1BH9B

Htafii18/htafii28 heterodimer crystal structure with bound pcmbs
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation complex
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh9B00
1P3BB 5B2IA 3MVDD 5GT0D 1U35A 3W97C 5BNVA 5B31A 3UTBC 3AZLD 1M1AA 5B32D 3REID 2CV5A 3B6FC 1BH9A 1P3KB 1P3ID 3REJD 1P3AA 3LELD 5JRGC 4J8XC 3B6FB 5JA4B 5GSUC 4X23C 3UT9A 5B2ID 2F8NG 4ZUXC 1U35D 5JRGB 4ZBJC 4J8XB 3X1TB 1M18D 2BYMB 5GSUB 4X23B 3UTAC 3KXBA 4ZBJB 5B31D 3REHD 4J8WB 3UTAB 1M1AD 3VH5W 1P3AD 4LD9D 3AZKC 1B67A 5AV8B 1P3KA 3AFAC 3W96C 3B6FA 3AFAB 5JA4A 1P3BD 5B1LC 3W96B 3AV2C 5GXQD 4J8XA 3X1TA 2BYMA 5GSUA 5AV6C 4X23A 3AV2B 4J8VC 3X1UC 3C1CC 1KX3B 5AV6B 3W97D 4J8WA 3UTAA 3WKJC 5B0ZC 2AROA 3C1CB 4J8VB 3UTBD 3WKJB 5B0ZB 5B33B 3LZ1C 3B6FD 3MGQB 5AV8A 5AY8C 4EO5C 1EQZC 3KSYA 5JRGD 2CWEA 1TZYC 4J8XD 5GSUD 3AFAA 4X23D 4Z5TB 3W96A 4ZUXD 1EQZB 5CPKB 1S32C 4JJNC 3WA9A 5BO0B 3UTAD 3AZNC 2LY8A 3AV2A 2FJ7A 1S32B 4JJNB 1KX3A 5AV6A 3AZNB 5AVCC 4J8VA 3C1CA 2YFWB 3WTPC 3WKJA 5B0ZA 5B33A 1P3OC 5FUGB 5AVCB 5CP6B 3AZKD 3WTPB 1F66C 3MGQA 1KX5C 3AFAD 1P3OB 2NZDC 2RVQC 3W96D 3LZ0C 5CPJB 2IO5C 1KX5B 5B1LD 4Z5TA 3X1VC 3REKC 3AV2D 1P3GC 1P3FB 2IO5B 3VH6A 5CPKA 1EQZA 5AV6D 4WV4B 5BO0A 3REKB 3X1VB 1P3GB 1P3MC 4J8VD 3X1UD 3C1CD 4JJNA 3AZNA 3WKJD 5BS7C 5B0ZD 3AZHC 3W99C 1M19C 5FUGA 5AVCA 3LZ1D 2PYOC 5CP6A 4UUZB 3W99B 3WTPA 5AY8D 1P3LC 3B6GB 5CPJA 1EQZD 4XUJC 1TZYD 3AV1C 1KX5A 5F99C 3AZGB 2NZDA 1P3LB 1P3FA 1S32D 3AV1B 4JJND 5F99B 1P34C 3AZND 3REKA 3X1VA 1P3GA 1HTAA 1P34B 5AVCD 3AZEC 1KX4C 3WTPD 1BFMA 5BS7A 1P3OD 1H3OB 3W99A 1N1JB 4UUZA 5CPJD 5B31C 3TU4B 3AZEB 1KX4B 1KX5D 1AOIB 1F66D 1WWSA 2NZDD 2RVQD 3LZ0D 1P3PC 3B6GA 2CV5C 5B32G 4YM6A 5C3IB 3REKD 3AZGA 3X1VD 1P3GD 3MGSB 1P3PB 1P3LA 3AV1A 5F99A 3UT9C 4QLCC 1P3MD 1P34A 4M6BA 2HUEC 3AZHD 4QLCB 4HGAB 3KXBC 3W99D 1M19D 2HUEB 2BYKB 3KXBB 2PYOD 1H3OA 1N1JA 5B40B 3TU4A 3AZEA 5B31G 1KX4A 1AOIA 4CAYB 3X1SC 1P3LD 4XUJD 3AV1D 1P3KC 5F99D 3X1SB 3B0CW 1P3PA 3MGSA 4WU8C 1P34D 4WU8B 3X1TC 4R8PC 4QLCA 3AZED 1KX4D 2NZDB 4R8PB 4J8WC 2BYKA 3W98A 2AROC 3MNNB 4DRAA 5B40A 4H9OB 3B0DC 4CAYA 2AROB 1P3PD 2CV5D 3B0DB 5AV8C 1ZLAC 3MGRA 3X1SA 1TAFB 1ZLAB 1R4VA 3UT9D 3VH5T 4QLCD 4WU8A 3NQUB 3WA9C 3KXBD 2FJ7C 3LJAC 3WA9B 5G49B 1KX3C 3AN2A 4R8PA 2FJ7B 3LJAB 3MNNA 4H9OA 3O62C 5B33C 3X1SD 2JSSA 3O62B 3MGQC 4H9SC 1P3KD 4YS3C 3B0BA 1TAFA 5BT1C 4WU8D 1ZLAA 5KDMB 4Z5TC 4YS3B 5CPKC 3X1TD 3NQUA 4R8PD 4XZQC 1WWIA 5G49A 4J8WD 5AV5A 4XZQB 3LJAA 2AROD 5AVBC 5CP6C 3A6NA 5AV8D 3O62A 1ZLAD 5AVBB 5CPJC 1KU5A 4H9SA 5KDMA 4YS3A 1P3FC 3WAAC 3WA9D 4KUDA 2FJ7D 5B24B 3LJAD 3WAAB 1KX3D 4XZQA 5AV9C 3AZJC 4KGCB 3O62D 5GT3A 4E45A 5B33D 5AV9B 3AZJB 3MGQD 4NE5A 4H9RB 5AVBA 4YS3D 1ID3B 5BT1D 3B6GC 4YM6C 4Z5TD 3AZGC 1B6WA 5CPKD 4J8UB 4YM6B 3AZMB 4XZQD 5B24A 2HIOB 3WAAA 1A7WA 4KGCA 5AVBD 5CP6D 3TU4C 5AV9A 3AZJA 1AOIC 3MGPB 4H9RA 1ID3A 4NE6A 1BH8B 5DNMC 3NQJB 5C3IC 1P3FD 3MGSC 3WAAD 4J8UA 5B1MA 5DNMB 3AZMA 5E5AC 3AYWA 2HIOA 4NE3A 3VH6W 3AZIC 5E5AB 4HGAC 5AV9D 3AZJD 3AZIB 4CSRB 4AWLB 4WNNB 3W98C 5B40C 3MGPA 3W98B 3KWQA 3B6GD 1M18B 1BH8A 4YM6D 3MGRC 3AZGD 3NQJA 3MVDA 4E44A 5DNMA 3MGRB 5B32A 5E5AA 3B0CT 3AZIA 3AN2C 3RELC 4CSRA 5BNXB 4WNNA 3V9RB 3MNNC 3TU4D 3AN2B 1AOID 2F8NB 3RELB 5GXQB 1M18A 5DNMD 3MGSD 3REHA 3R45A 3W97B 5E5AD 3UTBB 3AZID 5CHLB 4LD9A 5AV5C 5BNXA 3V9RA 3W98D 5B40D 4Z66C 2NQBC 2F8NA 3RELA 5AV5B 1P3BA 4ZUXB 4H9NB 5DNNC 5B2JC 4Z66B 5GXQA 3A6NC 2NQBB 3MGRD 5B2JB 5DNNB 3A6NB 3W97A 3AZFC 3UTBA 3AZFB 4H9QB 4KUDC 3AZKB 3AN2D 2F8ND 3RELD 4KUDB 3MNND 5JRGA 5GT3C 4G91C 5B1LB 4ZUXA 4H9NA 4Z66A 5GT3B 4G91B 2NQBA 5B2JA 5DNNA 3X1UB 2L5AA 3AZFA 4H9QA 4Z2MG 5CPIC 5B24C 3LZ1B 3AZKA 5CPIB 5AV5D 3WTPE 5AY8B 4WZSB 4EO5B 4Z66D 1TZYB 4KGCC 2NQBD 5B1LA 5B2JD 5DNND 3A6ND 4H9PB 1F1EA 3C1BC 4DRBA 1ID3C 3X1UA 3AZFD 3C1BB 5B0YC 4J8UC 5B1MC 2F8NK 3AZMC 4KUDD 5B0YB 3LZ1A 3AYWC 2HIOC 1F66B 5B1MB 2YFVB 5CPIA 4WU9C 5AY8A 3LZ0B 3KUYC 3AYWB 4NFTA 1TZYA 5GT3D 4WU9B 4KHAB 3KUYB 1JFIB 1S32A 1HQ3C 4H9PA 3MGPC 3KWQC 1HQ3B 1P3MB 2YFWA 2F8NH 3C1BA 3MVDC 3KWQB 3AZHB 5GT0C 1M19B 3MVDB 5CPID 1P3OA 5GT0B 5B0YA 5B24D 2PYOB 4G92C 3AZLC 1F66A 2YFVA 5B32C 3REIC 3LZ0A 4G92B 3AZLB 4XUJB 4KGCD 5B32B 1P3IC 4WU9A 4AWLC 4KHAA 3KUYA 3REIB 3REJC 1JFIA 3LELC 1Q9CA 3VH6T 1P3IB 3C1BD 3REJB 5B2IC 1ID3D 1U35C 1HQ3A 3LELB 1P3MA 1M18C 1ULYA 5B2IB 3AZHA 5B0YD 1U35B 1M19A 4J8UD 3REHC 5B1MD 3AZMD 1M1AC 5GT0A 3AYWD 2HIOD 2PYOA 5BNVB 5B31B 3REHB 3R45B 1M1AB 3VH5A 4WU9D 3KUYD 1P3AC 2CV5B 4LD9C 3AZLA 4XUJA 1BH9B 3REIA 1P3AB 4LD9B 1HQ3D 4Z2MH 1P3IA 3UT9B 1P3BC 3MGPD 3REJA 3KWQD 3LELA 5GXQC
