3KWQD

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kwqD00
3AZFB 3X1UD 4ZUXA 3MNND 1F66A 3AZGB 4M6BA 1BH8A 3RELB 1WWSA 1U35A 2IO5C 2NZDD 4WNNA 5B1LA 3REKD 5JRGC 3B0DC 2NQBD 1BH8B 3AZJC 5GXQD 1AOIA 1KX4A 5F99A 2HIOB 3UTBD 5C3IB 1P3OB 4WNNB 5B1LB 5B40C 1M1AC 4DRAA 5BNXA 3AFAC 3W99D 5B2JD 1KX4B 4H9PB 1P3BA 5CP6A 5BNXB 3AV1B 3WA9C 5B33D 4XZQB 5BO0A 3X1VC 1P3BB 1M19C 5DNMC 1TZYC 3AZLB 3MVDA 5BO0B 3KUYB 2AROA 4YS3C 3MGRA 3AZIB 4WU8A 3KXBC 5B32A 5AV9A 3UTAC 1P3KC 1P3GD 3VH5A 3MGRB 1HQ3C 2NQBB 3B6GC 3W97C 4QLCA 5AV9B 1P34A 3MGQA 3AYWD 5AVBD 4J8UD 1KX3C 3AZMC 3LJAC 3AZNC 4J8WA 3A6NB 4KHAA 4WU9C 3LELD 5B24B 1P3PB 1EQZC 5BT1C 3AZHD 4KGCD 3UT9D 3AZEB 3REHB 3KSYA 3AV2B 1M18C 3WTPC 1ZLAA 5AY8D 3REID 1P3IC 3C1BD 2L5AA 1P3MB 4J8XC 5CPJB 1KX5B 2YFVA 5JRGA 5DNND 2BYKB 3AZJA 1P3FC 3WKJD 4XUJC 3C1CC 4X23D 5B31C 1M1AA 3AZKD 3X1TD 3WAAD 2FJ7D 4Z2MH 3X1SC 2PYOD 4JJNA 2HUEC 2YFWB 5GT3B 3W98C 3LZ1A 3NQUB 1ULYA 3WA9A 5B2IA 4JJNB 5GT0C 3X1VA 5CPKD 3TU4D 4KGCB 5DNMA 3AZFD 3LZ1B 1TZYA 4H9RB 4Z5TC 3AZGD 5AV8A 3RELD 5B2IB 3REJC 5AVCC 4YS3A 3MGPC 3KWQC 5BS7C 1P3LB 5AV8B 4ZBJB 1ID3B 2HIOD 5E5AC 1P3OD 5CPIB 1HQ3A 5B1LD 3W97A 3B6GA 5AV6B 5B0YB 4R8PA 1AOID 2JSSA 5F99D 1KX4D 1Q9CA 3X1UC 3MNNC 1KX3A 5B1MA 3AZNA 3AN2A 4R8PB 4LD9C 3AV1D 3B6FC 3REKC 1EQZA 4XZQD 1P3BD 4KUDB 3MGSB 5B1MB 5GXQC 4AWLC 3AN2B 3UTBC 3O62B 3WTPA 3W99C 3KUYD 3AZID 5B0ZC 5B2JC 2F8NB 4G91B 1P3IA 2CV5B 4J8XA 3MGRD 4ZUXB 1F66B 1P3FA 5AV9D 4XUJA 1U35B 4NE3A 4HGAB 5B31A 3LZ0C 1AOIB 4DRBA 5F99B 5AV5A 3A6ND 3X1SA 5B31B 5B24D 1P3PD 1P3AA 1P3GC 3AZED 5AV5B 3REHD 3AV2D 4CSRA 5CP6B 1P3AB 3V9RA 3VH6A 4EO5B 3VH6W 4Z5TA 3AYWC 5AVBC 4J8UC 3REJA 4CSRB 5AVCA 1P3MD 3MGPA 3V9RB 5CPJD 3KWQA 1KX5D 5BS7A 1B67A 3LELC 4UUZA 3MVDB 2LY8A 3B0CT 5E5AA 2AROB 3AZHC 3UT9C 4WU8B 5B32B 5GSUA 5AY8C 5GT3D 5KDMA 4QLCB 3REIC 1P34B 4Z66A 3C1BC 4LD9A 3MGQB 3B6FA 4YM6A 5GSUB 3REKA 3W96C 4JJND 5DNNC 3WKJC 5GXQA 4J8WB 4Z66B 3LZ1D 4KHAB 4X23C 4H9SC 4YM6B 5B2ID 3AZKC 3W99A 5JA4A 3WAAC 3X1TC 2F8NG 5B0ZA 4Z2MG 5B2JA 4J8VC 2PYOC 1P3LD 5AV8D 1ZLAB 1ID3D 5FUGA 5JA4B 5CPID 5B0ZB 4G92C 5AV6D 5B0YD 5CPKC 4NE6A 3TU4C 2IO5B 5B40A 2YFVB 5JRGB 3AFAA 3AZGC 3B0DB 3LZ0A 3B6GD 3AZJB 3RELC 4R8PD 5B31G 3VH5T 5B40B 1M1AB 3AFAB 1S32C 4KUDD 3MGSD 5B1MD 1P3GA 2HIOC 3AN2D 1P3OC 5C3IC 3O62D 1H3OA 1M19A 1BH9A 1EQZD 1KX4C 3WA9B 2F8ND 3AYWA 5AVBA 4J8UA 1H3OB 3X1VB 3R45A 2RVQD 1M19B 2CV5D 5DNMB 1JFIA 4H9QA 1F66D 4ZUXD 4WZSB 3KXBA 1N1JA 1TZYB 3AV1C 3LELA 3UTAA 1P3KA 4XZQC 1U35D 1P3ID 4E44A 4YS3B 5B32G 3AZHA 4H9QB 3KXBB 1N1JB 3AZLC 2CWEA 3UTAB 1P3KB 3KUYC 3AZIC 1HQ3B 3AZMA 5AY8A 5B31D 3B6GB 3W97B 3REIA 3LJAA 3C1BA 2NZDC 4WU9A 5AV5D 3W96A 1KX3B 3AZMB 2NQBC 5CP6D 5DNNA 3WKJA 1P3AD 3LJAB 3AZNB 5G49A 4X23A 1M18A 3NQJA 4WU9B 1EQZB 3AZKA 3W96B 1TAFA 3WAAA 3A6NC 4J8VA 2PYOA 1M18B 3WTPB 5B24C 1P3PC 3MVDD 2AROD 4WU8D 3AZEC 5B32D 3REHC 5B33C 3AV2C 1P3IB 5CPKA 3TU4A 3C1CA 3B0BA 5E5AD 4J8XB 3AZGA 1A7WA 4QLCD 1P3FB 1P34D 4XUJB 3B0CW 3MGQD 3C1CB 1P3MC 5GSUD 5CPJC 1KX5C 1S32A 3W98A 4J8WD 4Z66D 2HIOA 4LD9D 3X1SB 1P3OA 3B6FD 5GT0A 4YM6D 2HUEB 1S32B 3W98B 2BYMA 5GT0B 4H9PA 1ZLAD 5GT3C 1BFMA 5B0ZD 2BYMB 4Z5TB 3AV1A 4JJNC 3REJB 4XZQA 5AVCB 4KGCC 1B6WA 3MGPB 3KWQB 5JRGD 3LZ1C 3AZLA 3AZJD 4UUZB 5B2IC 5E5AB 3KUYA 3X1UA 3MNNA 3AZIA 5B40D 1M1AD 3AFAD 1P3LC 3LZ0D 5AV8C 2NZDA 4ZBJC 1ID3C 5CPIC 3X1UB 3MNNB 2NQBA 5KDMB 5AV6C 5B0YC 4LD9B 3UTBA 2NZDB 3B6FB 3WA9D 3REKB 3VH5W 3X1VD 1M19D 5DNMD 5GXQB 4AWLB 2FJ7C 4R8PC 5CHLB 1TZYD 3A6NA 3UTBB 5B24A 4NFTA 1P3PA 3W99B 4KUDC 4YS3D 3MGSC 5B1MC 3VH6T 5B2JB 3AN2C 3KXBD 3AZEA 3REHA 5B33A 3O62C 3AV2A 3UTAD 3AZFC 5FUGB 1P3KD 1HQ3D 3W97D 5B33B 4G91C 2RVQC 2CV5C 1P3MA 1F66C 4ZUXC 5CPJA 1KX5A 1KX3D 3AZMD 3LZ0B 2BYKA 5BNVA 3LJAD 3AZND 1U35C 5B1LC 4WU9D 4HGAC 3W96D 5BT1D 1AOIC 5BNVB 5F99C 1P3GB 1M18D 3WTPD 1BH9B 2YFWA 5GT3A 2F8NH 3NQUA 5AV5C 4J8VD 5AVBB 3AYWB 4J8UB 3R45B 1P3BC 5CP6C 1HTAA 4KGCA 3UT9A 1JFIB 1F1EA 4J8XD 1P3AC 4EO5C 4H9RA 1P3FD 3LELB 4XUJD 3C1CD 4WV4B 3UT9B 3AZHB 1KU5A 4E45A 1P3LA 3MVDC 1ID3A 2AROC 3X1SD 3MGRC 5CPIA 4WU8C 3WTPE 5AY8B 5B32C 5AV6A 5AV9C 5B0YA 3REIB 1S32D 3C1BB 3W98D 4H9OA 4H9SA 4CAYA 1WWIA 5GT0D 3X1TA 5DNNB 3WKJB 4QLCC 2FJ7A 2F8NK 1P34C 4H9OB 5G49B 4Z5TD 4X23B 3MGQC 3NQJB 5GSUC 4CAYB 3AZKB 3REJD 1TAFB 3X1TB 3WAAB 1R4VA 5AVCD 3MGSA 4KUDA 3MGPD 2FJ7B 3KWQD 4NE5A 4Z66C 4J8WC 4J8VB 4H9NA 2PYOB 3O62A 4YM6C 3AZFA 4G92B 2F8NA 3RELA 4H9NB 3AZLD 5CPKB 3TU4B 1ZLAC 2CV5A
