ D;  3AZJ C;  2L5A A;  5BS7 C;  1P3P D;  4Z5T D;  5CPK A;  2IO5 C;  1F66 D;  3KXB A;  3AN2 A;  3X1T C;  1P3A D;  5B32 G;  5BNX A;  3X1T D;  3B6F C;  3REI A;  3MGR A;  2G5H C;  3WTP E;  5B2I D;  3AYW D;  5DNM D;  5B2J D;  3NQJ A;  2LY8 A;  3LJA C;  2NQB C;  1P3L B;  4JJN C;  5CP6 A;  3LJA D;  3R45 A;  1P3O A;  4HGA C;  5GT0 B;  4J8W A;  4QLC C;  1EQZ C;  3WKJ D;  5B32 B;  5B31 D;  2F8N G;  3REH D;  3WTP B;  3WAA A;  1EQZ D;  2Y2M A;  3REJ D;  3AZG C;  3B6G A;  4YS3 C;  1B67 A;  4LD9 D;  2HIO B;  5B40 B;  3MGP C;  4KUD A;  1WWS A;  4Z66 D;  4H9O A;  5GSU A;  2PYO D;  2RIQ A;  5AVB C;  1ZLA B;  4G92 B;  5BO0 A;  5B1M B;  3AZE C;  3MGS B;  4H9Q B;  2CV5 A;  5AV8 A;  1P34 C;  5AV5 B;  3A6N D;  1M1A B;  4X23 C;  2FJ7 D;  2NZD A;  2ARO B;  4ZBJ B;  3VH6 A;  2F8N B;  3MVD B;  3KSY A;  3LZ0 A;  5AVC C;  3NQU B;  3LEL D;  1KX5 C;  5AV6 D;  3LZ1 C;  3X1V D;  3KWQ D;  5CPJ B;  3W98 A;  1TZY A;  1ID3 B;  1P3P B;  1KX5 D;  2Y2N A;  4Z5T B;  5JRG C;  3REL A;  3AZK D;  3W97 D;  1F66 B;  1P3A B;  4CSR A;  4XZQ C;  5GT3 D;  4ZUX A;  3MNN D;  5B31 G;  1Z2C B;  2DQN C;  1P3K C;  4XZQ D;  3X1T B;  5B0Y A;  3F6T A;  5GXQ C;  1P3B A;  2F2A C;  1P3K D;  1AOI C;  5AY8 A;  4XUJ D;  2RVQ C;  2DF4 C;  5B2I B;  3AYW B;  5DNM B;  5B2J B;  3KXB C;  4J8U D;  1A7W A;  5CPK D;  4H9P B;  3AN2 D;  5B0Z A;  2YFV A;  3LJA B;  3REI C;  3MGR C;  1N1J A;  3AZL A;  5B31 B;  2Y2P A;  2UWX A;  3REI D;  3MGR D;  1EQZ B;  4QLC B;  3V9R B;  1JFI B;  3WKJ A;  1PZR A;  4WZS B;  3REJ B;  3REH A;  4LD9 B;  5G49 A;  1TAF B;  3O62 A;  3B0C T;  4Z66 B;  2PYO B;  3H0M C;  1P3L C;  1BH8 A;  3MGP B;  4WNN B;  5CP6 D;  2BYM A;  4WU8 A;  1P3O D;  5GT0 C;  4J8W D;  4WU9 A;  1B6W A;  2Y2H A;  3AZE B;  1KX4 A;  3A6N B;  2FJ7 B;  4UUZ B;  3WTP C;  3WAA D;  5GSU C;  3LEL B;  3B6G D;  2G5I C;  5AV6 B;  2HIO C;  4KUD D;  3X1V B;  3KWQ B;  1P3F D;  2ZY3 A;  1KX5 B;  3AZK B;  1ZLA C;  3W99 A;  4G92 C;  3W97 B;  5B1M C;  5GT3 B;  3MGS C;  3MNN B;  4YM6 A;  2FFF B;  2CV5 D;  4Z2M H;  5AV8 D;  4XZQ B;  5AV5 C;  1M1A C;  2NZD D;  3WA9 A;  2ARO C;  4H9N A;  4ZBJ C;  3KFU G;  5KDM B;  1P3K B;  3MVD C;  1TZY C;  3LZ0 D;  4XUJ B;  3EPL A;  2ZY5 A;  3REL C;  