chains in the Genus database with same CATH superfamily
2JE5A 1P3BB 2XD5A 5B2IA 3MVDD 5GT0D 1U35A 3W97C 5BNVA 5B31A 3UTBC 3AZLD 1M1AA 5B32D 3REID 2CV5A 3B6FC 1BH9A 1P3KB 1P3ID 3REJD 1P3AA 4UPKA 3LELD 5JRGC 4J8XC 3B6FB 5JA4B 5GSUC 4X23C 3UT9A 5B2ID 2F8NG 4ZUXC 4WJ3C 1U35D 5JRGB 2Y2MA 4ZBJC 4J8XB 3X1TB 2BYMB 1M18D 5GSUB 4X23B 3UTAC 3KXBA 4ZBJB 5B31D 3REHD 4J8WB 3UTAB 1M1AD 3VH5W 1P3AD 4LD9D 3AZKC 1B67A 5AV8B 1P3KA 3AFAC 3W96C 3B6FA 3AFAB 5JA4A 1P3BD 5B1LC 3W96B 2JCHA 3AV2C 5GXQD 4J8XA 3X1TA 2BYMA 5GSUA 5AV6C 4X23A 3EPJA 3AV2B 4J8VC 3X1UC 3C1CC 1KX3B 5AV6B 3W97D 4J8WA 3UTAA 3WKJC 5B0ZC 2AROA 3C1CB 4J8VB 3UTBD 3WKJB 5B0ZB 5B33B 3LZ1C 3B6FD 3MGQB 5AV8A 2Y2KA 5AY8C 4EO5C 1EQZC 3KSYA 5JRGD 2CWEA 1TZYC 4J8XD 5GSUD 3AFAA 4X23D 4Z5TB 3W96A 4ZUXD 1EQZB 5CPKB 1S32C 4JJNC 2Y2GA 3WA9A 5BO0B 3UTAD 3AZNC 2LY8A 3AV2A 2FJ7A 1S32B 4JJNB 2ZY2A 1KX3A 5AV6A 3AZNB 5AVCC 4J8VA 3C1CA 2YFWB 2ZM5A 3WTPC 3WKJA 5B0ZA 5B33A 1P3OC 5FUGB 5AVCB 5CP6B 3AZKD 3WTPB 1F66C 3MGQA 1KX5C 3AFAD 1P3OB 2NZDC 2RVQC 3W96D 3LZ0C 5CPJB 2IO5C 2Y2JA 1KX5B 5B1LD 4Z5TA 3X1VC 3REKC 3AV2D 1P3GC 1P3FB 2IO5B 3VH6A 5CPKA 1EQZA 5AV6D 2G5HC 4WV4B 5BO0A 3REKB 3X1VB 1P3GB 1P3MC 4J8VD 3X1UD 3C1CD 4JJNA 3AZNA 3WKJD 3EG5B 5BS7C 5B0ZD 3AZHC 3W99C 1M19C 5FUGA 5AVCA 3LZ1D 2PYOC 5CP6A 4UUZB 3W99B 3WTPA 5AY8D 1P3LC 3B6GB 5CPJA 1EQZD 2W8SA 4XUJC 1TZYD 3AV1C 1KX5A 5F99C 3AZGB 2NZDA 1P3LB 1P3FA 1S32D 3AV1B 4JJND 1PZRA 5F99B 1P34C 3AZND 3REKA 3X1VA 1P3GA 1HTAA 1P34B 5AVCD 3AZEC 1KX4C 3WTPD 1BFMA 5BS7A 1P3OD 1H3OB 3W99A 1N1JB 4UUZA 5CPJD 5B31C 3TU4B 3AZEB 1KX4B 1KX5D 1AOIB 1F66D 1WWSA 2NZDD 2RVQD 3LZ0D 1P3PC 3B6GA 2CV5C 5B32G 1T3UA 5C3IB 4YM6A 3REKD 3AZGA 3X1VD 3MGSB 1P3GD 1P3PB 1P3LA 3AV1A 5F99A 3UT9C 3AL0C 4QLCC 1P3MD 1P34A 4M6BA 2HUEC 3IP4C 3AZHD 4QLCB 4HGAB 3KXBC 3W99D 1M19D 2HUEB 2BYKB 3KXBB 2PYOD 1H3OA 2Y2QA 1N1JA 5B40B 3TU4A 3AZEA 5B31G 1KX4A 2FFFB 1AOIA 4CAYB 3X1SC 1P3LD 4XUJD 3AV1D 2Y2OA 1P3KC 5F99D 3X1SB 3B0CW 1P3PA 3MGSA 3KFUG 4WU8C 1P34D 4WU8B 3X1TC 4R8PC 4QLCA 3AZED 1KX4D 2NZDB 4R8PB 4J8WC 2BYKA 3W98A 2AROC 3MNNB 4DRAA 5B40A 4H9OB 3B0DC 4CAYA 2AROB 1P3PD 2CV5D 3B0DB 5AV8C 1ZLAC 3MGRA 3X1SA 1TAFB 2Y2PA 1ZLAB 1R4VA 3UT9D 3VH5T 4QLCD 4WU8A 1W2EA 3NQUB 3WA9C 3KXBD 2FJ7C 3LJAC 3WA9B 5G49B 1KX3C 3AN2A 4R8PA 2FJ7B 3LJAB 3MNNA 4H9OA 3O62C 5B33C 3X1SD 2JSSA 3A1IA 3O62B 3MGQC 4H9SC 1P3KD 4YS3C 2DF4C 3B0BA 1TAFA 5BT1C 4WU8D 1ZLAA 3F6TA 5KDMB 3EPKA 4Z5TC 4YS3B 5CPKC 3X1TD 3NQUA 3H0LC 4R8PD 4XZQC 1WWIA 5G49A 4J8WD 5AV5A 4XZQB 3LJAA 2AROD 5AVBC 5CP6C 3A6NA 5AV8D 3O62A 1ZLAD 5AVBB 5CPJC 1KU5A 4H9SA 5KDMA 4YS3A 1P3FC 3WAAC 4DQYB 3WA9D 4KUDA 2FJ7D 5B24B 3LJAD 3WAAB 1KX3D 4XZQA 5AV9C 3AZJC 4KGCB 3O62D 5GT3A 4E45A 5B33D 5AV9B 3AZJB 3MGQD 4NE5A 4H9RB 5AVBA 4YS3D 1ID3B 5BT1D 3B6GC 4YM6C 4Z5TD 3AZGC 1B6WA 5CPKD 4J8UB 4YM6B 3AZMB 4XZQD 5B24A 2HIOB 3WAAA 1A7WA 2Y2NA 4KGCA 5AVBD 5CP6D 3TU4C 5AV9A 3AZJA 1AOIC 3MGPB 4H9RA 1ID3A 4NE6A 1BH8B 2ZY4A 5DNMC 3NQJB 5C3IC 1P3FD 3MGSC 3WAAD 4J8UA 5B1MA 5DNMB 3AZMA 5E5AC 3AYWA 2HIOA 4NE3A 3VH6W 3AZIC 5E5AB 4HGAC 5AV9D 3AZJD 3AZIB 3EPLA 4CSRB 4AWLB 4WNNB 3W98C 5B40C 3MGPA 3W98B 3KWQA 3B6GD 1M18B 1BH8A 2Y2IA 4YM6D 3MGRC 2ZY3A 3NQJA 3MVDA 3AZGD 4E44A 5DNMA 3MGRB 1Z2CB 2BG1A 2DQNC 5B32A 5E5AA 3B0CT 3AZIA 3AN2C 3RELC 4CSRA 2VQRA 5BNXB 4WNNA 3V9RB 3MNNC 3TU4D 3AN2B 1AOID 2F8NB 3RELB 5GXQB 1M18A 5DNMD 3MGSD 3REHA 3R45A 3W97B 5E5AD 3UTBB 3AZID 5CHLB 4LD9A 5AV5C 5BNXA 3V9RA 3W98D 5B40D 4Z66C 2NQBC 2F8NA 3RELA 5AV5B 1P3BA 4ZUXB 4H9NB 5DNNC 5B2JC 4Z66B 5GXQA 3A6NC 2NQBB 3MGRD 5B2JB 5DNNB 3A6NB 3W97A 3AZFC 2RIQA 3UTBA 3AZFB 4H9QB 4KUDC 3AZKB 3AN2D 2F8ND 3RELD 4KUDB 3MNND 5JRGA 5GT3C 4G91C 5B1LB 4ZUXA 4H9NA 4Z66A 5GT3B 4G91B 2NQBA 5B2JA 5DNNA 3X1UB 3FDDA 2L5AA 2Y2LA 3A1KA 3AZFA 4H9QA 4Z2MG 5CPIC 5B24C 3LZ1B 3AZKA 5CPIB 5AV5D 3WTPE 5AY8B 4WZSB 4EO5B 4Z66D 1TZYB 4KGCC 2NQBD 5B1LA 3P5JB 5B2JD 5DNND 3A6ND 4H9PB 1F1EA 3C1BC 4DRBA 3H0MC 1ID3C 3X1UA 3AZFD 2ZY5A 3C1BB 3EPHA 5B0YC 4J8UC 5B1MC 2F8NK 3AZMC 4KUDD 2F2AC 5B0YB 3LZ1A 3AYWC 2HIOC 1F66B 5B1MB 2YFVB 5CPIA 4WU9C 5AY8A 3LZ0B 3KUYC 3AYWB 4NFTA 1TZYA 5GT3D 4WU9B 4KHAB 3KUYB 1JFIB 1S32A 1HQ3C 4H9PA 3H0RC 2J8PA 2G5IC 3KWQC 3MGPC 1HQ3B 1P3MB 2YFWA 2F8NH 3C1BA 3MVDC 3KWQB 3AZHB 5GT0C 1M19B 3MVDB 5CPID 1P3OA 2Y2HA 5GT0B 5B0YA 5B24D 2PYOB 4G92C 3AZLC 1F66A 2YFVA 5B32C 3REIC 3LZ0A 4G92B 3AZLB 4XUJB 4KGCD 2UWXA 5B32B 1P3IC 4WU9A 4AWLC 2XD1A 4KHAA 3KUYA 3REIB 3REJC 1JFIA 3LELC 1Q9CA 3VH6T 1P3IB 3C1BD 3REJB 5B2IC 1ID3D 1U35C 1HQ3A 3LELB 1P3MA 1M18C 1ULYA 5B2IB 3AZHA 5B0YD 1U35B 1M19A 4J8UD 3REHC 5B1MD 3AZMD 1M1AC 5GT0A 3AYWD 2HIOD 2PYOA 5BNVB 5B31B 3REHB 3R45B 1M1AB 3VH5A 4WU9D 3KUYD 1P3AC 2CV5B 4LD9C 3AZLA 4XUJA 1BH9B 3REIA 1P3AB 4LD9B 1HQ3D 4Z2MH 1P3IA 3UT9B 1P3BC 3MGPD 3REJA 3KWQD 3LELA 5GXQC