chains in the Genus database with same CATH superfamily
3AZFB 3X1UD 4ZUXA 3MNND 1F66A 3AZGB 4M6BA 3H0LC 2W8SA 1BH8A 3RELB 1WWSA 1U35A 2IO5C 2NZDD 4WNNA 5B1LA 3REKD 5JRGC 3B0DC 2NQBD 1BH8B 2J8PA 5GXQD 3AZJC 1AOIA 1KX4A 5F99A 2HIOB 3UTBD 5C3IB 1P3OB 4WNNB 5B1LB 5B40C 1M1AC 4DRAA 5BNXA 3AFAC 3W99D 2ZM5A 5B2JD 1KX4B 4H9PB 1P3BA 5CP6A 5BNXB 3AV1B 3AL0C 3WA9C 5B33D 4XZQB 5BO0A 3X1VC 1P3BB 1M19C 5DNMC 1TZYC 3AZLB 3MVDA 5BO0B 3KUYB 2AROA 4YS3C 3MGRA 3AZIB 4WU8A 3KXBC 5B32A 5AV9A 3UTAC 1P3KC 1P3GD 3VH5A 3MGRB 1HQ3C 2NQBB 3B6GC 3W97C 4QLCA 5AV9B 1P34A 3H0RC 3MGQA 3H0MC 3AYWD 5AVBD 4J8UD 1KX3C 3AZMC 3LJAC 3AZNC 4J8WA 3A6NB 4KHAA 4WU9C 3LELD 4DQYB 5B24B 1P3PB 1EQZC 5BT1C 3AZHD 4KGCD 3UT9D 3AZEB 3REHB 3KSYA 3AV2B 1M18C 3WTPC 1ZLAA 2Y2LA 5AY8D 3REID 1P3IC 3C1BD 2L5AA 2ZY4A 1P3MB 4J8XC 5CPJB 1KX5B 2Y2PA 2YFVA 5JRGA 5DNND 2BYKB 3AZJA 1P3FC 3WKJD 4XUJC 3C1CC 4X23D 3EPJA 5B31C 1M1AA 3AZKD 3X1TD 3WAAD 1Z2CB 2FJ7D 4Z2MH 3X1SC 2PYOD 4JJNA 2HUEC 2JCHA 2YFWB 5GT3B 3W98C 3LZ1A 3NQUB 1ULYA 3WA9A 5B2IA 4JJNB 2Y2KA 5GT0C 3X1VA 5CPKD 3TU4D 4KGCB 5DNMA 3AZFD 3LZ1B 1TZYA 2Y2HA 4H9RB 4Z5TC 3AZGD 5AV8A 3RELD 5B2IB 3REJC 5AVCC 4YS3A 2Y2NA 3MGPC 3KWQC 5BS7C 1P3LB 5AV8B 4ZBJB 1ID3B 2HIOD 5E5AC 1P3OD 5CPIB 1HQ3A 1PZRA 5B1LD 3EPKA 3W97A 3B6GA 5AV6B 5B0YB 4R8PA 1AOID 2JSSA 5F99D 1KX4D 1Q9CA 3X1UC 2G5HC 3MNNC 1KX3A 2Y2MA 5B1MA 3IP4C 3AZNA 3AN2A 4R8PB 4LD9C 3AV1D 3B6FC 3REKC 1EQZA 4UPKA 4XZQD 1P3BD 4KUDB 3MGSB 5B1MB 5GXQC 4AWLC 3AN2B 3UTBC 3O62B 3WTPA 3W99C 3KUYD 3AZID 5B0ZC 5B2JC 2F8NB 4G91B 1P3IA 2CV5B 4J8XA 3MGRD 4ZUXB 1F66B 2F2AC 1P3FA 5AV9D 2Y2QA 4XUJA 1U35B 4NE3A 4HGAB 5B31A 3LZ0C 1AOIB 4DRBA 5F99B 5AV5A 3A6ND 3X1SA 5B31B 5B24D 1P3PD 1P3AA 1P3GC 3AZED 5AV5B 3REHD 3AV2D 2BG1A 4CSRA 5CP6B 1P3AB 3V9RA 3VH6A 4EO5B 3VH6W 4Z5TA 3AYWC 5AVBC 4J8UC 3REJA 4CSRB 5AVCA 2UWXA 1P3MD 3MGPA 3V9RB 5CPJD 3KWQA 1KX5D 5BS7A 1B67A 3LELC 4UUZA 3MVDB 2LY8A 3B0CT 5E5AA 2AROB 3AZHC 3UT9C 4WU8B 5B32B 5GSUA 5AY8C 5GT3D 5KDMA 4QLCB 3REIC 1P34B 4Z66A 3C1BC 4LD9A 3MGQB 3B6FA 4YM6A 5GSUB 3REKA 3W96C 4JJND 5DNNC 1T3UA 3WKJC 5GXQA 4J8WB 4Z66B 3LZ1D 4KHAB 4X23C 4H9SC 4YM6B 5B2ID 3AZKC 3W99A 5JA4A 3WAAC 3X1TC 2F8NG 5B0ZA 4Z2MG 5B2JA 4J8VC 2PYOC 1P3LD 5AV8D 1ZLAB 1ID3D 2RIQA 5FUGA 5JA4B 5CPID 5B0ZB 4G92C 5AV6D 5B0YD 5CPKC 4NE6A 3TU4C 2IO5B 5B40A 2YFVB 5JRGB 3AFAA 3AZGC 3B0DB 3LZ0A 3B6GD 3AZJB 3RELC 3F6TA 2ZY2A 4R8PD 5B31G 2XD1A 3VH5T 5B40B 2Y2IA 1M1AB 3AFAB 2VQRA 1S32C 4KUDD 3MGSD 5B1MD 2DF4C 1P3GA 2HIOC 3AN2D 1P3OC 5C3IC 3O62D 1H3OA 1M19A 1BH9A 1EQZD 4WJ3C 1KX4C 3WA9B 2F8ND 3AYWA 5AVBA 4J8UA 1H3OB 3X1VB 2RVQD 3R45A 1M19B 2CV5D 5DNMB 1JFIA 4H9QA 1F66D 4ZUXD 4WZSB 3KXBA 1N1JA 1TZYB 3AV1C 3LELA 3UTAA 1P3KA 4XZQC 1U35D 1P3ID 4E44A 4YS3B 5B32G 3AZHA 4H9QB 2G5IC 1N1JB 3KXBB 3AZLC 2CWEA 3UTAB 1P3KB 3KUYC 3AZIC 1HQ3B 3AZMA 3EPLA 5AY8A 5B31D 3B6GB 3W97B 3EPHA 2XD5A 3LJAA 3REIA 3C1BA 2NZDC 4WU9A 5AV5D 3A1KA 3W96A 1KX3B 3AZMB 2NQBC 5CP6D 5DNNA 3WKJA 1P3AD 3LJAB 3AZNB 3A1IA 5G49A 4X23A 1M18A 3NQJA 4WU9B 1EQZB 3AZKA 3W96B 1TAFA 1W2EA 3EG5B 3WAAA 3A6NC 4J8VA 2PYOA 1M18B 3WTPB 5B24C 1P3PC 3MVDD 2AROD 4WU8D 3FDDA 3AZEC 5B32D 3REHC 5B33C 2ZY5A 3AV2C 1P3IB 2FFFB 5CPKA 3TU4A 3C1CA 3B0BA 5E5AD 4J8XB 3AZGA 1A7WA 4QLCD 1P3FB 1P34D 4XUJB 3B0CW 3MGQD 3C1CB 1P3MC 5GSUD 5CPJC 1KX5C 1S32A 3W98A 4J8WD 4Z66D 2HIOA 4LD9D 3X1SB 1P3OA 3B6FD 5GT0A 4YM6D 2HUEB 1S32B 3W98B 2BYMA 5GT0B 4H9PA 1ZLAD 5GT3C 1BFMA 5B0ZD 2Y2OA 2BYMB 4Z5TB 3AV1A 4JJNC 3REJB 4XZQA 5AVCB 4KGCC 1B6WA 3MGPB 3KWQB 5JRGD 3LZ1C 3AZLA 3AZJD 4UUZB 5B2IC 5E5AB 3KUYA 3X1UA 3MNNA 3AZIA 5B40D 1M1AD 3AFAD 1P3LC 3LZ0D 5AV8C 2NZDA 4ZBJC 1ID3C 5CPIC 3X1UB 3MNNB 2NQBA 5KDMB 5AV6C 5B0YC 4LD9B 3UTBA 2NZDB 3B6FB 3WA9D 3REKB 3VH5W 3X1VD 1M19D 5DNMD 5GXQB 4AWLB 2FJ7C 4R8PC 5CHLB 1TZYD 3A6NA 3UTBB 5B24A 4NFTA 1P3PA 3W99B 4KUDC 4YS3D 3MGSC 5B1MC 3VH6T 5B2JB 3AN2C 3KXBD 3AZEA 3REHA 5B33A 3O62C 3AV2A 3UTAD 3AZFC 5FUGB 1P3KD 3KFUG 1HQ3D 3W97D 2JE5A 5B33B 4G91C 2ZY3A 2RVQC 2CV5C 1P3MA 1F66C 4ZUXC 3P5JB 5CPJA 1KX5A 1KX3D 3AZMD 3LZ0B 2BYKA 5BNVA 3LJAD 3AZND 1U35C 5B1LC 4WU9D 4HGAC 3W96D 5BT1D 1AOIC 5BNVB 5F99C 1P3GB 1M18D 3WTPD 1BH9B 2YFWA 5GT3A 2F8NH 3NQUA 5AV5C 4J8VD 5AVBB 3AYWB 4J8UB 3R45B 1P3BC 5CP6C 1HTAA 4KGCA 3UT9A 1JFIB 1F1EA 4J8XD 1P3AC 2DQNC 4EO5C 4H9RA 1P3FD 3LELB 4XUJD 3C1CD 4WV4B 3UT9B 3AZHB 2Y2JA 1KU5A 4E45A 1P3LA 3MVDC 2Y2GA 1ID3A 2AROC 3X1SD 3MGRC 5CPIA 4WU8C 3WTPE 5AY8B 5B32C 5AV6A 5AV9C 5B0YA 3REIB 1S32D 3C1BB 3W98D 4H9OA 4H9SA 4CAYA 1WWIA 5GT0D 3X1TA 5DNNB 3WKJB 4QLCC 2FJ7A 2F8NK 1P34C 4H9OB 5G49B 4Z5TD 4X23B 3MGQC 3NQJB 5GSUC 4CAYB 3AZKB 3REJD 1TAFB 3X1TB 3WAAB 1R4VA 5AVCD 3MGSA 4KUDA 3MGPD 2FJ7B 3KWQD 4NE5A 4Z66C 4J8WC 4J8VB 4H9NA 2PYOB 3O62A 4YM6C 3AZFA 4G92B 2F8NA 3RELA 4H9NB 3AZLD 5CPKB 3TU4B 1ZLAC 2CV5A
