1BH9B

Htafii18/htafii28 heterodimer crystal structure with bound pcmbs
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation complex
total genus 34
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh9B00
5B31B 5BO0B 1M19A 4H9OB 4XUJD 5GSUA 4KUDD 5CPJD 4XZQA 1P3KC 4ZUXD 3WTPD 2AROA 1HTAA 5AV8A 3LZ1B 1EQZC 5CPIB 3W96A 3B0BA 2F8NB 3NQUB 3AZHD 2YFWA 3W98B 4KGCD 4KHAA 3KUYC 3MGSB 3X1UC 4H9PB 1P3MD 3AZJC 3AYWB 1P3GC 5B1LA 3W97D 2HIOB 1TZYD 5B0ZA 2HUEC 5AVCB 1ZLAD 3VH5T 3WKJD 4G91B 3MNNA 1U35B 5AV5C 3AFAD 1AOIC 3WA9A 5AV9A 3O62A 3UT9B 3AZKC 5F99B 5B0YC 3AZED 1P3FB 1KX3C 5CP6B 4NFTA 5GXQB 4WU9D 5GT0D 3NQJB 1P3LC 3REJB 4J8UA 1P3IB 1P3KA 2PYOD 3X1VB 5B33D 3X1TC 4NE6A 5B31C 5B32B 2NQBD 1P3BD 1H3OB 3A6NB 3X1SB 3MGPB 3AZID 3B6FD 3AV1C 2NZDD 3WAAD 1F66A 3R45A 5B2ID 5GT3B 4R8PB 1N1JB 5B31G 4J8VC 3B6GC 3V9RA 5AY8B 5DNND 3W98C 4ZUXB 3UTBD 4J8XD 4DRBA 5AV5A 1WWIA 3LJAB 3AZMD 3VH6A 1M18C 2F8NG 1TAFA 4LD9C 1S32D 3AZHB 3AZLA 5C3IB 1U35C 3LZ1D 1P3MB 5CPID 5B2JD 3TU4A 2F8ND 3UT9C 3AZGC 4WU8A 1TZYB 1M1AB 3MGSD 4J8WC 3X1TA 4Z2MG 2CV5C 2BYMA 5CP6C 3AYWD 3AFAB 2HIOD 4X23B 3AV1A 3REJC 4H9RA 5AVCD 3X1VC 5CPKC 3LELA 5AV6C 1P34D 1KX5D 4E45A 4J8VA 3A6NC 2RVQC 1Q9CA 3MGPC 1HQ3B 3B6GA 5F99D 4WNNA 3UTAD 5GT0B 3REHA 3LZ0D 1P3FD 4R8PC 5JA4B 5GXQD 3C1BD 1P3AB 4Z5TB 2NQBB 1P3BB 4EO5B 1M18A 4XUJC 3AZFA 1P3ID 5KDMA 2FJ7D 2NZDB 5BNXA 4KUDC 4LD9A 5E5AB 5CPJC 4ZUXC 1BH8B 5FUGB 4Z2MH 5B2IB 1P3PB 3WTPC 1F66B 5B32D 3REIB 3C1CA 4H9SC 3X1SD 4AWLC 3W99B 4WZSB 4QLCB 3MGRA 3REKA 3AZGA 4Z66B 5GT3D 3AZHC 4H9QA 3AV2D 1KU5A 3AZNA 3KWQB 4KGCC 1KX4B 4J8WA 5AVBA 2CV5A 3RELB 1ULYA 1P3MC 3AN2A 4J8XB 5AY8D 3W97C 3AZMB 1TZYC 4XZQD 