chains in the Genus database with same CATH topology
2JE5A 1P3BB 2XD5A 5B2IA 3MVDD 5GT0D 1U35A 3W97C 5BNVA 5B31A 3UTBC 3AZLD 1M1AA 5B32D 3REID 2CV5A 3B6FC 1BH9A 1P3KB 1P3ID 3REJD 1P3AA 4UPKA 3LELD 5JRGC 4J8XC 3B6FB 5JA4B 5GSUC 4X23C 3UT9A 5B2ID 2F8NG 4ZUXC 4WJ3C 1U35D 5JRGB 2Y2MA 4ZBJC 4J8XB 3X1TB 2BYMB 1M18D 5GSUB 4X23B 3UTAC 3KXBA 4ZBJB 5B31D 3REHD 4J8WB 3UTAB 1M1AD 3VH5W 1P3AD 4LD9D 3AZKC 1B67A 5AV8B 1P3KA 3AFAC 3W96C 3B6FA 3AFAB 5JA4A 1P3BD 5B1LC 3W96B 2JCHA 3AV2C 5GXQD 4J8XA 3X1TA 2BYMA 5GSUA 5AV6C 4X23A 3EPJA 3AV2B 4J8VC 3X1UC 3C1CC 1KX3B 5AV6B 3W97D 4J8WA 3UTAA 3WKJC 5B0ZC 2AROA 3C1CB 4J8VB 3UTBD 3WKJB 5B0ZB 5B33B 3LZ1C 3B6FD 3MGQB 5AV8A 2Y2KA 5AY8C 4EO5C 1EQZC 3KSYA 5JRGD 2CWEA 1TZYC 4J8XD 5GSUD 3AFAA 4X23D 4Z5TB 3W96A 4ZUXD 1EQZB 5CPKB 1S32C 4JJNC 2Y2GA 3WA9A 5BO0B 3UTAD 3AZNC 2LY8A 3AV2A 2FJ7A 1S32B 4JJNB 2ZY2A 1KX3A 5AV6A 3AZNB 5AVCC 4J8VA 3C1CA 2YFWB 2ZM5A 3WTPC 3WKJA 5B0ZA 5B33A 1P3OC 5FUGB 5AVCB 5CP6B 3AZKD 3WTPB 1F66C 3MGQA 1KX5C 3AFAD 1P3OB 2NZDC 2RVQC 3W96D 3LZ0C 5CPJB 2IO5C 2Y2JA 1KX5B 5B1LD 4Z5TA 3X1VC 3REKC 3AV2D 1P3GC 1P3FB 2IO5B 3VH6A 5CPKA 1EQZA 5AV6D 2G5HC 4WV4B 5BO0A 3REKB 3X1VB 1P3GB 1P3MC 4J8VD 3X1UD 3C1CD 4JJNA 3AZNA 3WKJD 3EG5B 5BS7C 5B0ZD 3AZHC 3W99C 1M19C 5FUGA 5AVCA 3LZ1D 2PYOC 5CP6A 4UUZB 3W99B 3WTPA 5AY8D 1P3LC 3B6GB 5CPJA 1EQZD 2W8SA 4XUJC 1TZYD 3AV1C 1KX5A 5F99C 3AZGB 2NZDA 1P3LB 1P3FA 1S32D 3AV1B 4JJND 1PZRA 5F99B 1P34C 3AZND 3REKA 3X1VA 1P3GA 1HTAA 1P34B 5AVCD 3AZEC 1KX4C 3WTPD 1BFMA 5BS7A 1P3OD 1H3OB 3W99A 1N1JB 4UUZA 5CPJD 5B31C 3TU4B 3AZEB 1KX4B 1KX5D 1AOIB 1F66D 1WWSA 2NZDD 2RVQD 3LZ0D 1P3PC 3B6GA 2CV5C 5B32G 1T3UA 5C3IB 4YM6A 3REKD 3AZGA 3X1VD 3MGSB 1P3GD 1P3PB 1P3LA 3AV1A 5F99A 3UT9C 3AL0C 4QLCC 1P3MD 1P34A 4M6BA 2HUEC 3IP4C 3AZHD 4QLCB 4HGAB 3KXBC 3W99D 1M19D 2HUEB 2BYKB 3KXBB 2PYOD 1H3OA 2Y2QA 1N1JA 5B40B 3TU4A 3AZEA 5B31G 1KX4A 2FFFB 1AOIA 4CAYB 3X1SC 1P3LD 4XUJD 3AV1D 2Y2OA 1P3KC 5F99D 3X1SB 3B0CW 1P3PA 3MGSA 3KFUG 4WU8C 1P34D 4WU8B 3X1TC 4R8PC 4QLCA 3AZED 1KX4D 2NZDB 4R8PB 4J8WC 2BYKA 3W98A 2AROC 3MNNB 4DRAA 5B40A 4H9OB 3B0DC 4CAYA 2AROB 1P3PD 2CV5D 3B0DB 5AV8C 1ZLAC 3MGRA 3X1SA 1TAFB 2Y2PA 1ZLAB 1R4VA 3UT9D 3VH5T 4QLCD 4WU8A 1W2EA 3NQUB 3WA9C 3KXBD 2FJ7C 3LJAC 3WA9B 5G49B 1KX3C 3AN2A 4R8PA 2FJ7B 3LJAB 3MNNA 4H9OA 3O62C 5B33C 3X1SD 2JSSA 3A1IA 3O62B 3MGQC 4H9SC 1P3KD 4YS3C 2DF4C 3B0BA 1TAFA 5BT1C 4WU8D 1ZLAA 3F6TA 5KDMB 3EPKA 4Z5TC 4YS3B 5CPKC 3X1TD 3NQUA 3H0LC 4R8PD 4XZQC 1WWIA 5G49A 4J8WD 5AV5A 4XZQB 3LJAA 2AROD 5AVBC 5CP6C 3A6NA 5AV8D 3O62A 1ZLAD 5AVBB 5CPJC 1KU5A 4H9SA 5KDMA 4YS3A 1P3FC 3WAAC 4DQYB 3WA9D 4KUDA 2FJ7D 5B24B 3LJAD 3WAAB 1KX3D 4XZQA 5AV9C 3AZJC 4KGCB 3O62D 5GT3A 4E45A 5B33D 5AV9B 3AZJB 3MGQD 4NE5A 4H9RB 5AVBA 4YS3D 1ID3B 5BT1D 3B6GC 4YM6C 4Z5TD 3AZGC 1B6WA 5CPKD 4J8UB 4YM6B 3AZMB 4XZQD 5B24A 2HIOB 3WAAA 1A7WA 2Y2NA 4KGCA 5AVBD 5CP6D 3TU4C 5AV9A 3AZJA 1AOIC 3MGPB 4H9RA 1ID3A 4NE6A 1BH8B 2ZY4A 5DNMC 3NQJB 5C3IC 1P3FD 3MGSC 3WAAD 4J8UA 5B1MA 5DNMB 3AZMA 5E5AC 3AYWA 2HIOA 4NE3A 3VH6W 3AZIC 5E5AB 4HGAC 5AV9D 3AZJD 3AZIB 3EPLA 4CSRB 4AWLB 4WNNB 3W98C 5B40C 3MGPA 3W98B 3KWQA 3B6GD 1M18B 1BH8A 2Y2IA 4YM6D 3MGRC 2ZY3A 3NQJA 3MVDA 3AZGD 4E44A 5DNMA 3MGRB 1Z2CB 2BG1A 2DQNC 5B32A 5E5AA 3B0CT 3AZIA 3AN2C 3RELC 4CSRA 2VQRA 5BNXB 4WNNA 3V9RB 3MNNC 3TU4D 3AN2B 1AOID 2F8NB 3RELB 5GXQB 1M18A 5DNMD 3MGSD 3REHA 3R45A 3W97B 5E5AD 3UTBB 3AZID 5CHLB 4LD9A 5AV5C 5BNXA 3V9RA 3W98D 5B40D 4Z66C 2NQBC 2F8NA 3RELA 5AV5B 1P3BA 4ZUXB 4H9NB 5DNNC 5B2JC 4Z66B 5GXQA 3A6NC 2NQBB 3MGRD 5B2JB 5DNNB 3A6NB 3W97A 3AZFC 2RIQA 3UTBA 3AZFB 4H9QB 4KUDC 3AZKB 3AN2D 2F8ND 3RELD 4KUDB 3MNND 5JRGA 5GT3C 4G91C 5B1LB 4ZUXA 4H9NA 4Z66A 5GT3B 4G91B 2NQBA 5B2JA 5DNNA 3X1UB 3FDDA 2L5AA 2Y2LA 3A1KA 3AZFA 4H9QA 4Z2MG 5CPIC 5B24C 3LZ1B 3AZKA 