chains in the Genus database with same CATH topology
3AZFB 3X1UD 4ZUXA 3MNND 1F66A 3AZGB 4M6BA 3H0LC 2W8SA 1BH8A 3RELB 1WWSA 1U35A 2IO5C 2NZDD 4WNNA 5B1LA 3REKD 5JRGC 3B0DC 2NQBD 1BH8B 2J8PA 5GXQD 3AZJC 1AOIA 1KX4A 5F99A 2HIOB 3UTBD 5C3IB 1P3OB 4WNNB 5B1LB 5B40C 1M1AC 4DRAA 5BNXA 3AFAC 3W99D 2ZM5A 5B2JD 1KX4B 4H9PB 1P3BA 5CP6A 5BNXB 3AV1B 3AL0C 3WA9C 5B33D 4XZQB 5BO0A 3X1VC 1P3BB 1M19C 5DNMC 1TZYC 3AZLB 3MVDA 5BO0B 3KUYB 2AROA 4YS3C 3MGRA 3AZIB 4WU8A 3KXBC 5B32A 5AV9A 3UTAC 1P3KC 1P3GD 3VH5A 3MGRB 1HQ3C 2NQBB 3B6GC 3W97C 4QLCA 5AV9B 1P34A 3H0RC 3MGQA 3H0MC 3AYWD 5AVBD 4J8UD 1KX3C 3AZMC 3LJAC 3AZNC 4J8WA 3A6NB 4KHAA 4WU9C 3LELD 4DQYB 5B24B 1P3PB 1EQZC 5BT1C 3AZHD 4KGCD 3UT9D 3AZEB 3REHB 3KSYA 3AV2B 1M18C 3WTPC 1ZLAA 2Y2LA 5AY8D 3REID 1P3IC 3C1BD 2L5AA 2ZY4A 1P3MB 4J8XC 5CPJB 1KX5B 2Y2PA 2YFVA 5JRGA 5DNND 2BYKB 3AZJA 1P3FC 3WKJD 4XUJC 3C1CC 4X23D 3EPJA 5B31C 1M1AA 3AZKD 3X1TD 3WAAD 1Z2CB 2FJ7D 4Z2MH 3X1SC 2PYOD 4JJNA 2HUEC 2JCHA 2YFWB 5GT3B 3W98C 3LZ1A 3NQUB 1ULYA 3WA9A 5B2IA 4JJNB 2Y2KA 5GT0C 3X1VA 5CPKD 3TU4D 4KGCB 5DNMA 3AZFD 3LZ1B 1TZYA 2Y2HA 4H9RB 4Z5TC 3AZGD 5AV8A 3RELD 5B2IB 3REJC 5AVCC 4YS3A 2Y2NA 3MGPC 3KWQC 5BS7C 1P3LB 5AV8B 4ZBJB 1ID3B 2HIOD 5E5AC 1P3OD 5CPIB 1HQ3A 1PZRA 5B1LD 3EPKA 3W97A 3B6GA 5AV6B 5B0YB 4R8PA 1AOID 2JSSA 5F99D 1KX4D 1Q9CA 3X1UC 2G5HC 3MNNC 1KX3A 2Y2MA 5B1MA 3IP4C 3AZNA 3AN2A 4R8PB 4LD9C 3AV1D 3B6FC 3REKC 1EQZA 4UPKA 4XZQD 1P3BD 4KUDB 3MGSB 5B1MB 5GXQC 4AWLC 3AN2B 3UTBC 3O62B 3WTPA 3W99C 3KUYD 3AZID 5B0ZC 5B2JC 2F8NB 4G91B 1P3IA 2CV5B 4J8XA 3MGRD 4ZUXB 1F66B 2F2AC 1P3FA 5AV9D 2Y2QA 4XUJA 1U35B 4NE3A 4HGAB 5B31A 3LZ0C 1AOIB 4DRBA 5F99B 5AV5A 3A6ND 3X1SA 5B31B 5B24D 1P3PD 1P3AA 1P3GC 3AZED 5AV5B 3REHD 3AV2D 2BG1A 4CSRA 5CP6B 1P3AB 3V9RA 3VH6A 4EO5B 3VH6W 4Z5TA 3AYWC 5AVBC 4J8UC 3REJA 4CSRB 5AVCA 2UWXA 1P3MD 3MGPA 3V9RB 5CPJD 3KWQA 1KX5D 5BS7A 1B67A 3LELC 4UUZA 3MVDB 2LY8A 3B0CT 5E5AA 2AROB 3AZHC 3UT9C 4WU8B 5B32B 5GSUA 5AY8C 5GT3D 5KDMA 4QLCB 3REIC 1P34B 4Z66A 3C1BC 4LD9A 3MGQB 3B6FA 4YM6A 5GSUB 3REKA 3W96C 4JJND 5DNNC 1T3UA 3WKJC 5GXQA 4J8WB 4Z66B 3LZ1D 4KHAB 4X23C 4H9SC 4YM6B 5B2ID 3AZKC 3W99A 5JA4A 3WAAC 3X1TC 2F8NG 5B0ZA 4Z2MG 5B2JA 4J8VC 2PYOC 1P3LD 5AV8D 1ZLAB 1ID3D 2RIQA 5FUGA 5JA4B 5CPID 5B0ZB 4G92C 5AV6D 5B0YD 5CPKC 4NE6A 3TU4C 2IO5B 5B40A 2YFVB 5JRGB 3AFAA 3AZGC 3B0DB 3LZ0A 3B6GD 3AZJB 3RELC 3F6TA 2ZY2A 4R8PD 5B31G 2XD1A 3VH5T 5B40B 2Y2IA 1M1AB 3AFAB 2VQRA 1S32C 4KUDD 3MGSD 5B1MD 2DF4C 1P3GA 2HIOC 3AN2D 1P3OC 5C3IC 3O62D 1H3OA 1M19A 1BH9A 1EQZD 4WJ3C 1KX4C 3WA9B 2F8ND 3AYWA 5AVBA 4J8UA 1H3OB 3X1VB 2RVQD 3R45A 1M19B 2CV5D 5DNMB 1JFIA 4H9QA 1F66D 4ZUXD 4WZSB 3KXBA 1N1JA 1TZYB 3AV1C 3LELA 3UTAA 1P3KA 4XZQC 1U35D 1P3ID 4E44A 4YS3B 5B32G 3AZHA 4H9QB 2G5IC 1N1JB 3KXBB 3AZLC 2CWEA 3UTAB 1P3KB 3KUYC 3AZIC 1HQ3B 3AZMA 3EPLA 5AY8A 5B31D 3B6GB 3W97B 3EPHA 2XD5A 3LJAA 3REIA 3C1BA 2NZDC 4WU9A 5AV5D 3A1KA 3W96A 1KX3B 3AZMB 2NQBC 5CP6D 5DNNA 3WKJA 1P3AD 3LJAB 3AZNB 3A1IA 5G49A 4X23A 1M18A 3NQJA 4WU9B 1EQZB 3AZKA 3W96B 1TAFA 1W2EA 3EG5B 3WAAA 3A6NC 4J8VA 2PYOA 1M18B 3WTPB 5B24C 1P3PC 3MVDD 2AROD 4WU8D 3FDDA 3AZEC 5B32D 3REHC 5B33C 2ZY5A 3AV2C 1P3IB 2FFFB 5CPKA 3TU4A 3C1CA 3B0BA 5E5AD 4J8XB 3AZGA 1A7WA 4QLCD 1P3FB 1P34D 4XUJB 3B0CW 3MGQD 3C1CB 1P3MC 5GSUD 5CPJC 1KX5C 1S32A 3W98A 4J8WD 4Z66D 2HIOA 4LD9D 3X1SB 1P3OA 3B6FD 5GT0A 4YM6D 2HUEB 1S32B 3W98B 2BYMA 5GT0B 4H9PA 1ZLAD 5GT3C 1BFMA 5B0ZD 2Y2OA 2BYMB 4Z5TB 3AV1A 4JJNC 3REJB 4XZQA 5AVCB 4KGCC 1B6WA 3MGPB 3KWQB 5JRGD 3LZ1C 3AZLA 3AZJD 4UUZB 5B2IC 5E5AB 3KUYA 3X1UA 3MNNA 3AZIA 5B40D 1M1AD 3AFAD 1P3LC 3LZ0D 5AV8C 2NZDA 4ZBJC 1ID3C 5CPIC 3X1UB 3MNNB 2NQBA 5KDMB 5AV6C 5B0YC 4LD9B 3UTBA 2NZDB 3B6FB 3WA9D 3REKB 3VH5W 3X1VD 1M19D 5DNMD 5GXQB 4AWLB 2FJ7C 4R8PC 5CHLB 1TZYD 3A6NA 3UTBB 5B24A 4NFTA 1P3PA 3W99B 4KUDC 4YS3D 3MGSC 5B1MC 3VH6T 5B2JB 3AN2C 3KXBD 3AZEA 3REHA 