5AV6A 4H9NA 1S32B 1ZLAC 3VH6W 3WKJC 2AROD 1JFIB 3KXBA 4JJNA 2LY8A 3LJAD 3AFAC 5B2JB 1P3OB 3MGQB 4G92B 3TU4B 3W96D 4DRAA 4YM6A 3AZEC 4NE5A 2BYMB 3MVDA 4WU9C 4XUJA 5B24A 5GT0C 1M1AD 4KUDA 5CPJA 4CSRA 2PYOC 2BYKB 4H9RB 5JRGA 5B33C 1P34B 1KX5B 4H9SA 3MNND 2NQBC 1P3BC 4X23D 5DNMB 3AZIC 3B6FC 2NZDC 3UTAB 3WAAC 5B40B 5B2IC 3LZ0B 2IO5B 3C1BB 1ID3B 1HQ3D 3W97A 5B1MB 4J8UD 5DNNC 2FJ7B 3UTBC 3WKJA 1BFMA 1P3AD 4Z5TD 1BH9B 4J8XC 2YFVB 1EQZA 3AZMC 5E5AD 1P3PD 1F66D 1S32C 3KUYA 3REID 3AZEA 3AV2B 3X1UA 3W99D 4CAYA 3AZJA 4QLCD 3LZ1C 4YS3B 4WU9A 1P3GA 5CPIC 5B2JC 1M19B 2F8NK 4Z66D 5GSUB 3KWQD 1KX4D 5BNVA 4XZQB 3B0CT 4UUZA 3RELD 3MGSC 5B33A 2AROB 5AV8B 1AOIA 3AYWC 2CWEA 3AZKA 2HIOC 3B6FA 5AVCC 3W96B 5B0YA 2YFWB 3AZLD 4G91C 1KX3A 4KHAB 4YM6B 1KX5C 1P3OD 5BS7C 3MGQD 3TU4D 1P3LA 5F99C 5B1LB 4ZBJB 3UTAC 4WU8D 3LZ0C 1P3FC 1F1EA 5B0ZB 5B31A 3C1BC 3B0CW 5GXQC 3MNNB 4H9OA 1P3IC 3WA9B 5AV9B 3O62B 2FJ7C 5BT1D 3LELD 2L5AA 1A7WA 5B32C 3WTPE 3B0DB 3LZ1A 5DNMD 3X1SC 5CPIA 2F8NH 2F8NA 5B40D 3NQUA 3W98A 3REHD 5GT3C 4J8UB 3AV2C 1P3KB 4HGAB 3MGSA 4H9PA 1ID3D 5B32G 3AYWA 5B1MD 5AY8C 3AZFD 3VH6T 5AVCA 4XZQC 3R45B 2AROC 1U35A 3C1CD 3LJAC 3MGRD 3UT9A 5F99A 3REKD 3W96C 3V9RB 5C3IC 1P3FA 3AZND 5AVBD 5CP6A 4YS3D 5GXQA 3AN2D 5AV5B 1M19D 3NQJA 5GSUD 3REJA 1P3IA 3KSYA 1WWSA 3X1VA 5CPKA 1M1AC 1TAFB 1B67A 4WV4B 3AZLB 5AV8D 3KXBD 4JJND 1H3OA 3A6NA 3MNNC 3X1SA 3MGPA 4X23C 5GT3A 4WU8B 4R8PA 1N1JA 4YM6D 3X1TB 1HQ3C 3MVDD 5B1LD 5AY8A 5B24D 3AV1B 5B0ZD 4J8UC 4ZUXA 4HGAC 3WTPA 3LELB 5JRGD 1P3AC 4Z5TC 3LJAA 4J8VB 4EO5C 3WA9D 2JSSA 5AV9D 3O62D 3B6GB 5E5AC 4WNNB 3AZHA 1P3PC 5G49A 1F66C 3REHB 4KGCA 3REIC 1P3MA 3W99C 4QLCC 4Z66C 1M18B 