5CPIB 5AV5D 3WTPE 5AY8B 4WZSB 4EO5B 4Z66D 1TZYB 4KGCC 2NQBD 5B1LA 3P5JB 5B2JD 5DNND 3A6ND 4H9PB 1F1EA 3C1BC 4DRBA 3H0MC 1ID3C 3X1UA 3AZFD 2ZY5A 3C1BB 3EPHA 5B0YC 4J8UC 5B1MC 2F8NK 3AZMC 4KUDD 2F2AC 5B0YB 3LZ1A 3AYWC 2HIOC 1F66B 5B1MB 2YFVB 5CPIA 4WU9C 5AY8A 3LZ0B 3KUYC 3AYWB 4NFTA 1TZYA 5GT3D 4WU9B 4KHAB 3KUYB 1JFIB 1S32A 1HQ3C 4H9PA 3H0RC 2J8PA 2G5IC 3KWQC 3MGPC 1HQ3B 1P3MB 2YFWA 2F8NH 3C1BA 3MVDC 3KWQB 3AZHB 5GT0C 1M19B 3MVDB 5CPID 1P3OA 2Y2HA 5GT0B 5B0YA 5B24D 2PYOB 4G92C 3AZLC 1F66A 2YFVA 5B32C 3REIC 3LZ0A 4G92B 3AZLB 4XUJB 4KGCD 2UWXA 5B32B 1P3IC 4WU9A 4AWLC 2XD1A 4KHAA 3KUYA 3REIB 3REJC 1JFIA 3LELC 1Q9CA 3VH6T 1P3IB 3C1BD 3REJB 5B2IC 1ID3D 1U35C 1HQ3A 3LELB 1P3MA 1M18C 1ULYA 5B2IB 3AZHA 5B0YD 1U35B 1M19A 4J8UD 3REHC 5B1MD 3AZMD 1M1AC 5GT0A 3AYWD 2HIOD 2PYOA 5BNVB 5B31B 3REHB 3R45B 1M1AB 3VH5A 4WU9D 3KUYD 1P3AC 2CV5B 4LD9C 3AZLA 4XUJA 1BH9B 3REIA 1P3AB 4LD9B 1HQ3D 4Z2MH 1P3IA 3UT9B 1P3BC 3MGPD 3REJA 3KWQD 3LELA 5GXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B B;  5B2I A;  3MVD D;  5GT0 D;  1U35 A;  3W97 C;  5BNV A;  5B31 A;  3UTB C;  3AZL D;  1M1A A;  5B32 D;  3REI D;  2CV5 A;  3B6F C;  1BH9 A;  1P3K B;  1P3I D;  3REJ D;  1P3A A;  3LEL D;  5JRG C;  4J8X C;  3B6F B;  5JA4 B;  5GSU C;  4X23 C;  3UT9 A;  5B2I D;  2F8N G;  4ZUX C;  1U35 D;  5JRG B;  4ZBJ C;  4J8X B;  3X1T B;  1M18 D;  2BYM B;  5GSU B;  4X23 B;  3UTA C;  3KXB A;  4ZBJ B;  5B31 D;  3REH D;  4J8W B;  3UTA B;  1M1A D;  3VH5 W;  1P3A D;  4LD9 D;  3AZK C;  1B67 A;  5AV8 B;  1P3K A;  3AFA C;  3W96 C;  3B6F A;  3AFA B;  5JA4 A;  1P3B D;  5B1L C;  3W96 B;  3AV2 C;  5GXQ D;  4J8X A;  3X1T A;  2BYM A;  5GSU A;  5AV6 C;  4X23 A;  3AV2 B;  4J8V C;  3X1U C;  3C1C C;  1KX3 B;  5AV6 B;  3W97 D;  4J8W A;  3UTA A;  3WKJ C;  5B0Z C;  2ARO A;  3C1C B;  4J8V B;  3UTB D;  3WKJ B;  5B0Z B;  5B33 B;  3LZ1 C;  3B6F D;  3MGQ B;  5AV8 A;  5AY8 C;  4EO5 C;  1EQZ C;  3KSY A;  5JRG D;  2CWE A;  1TZY C;  4J8X D;  5GSU D;  3AFA A;  4X23 D;  4Z5T B;  3W96 A;  4ZUX D;  1EQZ B;  5CPK B;  1S32 C;  4JJN C;  3WA9 A;  5BO0 B;  3UTA D;  3AZN C;  2LY8 A;  3AV2 A;  2FJ7 A;  1S32 B;  4JJN B;  1KX3 A;  5AV6 A;  3AZN B;  5AVC C;  4J8V A;  3C1C A;  2YFW B;  3WTP C;  3WKJ A;  5B0Z A;  5B33 A;  1P3O C;  5FUG B;  5AVC B;  5CP6 B;  3AZK D;  3WTP B;  1F66 C;  3MGQ A;  1KX5 C;  3AFA D;  1P3O B;  2NZD C;  2RVQ C;  3W96 D;  3LZ0 C;  5CPJ B;  2IO5 C;  1KX5 B;  5B1L D;  4Z5T A;  3X1V C;  3REK C;  3AV2 D;  1P3G C;  1P3F B;  2IO5 B;  3VH6 A;  5CPK A;  1EQZ A;  5AV6 D;  4WV4 B;  5BO0 A;  3REK B;  3X1V B;  1P3G B;  1P3M C;  4J8V D;  3X1U D;  3C1C D;  4JJN A;  3AZN A;  3WKJ D;  5BS7 C;  5B0Z D;  3AZH C;  3W99 C;  1M19 C;  5FUG A;  5AVC A;  3LZ1 D;  2PYO C;  5CP6 A;  4UUZ B;  3W99 B;  3WTP A;  5AY8 D;  1P3L C;  3B6G B;  5CPJ A;  1EQZ D;  4XUJ C;  1TZY D;  3AV1 C;  1KX5 A;  5F99 C;  3AZG B;  2NZD A;  1P3L B;  1P3F A;  1S32 D;  3AV1 B;  4JJN D;  5F99 B;  1P34 C;  3AZN D;  3REK A;  3X1V A;  1P3G A;  1HTA A;  1P34 B;  5AVC D;  3AZE C;  1KX4 C;  3WTP D;  1BFM A;  5BS7 A;  1P3O D;  1H3O B;  3W99 A;  1N1J B;  4UUZ A;  5CPJ D;  5B31 C;  3TU4 B;  3AZE B;  1KX4 B;  1KX5 D;  1AOI B;  1F66 D;  1WWS A;  2NZD D;  2RVQ D;  3LZ0 D;  1P3P C;  3B6G A;  2CV5 C;  5B32 G;  4YM6 A;  5C3I B;  3REK D;  3AZG A;  3X1V D;  1P3G D;  3MGS B;  1P3P B;  1P3L A;  3AV1 A;  5F99 A;  3UT9 C;  4QLC C;  1P3M D;  1P34 A;  4M6B A;  2HUE C;  3AZH D;  4QLC B;  4HGA B;  3KXB C;  3W99 D;  1M19 D;  2HUE B;  2BYK B;  3KXB B;  2PYO D;  1H3O A;  1N1J A;  5B40 B;  3TU4 A;  3AZE A;  5B31 G;  1KX4 A;  1AOI A;  4CAY B;  3X1S C;  1P3L D;  4XUJ D;  3AV1 D;  1P3K C;  5F99 D;  3X1S B;  3B0C W;  1P3P A;  3MGS A;  4WU8 C;  1P34 D;  4WU8 B;  3X1T C;  4R8P C;  4QLC A;  3AZE D;  1KX4 D;  2NZD B;  4R8P B;  4J8W C;  2BYK A;  3W98 A;  2ARO C;  3MNN B;  4DRA A;  5B40 A;  4H9O B;  3B0D C;  4CAY A;  2ARO B;  1P3P D;  2CV5 D;  3B0D B;  5AV8 C;  1ZLA C;  3MGR A;  3X1S A;  1TAF B;  1ZLA B;  1R4V A;  3UT9 D;  3VH5 T;  4QLC D;  4WU8 A;  3NQU B;  3WA9 C;  3KXB D;  2FJ7 C;  3LJA C;  3WA9 B;  5G49 B;  1KX3 C;  3AN2 A;  4R8P A;  2FJ7 B;  3LJA B;  3MNN A;  4H9O A;  3O62 C;  5B33 C;  3X1S D;  2JSS A;  3O62 B;  3MGQ C;  4H9S C;  1P3K D;  4YS3 C;  3B0B A;  1TAF A;  5BT1 C;  4WU8 D;  1ZLA A;  5KDM B;  4Z5T C;  4YS3 B;  5CPK C;  3X1T D;  3NQU A;  4R8P D;  4XZQ C;  