3AZI A;  5GXQ B;  5BT1 D;  1KX3 A;  3W98 D;  5CPJ C;  1P3P C;  3REL D;  4Z5T C;  1P3G A;  4J8V A;  3EPH A;  2W8S A;  5CPK B;  4NE6 A;  1P3M A;  4R8P A;  1F66 C;  3KXB B;  4J8U A;  4ZUX D;  3AN2 B;  2BYK A;  1P3A C;  5BNX B;  5B0Y D;  3C1B A;  5B1L A;  3REI B;  1S32 A;  3MGR B;  5C3I B;  1P3B D;  5AY8 D;  3UT9 A;  3X1S A;  2J8P A;  5B2I C;  3AYW C;  5B33 A;  5DNM C;  5B2J C;  3UTA A;  3NQJ B;  3A1I A;  3AL0 C;  5B0Z D;  5CP6 B;  2ZY4 A;  1P3O B;  3R45 B;  2XD5 A;  4J8W B;  1H3O A;  3AZL D;  3WKJ C;  5B31 C;  3REH C;  1HQ3 A;  3WAA B;  3O62 C;  3TU4 A;  4KGC A;  3REJ C;  3B6G B;  3AZM A;  4LD9 C;  3B0C W;  4KUD B;  3O62 D;  1KU5 A;  3AZF D;  4WJ3 C;  4H9O B;  5GSU B;  4Z66 C;  1M19 A;  2PYO C;  1P3F A;  5BO0 B;  4WU8 D;  4DQY B;  4WU9 D;  2CV5 B;  3KUY A;  5AV8 B;  1KX4 D;  3C1C A;  3A6N C;  2FJ7 C;  2NZD B;  3UTB A;  1BH9 A;  5AV9 D;  2HUE B;  3LZ0 B;  3AZH A;  3LEL C;  5AV6 C;  3VH6 T;  1U35 D;  3AV1 A;  3X1V C;  5BNV A;  3KWQ C;  3W98 B;  2Y2O A;  1TZY B;  2CWE A;  3REL B;  3A1K A;  3AZK C;  2Y2K A;  3B0D B;  3W99 D;  3W97 C;  5DNN A;  4CSR B;  4ZUX B;  5GT3 C;  4H9S A;  4YM6 D;  3MNN C;  3X1U A;  4CAY A;  5B0Y B;  3WA9 D;  1P3B B;  5F99 A;  5AY8 B;  5CPI A;  4XUJ C;  3AZI D;  1KX3 D;  1W2E A;  4J8U C;  3AFA A;  4J8V D;  1P3G D;  5B24 A;  5CPK C;  1P3M D;  4R8P D;  3REK A;  5B0Z B;  3AN2 C;  2YFV B;  4J8X A;  2F8N H;  3MGQ A;  3EG5 B;  1N1J B;  3AZL B;  3C1B D;  1P3I A;  5B1L D;  2Y2J A;  1S32 D;  3VH5 T;  5C3I C;  3WKJ B;  3REH B;  3UT9 D;  3X1S D;  3AZJ A;  5G49 B;  5B33 D;  3O62 B;  5BS7 A;  3UTA D;  1R4V A;  1BH8 B;  4G91 C;  5CP6 C;  2BYM B;  4WU8 B;  3AZF A;  1T3U A;  1P3O C;  4J8W C;  3FDD A;  4WU9 B;  3H0R C;  3B6F A;  1KX4 B;  1HQ3 D;  3WAA C;  3TU4 D;  4KGC D;  3B6G C;  3AZM D;  2JSS A;  1P3F C;  4KUD C;  5AV9 A;  2ZM5 A;  1M19 D;  2NQB A;  1U35 A;  3W99 B;  4JJN A;  1M18 A;  4YM6 B;  2CV5 C;  3KUY D;  3AZH C;  5AV8 C;  3C1C D;  4H9R A;  2VQR A;  2NZD C;  3WA9 B;  4H9N B;  3UTB D;  3AZH D;  2HUE C;  3LZ0 C;  3AZG A;  4YS3 A;  3AZI B;  5BT1 C;  1KX3 B;  3AV1 D;  3W98 C;  4H9S C;  5AVB A;  5FUG A;  4J8V B;  1P3G B;  3B0D C;  1P3M B;  5B32 D;  4R8P B;  5DNN D;  4J8U B;  