1TZYA 3AZFB 1P3KD 1M1AA 5KDMB 3KWQC 1ZLAA 5BNXB 1KX4C 4LD9B 3RELC 3AFAA 3C1CB 1EQZD 4X23A 3MGRB 3REKB 3AZGB 3KUYD 4H9QB 3AZLC 3AZNB 3X1UD 4J8WB 5AVBB 3AZJD 2CV5B 1HQ3A 1P3GD 3AN2B 1P3OC 3MGQC 4G92C 3TU4C 5GT0A 4WU8C 2PYOA 5CPKB 5AV6B 4H9NB 5JA4A 1P3AA 4Z5TA 2NQBA 3KXBB 5AV5D 4JJNB 3VH5W 1P3BA 1AOID 3AZIA 1B6WA 3AZKD 2NZDA 5E5AA 3WAAA 1BH8A 5FUGA 5B0YD 5B2IA 1P3PA 5BT1C 3LELC 3REIA 1P34C 1KX3D 3W99A 4QLCA 5DNMC 3MVDB 1P3LD 4Z66A 5B40C 4XUJB 5B24B 5DNNA 3KWQA 3REHC 1KX4A 4KUDB 3UTBA 4CSRB 5CPJB 2IO5C 3X1TD 3RELA 3WTPB 5JRGB 5B31D 1ID3C 5BO0A 4J8XA 4E44A 5B1MC 4AWLB 3AZMA 3AV1D 3AZFC 1S32A 1JFIA 5G49B 4KGCB 4M6BA 4J8VD 3C1CC 5B2JA 1P3OA 3B6GD 3MGQA 3MGRC 3REKC 3W97B 3W98D 3AZNC 1ZLAB 5AVBC 3WKJB 4YS3C 3AN2C 1M19C 2HIOA 1M18D 1EQZB 5GSUC 4LD9D 2BYKA 1P34A 3KUYB 3AZEB 1KX5A 5AV8C 3KXBC 1U35D 3X1UB 4JJNC 1R4VA 4CAYB 3AZJB 5BS7A 5DNMA 4WU9B 1P3GB 3UT9D 3UTAA 5B40A 3AZGD 3LZ0A 2HUEB 2PYOB 5BNVB 4YM6C 4J8WD 2CV5D 4UUZB 5CP6D 3C1BA 5B33B 1ID3A 3MVDC 5B1MA 1AOIB 5B1LC 4ZBJC 4NE3A 3REJD 5B24C 3AZKB 3AZIB 3X1VD 5CPKD 2FJ7A 3B6FB 3VH5A 5AV6D 5B0ZC 3WAAB 5B0YB 5B32A 5CHLB 5JRGC 1BH9A 1KX3B 2YFVA 3A6ND 2RVQD 3MGPD 3WA9C 5AV9C 3O62C 1P3LB 3AV2A 5DNNB 4R8PD 3UTBB 3B0DC 4YS3A
chains in the Genus database with same CATH superfamily
5B31B 5BO0B 1M19A 4H9OB 4XUJD 5GSUA 4KUDD 5CPJD 4XZQA 1P3KC 4ZUXD 3WTPD 3AL0C 2AROA 1HTAA 2Y2NA 5AV8A 3LZ1B 1EQZC 5CPIB 3W96A 3B0BA 2F8NB 3NQUB 3AZHD 2YFWA 3W98B 4KGCD 4KHAA 3KUYC 3MGSB 3X1UC 4H9PB 1P3MD 3AZJC 3A1IA 3AYWB 1P3GC 5B1LA 3W97D 2HIOB 1TZYD 5B0ZA 2HUEC 5AVCB 1ZLAD 3VH5T 3WKJD 4G91B 3MNNA 1U35B 4UPKA 5AV5C 3AFAD 1AOIC 3WA9A 5AV9A 3O62A 3UT9B 3AZKC 5F99B 3EPHA 