1WWI A;  5G49 A;  4J8W D;  5AV5 A;  4XZQ B;  3LJA A;  2ARO D;  5AVB C;  5CP6 C;  3A6N A;  5AV8 D;  3O62 A;  1ZLA D;  5AVB B;  5CPJ C;  1KU5 A;  4H9S A;  5KDM A;  4YS3 A;  1P3F C;  3WAA C;  3WA9 D;  4KUD A;  2FJ7 D;  5B24 B;  3LJA D;  3WAA B;  1KX3 D;  4XZQ A;  5AV9 C;  3AZJ C;  4KGC B;  3O62 D;  5GT3 A;  4E45 A;  5B33 D;  5AV9 B;  3AZJ B;  3MGQ D;  4NE5 A;  4H9R B;  5AVB A;  4YS3 D;  1ID3 B;  5BT1 D;  3B6G C;  4YM6 C;  4Z5T D;  3AZG C;  1B6W A;  5CPK D;  4J8U B;  4YM6 B;  3AZM B;  4XZQ D;  5B24 A;  2HIO B;  3WAA A;  1A7W A;  4KGC A;  5AVB D;  5CP6 D;  3TU4 C;  5AV9 A;  3AZJ A;  1AOI C;  3MGP B;  4H9R A;  1ID3 A;  4NE6 A;  1BH8 B;  5DNM C;  3NQJ B;  5C3I C;  1P3F D;  3MGS C;  3WAA D;  4J8U A;  5B1M A;  5DNM B;  3AZM A;  5E5A C;  3AYW A;  2HIO A;  4NE3 A;  3VH6 W;  3AZI C;  5E5A B;  4HGA C;  5AV9 D;  3AZJ D;  3AZI B;  4CSR B;  4AWL B;  4WNN B;  3W98 C;  5B40 C;  3MGP A;  3W98 B;  3KWQ A;  3B6G D;  1M18 B;  1BH8 A;  4YM6 D;  3MGR C;  3AZG D;  3NQJ A;  3MVD A;  4E44 A;  5DNM A;  3MGR B;  5B32 A;  5E5A A;  3B0C T;  3AZI A;  3AN2 C;  3REL C;  4CSR A;  5BNX B;  4WNN A;  3V9R B;  3MNN C;  3TU4 D;  3AN2 B;  1AOI D;  2F8N B;  3REL B;  5GXQ B;  1M18 A;  5DNM D;  3MGS D;  3REH A;  3R45 A;  3W97 B;  5E5A D;  3UTB B;  3AZI D;  5CHL B;  4LD9 A;  5AV5 C;  5BNX A;  3V9R A;  3W98 D;  5B40 D;  4Z66 C;  2NQB C;  2F8N A;  3REL A;  5AV5 B;  1P3B A;  4ZUX B;  4H9N B;  5DNN C;  5B2J C;  4Z66 B;  5GXQ A;  3A6N C;  2NQB B;  3MGR D;  5B2J B;  5DNN B;  3A6N B;  3W97 A;  3AZF C;  3UTB A;  3AZF B;  4H9Q B;  4KUD C;  3AZK B;  3AN2 D;  2F8N D;  3REL D;  4KUD B;  3MNN D;  5JRG A;  5GT3 C;  4G91 C;  5B1L B;  4ZUX A;  4H9N A;  4Z66 A;  5GT3 B;  4G91 B;  2NQB A;  5B2J A;  5DNN A;  3X1U B;  2L5A A;  3AZF A;  4H9Q A;  4Z2M G;  5CPI C;  5B24 C;  3LZ1 B;  3AZK A;  5CPI B;  5AV5 D;  3WTP E;  5AY8 B;  4WZS B;  4EO5 B;  4Z66 D;  1TZY B;  4KGC C;  2NQB D;  5B1L A;  5B2J D;  5DNN D;  3A6N D;  4H9P B;  1F1E A;  3C1B C;  4DRB A;  1ID3 C;  3X1U A;  3AZF D;  3C1B B;  5B0Y C;  4J8U C;  5B1M C;  2F8N K;  3AZM C;  4KUD D;  5B0Y B;  3LZ1 A;  3AYW C;  2HIO C;  1F66 B;  5B1M B;  2YFV B;  5CPI A;  4WU9 C;  5AY8 A;  3LZ0 B;  3KUY C;  3AYW B;  4NFT A;  1TZY A;  5GT3 D;  4WU9 B;  4KHA B;  3KUY B;  1JFI B;  1S32 A;  1HQ3 C;  4H9P A;  3MGP C;  3KWQ C;  1HQ3 B;  1P3M B;  2YFW A;  2F8N H;  3C1B A;  3MVD C;  3KWQ B;  3AZH B;  5GT0 C;  1M19 B;  3MVD B;  5CPI D;  1P3O A;  5GT0 B;  5B0Y A;  5B24 D;  2PYO B;  4G92 C;  3AZL C;  1F66 A;  2YFV A;  5B32 C;  3REI C;  3LZ0 A;  4G92 B;  3AZL B;  4XUJ B;  4KGC D;  5B32 B;  1P3I C;  4WU9 A;  4AWL C;  4KHA A;  3KUY A;  3REI B;  3REJ C;  1JFI A;  3LEL C;  1Q9C A;  3VH6 T;  1P3I B;  3C1B D;  3REJ B;  5B2I C;  1ID3 D;  1U35 C;  1HQ3 A;  3LEL B;  1P3M A;  1M18 C;  1ULY A;  5B2I B;  3AZH A;  5B0Y D;  1U35 B;  1M19 A;  4J8U D;  3REH C;  5B1M D;  3AZM D;  1M1A C;  5GT0 A;  3AYW D;  2HIO D;  2PYO A;  5BNV B;  5B31 B;  3REH B;  3R45 B;  1M1A B;  3VH5 A;  4WU9 D;  3KUY D;  1P3A C;  2CV5 B;  4LD9 C;  3AZL A;  4XUJ A;  1BH9 B;  3REI A;  1P3A B;  4LD9 B;  1HQ3 D;  4Z2M H;  1P3I A;  3UT9 B;  1P3B C;  3MGP D;  3REJ A;  3KWQ D;  3LEL A;  5GXQ C; 
#chains in the Genus database with same CATH topology
 2JE5 A;  1P3B B;  2XD5 A;  5B2I A;  3MVD D;  5GT0 D;  1U35 A;  3W97 C;  5BNV A;  5B31 A;  3UTB C;  3AZL D;  1M1A A;  5B32 D;  3REI D;  2CV5 A;  3B6F C;  1BH9 A;  1P3K B;  1P3I D;  3REJ D;  1P3A A;  4UPK A;  3LEL D;  5JRG C;  4J8X C;  3B6F B;  5JA4 B;  5GSU C;  4X23 C;  3UT9 A;  5B2I D;  2F8N G;  4ZUX C;  4WJ3 C;  1U35 D;  5JRG B;  2Y2M A;  4ZBJ C;  4J8X B;  3X1T B;  2BYM B;  1M18 D;  5GSU B;  4X23 B;  3UTA C;  3KXB A;  4ZBJ B;  5B31 D;  3REH D;  4J8W B;  3UTA B;  1M1A D;  3VH5 W;  1P3A D;  4LD9 D;  3AZK C;  1B67 A;  5AV8 B;  1P3K A;  3AFA C;  3W96 C;  3B6F A;  3AFA B;  5JA4 A;  1P3B D;  5B1L C;  3W96 B;  2JCH A;  3AV2 C;  5GXQ D;  4J8X A;  3X1T A;  2BYM A;  5GSU A;  5AV6 C;  4X23 A;  3EPJ A;  3AV2 B;  4J8V C;  3X1U C;  3C1C C;  1KX3 B;  5AV6 B;  3W97 D;  4J8W A;  3UTA A;  3WKJ C;  5B0Z C;  2ARO A;  3C1C B;  4J8V B;  3UTB D;  3WKJ B;  5B0Z B;  5B33 B;  3LZ1 C;  3B6F D;  3MGQ B;  5AV8 A;  2Y2K A;  5AY8 C;  4EO5 C;  1EQZ C;  3KSY A;  5JRG D;  2CWE A;  1TZY C;  4J8X D;  5GSU D;  3AFA A;  4X23 D;  4Z5T B;  3W96 A;  4ZUX D;  1EQZ B;  5CPK B;  1S32 C;  4JJN