4ZUX C;  2BYK B;  3X1U D;  1P34 A;  2Y2G A;  5B0Y C;  3C1B B;  4X23 A;  5B1L B;  1S32 B;  5F99 D;  1P3B C;  5AVC A;  5AY8 C;  5CPI D;  3LZ1 A;  3UT9 B;  3X1S B;  4KHA A;  5B33 B;  2YFW A;  4EO5 B;  3UTA B;  5JRG A;  3AZN A;  3AFA D;  5B24 D;  3REK D;  5B0Z C;  4J8X D;  3MGQ D;  4WV4 B;  3AV2 A;  3IP4 C;  1H3O B;  4G91 B;  3EPK A;  3AZL C;  3VH5 W;  1P3I D;  1HQ3 B;  1AOI A;  1ID3 D;  3TU4 B;  4KGC B;  5E5A A;  3AZM B;  4DRA A;  3W96 A;  5JA4 A;  4NFT A;  3AZJ D;  3AZF C;  4NE3 A;  1M19 B;  1P3F B;  1ULY A;  4WU8 C;  1Q9C A;  4WU9 C;  3KUY B;  2Y2I A;  3B6F D;  3C1C B;  1KX4 C;  3UTB B;  1BH9 B;  3AZH B;  5AV9 C;  1U35 C;  3AV1 B;  5BNV B;  4AWL B;  1M18 C;  2NQB D;  1P3L A;  3W99 C;  4JJN D;  5DNN B;  1M18 D;  4YM6 C;  1BFM A;  3H0L C;  5GT0 A;  3X1U B;  4QLC D;  4CAY B;  5B32 A;  3WTP A;  3WA9 C;  5F99 B;  3AZG D;  5CPI B;  4YS3 D;  3AZI C;  2HIO A;  5B40 A;  3MGP D;  1KX3 C;  2Y2Q A;  5AVB D;  3AFA B;  3EPJ A;  4J8V C;  5B24 B;  1P3G C;  1ZLA A;  1P3M C;  2JE5 A;  4R8P C;  3REK B;  5B1M A;  3AZE D;  3MGS A;  4J8X B;  3MGQ B;  4H9Q A;  1P34 D;  2F8N K;  5AV5 A;  3C1B C;  4X23 D;  1P3I B;  1M1A A;  5B1L C;  2ARO A;  1S32 C;  1WWI A;  2F8N A;  3MVD A;  4E44 A;  5AVC D;  3NQU A;  3AZN C;  3LZ1 D;  3UT9 C;  3X1S C;  4E45 A;  3AZJ B;  5CPJ A;  5B33 C;  4EO5 C;  1ID3 A;  3UTA C;  1P3P A;  2BG1 A;  4Z5T A;  5JRG D;  3AZN D;  3AV2 C;  2IO5 B;  2JCH A;  1F66 A;  1P3A A;  3AZF B;  3AV2 D;  3X1T A;  3B6F B;  4DRB A;  5GXQ D;  5E5A C;  3P5J B;  1HQ3 C;  3W96 C;  4Z2M G;  1AOI D;  3TU4 C;  4KGC C;  5E5A D;  2RVQ D;  3AZM C;  3W96 D;  5B2I A;  3AYW A;  4UPK A;  5DNM A;  5B2J A;  3KXB D;  5AV9 B;  2ZY2 A; 
#chains in the Genus database with same CATH homology
 1M19 C;  2NQB B;  3VH5 A;  1U35 B;  4H9P A;  4JJN B;  1M18 B;  3LJA A;  4HGA B;  1F1E A;  3KUY C;  5B31 A;  4NE5 A;  3C1C C;  4H9R B;  1EQZ A;  4QLC A;  3V9R A;  3UTB C;  3B0B A;  1JFI A;  3REJ A;  3AZG B;  4YS3 B;  4LD9 A;  3AV1 C;  1TAF A;  2Y2L A;  4Z66 A;  4AWL C;  3VH6 W;  2PYO A;  1HTA A;  5AVB B;  5FUG B;  1P3L D;  3MGP A;  4WNN A;  5B32 C;  5DNN C;  3X1U C;  5GT0 D;  5CHL B;  1P34 B;  3AZE A;  3A6N A;  3WTP D;  4UUZ A;  4X23 B;  2FJ7 