5B0YC 3AZED 1P3FB 1KX3C 5CP6B 4NFTA 5GXQB 2FFFB 4WU9D 4WJ3C 5GT0D 3NQJB 1P3LC 3REJB 4J8UA 1P3IB 1P3KA 2PYOD 3X1VB 5B33D 2ZM5A 3X1TC 4NE6A 5B31C 5B32B 2NQBD 1P3BD 1H3OB 2UWXA 3A6NB 2Y2PA 3X1SB 3MGPB 3AZID 3B6FD 3AV1C 2NZDD 3WAAD 3IP4C 1F66A 3R45A 5B2ID 5GT3B 4R8PB 1N1JB 5B31G 4J8VC 2JCHA 3B6GC 3V9RA 5AY8B 2DF4C 5DNND 3W98C 4ZUXB 3UTBD 3KFUG 4J8XD 4DRBA 5AV5A 1WWIA 3LJAB 3AZMD 3VH6A 1M18C 2ZY4A 2F8NG 1TAFA 4LD9C 4DQYB 1S32D 2XD1A 3AZHB 3AZLA 5C3IB 1U35C 3LZ1D 1P3MB 5CPID 5B2JD 3TU4A 2F8ND 3UT9C 3AZGC 4WU8A 1TZYB 1M1AB 3MGSD 4J8WC 3X1TA 4Z2MG 2CV5C 2BYMA 5CP6C 3AYWD 3AFAB 2HIOD 4X23B 3AV1A 3REJC 4H9RA 5AVCD 3X1VC 5CPKC 3LELA 5AV6C 1P34D 1KX5D 2Y2MA 4E45A 4J8VA 3F6TA 3A6NC 2RVQC 1Q9CA 3MGPC 1HQ3B 3B6GA 5F99D 4WNNA 3UTAD 5GT0B 3REHA 3LZ0D 1P3FD 4R8PC 5JA4B 5GXQD 3C1BD 1P3AB 4Z5TB 2NQBB 1P3BB 4EO5B 1M18A 4XUJC 3AZFA 1P3ID 5KDMA 2FJ7D 2NZDB 5BNXA 4KUDC 4LD9A 5E5AB 5CPJC 4ZUXC 1BH8B 5FUGB 4Z2MH 5B2IB 1P3PB 3WTPC 1F66B 5B32D 3REIB 3C1CA 4H9SC 3X1SD 4AWLC 3W99B 4WZSB 4QLCB 3MGRA 3H0RC 3REKA 3AZGA 2Y2QA 4Z66B 5GT3D 3AZHC 4H9QA 3AV2D 1KU5A 3AZNA 3KWQB 4KGCC 1KX4B 4J8WA 5AVBA 2CV5A 3RELB 1ULYA 1P3MC 3AN2A 4J8XB 5AY8D 3W97C 3AZMB 1TZYC 4XZQD 5AV6A 4H9NA 1S32B 1ZLAC 3VH6W 3WKJC 2AROD 1JFIB 3KXBA 4JJNA 2LY8A 3LJAD 3AFAC 5B2JB 1P3OB 3MGQB 4G92B 3TU4B 3W96D 3EG5B 2Y2GA 4DRAA 4YM6A 3AZEC 4NE5A 2BYMB 3MVDA 4WU9C 4XUJA 5B24A 5GT0C 1M1AD 4KUDA 5CPJA 4CSRA 2PYOC 2BYKB 4H9RB 5JRGA 5B33C 1P34B 1KX5B 4H9SA 3MNND 2NQBC 1P3BC 4X23D 5DNMB 3AZIC 2J8PA 3B6FC 2NZDC 3UTAB 3WAAC 5B40B 5B2IC 3LZ0B 2IO5B 2XD5A 3H0MC 3C1BB 1ID3B 1HQ3D 3W97A 5B1MB 4J8UD 3FDDA 5DNNC 2FJ7B 2G5IC 3UTBC 3WKJA 1BFMA 1P3AD 4Z5TD 1BH9B 