C;  2Y2G A;  3WA9 A;  5BO0 B;  3UTA D;  3AZN C;  2LY8 A;  3AV2 A;  2FJ7 A;  1S32 B;  4JJN B;  2ZY2 A;  1KX3 A;  5AV6 A;  3AZN B;  5AVC C;  4J8V A;  3C1C A;  2YFW B;  2ZM5 A;  3WTP C;  3WKJ A;  5B0Z A;  5B33 A;  1P3O C;  5FUG B;  5AVC B;  5CP6 B;  3AZK D;  3WTP B;  1F66 C;  3MGQ A;  1KX5 C;  3AFA D;  1P3O B;  2NZD C;  2RVQ C;  3W96 D;  3LZ0 C;  5CPJ B;  2IO5 C;  2Y2J A;  1KX5 B;  5B1L D;  4Z5T A;  3X1V C;  3REK C;  3AV2 D;  1P3G C;  1P3F B;  2IO5 B;  3VH6 A;  5CPK A;  1EQZ A;  5AV6 D;  2G5H C;  4WV4 B;  5BO0 A;  3REK B;  3X1V B;  1P3G B;  1P3M C;  4J8V D;  3X1U D;  3C1C D;  4JJN A;  3AZN A;  3WKJ D;  3EG5 B;  5BS7 C;  5B0Z D;  3AZH C;  3W99 C;  1M19 C;  5FUG A;  5AVC A;  3LZ1 D;  2PYO C;  5CP6 A;  4UUZ B;  3W99 B;  3WTP A;  5AY8 D;  1P3L C;  3B6G B;  5CPJ A;  1EQZ D;  2W8S A;  4XUJ C;  1TZY D;  3AV1 C;  1KX5 A;  5F99 C;  3AZG B;  2NZD A;  1P3L B;  1P3F A;  1S32 D;  3AV1 B;  4JJN D;  1PZR A;  5F99 B;  1P34 C;  3AZN D;  3REK A;  3X1V A;  1P3G A;  1HTA A;  1P34 B;  5AVC D;  3AZE C;  1KX4 C;  3WTP D;  1BFM A;  5BS7 A;  1P3O D;  1H3O B;  3W99 A;  1N1J B;  4UUZ A;  5CPJ D;  5B31 C;  3TU4 B;  3AZE B;  1KX4 B;  1KX5 D;  1AOI B;  1F66 D;  1WWS A;  2NZD D;  2RVQ D;  3LZ0 D;  1P3P C;  3B6G A;  2CV5 C;  5B32 G;  1T3U A;  5C3I B;  4YM6 A;  3REK D;  3AZG A;  3X1V D;  3MGS B;  1P3G D;  1P3P B;  1P3L A;  3AV1 A;  5F99 A;  3UT9 C;  3AL0 C;  4QLC C;  1P3M D;  1P34 A;  4M6B A;  2HUE C;  3IP4 C;  3AZH D;  4QLC B;  4HGA B;  3KXB C;  3W99 D;  1M19 D;  2HUE B;  2BYK B;  3KXB B;  2PYO D;  1H3O A;  2Y2Q A;  1N1J A;  5B40 B;  3TU4 A;  3AZE A;  5B31 G;  1KX4 A;  2FFF B;  1AOI A;  4CAY B;  3X1S C;  1P3L D;  4XUJ D;  3AV1 D;  2Y2O A;  1P3K C;  5F99 D;  3X1S B;  3B0C W;  1P3P A;  3MGS A;  3KFU G;  4WU8 C;  1P34 D;  4WU8 B;  3X1T C;  4R8P C;  4QLC A;  3AZE D;  1KX4 D;  2NZD B;  4R8P B;  4J8W C;  2BYK A;  3W98 A;  2ARO C;  3MNN B;  4DRA A;  5B40 A;  4H9O B;  3B0D C;  4CAY A;  2ARO B;  1P3P D;  2CV5 D;  3B0D B;  5AV8 C;  1ZLA C;  3MGR A;  3X1S A;  1TAF B;  2Y2P A;  1ZLA B;  1R4V A;  3UT9 D;  3VH5 T;  4QLC D;  4WU8 A;  1W2E A;  3NQU B;  3WA9 C;  3KXB D;  2FJ7 C;  3LJA C;  3WA9 B;  5G49 B;  1KX3 C;  3AN2 A;  4R8P A;  2FJ7 B;  3LJA B;  3MNN A;  4H9O A;  3O62 C;  5B33 C;  3X1S D;  2JSS A;  3A1I A;  3O62 B;  3MGQ C;  4H9S C;  1P3K D;  4YS3 C;  2DF4 C;  3B0B A;  1TAF A;  5BT1 C;  4WU8 D;  1ZLA A;  3F6T A;  5KDM B;  3EPK A;  4Z5T C;  4YS3 B;  5CPK C;  3X1T D;  3NQU A;  3H0L C;  4R8P D;  4XZQ C;  1WWI A;  5G49 A;  4J8W D;  5AV5 A;  4XZQ B;  3LJA A;  2ARO D;  5AVB C;  5CP6 C;  3A6N A;  5AV8 D;  3O62 A;  1ZLA D;  5AVB B;  5CPJ C;  1KU5 A;  4H9S A;  5KDM A;  4YS3 A;  1P3F C;  3WAA C;  4DQY B;  3WA9 D;  4KUD A;  2FJ7 D;  5B24 B;  3LJA D;  3WAA B;  1KX3 D;  4XZQ A;  5AV9 C;  3AZJ C;  4KGC B;  3O62 D;  5GT3 A;  4E45 A;  5B33 D;  5AV9 B;  3AZJ B;  3MGQ D;  4NE5 A;  4H9R B;  5AVB A;  4YS3 D;  1ID3 B;  5BT1 D;  3B6G C;  4YM6 C;  4Z5T D;  3AZG C;  1B6W A;  5CPK D;  4J8U B;  4YM6 B;  3AZM B;  4XZQ D;  5B24 A;  2HIO B;  3WAA A;  1A7W A;  2Y2N A;  4KGC A;  5AVB D;  5CP6 D;  3TU4 C;  5AV9 A;  3AZJ A;  1AOI C;  3MGP B;  4H9R A;  1ID3 A;  4NE6 A;  1BH8 B;  2ZY4 A;  5DNM C;  3NQJ B;  5C3I C;  1P3F D;  3MGS C;  3WAA D;  4J8U A;  5B1M A;  5DNM B;  3AZM A;  5E5A C;  3AYW A;  2HIO A;  4NE3 A;  3VH6 W;  3AZI C;  5E5A B;  4HGA C;  5AV9 D;  3AZJ D;  3AZI B;  3EPL A;  4CSR B;  4AWL B;  4WNN B;  3W98 C;  5B40 C;  3MGP A;  3W98 B;  3KWQ A;  3B6G D;  1M18 B;  1BH8 A;  2Y2I A;  4YM6 D;  3MGR C;  2ZY3 A;  3NQJ A;  3MVD A;  3AZG D;  4E44 A;  5DNM A;  3MGR B;  1Z2C B;  2BG1 A;  2DQN C;  5B32 A;  5E5A A;  3B0C T;  3AZI A;  3AN2 C;  3REL C;  4CSR A;  2VQR A;  5BNX B;  4WNN A;  3V9R B;  3MNN C;  3TU4 D;  3AN2 B;  1AOI D;  2F8N B;  3REL B;  5GXQ B;  1M18 A;  5DNM D;  3MGS D;  3REH A;  3R45 A;  3W97 B;  5E5A D;  3UTB B;  3AZI D;  5CHL B;  4LD9 A;  5AV5 C;  5BNX A;  3V9R A;  3W98 D;  5B40 D;  4Z66 C;  2NQB C;  2F8N A;  3REL A;  5AV5 B;  1P3B A;  4ZUX B;  4H9N B;  5DNN C;  5B2J C;  4Z66 B;  5GXQ A;  3A6N C;  2NQB B;  3MGR D;  5B2J B;  5DNN B;  3A6N B;  3W97 A;  3AZF C;  2RIQ A;  3UTB A;  3AZF B;  4H9Q B;  4KUD C;  3AZK B;  3AN2 D;  2F8N D;  3REL D;  4KUD B;  3MNN D;  5JRG A;  5GT3 C;  4G91 C;  5B1L B;  4ZUX A;  4H9N A;  4Z66 A;  5GT3 B;  4G91 B;  2NQB A;  5B2J A;  5DNN A;  3X1U B;  