5B33A 3O62C 3AV2A 3UTAD 3AZFC 5FUGB 1P3KD 3KFUG 1HQ3D 3W97D 2JE5A 5B33B 4G91C 2ZY3A 2RVQC 2CV5C 1P3MA 1F66C 4ZUXC 3P5JB 5CPJA 1KX5A 1KX3D 3AZMD 3LZ0B 2BYKA 5BNVA 3LJAD 3AZND 1U35C 5B1LC 4WU9D 4HGAC 3W96D 5BT1D 1AOIC 5BNVB 5F99C 1P3GB 1M18D 3WTPD 1BH9B 2YFWA 5GT3A 2F8NH 3NQUA 5AV5C 4J8VD 5AVBB 3AYWB 4J8UB 3R45B 1P3BC 5CP6C 1HTAA 4KGCA 3UT9A 1JFIB 1F1EA 4J8XD 1P3AC 2DQNC 4EO5C 4H9RA 1P3FD 3LELB 4XUJD 3C1CD 4WV4B 3UT9B 3AZHB 2Y2JA 1KU5A 4E45A 1P3LA 3MVDC 2Y2GA 1ID3A 2AROC 3X1SD 3MGRC 5CPIA 4WU8C 3WTPE 5AY8B 5B32C 5AV6A 5AV9C 5B0YA 3REIB 1S32D 3C1BB 3W98D 4H9OA 4H9SA 4CAYA 1WWIA 5GT0D 3X1TA 5DNNB 3WKJB 4QLCC 2FJ7A 2F8NK 1P34C 4H9OB 5G49B 4Z5TD 4X23B 3MGQC 3NQJB 5GSUC 4CAYB 3AZKB 3REJD 1TAFB 3X1TB 3WAAB 1R4VA 5AVCD 3MGSA 4KUDA 3MGPD 2FJ7B 3KWQD 4NE5A 4Z66C 4J8WC 4J8VB 4H9NA 2PYOB 3O62A 4YM6C 3AZFA 4G92B 2F8NA 3RELA 4H9NB 3AZLD 5CPKB 3TU4B 1ZLAC 2CV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF B;  3X1U D;  4ZUX A;  3MNN D;  1F66 A;  3AZG B;  4M6B A;  1BH8 A;  3REL B;  1WWS A;  1U35 A;  2IO5 C;  2NZD D;  4WNN A;  5B1L A;  3REK D;  5JRG C;  3B0D C;  2NQB D;  1BH8 B;  3AZJ C;  5GXQ D;  1AOI A;  1KX4 A;  5F99 A;  2HIO B;  3UTB D;  5C3I B;  1P3O B;  4WNN B;  5B1L B;  5B40 C;  1M1A C;  4DRA A;  5BNX A;  3AFA C;  3W99 D;  5B2J D;  1KX4 B;  4H9P B;  1P3B A;  5CP6 A;  5BNX B;  3AV1 B;  3WA9 C;  5B33 D;  4XZQ B;  5BO0 A;  3X1V C;  1P3B B;  1M19 C;  5DNM C;  1TZY C;  3AZL B;  3MVD A;  5BO0 B;  3KUY B;  2ARO A;  4YS3 C;  3MGR A;  3AZI B;  4WU8 A;  3KXB C;  5B32 A;  5AV9 A;  3UTA C;  1P3K C;  1P3G D;  3VH5 A;  3MGR B;  1HQ3 C;  2NQB B;  3B6G C;  3W97 C;  4QLC A;  5AV9 B;  1P34 A;  3MGQ A;  3AYW D;  5AVB D;  4J8U D;  1KX3 C;  3AZM C;  3LJA C;  3AZN C;  4J8W A;  3A6N B;  4KHA A;  4WU9 C;  3LEL D;  5B24 B;  1P3P B;  1EQZ C;  5BT1 C;  3AZH D;  4KGC D;  3UT9 D;  3AZE B;  3REH B;  3KSY A;  3AV2 B;  1M18 C;  3WTP C;  1ZLA A;  5AY8 D;  3REI D;  1P3I C;  3C1B D;  2L5A A;  1P3M B;  4J8X C;  5CPJ B;  1KX5 B;  2YFV A;  5JRG A;  5DNN D;  2BYK B;  3AZJ A;  1P3F C;  3WKJ D;  4XUJ C;  3C1C C;  4X23 D;  5B31 C;  1M1A A;  3AZK D;  3X1T D;  3WAA D;  2FJ7 D;  4Z2M H;  3X1S C;  2PYO D;  4JJN A;  2HUE C;  2YFW B;  5GT3 B;  3W98 C;  3LZ1 A;  3NQU B;  1ULY A;  3WA9 A;  5B2I A;  4JJN B;  5GT0 C;  3X1V A;  5CPK D;  3TU4 D;  4KGC B;  5DNM A;  3AZF D;  3LZ1 B;  1TZY A;  4H9R B;  4Z5T C;  3AZG D;  5AV8 A;  3REL D;  5B2I B;  3REJ C;  5AVC C;  4YS3 A;  3MGP C;  3KWQ C;  5BS7 C;  1P3L B;  5AV8 B;  4ZBJ B;  1ID3 B;  2HIO D;  5E5A C;  1P3O D;  5CPI B;  1HQ3 A;  5B1L D;  3W97 A;  3B6G A;  5AV6 B;  5B0Y B;  4R8P A;  1AOI D;  2JSS A;  5F99 D;  1KX4 D;  1Q9C A;  3X1U C;  3MNN C;  1KX3 A;  5B1M A;  3AZN A;  3AN2 A;  4R8P B;  4LD9 C;  3AV1 D;  3B6F C;  3REK C;  1EQZ A;  4XZQ D;  1P3B D;  4KUD B;  3MGS B;  5B1M B;  5GXQ C;  4AWL C;  3AN2 B;  3UTB C;  3O62 B;  3WTP A;  3W99 C;  3KUY D;  3AZI D;  5B0Z C;  5B2J C;  2F8N B;  4G91 B;  1P3I A;  2CV5 B;  4J8X A;  3MGR D;  4ZUX B;  1F66 B;  1P3F A;  5AV9 D;  4XUJ A;  1U35 B;  4NE3 A;  4HGA B;  5B31 A;  3LZ0 C;  1AOI B;  4DRB A;  5F99 B;  5AV5 A;  3A6N D;  3X1S A;  5B31 B;  5B24 D;  1P3P D;  1P3A A;  1P3G C;  3AZE D;  5AV5 B;  3REH D;  3AV2 D;  4CSR A;  5CP6 B;  1P3A B;  3V9R A;  3VH6 A;  4EO5 B;  3VH6 W;  4Z5T A;  3AYW C;  5AVB C;  4J8U C;  3REJ A;  4CSR B;  5AVC A;  1P3M D;  3MGP A;  3V9R B;  5CPJ D;  3KWQ A;  1KX5 D;  5BS7 A;  1B67 A;  3LEL C;  4UUZ A;  3MVD B;  2LY8 A;  3B0C T;  5E5A A;  2ARO B;  3AZH C;  3UT9 C;  4WU8 B;  5B32 B;  5GSU A;  5AY8 C;  5GT3 D;  5KDM A;  4QLC B;  3REI C;  1P34 B;  4Z66 A;  3C1B C;  4LD9 A;  3MGQ B;  3B6F A;  4YM6 A;  5GSU B;  3REK A;  3W96 C;  4JJN D;  5DNN C;  3WKJ C;  5GXQ A;  4J8W B;  4Z66 B;  3LZ1 D;  4KHA B;  4X23 C;  4H9S C;  4YM6 B;  5B2I D;  3AZK C;  3W99 A;  5JA4 A;  3WAA C;  3X1T C;  2F8N G;  5B0Z A;  4Z2M G;  5B2J A;  4J8V C;  2PYO C;  1P3L D;  5AV8 D;  1ZLA B;  1ID3 D;  5FUG A;  5JA4 B;  5CPI D;  5B0Z B;  4G92 C;  5AV6 D;  5B0Y D;  5CPK C;  4NE6 A;  3TU4 C;  2IO5 B;  5B40 A;  2YFV B;  5JRG B;  3AFA A;  3AZG C;  3B0D B;  3LZ0 A;  3B6G D;  3AZJ B;  3REL C;  4R8P D;  5B31 G;  3VH5 T;  5B40 B;  1M1A B;  3AFA B;  1S32 C;  4KUD D;  3MGS D;  5B1M D;  1P3G A;  2HIO C;  3AN2 D;  1P3O C;  5C3I C;  3O62 D;  1H3O A;  1M19 A;  1BH9 A;  1EQZ D;  1KX4 C;  3WA9 B;  2F8N