A;  5B40 C;  5F99 C;  5AVC B;  5GSU D;  3LEL A;  5CPI C;  5AV6 A;  3LZ1 B;  2HIO D;  5B40 D;  3X1V A;  3KWQ A;  4KHA B;  2YFW B;  1KX5 A;  5JRG B;  3AZN B;  2XD1 A;  3AFA C;  3AZK A;  5B24 C;  4M6B A;  1ZLA D;  3W97 A;  5B1M D;  5GT3 A;  3REK C;  3MGS D;  3MNN A;  4J8X C;  3MGQ C;  3AV2 B;  4XZQ A;  5AV5 D;  1M1A D;  1P3I C;  2ARO D;  2F8N D;  5KDM A;  3MVD D;  1TZY D;  1P3K A;  1AOI B;  1ID3 C;  4XUJ A;  5E5A B;  5GXQ A;  5JA4 B;  3W96 B;  5CPJ D;  3AZJ C;  2L5A A;  5BS7 C;  1P3P D;  4Z5T D;  5CPK A;  2IO5 C;  1F66 D;  3KXB A;  3AN2 A;  3X1T C;  1P3A D;  5B32 G;  5BNX A;  3X1T D;  3B6F C;  3REI A;  3MGR A;  2G5H C;  3WTP E;  5B2I D;  3AYW D;  5DNM D;  5B2J D;  3NQJ A;  2LY8 A;  3LJA C;  2NQB C;  1P3L B;  4JJN C;  5CP6 A;  3LJA D;  3R45 A;  1P3O A;  4HGA C;  5GT0 B;  4J8W A;  4QLC C;  1EQZ C;  3WKJ D;  5B32 B;  5B31 D;  2F8N G;  3REH D;  3WTP B;  3WAA A;  1EQZ D;  2Y2M A;  3REJ D;  3AZG C;  3B6G A;  4YS3 C;  1B67 A;  4LD9 D;  2HIO B;  5B40 B;  3MGP C;  4KUD A;  1WWS A;  4Z66 D;  4H9O A;  5GSU A;  2PYO D;  2RIQ A;  5AVB C;  1ZLA B;  4G92 B;  5BO0 A;  5B1M B;  3AZE C;  3MGS B;  4H9Q B;  2CV5 A;  5AV8 A;  1P34 C;  5AV5 B;  3A6N D;  1M1A B;  4X23 C;  2FJ7 D;  2NZD A;  2ARO B;  4ZBJ B;  3VH6 A;  2F8N B;  3MVD B;  3KSY A;  3LZ0 A;  5AVC C;  3NQU B;  3LEL D;  1KX5 C;  5AV6 D;  3LZ1 C;  3X1V D;  3KWQ D;  5CPJ B;  3W98 A;  1TZY A;  1ID3 B;  1P3P B;  1KX5 D;  2Y2N A;  4Z5T B;  5JRG C;  3REL A;  3AZK D;  3W97 D;  1F66 B;  1P3A B;  4CSR A;  4XZQ C;  5GT3 D;  4ZUX A;  3MNN D;  5B31 G;  1Z2C B;  2DQN C;  1P3K C;  4XZQ D;  3X1T B;  5B0Y A;  3F6T A;  5GXQ C;  1P3B A;  2F2A C;  1P3K D;  1AOI C;  5AY8 A;  4XUJ D;  2RVQ C;  2DF4 C;  5B2I B;  3AYW B;  5DNM B;  5B2J B;  3KXB C;  4J8U D;  1A7W A;  5CPK D;  4H9P B;  3AN2 D;  5B0Z A;  2YFV A;  3LJA B;  3REI C;  3MGR C;  1N1J A;  3AZL A;  5B31 B;  2Y2P A;  2UWX A;  3REI D;  3MGR D;  1EQZ B;  4QLC B;  3V9R B;  1JFI B;  3WKJ A;  1PZR A;  4WZS B;  3REJ B;  3REH A;  4LD9 B;  5G49 A;  1TAF B;  3O62 A;  3B0C T;  4Z66 B;  2PYO B;  3H0M C;  1P3L C;  1BH8 A;  3MGP B;  4WNN B;  5CP6 D;  2BYM A;  4WU8 A;  1P3O D;  5GT0 C;  4J8W D;  4WU9 A;  1B6W A;  2Y2H A;  3AZE B;  