4J8XC 2YFVB 1EQZA 3AZMC 5E5AD 1P3PD 1F66D 1S32C 3KUYA 3REID 3AZEA 3AV2B 3X1UA 3W99D 4CAYA 3AZJA 4QLCD 3LZ1C 4YS3B 4WU9A 1P3GA 5CPIC 5B2JC 1M19B 2F8NK 4Z66D 5GSUB 2F2AC 3KWQD 1KX4D 5BNVA 2Y2KA 4XZQB 3B0CT 4UUZA 3RELD 3MGSC 5B33A 2AROB 5AV8B 1AOIA 3AYWC 2CWEA 3AZKA 2HIOC 3B6FA 5AVCC 3W96B 5B0YA 2YFWB 3AZLD 4G91C 1KX3A 4KHAB 4YM6B 1KX5C 3H0LC 1P3OD 5BS7C 3MGQD 3TU4D 2ZY2A 1P3LA 5F99C 5B1LB 4ZBJB 3UTAC 4WU8D 3EPJA 3LZ0C 1P3FC 1F1EA 5B0ZB 5B31A 3C1BC 3B0CW 5GXQC 3MNNB 4H9OA 1P3IC 3WA9B 5AV9B 3O62B 2Y2OA 2FJ7C 5BT1D 3LELD 2L5AA 1A7WA 5B32C 3WTPE 3B0DB 3LZ1A 2ZY3A 5DNMD 3X1SC 5CPIA 2F8NH 2F8NA 5B40D 3NQUA 2DQNC 3REHD 3W98A 5GT3C 4J8UB 3AV2C 1P3KB 4HGAB 3MGSA 4H9PA 1ID3D 5B32G 3AYWA 5B1MD 5AY8C 3AZFD 3VH6T 1PZRA 5AVCA 2ZY5A 4XZQC 3R45B 2AROC 1U35A 3C1CD 3LJAC 3MGRD 3UT9A 5F99A 3REKD 3W96C 3V9RB 5C3IC 1P3FA 3AZND 5AVBD 5CP6A 4YS3D 5GXQA 3AN2D 5AV5B 1M19D 3NQJA 5GSUD 3REJA 1P3IA 3KSYA 1WWSA 3X1VA 5CPKA 1M1AC 1TAFB 1B67A 4WV4B 3AZLB 5AV8D 3KXBD 4JJND 1H3OA 3A6NA 3MNNC 3X1SA 3MGPA 4X23C 5GT3A 4WU8B 4R8PA 1N1JA 4YM6D 3X1TB 2BG1A 1HQ3C 3MVDD 5B1LD 5AY8A 5B24D 3AV1B 5B0ZD 4J8UC 4ZUXA 4HGAC 3WTPA 3LELB 5JRGD 1P3AC 4Z5TC 3LJAA 4J8VB 4EO5C 3WA9D 2JSSA 5AV9D 3O62D 3B6GB 5E5AC 4WNNB 3AZHA 1P3PC 5G49A 1F66C 3REHB 4KGCA 3REIC 1P3MA 3W99C 4QLCC 2JE5A 4Z66C 1M18B 1TZYA 3AZFB 1P3KD 1M1AA 5KDMB 3KWQC 1ZLAA 5BNXB 1KX4C 4LD9B 3RELC 3AFAA 3C1CB 1EQZD 4X23A 3MGRB 3REKB 3AZGB 3KUYD 4H9QB 3AZLC 3AZNB 3X1UD 4J8WB 5AVBB 3AZJD 2CV5B 1HQ3A 1P3GD 3AN2B 1P3OC 3MGQC 4G92C 3TU4C 5GT0A 4WU8C 2PYOA 5CPKB 5AV6B 4H9NB 5JA4A 1P3AA 4Z5TA 2NQBA 3KXBB 5AV5D 4JJNB 3VH5W 1P3BA 1AOID 2Y2IA 3AZIA 1B6WA 3AZKD 2NZDA 3P5JB 5E5AA 