3FDD A;  2L5A A;  2Y2L A;  3A1K A;  3AZF A;  4H9Q A;  4Z2M G;  5CPI C;  5B24 C;  3LZ1 B;  3AZK A;  5CPI B;  5AV5 D;  3WTP E;  5AY8 B;  4WZS B;  4EO5 B;  4Z66 D;  1TZY B;  4KGC C;  2NQB D;  5B1L A;  3P5J B;  5B2J D;  5DNN D;  3A6N D;  4H9P B;  1F1E A;  3C1B C;  4DRB A;  3H0M C;  1ID3 C;  3X1U A;  3AZF D;  2ZY5 A;  3C1B B;  3EPH A;  5B0Y C;  4J8U C;  5B1M C;  2F8N K;  3AZM C;  4KUD D;  2F2A C;  5B0Y B;  3LZ1 A;  3AYW C;  2HIO C;  1F66 B;  5B1M B;  2YFV B;  5CPI A;  4WU9 C;  5AY8 A;  3LZ0 B;  3KUY C;  3AYW B;  4NFT A;  1TZY A;  5GT3 D;  4WU9 B;  4KHA B;  3KUY B;  1JFI B;  1S32 A;  1HQ3 C;  4H9P A;  3H0R C;  2J8P A;  2G5I C;  3KWQ C;  3MGP C;  1HQ3 B;  1P3M B;  2YFW A;  2F8N H;  3C1B A;  3MVD C;  3KWQ B;  3AZH B;  5GT0 C;  1M19 B;  3MVD B;  5CPI D;  1P3O A;  2Y2H A;  5GT0 B;  5B0Y A;  5B24 D;  2PYO B;  4G92 C;  3AZL C;  1F66 A;  2YFV A;  5B32 C;  3REI C;  3LZ0 A;  4G92 B;  3AZL B;  4XUJ B;  4KGC D;  2UWX A;  5B32 B;  1P3I C;  4WU9 A;  4AWL C;  2XD1 A;  4KHA A;  3KUY A;  3REI B;  3REJ C;  1JFI A;  3LEL C;  1Q9C A;  3VH6 T;  1P3I B;  3C1B D;  3REJ B;  5B2I C;  1ID3 D;  1U35 C;  1HQ3 A;  3LEL B;  1P3M A;  1M18 C;  1ULY A;  5B2I B;  3AZH A;  5B0Y D;  1U35 B;  1M19 A;  4J8U D;  3REH C;  5B1M D;  3AZM D;  1M1A C;  5GT0 A;  3AYW D;  2HIO D;  2PYO A;  5BNV B;  5B31 B;  3REH B;  3R45 B;  1M1A B;  3VH5 A;  4WU9 D;  3KUY D;  1P3A C;  2CV5 B;  4LD9 C;  3AZL A;  4XUJ A;  1BH9 B;  3REI A;  1P3A B;  4LD9 B;  1HQ3 D;  4Z2M H;  1P3I A;  3UT9 B;  1P3B C;  3MGP D;  3REJ A;  3KWQ D;  3LEL A;  5GXQ C; 
#chains in the Genus database with same CATH homology
 2JE5 A;  1P3B B;  2XD5 A;  5B2I A;  3MVD D;  5GT0 D;  1U35 A;  3W97 C;  5BNV A;  5B31 A;  3UTB C;  3AZL D;  1M1A A;  5B32 D;  3REI D;  2CV5 A;  3B6F C;  1BH9 A;  1P3K B;  1P3I D;  3REJ D;  1P3A A;  4UPK A;  3LEL D;  5JRG C;  4J8X C;  3B6F B;  5JA4 B;  5GSU C;  4X23 C;  3UT9 A;  5B2I D;  2F8N G;  4ZUX C;  4WJ3 C;  1U35 D;  5JRG B;  2Y2M A;  4ZBJ C;  4J8X B;  3X1T B;  2BYM B;  1M18 D;  5GSU B;  4X23 B;  3UTA C;  3KXB A;  4ZBJ B;  5B31 D;  3REH D;  4J8W B;  3UTA B;  1M1A D;  3VH5 W;  1P3A D;  4LD9 D;  3AZK C;  1B67 A;  5AV8 B;  1P3K A;  3AFA C;  3W96 C;  3B6F A;  3AFA B;  5JA4 A;  1P3B D;  5B1L C;  3W96 B;  2JCH A;  3AV2 C;  5GXQ D;  4J8X A;  3X1T A;  2BYM A;  5GSU A;  5AV6 C;  4X23 A;  3EPJ A;  3AV2 B;  4J8V C;  3X1U C;  3C1C C;  1KX3 B;  5AV6 B;  3W97 D;  4J8W A;  3UTA A;  3WKJ C;  5B0Z C;  2ARO A;  3C1C B;  4J8V B;  3UTB D;  3WKJ B;  5B0Z B;  5B33 B;  3LZ1 C;  3B6F D;  3MGQ B;  5AV8 A;  2Y2K A;  5AY8 C;  4EO5 C;  1EQZ C;  3KSY A;  5JRG D;  2CWE A;  1TZY C;  4J8X D;  5GSU D;  3AFA A;  4X23 D;  4Z5T B;  3W96 A;  4ZUX D;  1EQZ B;  5CPK B;  1S32 C;  4JJN C;  2Y2G A;  3WA9 A;  5BO0 B;  3UTA D;  3AZN C;  2LY8 A;  3AV2 A;  2FJ7 A;  1S32 B;  4JJN B;  2ZY2 A;  1KX3 A;  5AV6 A;  3AZN B;  5AVC C;  4J8V A;  3C1C A;  2YFW B;  2ZM5 A;  3WTP C;  3WKJ A;  5B0Z A;  5B33 A;  1P3O C;  5FUG B;  5AVC B;  5CP6 B;  3AZK D;  3WTP B;  1F66 C;  3MGQ A;  1KX5 C;  3AFA D;  1P3O B;  2NZD C;  2RVQ C;  3W96 D;  3LZ0 C;  5CPJ B;  2IO5 C;  2Y2J A;  1KX5 B;  5B1L D;  4Z5T A;  3X1V C;  3REK C;  3AV2 D;  1P3G C;  1P3F B;  2IO5 B;  3VH6 A;  5CPK A;  1EQZ A;  5AV6 D;  2G5H C;  4WV4 B;  5BO0 A;  3REK B;  3X1V B;  1P3G B;  1P3M C;  4J8V D;  3X1U D;  3C1C D;  4JJN A;  3AZN A;  3WKJ D;  3EG5 B;  5BS7 C;  5B0Z D;  3AZH C;  3W99 C;  1M19 C;  5FUG A;  5AVC A;  3LZ1 D;  2PYO C;  5CP6 A;  4UUZ B;  3W99 B;  3WTP A;  5AY8 D;  1P3L C;  3B6G B;  5CPJ A;  1EQZ D;  2W8S A;  4XUJ C;  1TZY D;  3AV1 C;  1KX5 A;  5F99 C;  3AZG B;  2NZD A;  1P3L B;  1P3F A;  1S32 D;  3AV1 B;  4JJN D;  1PZR A;  5F99 B;  1P34 C;  3AZN D;  3REK A;  3X1V A;  1P3G A;  1HTA A;  1P34 B;  5AVC D;  3AZE C;  1KX4 C;  3WTP D;  1BFM A;  5BS7 A;  1P3O D;  1H3O B;  3W99 A;  1N1J B;  4UUZ A;  5CPJ D;  5B31 C;  3TU4 B;  3AZE B;  1KX4 B;  1KX5 D;  1AOI B;  1F66 D;  1WWS A;  2NZD D;  2RVQ D;  3LZ0 D;  1P3P C;  3B6G A;  2CV5 C;  5B32 G;  1T3U A;  5C3I B;  4YM6 A;  3REK D;  3AZG A;  3X1V D;  3MGS B;  1P3G D;  1P3P B;  1P3L A;  3AV1 A;  5F99 A;  3UT9 C;  3AL0 C;  4QLC C;  1P3M D;  1P34 A;  4M6B A;  2HUE C;  3IP4 C;  3AZH D;  4QLC B;  4HGA B;  3KXB C;  3W99 D;  1M19 D;  2HUE B;  2BYK B;  3KXB B;  2PYO D;  1H3O A;  2Y2Q A;  1N1J A;  5B40 B;  3TU4 A;  3AZE A;  5B31 G;  