1KX4 A;  3A6N B;  2FJ7 B;  4UUZ B;  3WTP C;  3WAA D;  5GSU C;  3LEL B;  3B6G D;  2G5I C;  5AV6 B;  2HIO C;  4KUD D;  3X1V B;  3KWQ B;  1P3F D;  2ZY3 A;  1KX5 B;  3AZK B;  1ZLA C;  3W99 A;  4G92 C;  3W97 B;  5B1M C;  5GT3 B;  3MGS C;  3MNN B;  4YM6 A;  2FFF B;  2CV5 D;  4Z2M H;  5AV8 D;  4XZQ B;  5AV5 C;  1M1A C;  2NZD D;  3WA9 A;  2ARO C;  4H9N A;  4ZBJ C;  3KFU G;  5KDM B;  1P3K B;  3MVD C;  1TZY C;  3LZ0 D;  4XUJ B;  3EPL A;  2ZY5 A;  3REL C;  3AZI A;  5GXQ B;  5BT1 D;  1KX3 A;  3W98 D;  5CPJ C;  1P3P C;  3REL D;  4Z5T C;  1P3G A;  4J8V A;  3EPH A;  2W8S A;  5CPK B;  4NE6 A;  1P3M A;  4R8P A;  1F66 C;  3KXB B;  4J8U A;  4ZUX D;  3AN2 B;  2BYK A;  1P3A C;  5BNX B;  5B0Y D;  3C1B A;  5B1L A;  3REI B;  1S32 A;  3MGR B;  5C3I B;  1P3B D;  5AY8 D;  3UT9 A;  3X1S A;  2J8P A;  5B2I C;  3AYW C;  5B33 A;  5DNM C;  5B2J C;  3UTA A;  3NQJ B;  3A1I A;  3AL0 C;  5B0Z D;  5CP6 B;  2ZY4 A;  1P3O B;  3R45 B;  2XD5 A;  4J8W B;  1H3O A;  3AZL D;  3WKJ C;  5B31 C;  3REH C;  1HQ3 A;  3WAA B;  3O62 C;  3TU4 A;  4KGC A;  3REJ C;  3B6G B;  3AZM A;  4LD9 C;  3B0C W;  4KUD B;  3O62 D;  1KU5 A;  3AZF D;  4WJ3 C;  4H9O B;  5GSU B;  4Z66 C;  1M19 A;  2PYO C;  1P3F A;  5BO0 B;  4WU8 D;  4DQY B;  4WU9 D;  2CV5 B;  3KUY A;  5AV8 B;  1KX4 D;  3C1C A;  3A6N C;  2FJ7 C;  2NZD B;  3UTB A;  1BH9 A;  5AV9 D;  2HUE B;  3LZ0 B;  3AZH A;  3LEL C;  5AV6 C;  3VH6 T;  1U35 D;  3AV1 A;  3X1V C;  5BNV A;  3KWQ C;  3W98 B;  2Y2O A;  1TZY B;  2CWE A;  3REL B;  3A1K A;  3AZK C;  2Y2K A;  3B0D B;  3W99 D;  3W97 C;  5DNN A;  4CSR B;  4ZUX B;  5GT3 C;  4H9S A;  4YM6 D;  3MNN C;  3X1U A;  4CAY A;  5B0Y B;  3WA9 D;  1P3B B;  5F99 A;  5AY8 B;  5CPI A;  4XUJ C;  3AZI D;  1KX3 D;  1W2E A;  4J8U C;  3AFA A;  4J8V D;  1P3G D;  5B24 A;  5CPK C;  1P3M D;  4R8P D;  3REK A;  5B0Z B;  3AN2 C;  2YFV B;  4J8X A;  2F8N H;  3MGQ A;  3EG5 B;  1N1J B;  3AZL B;  3C1B D;  1P3I A;  5B1L D;  2Y2J A;  1S32 D;  3VH5 T;  5C3I C;  3WKJ B;  3REH B;  3UT9 D;  3X1S D;  3AZJ A;  5G49 B;  5B33 D;  3O62 B;  5BS7 A;  3UTA D;  1R4V A;  1BH8 B;  4G91 C;  5CP6 C;  2BYM B;  4WU8 B;  3AZF A;  1T3U A;  1P3O C;  4J8W C;  3FDD A;  4WU9 B;  3H0R C;  3B6F A;  1KX4 B;  