3WAAA 1BH8A 5FUGA 5B0YD 5B2IA 1P3PA 5BT1C 3LELC 3REIA 1P34C 1KX3D 3W99A 4QLCA 2W8SA 5DNMC 3MVDB 1P3LD 4Z66A 5B40C 4XUJB 5B24B 5DNNA 3EPLA 3KWQA 3REHC 1KX4A 4KUDB 3UTBA 2RIQA 4CSRB 5CPJB 2IO5C 3X1TD 3RELA 3WTPB 5JRGB 5B31D 1ID3C 5BO0A 4J8XA 4E44A 5B1MC 4AWLB 3AZMA 3AV1D 3AZFC 1S32A 1JFIA 5G49B 4KGCB 2VQRA 4M6BA 4J8VD 3C1CC 1W2EA 5B2JA 1P3OA 3B6GD 3MGQA 3MGRC 2Y2JA 3REKC 3W97B 3W98D 3AZNC 2Y2HA 1ZLAB 2Y2LA 5AVBC 3WKJB 4YS3C 3AN2C 1M19C 2HIOA 1M18D 1EQZB 5GSUC 4LD9D 2BYKA 1P34A 3KUYB 3AZEB 1KX5A 3EPKA 5AV8C 1T3UA 3KXBC 3X1UB 4JJNC 1U35D 1R4VA 4CAYB 3AZJB 5BS7A 5DNMA 2G5HC 4WU9B 1P3GB 3UT9D 3UTAA 5B40A 3AZGD 3LZ0A 2HUEB 2PYOB 5BNVB 4YM6C 4J8WD 2CV5D 4UUZB 5CP6D 3A1KA 5B33B 3C1BA 1ID3A 3MVDC 5B1MA 1AOIB 5B1LC 4ZBJC 4NE3A 3REJD 5B24C 3AZKB 3AZIB 3X1VD 5CPKD 2FJ7A 3B6FB 3VH5A 5AV6D 5B0ZC 3WAAB 5B0YB 5B32A 5CHLB 5JRGC 1BH9A 1KX3B 2YFVA 3A6ND 2RVQD 3MGPD 3WA9C 5AV9C 3O62C 1P3LB 3AV2A 5DNNB 4R8PD 1Z2CB 3UTBB 3B0DC 4YS3A
chains in the Genus database with same CATH topology
5B31B 5BO0B 1M19A 4H9OB 4XUJD 5GSUA 4KUDD 5CPJD 4XZQA 1P3KC 4ZUXD 3WTPD 3AL0C 2AROA 1HTAA 2Y2NA 5AV8A 3LZ1B 1EQZC 5CPIB 3W96A 3B0BA 2F8NB 3NQUB 3AZHD 2YFWA 3W98B 4KGCD 4KHAA 3KUYC 3MGSB 3X1UC 4H9PB 1P3MD 3AZJC 3A1IA 3AYWB 1P3GC 5B1LA 3W97D 2HIOB 1TZYD 5B0ZA 2HUEC 5AVCB 1ZLAD 3VH5T 3WKJD 4G91B 3MNNA 1U35B 4UPKA 5AV5C 3AFAD 1AOIC 3WA9A 5AV9A 3O62A 3UT9B 3AZKC 5F99B 3EPHA 5B0YC 3AZED 1P3FB 1KX3C 5CP6B 4NFTA 5GXQB 2FFFB 4WU9D 4WJ3C 5GT0D 3NQJB 1P3LC 3REJB 4J8UA 1P3IB 1P3KA 2PYOD 3X1VB 5B33D 2ZM5A 3X1TC 4NE6A 5B31C 5B32B 2NQBD 1P3BD 1H3OB 2UWXA 3A6NB 2Y2PA 3X1SB 3MGPB 3AZID 3B6FD 3AV1C 2NZDD 3WAAD 3IP4C 1F66A 3R45A 5B2ID 5GT3B 