D;  3AYW A;  5AVB A;  4J8U A;  1H3O B;  3X1V B;  3R45 A;  2RVQ D;  1M19 B;  2CV5 D;  5DNM B;  1JFI A;  4H9Q A;  1F66 D;  4ZUX D;  4WZS B;  3KXB A;  1N1J A;  1TZY B;  3AV1 C;  3LEL A;  3UTA A;  1P3K A;  4XZQ C;  1U35 D;  1P3I D;  4E44 A;  4YS3 B;  5B32 G;  3AZH A;  4H9Q B;  3KXB B;  1N1J B;  3AZL C;  2CWE A;  3UTA B;  1P3K B;  3KUY C;  3AZI C;  1HQ3 B;  3AZM A;  5AY8 A;  5B31 D;  3B6G B;  3W97 B;  3REI A;  3LJA A;  3C1B A;  2NZD C;  4WU9 A;  5AV5 D;  3W96 A;  1KX3 B;  3AZM B;  2NQB C;  5CP6 D;  5DNN A;  3WKJ A;  1P3A D;  3LJA B;  3AZN B;  5G49 A;  4X23 A;  1M18 A;  3NQJ A;  4WU9 B;  1EQZ B;  3AZK A;  3W96 B;  1TAF A;  3WAA A;  3A6N C;  4J8V A;  2PYO A;  1M18 B;  3WTP B;  5B24 C;  1P3P C;  3MVD D;  2ARO D;  4WU8 D;  3AZE C;  5B32 D;  3REH C;  5B33 C;  3AV2 C;  1P3I B;  5CPK A;  3TU4 A;  3C1C A;  3B0B A;  5E5A D;  4J8X B;  3AZG A;  1A7W A;  4QLC D;  1P3F B;  1P34 D;  4XUJ B;  3B0C W;  3MGQ D;  3C1C B;  1P3M C;  5GSU D;  5CPJ C;  1KX5 C;  1S32 A;  3W98 A;  4J8W D;  4Z66 D;  2HIO A;  4LD9 D;  3X1S B;  1P3O A;  3B6F D;  5GT0 A;  4YM6 D;  2HUE B;  1S32 B;  3W98 B;  2BYM A;  5GT0 B;  4H9P A;  1ZLA D;  5GT3 C;  1BFM A;  5B0Z D;  2BYM B;  4Z5T B;  3AV1 A;  4JJN C;  3REJ B;  4XZQ A;  5AVC B;  4KGC C;  1B6W A;  3MGP B;  3KWQ B;  5JRG D;  3LZ1 C;  3AZL A;  3AZJ D;  4UUZ B;  5B2I C;  5E5A B;  3KUY A;  3X1U A;  3MNN A;  3AZI A;  5B40 D;  1M1A D;  3AFA D;  1P3L C;  3LZ0 D;  5AV8 C;  2NZD A;  4ZBJ C;  1ID3 C;  5CPI C;  3X1U B;  3MNN B;  2NQB A;  5KDM B;  5AV6 C;  5B0Y C;  4LD9 B;  3UTB A;  2NZD B;  3B6F B;  3WA9 D;  3REK B;  3VH5 W;  3X1V D;  1M19 D;  5DNM D;  5GXQ B;  4AWL B;  2FJ7 C;  4R8P C;  5CHL B;  1TZY D;  3A6N A;  3UTB B;  5B24 A;  4NFT A;  1P3P A;  3W99 B;  4KUD C;  4YS3 D;  3MGS C;  5B1M C;  3VH6 T;  5B2J B;  3AN2 C;  3KXB D;  3AZE A;  3REH A;  5B33 A;  3O62 C;  3AV2 A;  3UTA D;  3AZF C;  5FUG B;  1P3K D;  1HQ3 D;  3W97 D;  5B33 B;  4G91 C;  2RVQ C;  2CV5 C;  1P3M A;  1F66 C;  4ZUX C;  5CPJ A;  1KX5 A;  1KX3 D;  3AZM D;  3LZ0 B;  2BYK A;  5BNV A;  3LJA D;  3AZN D;  1U35 C;  5B1L C;  4WU9 D;  4HGA C;  3W96 D;  5BT1 D;  1AOI C;  5BNV B;  5F99 C;  1P3G B;  1M18 D;  3WTP D;  1BH9 B;  2YFW A;  5GT3 A;  2F8N H;  3NQU A;  5AV5 C;  4J8V D;  5AVB B;  3AYW B;  4J8U B;  3R45 B;  1P3B C;  5CP6 C;  1HTA A;  4KGC A;  3UT9 A;  1JFI B;  1F1E A;  4J8X D;  1P3A C;  4EO5 C;  4H9R A;  1P3F D;  3LEL B;  4XUJ D;  3C1C D;  4WV4 B;  3UT9 B;  3AZH B;  1KU5 A;  4E45 A;  1P3L A;  3MVD C;  1ID3 A;  2ARO C;  3X1S D;  3MGR C;  5CPI A;  4WU8 C;  3WTP E;  5AY8 B;  5B32 C;  5AV6 A;  5AV9 C;  5B0Y A;  3REI B;  1S32 D;  3C1B B;  3W98 D;  4H9O A;  4H9S A;  4CAY A;  1WWI A;  5GT0 D;  3X1T A;  5DNN B;  3WKJ B;  4QLC C;  2FJ7 A;  2F8N K;  1P34 C;  4H9O B;  5G49 B;  4Z5T D;  4X23 B;  3MGQ C;  3NQJ B;  5GSU C;  4CAY B;  3AZK B;  3REJ D;  1TAF B;  3X1T B;  3WAA B;  1R4V A;  5AVC D;  3MGS A;  4KUD A;  3MGP D;  2FJ7 B;  3KWQ D;  4NE5 A;  4Z66 C;  4J8W C;  4J8V B;  4H9N A;  2PYO B;  3O62 A;  4YM6 C;  3AZF A;  4G92 B;  2F8N A;  3REL A;  4H9N B;  3AZL D;  5CPK B;  3TU4 B;  1ZLA C;  2CV5 A; 
#chains in the Genus database with same CATH topology
 3AZF B;  3X1U D;  4ZUX A;  3MNN D;  1F66 A;  3AZG B;  4M6B A;  3H0L C;  2W8S A;  1BH8 A;  3REL B;  1WWS A;  1U35 A;  2IO5 C;  2NZD D;  4WNN A;  5B1L A;  3REK D;  5JRG C;  3B0D C;  2NQB D;  1BH8 B;  2J8P A;  5GXQ D;  3AZJ C;  1AOI A;  1KX4 A;  5F99 A;  2HIO B;  3UTB D;  5C3I B;  1P3O B;  4WNN B;  5B1L B;  5B40 C;  1M1A C;  4DRA A;  5BNX A;  3AFA C;  3W99 D;  2ZM5 A;  5B2J D;  1KX4 B;  4H9P B;  1P3B A;  5CP6 A;  5BNX B;  3AV1 B;  3AL0 C;  3WA9 C;  5B33 D;  4XZQ B;  5BO0 A;  3X1V C;  1P3B B;  1M19 C;  5DNM C;  1TZY C;  3AZL B;  3MVD A;  5BO0 B;  3KUY B;  2ARO A;  4YS3 C;  3MGR A;  3AZI B;  4WU8 A;  3KXB C;  5B32 A;  5AV9 A;  3UTA C;  1P3K C;  1P3G D;  3VH5 A;  3MGR B;  1HQ3 C;  2NQB B;  3B6G C;  3W97 C;  4QLC A;  5AV9 B;  1P34 A;  3H0R C;  3MGQ A;  3H0M C;  3AYW D;  5AVB D;  4J8U D;  1KX3 C;  3AZM C;  3LJA C;  3AZN C;  4J8W A;  3A6N B;  4KHA A;  4WU9 C;  3LEL D;  4DQY B;  5B24 B;  1P3P B;  1EQZ C;  5BT1 C;  3AZH D;  4KGC D;  3UT9 D;  3AZE B;  3REH B;  3KSY A;  3AV2 B;  1M18 C;  3WTP C;  1ZLA A;  2Y2L A;  5AY8 D;  3REI D;  1P3I C;  3C1B D;  2L5A A;  2ZY4 A;  1P3M B;  4J8X C;  5CPJ B;  1KX5 B;  2Y2P A;  