1HQ3 D;  3WAA C;  3TU4 D;  4KGC D;  3B6G C;  3AZM D;  2JSS A;  1P3F C;  4KUD C;  5AV9 A;  2ZM5 A;  1M19 D;  2NQB A;  1U35 A;  3W99 B;  4JJN A;  1M18 A;  4YM6 B;  2CV5 C;  3KUY D;  3AZH C;  5AV8 C;  3C1C D;  4H9R A;  2VQR A;  2NZD C;  3WA9 B;  4H9N B;  3UTB D;  3AZH D;  2HUE C;  3LZ0 C;  3AZG A;  4YS3 A;  3AZI B;  5BT1 C;  1KX3 B;  3AV1 D;  3W98 C;  4H9S C;  5AVB A;  5FUG A;  4J8V B;  1P3G B;  3B0D C;  1P3M B;  5B32 D;  4R8P B;  5DNN D;  4J8U B;  4ZUX C;  2BYK B;  3X1U D;  1P34 A;  2Y2G A;  5B0Y C;  3C1B B;  4X23 A;  5B1L B;  1S32 B;  5F99 D;  1P3B C;  5AVC A;  5AY8 C;  5CPI D;  3LZ1 A;  3UT9 B;  3X1S B;  4KHA A;  5B33 B;  2YFW A;  4EO5 B;  3UTA B;  5JRG A;  3AZN A;  3AFA D;  5B24 D;  3REK D;  5B0Z C;  4J8X D;  3MGQ D;  4WV4 B;  3AV2 A;  3IP4 C;  1H3O B;  4G91 B;  3EPK A;  3AZL C;  3VH5 W;  1P3I D;  1HQ3 B;  1AOI A;  1ID3 D;  3TU4 B;  4KGC B;  5E5A A;  3AZM B;  4DRA A;  3W96 A;  5JA4 A;  4NFT A;  3AZJ D;  3AZF C;  4NE3 A;  1M19 B;  1P3F B;  1ULY A;  4WU8 C;  1Q9C A;  4WU9 C;  3KUY B;  2Y2I A;  3B6F D;  3C1C B;  1KX4 C;  3UTB B;  1BH9 B;  3AZH B;  5AV9 C;  1U35 C;  3AV1 B;  5BNV B;  4AWL B;  1M18 C;  2NQB D;  1P3L A;  3W99 C;  4JJN D;  5DNN B;  1M18 D;  4YM6 C;  1BFM A;  3H0L C;  5GT0 A;  3X1U B;  4QLC D;  4CAY B;  5B32 A;  3WTP A;  3WA9 C;  5F99 B;  3AZG D;  5CPI B;  4YS3 D;  3AZI C;  2HIO A;  5B40 A;  3MGP D;  1KX3 C;  2Y2Q A;  5AVB D;  3AFA B;  3EPJ A;  4J8V C;  5B24 B;  1P3G C;  1ZLA A;  1P3M C;  2JE5 A;  4R8P C;  3REK B;  5B1M A;  3AZE D;  3MGS A;  4J8X B;  3MGQ B;  4H9Q A;  1P34 D;  2F8N K;  5AV5 A;  3C1B C;  4X23 D;  1P3I B;  1M1A A;  5B1L C;  2ARO A;  1S32 C;  1WWI A;  2F8N A;  3MVD A;  4E44 A;  5AVC D;  3NQU A;  3AZN C;  3LZ1 D;  3UT9 C;  3X1S C;  4E45 A;  3AZJ B;  5CPJ A;  5B33 C;  4EO5 C;  1ID3 A;  3UTA C;  1P3P A;  2BG1 A;  4Z5T A;  5JRG D;  3AZN D;  3AV2 C;  2IO5 B;  2JCH A;  1F66 A;  1P3A A;  3AZF B;  3AV2 D;  3X1T A;  3B6F B;  4DRB A;  5GXQ D;  5E5A C;  3P5J B;  1HQ3 C;  3W96 C;  4Z2M G;  1AOI D;  3TU4 C;  4KGC C;  5E5A D;  2RVQ D;  3AZM C;  3W96 D;  5B2I A;  3AYW A;  4UPK A;  5DNM A;  5B2J A;  3KXB D;  5AV9 B;  2ZY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...