4R8PB 1N1JB 5B31G 4J8VC 2JCHA 3B6GC 3V9RA 5AY8B 2DF4C 5DNND 3W98C 4ZUXB 3UTBD 3KFUG 4J8XD 4DRBA 5AV5A 1WWIA 3LJAB 3AZMD 3VH6A 1M18C 2ZY4A 2F8NG 1TAFA 4LD9C 4DQYB 1S32D 2XD1A 3AZHB 3AZLA 5C3IB 1U35C 3LZ1D 1P3MB 5CPID 5B2JD 3TU4A 2F8ND 3UT9C 3AZGC 4WU8A 1TZYB 1M1AB 3MGSD 4J8WC 3X1TA 4Z2MG 2CV5C 2BYMA 5CP6C 3AYWD 3AFAB 2HIOD 4X23B 3AV1A 3REJC 4H9RA 5AVCD 3X1VC 5CPKC 3LELA 5AV6C 1P34D 1KX5D 2Y2MA 4E45A 4J8VA 3F6TA 3A6NC 2RVQC 1Q9CA 3MGPC 1HQ3B 3B6GA 5F99D 4WNNA 3UTAD 5GT0B 3REHA 3LZ0D 1P3FD 4R8PC 5JA4B 5GXQD 3C1BD 1P3AB 4Z5TB 2NQBB 1P3BB 4EO5B 1M18A 4XUJC 3AZFA 1P3ID 5KDMA 2FJ7D 2NZDB 5BNXA 4KUDC 4LD9A 5E5AB 5CPJC 4ZUXC 1BH8B 5FUGB 4Z2MH 5B2IB 1P3PB 3WTPC 1F66B 5B32D 3REIB 3C1CA 4H9SC 3X1SD 4AWLC 3W99B 4WZSB 4QLCB 3MGRA 3H0RC 3REKA 3AZGA 2Y2QA 4Z66B 5GT3D 3AZHC 4H9QA 3AV2D 1KU5A 3AZNA 3KWQB 4KGCC 1KX4B 4J8WA 5AVBA 2CV5A 3RELB 1ULYA 1P3MC 3AN2A 4J8XB 5AY8D 3W97C 3AZMB 1TZYC 4XZQD 5AV6A 4H9NA 1S32B 1ZLAC 3VH6W 3WKJC 2AROD 1JFIB 3KXBA 4JJNA 2LY8A 3LJAD 3AFAC 5B2JB 1P3OB 3MGQB 4G92B 3TU4B 3W96D 3EG5B 2Y2GA 4DRAA 4YM6A 3AZEC 4NE5A 2BYMB 3MVDA 4WU9C 4XUJA 5B24A 5GT0C 1M1AD 4KUDA 5CPJA 4CSRA 2PYOC 2BYKB 4H9RB 5JRGA 5B33C 1P34B 1KX5B 4H9SA 3MNND 2NQBC 1P3BC 4X23D 5DNMB 3AZIC 2J8PA 3B6FC 2NZDC 3UTAB 3WAAC 5B40B 5B2IC 3LZ0B 2IO5B 2XD5A 3H0MC 3C1BB 1ID3B 1HQ3D 3W97A 5B1MB 4J8UD 3FDDA 5DNNC 2FJ7B 2G5IC 3UTBC 3WKJA 1BFMA 1P3AD 4Z5TD 1BH9B 4J8XC 2YFVB 1EQZA 3AZMC 5E5AD 1P3PD 1F66D 1S32C 3KUYA 3REID 3AZEA 3AV2B 3X1UA 3W99D 4CAYA 3AZJA 4QLCD 3LZ1C 4YS3B 4WU9A 1P3GA 5CPIC 5B2JC 1M19B 2F8NK 4Z66D 5GSUB 2F2AC 3KWQD 1KX4D 5BNVA 2Y2KA 4XZQB 3B0CT 4UUZA 3RELD 3MGSC 5B33A 2AROB 5AV8B 1AOIA 3AYWC 2CWEA 