2YFV A;  5JRG A;  5DNN D;  2BYK B;  3AZJ A;  1P3F C;  3WKJ D;  4XUJ C;  3C1C C;  4X23 D;  3EPJ A;  5B31 C;  1M1A A;  3AZK D;  3X1T D;  3WAA D;  1Z2C B;  2FJ7 D;  4Z2M H;  3X1S C;  2PYO D;  4JJN A;  2HUE C;  2JCH A;  2YFW B;  5GT3 B;  3W98 C;  3LZ1 A;  3NQU B;  1ULY A;  3WA9 A;  5B2I A;  4JJN B;  2Y2K A;  5GT0 C;  3X1V A;  5CPK D;  3TU4 D;  4KGC B;  5DNM A;  3AZF D;  3LZ1 B;  1TZY A;  2Y2H A;  4H9R B;  4Z5T C;  3AZG D;  5AV8 A;  3REL D;  5B2I B;  3REJ C;  5AVC C;  4YS3 A;  2Y2N A;  3MGP C;  3KWQ C;  5BS7 C;  1P3L B;  5AV8 B;  4ZBJ B;  1ID3 B;  2HIO D;  5E5A C;  1P3O D;  5CPI B;  1HQ3 A;  1PZR A;  5B1L D;  3EPK A;  3W97 A;  3B6G A;  5AV6 B;  5B0Y B;  4R8P A;  1AOI D;  2JSS A;  5F99 D;  1KX4 D;  1Q9C A;  3X1U C;  2G5H C;  3MNN C;  1KX3 A;  2Y2M A;  5B1M A;  3IP4 C;  3AZN A;  3AN2 A;  4R8P B;  4LD9 C;  3AV1 D;  3B6F C;  3REK C;  1EQZ A;  4UPK A;  4XZQ D;  1P3B D;  4KUD B;  3MGS B;  5B1M B;  5GXQ C;  4AWL C;  3AN2 B;  3UTB C;  3O62 B;  3WTP A;  3W99 C;  3KUY D;  3AZI D;  5B0Z C;  5B2J C;  2F8N B;  4G91 B;  1P3I A;  2CV5 B;  4J8X A;  3MGR D;  4ZUX B;  1F66 B;  2F2A C;  1P3F A;  5AV9 D;  2Y2Q A;  4XUJ A;  1U35 B;  4NE3 A;  4HGA B;  5B31 A;  3LZ0 C;  1AOI B;  4DRB A;  5F99 B;  5AV5 A;  3A6N D;  3X1S A;  5B31 B;  5B24 D;  1P3P D;  1P3A A;  1P3G C;  3AZE D;  5AV5 B;  3REH D;  3AV2 D;  2BG1 A;  4CSR A;  5CP6 B;  1P3A B;  3V9R A;  3VH6 A;  4EO5 B;  3VH6 W;  4Z5T A;  3AYW C;  5AVB C;  4J8U C;  3REJ A;  4CSR B;  5AVC A;  2UWX A;  1P3M D;  3MGP A;  3V9R B;  5CPJ D;  3KWQ A;  1KX5 D;  5BS7 A;  1B67 A;  3LEL C;  4UUZ A;  3MVD B;  2LY8 A;  3B0C T;  5E5A A;  2ARO B;  3AZH C;  3UT9 C;  4WU8 B;  5B32 B;  5GSU A;  5AY8 C;  5GT3 D;  5KDM A;  4QLC B;  3REI C;  1P34 B;  4Z66 A;  3C1B C;  4LD9 A;  3MGQ B;  3B6F A;  4YM6 A;  5GSU B;  3REK A;  3W96 C;  4JJN D;  5DNN C;  1T3U A;  3WKJ C;  5GXQ A;  4J8W B;  4Z66 B;  3LZ1 D;  4KHA B;  4X23 C;  4H9S C;  4YM6 B;  5B2I D;  3AZK C;  3W99 A;  5JA4 A;  3WAA C;  3X1T C;  2F8N G;  5B0Z A;  4Z2M G;  5B2J A;  4J8V C;  2PYO C;  1P3L D;  5AV8 D;  1ZLA B;  1ID3 D;  2RIQ A;  5FUG A;  5JA4 B;  5CPI D;  5B0Z B;  4G92 C;  5AV6 D;  5B0Y D;  5CPK C;  4NE6 A;  3TU4 C;  2IO5 B;  5B40 A;  2YFV B;  5JRG B;  3AFA A;  3AZG C;  3B0D B;  3LZ0 A;  3B6G D;  3AZJ B;  3REL C;  3F6T A;  2ZY2 A;  4R8P D;  5B31 G;  2XD1 A;  3VH5 T;  5B40 B;  2Y2I A;  1M1A B;  3AFA B;  2VQR A;  1S32 C;  4KUD D;  3MGS D;  5B1M D;  2DF4 C;  1P3G A;  2HIO C;  3AN2 D;  1P3O C;  5C3I C;  3O62 D;  1H3O A;  1M19 A;  1BH9 A;  1EQZ D;  4WJ3 C;  1KX4 C;  3WA9 B;  2F8N D;  3AYW A;  5AVB A;  4J8U A;  1H3O B;  3X1V B;  2RVQ D;  3R45 A;  1M19 B;  2CV5 D;  5DNM B;  1JFI A;  4H9Q A;  1F66 D;  4ZUX D;  4WZS B;  3KXB A;  1N1J A;  1TZY B;  3AV1 C;  3LEL A;  3UTA A;  1P3K A;  4XZQ C;  1U35 D;  1P3I D;  4E44 A;  4YS3 B;  5B32 G;  3AZH A;  4H9Q B;  2G5I C;  1N1J B;  3KXB B;  3AZL C;  2CWE A;  3UTA B;  1P3K B;  3KUY C;  3AZI C;  1HQ3 B;  3AZM A;  3EPL A;  5AY8 A;  5B31 D;  3B6G B;  3W97 B;  3EPH A;  2XD5 A;  3LJA A;  3REI A;  3C1B A;  2NZD C;  4WU9 A;  5AV5 D;  3A1K A;  3W96 A;  1KX3 B;  3AZM B;  2NQB C;  5CP6 D;  5DNN A;  3WKJ A;  1P3A D;  3LJA B;  3AZN B;  3A1I A;  5G49 A;  4X23 A;  1M18 A;  3NQJ A;  4WU9 B;  1EQZ B;  3AZK A;  3W96 B;  1TAF A;  1W2E A;  3EG5 B;  3WAA A;  3A6N C;  4J8V A;  2PYO A;  1M18 B;  3WTP B;  5B24 C;  1P3P C;  3MVD D;  2ARO D;  4WU8 D;  3FDD A;  3AZE C;  5B32 D;  3REH C;  5B33 C;  2ZY5 A;  3AV2 C;  1P3I B;  2FFF B;  5CPK A;  3TU4 A;  3C1C A;  3B0B A;  5E5A D;  4J8X B;  3AZG A;  1A7W A;  4QLC D;  1P3F B;  1P34 D;  4XUJ B;  3B0C W;  3MGQ D;  3C1C B;  1P3M C;  5GSU D;  5CPJ C;  1KX5 C;  1S32 A;  3W98 A;  4J8W D;  4Z66 D;  2HIO A;  4LD9 D;  3X1S B;  1P3O A;  3B6F D;  5GT0 A;  4YM6 D;  2HUE B;  1S32 B;  3W98 B;  2BYM A;  5GT0 B;  4H9P A;  1ZLA D;  5GT3 C;  1BFM A;  5B0Z D;  2Y2O A;  2BYM B;  4Z5T B;  3AV1 A;  4JJN C;  3REJ B;  4XZQ A;  5AVC B;  4KGC C;  1B6W A;  3MGP B;  3KWQ B;  5JRG D;  3LZ1 C;  3AZL A;  3AZJ D;  4UUZ B;  5B2I C;  5E5A B;  3KUY A;  3X1U A;  3MNN A;  3AZI A;  5B40 D;  1M1A D;  3AFA D;  1P3L C;  3LZ0 D;  5AV8 C;  2NZD A;  4ZBJ C;  1ID3 C;  5CPI C;  3X1U B;  3MNN B;  2NQB A;  5KDM B;  5AV6 C;  5B0Y C;  4LD9 B;  3UTB A;  2NZD B;  3B6F B;  3WA9 D;  3REK B;  3VH5 W;  3X1V D;  1M19 D;  5DNM D;  5GXQ B;  4AWL