1KX4 A;  2FFF B;  1AOI A;  4CAY B;  3X1S C;  1P3L D;  4XUJ D;  3AV1 D;  2Y2O A;  1P3K C;  5F99 D;  3X1S B;  3B0C W;  1P3P A;  3MGS A;  3KFU G;  4WU8 C;  1P34 D;  4WU8 B;  3X1T C;  4R8P C;  4QLC A;  3AZE D;  1KX4 D;  2NZD B;  4R8P B;  4J8W C;  2BYK A;  3W98 A;  2ARO C;  3MNN B;  4DRA A;  5B40 A;  4H9O B;  3B0D C;  4CAY A;  2ARO B;  1P3P D;  2CV5 D;  3B0D B;  5AV8 C;  1ZLA C;  3MGR A;  3X1S A;  1TAF B;  2Y2P A;  1ZLA B;  1R4V A;  3UT9 D;  3VH5 T;  4QLC D;  4WU8 A;  1W2E A;  3NQU B;  3WA9 C;  3KXB D;  2FJ7 C;  3LJA C;  3WA9 B;  5G49 B;  1KX3 C;  3AN2 A;  4R8P A;  2FJ7 B;  3LJA B;  3MNN A;  4H9O A;  3O62 C;  5B33 C;  3X1S D;  2JSS A;  3A1I A;  3O62 B;  3MGQ C;  4H9S C;  1P3K D;  4YS3 C;  2DF4 C;  3B0B A;  1TAF A;  5BT1 C;  4WU8 D;  1ZLA A;  3F6T A;  5KDM B;  3EPK A;  4Z5T C;  4YS3 B;  5CPK C;  3X1T D;  3NQU A;  3H0L C;  4R8P D;  4XZQ C;  1WWI A;  5G49 A;  4J8W D;  5AV5 A;  4XZQ B;  3LJA A;  2ARO D;  5AVB C;  5CP6 C;  3A6N A;  5AV8 D;  3O62 A;  1ZLA D;  5AVB B;  5CPJ C;  1KU5 A;  4H9S A;  5KDM A;  4YS3 A;  1P3F C;  3WAA C;  4DQY B;  3WA9 D;  4KUD A;  2FJ7 D;  5B24 B;  3LJA D;  3WAA B;  1KX3 D;  4XZQ A;  5AV9 C;  3AZJ C;  4KGC B;  3O62 D;  5GT3 A;  4E45 A;  5B33 D;  5AV9 B;  3AZJ B;  3MGQ D;  4NE5 A;  4H9R B;  5AVB A;  4YS3 D;  1ID3 B;  5BT1 D;  3B6G C;  4YM6 C;  4Z5T D;  3AZG C;  1B6W A;  5CPK D;  4J8U B;  4YM6 B;  3AZM B;  4XZQ D;  5B24 A;  2HIO B;  3WAA A;  1A7W A;  2Y2N A;  4KGC A;  5AVB D;  5CP6 D;  3TU4 C;  5AV9 A;  3AZJ A;  1AOI C;  3MGP B;  4H9R A;  1ID3 A;  4NE6 A;  1BH8 B;  2ZY4 A;  5DNM C;  3NQJ B;  5C3I C;  1P3F D;  3MGS C;  3WAA D;  4J8U A;  5B1M A;  5DNM B;  3AZM A;  5E5A C;  3AYW A;  2HIO A;  4NE3 A;  3VH6 W;  3AZI C;  5E5A B;  4HGA C;  5AV9 D;  3AZJ D;  3AZI B;  3EPL A;  4CSR B;  4AWL B;  4WNN B;  3W98 C;  5B40 C;  3MGP A;  3W98 B;  3KWQ A;  3B6G D;  1M18 B;  1BH8 A;  2Y2I A;  4YM6 D;  3MGR C;  2ZY3 A;  3NQJ A;  3MVD A;  3AZG D;  4E44 A;  5DNM A;  3MGR B;  1Z2C B;  2BG1 A;  2DQN C;  5B32 A;  5E5A A;  3B0C T;  3AZI A;  3AN2 C;  3REL C;  4CSR A;  2VQR A;  5BNX B;  4WNN A;  3V9R B;  3MNN C;  3TU4 D;  3AN2 B;  1AOI D;  2F8N B;  3REL B;  5GXQ B;  1M18 A;  5DNM D;  3MGS D;  3REH A;  3R45 A;  3W97 B;  5E5A D;  3UTB B;  3AZI D;  5CHL B;  4LD9 A;  5AV5 C;  5BNX A;  3V9R A;  3W98 D;  5B40 D;  4Z66 C;  2NQB C;  2F8N A;  3REL A;  5AV5 B;  1P3B A;  4ZUX B;  4H9N B;  5DNN C;  5B2J C;  4Z66 B;  5GXQ A;  3A6N C;  2NQB B;  3MGR D;  5B2J B;  5DNN B;  3A6N B;  3W97 A;  3AZF C;  2RIQ A;  3UTB A;  3AZF B;  4H9Q B;  4KUD C;  3AZK B;  3AN2 D;  2F8N D;  3REL D;  4KUD B;  3MNN D;  5JRG A;  5GT3 C;  4G91 C;  5B1L B;  4ZUX A;  4H9N A;  4Z66 A;  5GT3 B;  4G91 B;  2NQB A;  5B2J A;  5DNN A;  3X1U B;  3FDD A;  2L5A A;  2Y2L A;  3A1K A;  3AZF A;  4H9Q A;  4Z2M G;  5CPI C;  5B24 C;  3LZ1 B;  3AZK A;  5CPI B;  5AV5 D;  3WTP E;  5AY8 B;  4WZS B;  4EO5 B;  4Z66 D;  1TZY B;  4KGC C;  2NQB D;  5B1L A;  3P5J B;  5B2J D;  5DNN D;  3A6N D;  4H9P B;  1F1E A;  3C1B C;  4DRB A;  3H0M C;  1ID3 C;  3X1U A;  3AZF D;  2ZY5 A;  3C1B B;  3EPH A;  5B0Y C;  4J8U C;  5B1M C;  2F8N K;  3AZM C;  4KUD D;  2F2A C;  5B0Y B;  3LZ1 A;  3AYW C;  2HIO C;  1F66 B;  5B1M B;  2YFV B;  5CPI A;  4WU9 C;  5AY8 A;  3LZ0 B;  3KUY C;  3AYW B;  4NFT A;  1TZY A;  5GT3 D;  4WU9 B;  4KHA B;  3KUY B;  1JFI B;  1S32 A;  1HQ3 C;  4H9P A;  3H0R C;  2J8P A;  2G5I C;  3KWQ C;  3MGP C;  1HQ3 B;  1P3M B;  2YFW A;  2F8N H;  3C1B A;  3MVD C;  3KWQ B;  3AZH B;  5GT0 C;  1M19 B;  3MVD B;  5CPI D;  1P3O A;  2Y2H A;  5GT0 B;  5B0Y A;  5B24 D;  2PYO B;  4G92 C;  3AZL C;  1F66 A;  2YFV A;  5B32 C;  3REI C;  3LZ0 A;  4G92 B;  3AZL B;  4XUJ B;  4KGC D;  2UWX A;  5B32 B;  1P3I C;  4WU9 A;  4AWL C;  2XD1 A;  4KHA A;  3KUY A;  3REI B;  3REJ C;  1JFI A;  3LEL C;  1Q9C A;  3VH6 T;  1P3I B;  3C1B D;  3REJ B;  5B2I C;  1ID3 D;  1U35 C;  1HQ3 A;  3LEL B;  1P3M A;  1M18 C;  1ULY A;  5B2I B;  3AZH A;  5B0Y D;  1U35 B;  1M19 A;  4J8U D;  3REH C;  5B1M D;  3AZM D;  1M1A C;  5GT0 A;  3AYW D;  2HIO D;  2PYO A;  5BNV B;  5B31 B;  3REH B;  3R45 B;  1M1A B;  3VH5 A;  4WU9 D;  3KUY D;  1P3A C;  2CV5 B;  4LD9 C;  3AZL A;  4XUJ A;  1BH9 B;  3REI A;  1P3A B;  4LD9 B;  1HQ3 D;  4Z2M H;  1P3I A;  3UT9 B;  1P3B C;  3MGP D;  3REJ A;  3KWQ D;  3LEL A;  5GXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...