B;  2FJ7 C;  4R8P C;  5CHL B;  1TZY D;  3A6N A;  3UTB B;  5B24 A;  4NFT A;  1P3P A;  3W99 B;  4KUD C;  4YS3 D;  3MGS C;  5B1M C;  3VH6 T;  5B2J B;  3AN2 C;  3KXB D;  3AZE A;  3REH A;  5B33 A;  3O62 C;  3AV2 A;  3UTA D;  3AZF C;  5FUG B;  1P3K D;  3KFU G;  1HQ3 D;  3W97 D;  2JE5 A;  5B33 B;  4G91 C;  2ZY3 A;  2RVQ C;  2CV5 C;  1P3M A;  1F66 C;  4ZUX C;  3P5J B;  5CPJ A;  1KX5 A;  1KX3 D;  3AZM D;  3LZ0 B;  2BYK A;  5BNV A;  3LJA D;  3AZN D;  1U35 C;  5B1L C;  4WU9 D;  4HGA C;  3W96 D;  5BT1 D;  1AOI C;  5BNV B;  5F99 C;  1P3G B;  1M18 D;  3WTP D;  1BH9 B;  2YFW A;  5GT3 A;  2F8N H;  3NQU A;  5AV5 C;  4J8V D;  5AVB B;  3AYW B;  4J8U B;  3R45 B;  1P3B C;  5CP6 C;  1HTA A;  4KGC A;  3UT9 A;  1JFI B;  1F1E A;  4J8X D;  1P3A C;  2DQN C;  4EO5 C;  4H9R A;  1P3F D;  3LEL B;  4XUJ D;  3C1C D;  4WV4 B;  3UT9 B;  3AZH B;  2Y2J A;  1KU5 A;  4E45 A;  1P3L A;  3MVD C;  2Y2G A;  1ID3 A;  2ARO C;  3X1S D;  3MGR C;  5CPI A;  4WU8 C;  3WTP E;  5AY8 B;  5B32 C;  5AV6 A;  5AV9 C;  5B0Y A;  3REI B;  1S32 D;  3C1B B;  3W98 D;  4H9O A;  4H9S A;  4CAY A;  1WWI A;  5GT0 D;  3X1T A;  5DNN B;  3WKJ B;  4QLC C;  2FJ7 A;  2F8N K;  1P34 C;  4H9O B;  5G49 B;  4Z5T D;  4X23 B;  3MGQ C;  3NQJ B;  5GSU C;  4CAY B;  3AZK B;  3REJ D;  1TAF B;  3X1T B;  3WAA B;  1R4V A;  5AVC D;  3MGS A;  4KUD A;  3MGP D;  2FJ7 B;  3KWQ D;  4NE5 A;  4Z66 C;  4J8W C;  4J8V B;  4H9N A;  2PYO B;  3O62 A;  4YM6 C;  3AZF A;  4G92 B;  2F8N A;  3REL A;  4H9N B;  3AZL D;  5CPK B;  3TU4 B;  1ZLA C;  2CV5 A; 
#chains in the Genus database with same CATH homology
 3AZF B;  3X1U D;  4ZUX A;  3MNN D;  1F66 A;  3AZG B;  4M6B A;  3H0L C;  2W8S A;  1BH8 A;  3REL B;  1WWS A;  1U35 A;  2IO5 C;  2NZD D;  4WNN A;  5B1L A;  3REK D;  5JRG C;  3B0D C;  2NQB D;  1BH8 B;  2J8P A;  5GXQ D;  3AZJ C;  1AOI A;  1KX4 A;  5F99 A;  2HIO B;  3UTB D;  5C3I B;  1P3O B;  4WNN B;  5B1L B;  5B40 C;  1M1A C;  4DRA A;  5BNX A;  3AFA C;  3W99 D;  2ZM5 A;  5B2J D;  1KX4 B;  4H9P B;  1P3B A;  5CP6 A;  5BNX B;  3AV1 B;  3AL0 C;  3WA9 C;  5B33 D;  4XZQ B;  5BO0 A;  3X1V C;  1P3B B;  1M19 C;  5DNM C;  1TZY C;  3AZL B;  3MVD A;  5BO0 B;  3KUY B;  2ARO A;  4YS3 C;  3MGR A;  3AZI B;  4WU8 A;  3KXB C;  5B32 A;  5AV9 A;  3UTA C;  1P3K C;  1P3G D;  3VH5 A;  3MGR B;  1HQ3 C;  2NQB B;  3B6G C;  3W97 C;  4QLC A;  5AV9 B;  1P34 A;  3H0R C;  3MGQ A;  3H0M C;  3AYW D;  5AVB D;  4J8U D;  1KX3 C;  3AZM C;  3LJA C;  3AZN C;  4J8W A;  3A6N B;  4KHA A;  4WU9 C;  3LEL D;  4DQY B;  5B24 B;  1P3P B;  1EQZ C;  5BT1 C;  3AZH D;  4KGC D;  3UT9 D;  3AZE B;  3REH B;  3KSY A;  3AV2 B;  1M18 C;  3WTP C;  1ZLA A;  2Y2L A;  5AY8 D;  3REI D;  1P3I C;  3C1B D;  2L5A A;  2ZY4 A;  1P3M B;  4J8X C;  5CPJ B;  1KX5 B;  2Y2P A;  2YFV A;  5JRG A;  5DNN D;  2BYK B;  3AZJ A;  1P3F C;  3WKJ D;  4XUJ C;  3C1C C;  4X23 D;  3EPJ A;  5B31 C;  1M1A A;  3AZK D;  3X1T D;  3WAA D;  1Z2C B;  2FJ7 D;  4Z2M H;  3X1S C;  2PYO D;  4JJN A;  2HUE C;  2JCH A;  2YFW B;  5GT3 B;  3W98 C;  3LZ1 A;  3NQU B;  1ULY A;  3WA9 A;  5B2I A;  4JJN B;  2Y2K A;  5GT0 C;  3X1V A;  5CPK D;  3TU4 D;  4KGC B;  5DNM A;  3AZF D;  3LZ1 B;  1TZY A;  2Y2H A;  4H9R B;  4Z5T C;  3AZG D;  5AV8 A;  3REL D;  5B2I B;  3REJ C;  5AVC C;  4YS3 A;  2Y2N A;  3MGP C;  3KWQ C;  5BS7 C;  1P3L B;  5AV8 B;  4ZBJ B;  1ID3 B;  2HIO D;  5E5A C;  1P3O D;  5CPI B;  1HQ3 A;  1PZR A;  5B1L D;  3EPK A;  3W97 A;  3B6G A;  5AV6 B;  5B0Y B;  4R8P A;  1AOI D;  2JSS A;  5F99 D;  1KX4 D;  1Q9C A;  3X1U C;  2G5H C;  3MNN C;  1KX3 A;  2Y2M A;  5B1M A;  3IP4 C;  3AZN A;  3AN2 A;  4R8P B;  4LD9 C;  3AV1 D;  3B6F C;  3REK C;  1EQZ A;  4UPK A;  4XZQ D;  1P3B D;  4KUD B;  3MGS B;  5B1M B;  5GXQ C;  4AWL C;  3AN2 B;  3UTB C;  3O62 B;  3WTP A;  3W99 C;  3KUY D;  3AZI D;  5B0Z C;  5B2J C;  2F8N B;  4G91 B;  1P3I A;  2CV5 B;  4J8X A;  3MGR D;  4ZUX B;  1F66 B;  2F2A C;  1P3F A;  5AV9 D;  2Y2Q A;  4XUJ A;  1U35 B;  4NE3 A;  4HGA B;  5B31 A;  3LZ0 C;  1AOI B;  4DRB A;  5F99 B;  5AV5 A;  3A6N D;  3X1S A;  5B31 B;  5B24 D;  1P3P D;  1P3A A;  1P3G C;  3AZE D;  5AV5 B;  3REH D;  3AV2 D;  2BG1 A;  4CSR A;  5CP6 B;  1P3A B;  3V9R A;  3VH6 A;  4EO5 B;  3VH6 W;  4Z5T A;  3AYW C;  5AVB C;  4J8U C;  3REJ A;  4CSR B;  5AVC A;  2UWX A;  1P3M D;  3MGP A;  3V9R B;  5CPJ D;  3KWQ A;  1KX5 D;  5BS7 A;  1B67 A;  3LEL C;  4UUZ A;  3MVD B;  2LY8 A;  3B0C T;  5E5A A;  2ARO B;  3AZH C;  3UT9 C;  4WU8 B;  5B32 B;  5GSU A;  5AY8 C;  5GT3 D;  5KDM A;  4QLC B;  3REI C;  1P34 B;  4Z66 A;  3C1B C;  4LD9 A;  3MGQ B;  3B6F A;  4YM6 A;  5GSU B;  3REK A;  3W96 C;  4JJN D;  5DNN C;  1T3U A;  3WKJ C;  5GXQ A;  4J8W B;  4Z66 B;  3LZ1 D;  4KHA B;  4X23 C;  4H9S C;  4YM6 B;  5B2I D;  3AZK C;  3W99 A;  5JA4 A;  3WAA C;  3X1T C;  2F8N G;  5B0Z A;  4Z2M G;  5B2J A;  4J8V C;  2PYO C;  1P3L D;  5AV8 D;  1ZLA B;  1ID3 D;  2RIQ A;  5FUG A;  5JA4 B;  5CPI D;  5B0Z B;  4G92 C;  5AV6 D;  5B0Y D;  5CPK C;  4NE6 A;  3TU4 C;  2IO5 B;  5B40 A;  2YFV B;  5JRG B;  3AFA A;  3AZG C;  3B0D B;  3LZ0 A;  3B6G D;  3AZJ B;  3REL C;  3F6T A;  2ZY2 A;  4R8P D;  5B31 G;  2XD1 A;  3VH5 T;  5B40 B;  2Y2I A;  1M1A B;  3AFA B;  2VQR A;  1S32 C;  4KUD D;  3MGS D;  5B1M D;  2DF4 C;  1P3G A;  2HIO C;  3AN2 D;  1P3O C;  5C3I C;  3O62 D;  1H3O A;  1M19 A;  1BH9 A;  1EQZ D;  4WJ3 C;  1KX4 C;  3WA9 B;  2F8N D;  3AYW A;  5AVB A;  4J8U A;  1H3O B;  3X1V B;  2RVQ D;  3R45 A;  1M19 B;  2CV5 D;  5DNM B;  1JFI A;  4H9Q A;  1F66 D;  4ZUX D;  4WZS B;  3KXB A;  1N1J A;  1TZY B;  3AV1 C;  3LEL A;  3UTA A;  1P3K A;  4XZQ C;  1U35 D;  1P3I D;  4E44 A;  4YS3 B;  5B32 G;  3AZH A;  4H9Q B;  2G5I C;  1N1J B;  3KXB B;  3AZL C;  2CWE A;  3UTA B;  1P3K B;  3KUY C;  3AZI C;  1HQ3 B;  3AZM A;  3EPL A;  5AY8 A;  5B31 D;  3B6G B;  3W97 B;  3EPH A;  2XD5 A;  3LJA A;  3REI A;  3C1B A;  2NZD C;  4WU9 A;  5AV5 D;  3A1K A;  3W96 A;  1KX3 B;  3AZM B;  2NQB C;  5CP6 D;  5DNN A;  3WKJ A;  1P3A D;  3LJA B;  3AZN B;  3A1I A;  5G49 A;  4X23 A;  1M18 A;  3NQJ A;  4WU9 B;  1EQZ B;  3AZK A;  3W96 B;  1TAF A;  1W2E A;  3EG5 B;  3WAA A;  3A6N C;  4J8V A;  2PYO A;  1M18 B;  3WTP B;  5B24 C;  1P3P C;  3MVD D;  2ARO D;  4WU8 D;  3FDD A;  3AZE C;  5B32 D;  3REH C;  5B33 C;  2ZY5 A;  3AV2 C;  1P3I B;  2FFF B;  5CPK A;  3TU4 A;  3C1C A;  3B0B A;  5E5A D;  4J8X B;  3AZG A;  1A7W A;  4QLC D;  1P3F B;  1P34 D;  4XUJ B;  3B0C W;  3MGQ D;  3C1C B;  1P3M C;  5GSU D;  5CPJ C;  1KX5 C;  1S32 A;  3W98 A;  4J8W D;  4Z66 D;  2HIO A;  4LD9 D;  3X1S B;  1P3O A;  3B6F D;  5GT0 A;  4YM6 D;  2HUE B;  1S32 B;  3W98 B;  2BYM A;  5GT0 B;  4H9P A;  1ZLA D;  5GT3 C;  1BFM A;  5B0Z D;  2Y2O A;  2BYM B;  4Z5T B;  3AV1 A;  4JJN C;  3REJ B;  4XZQ A;  5AVC B;  4KGC C;  1B6W A;  3MGP B;  3KWQ B;  5JRG D;  3LZ1 C;  3AZL A;  3AZJ D;  4UUZ B;  5B2I C;  5E5A B;  3KUY A;  3X1U A;  3MNN A;  3AZI A;  5B40 D;  1M1A D;  3AFA D;  1P3L C;  3LZ0 D;  5AV8 C;  2NZD A;  4ZBJ C;  1ID3 C;  5CPI C;  3X1U B;  3MNN B;  2NQB A;  5KDM B;  5AV6 C;  5B0Y C;  4LD9 B;  3UTB A;  2NZD B;  3B6F B;  3WA9 D;  3REK B;  3VH5 W;  3X1V D;  1M19 D;  5DNM D;  5GXQ B;  4AWL B;  2FJ7 C;  4R8P C;  5CHL B;  1TZY D;  3A6N A;  3UTB B;  5B24 A;  4NFT A;  1P3P A;  3W99 B;  4KUD C;  4YS3 D;  3MGS C;  5B1M C;  3VH6 T;  5B2J B;  3AN2 C;  3KXB D;  3AZE A;  3REH A;  5B33 A;  3O62 C;  3AV2 A;  3UTA D;  3AZF C;  5FUG B;  1P3K D;  3KFU G;  1HQ3 D;  3W97 D;  2JE5 A;  5B33 B;  4G91 C;  2ZY3 A;  2RVQ C;  2CV5 C;  1P3M A;  1F66 C;  4ZUX C;  3P5J B;  5CPJ A;  1KX5 A;  1KX3 D;  3AZM D;  3LZ0 B;  2BYK A;  5BNV A;  3LJA D;  3AZN D;  1U35 C;  5B1L C;  4WU9 D;  4HGA C;  3W96 D;  5BT1 D;  1AOI C;  5BNV B;  5F99 C;  1P3G B;  1M18 D;  3WTP D;  1BH9 B;  2YFW A;  5GT3 A;  2F8N H;  3NQU A;  5AV5 C;  4J8V D;  5AVB B;  3AYW B;  4J8U B;  3R45 B;  1P3B C;  5CP6 C;  1HTA A;  4KGC A;  3UT9 A;  1JFI B;  1F1E A;  4J8X D;  1P3A C;  2DQN C;  4EO5 C;  4H9R A;  1P3F D;  3LEL B;  4XUJ D;  3C1C D;  4WV4 B;  3UT9 B;  3AZH B;  2Y2J A;  1KU5 A;  4E45 A;  1P3L A;  3MVD C;  2Y2G A;  1ID3 A;  2ARO C;  3X1S D;  3MGR C;  5CPI A;  4WU8 C;  3WTP E;  5AY8 B;  5B32 C;  5AV6 A;  5AV9 C;  5B0Y A;  3REI B;  1S32 D;  3C1B B;  3W98 D;  4H9O A;  4H9S A;  4CAY A;  1WWI A;  5GT0 D;  3X1T A;  5DNN B;  3WKJ B;  4QLC C;  2FJ7 A;  2F8N K;  1P34 C;  4H9O B;  5G49 B;  4Z5T D;  4X23 B;  3MGQ C;  3NQJ B;  5GSU C;  4CAY B;  3AZK B;  3REJ D;  1TAF B;  3X1T B;  3WAA B;  1R4V A;  5AVC D;  3MGS A;  4KUD A;  3MGP D;  2FJ7 B;  3KWQ D;  4NE5 A;  4Z66 C;  4J8W C;  4J8V B;  4H9N A;  2PYO B;  3O62 A;  4YM6 C;  3AZF A;  4G92 B;  2F8N A;  3REL A;  4H9N B;  3AZL D;  5CPK B;  3TU4 B;  1ZLA C;  2CV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...