3AZKA 2HIOC 3B6FA 5AVCC 3W96B 5B0YA 2YFWB 3AZLD 4G91C 1KX3A 4KHAB 4YM6B 1KX5C 3H0LC 1P3OD 5BS7C 3MGQD 3TU4D 2ZY2A 1P3LA 5F99C 5B1LB 4ZBJB 3UTAC 4WU8D 3EPJA 3LZ0C 1P3FC 1F1EA 5B0ZB 5B31A 3C1BC 3B0CW 5GXQC 3MNNB 4H9OA 1P3IC 3WA9B 5AV9B 3O62B 2Y2OA 2FJ7C 5BT1D 3LELD 2L5AA 1A7WA 5B32C 3WTPE 3B0DB 3LZ1A 2ZY3A 5DNMD 3X1SC 5CPIA 2F8NH 2F8NA 5B40D 3NQUA 2DQNC 3REHD 3W98A 5GT3C 4J8UB 3AV2C 1P3KB 4HGAB 3MGSA 4H9PA 1ID3D 5B32G 3AYWA 5B1MD 5AY8C 3AZFD 3VH6T 1PZRA 5AVCA 2ZY5A 4XZQC 3R45B 2AROC 1U35A 3C1CD 3LJAC 3MGRD 3UT9A 5F99A 3REKD 3W96C 3V9RB 5C3IC 1P3FA 3AZND 5AVBD 5CP6A 4YS3D 5GXQA 3AN2D 5AV5B 1M19D 3NQJA 5GSUD 3REJA 1P3IA 3KSYA 1WWSA 3X1VA 5CPKA 1M1AC 1TAFB 1B67A 4WV4B 3AZLB 5AV8D 3KXBD 4JJND 1H3OA 3A6NA 3MNNC 3X1SA 3MGPA 4X23C 5GT3A 4WU8B 4R8PA 1N1JA 4YM6D 3X1TB 2BG1A 1HQ3C 3MVDD 5B1LD 5AY8A 5B24D 3AV1B 5B0ZD 4J8UC 4ZUXA 4HGAC 3WTPA 3LELB 5JRGD 1P3AC 4Z5TC 3LJAA 4J8VB 4EO5C 3WA9D 2JSSA 5AV9D 3O62D 3B6GB 5E5AC 4WNNB 3AZHA 1P3PC 5G49A 1F66C 3REHB 4KGCA 3REIC 1P3MA 3W99C 4QLCC 2JE5A 4Z66C 1M18B 1TZYA 3AZFB 1P3KD 1M1AA 5KDMB 3KWQC 1ZLAA 5BNXB 1KX4C 4LD9B 3RELC 3AFAA 3C1CB 1EQZD 4X23A 3MGRB 3REKB 3AZGB 3KUYD 4H9QB 3AZLC 3AZNB 3X1UD 4J8WB 5AVBB 3AZJD 2CV5B 1HQ3A 1P3GD 3AN2B 1P3OC 3MGQC 4G92C 3TU4C 5GT0A 4WU8C 2PYOA 5CPKB 5AV6B 4H9NB 5JA4A 1P3AA 4Z5TA 2NQBA 3KXBB 5AV5D 4JJNB 3VH5W 1P3BA 1AOID 2Y2IA 3AZIA 1B6WA 3AZKD 2NZDA 3P5JB 5E5AA 3WAAA 1BH8A 5FUGA 5B0YD 5B2IA 1P3PA 5BT1C 3LELC 3REIA 1P34C 1KX3D 3W99A 4QLCA 2W8SA 5DNMC 3MVDB 1P3LD 4Z66A 5B40C 4XUJB 5B24B 5DNNA 3EPLA 3KWQA 3REHC 1KX4A 4KUDB 3UTBA 2RIQA 4CSRB 5CPJB 2IO5C 3X1TD 3RELA 3WTPB 5JRGB 5B31D 1ID3C 5BO0A 4J8XA 4E44A 5B1MC 4AWLB 3AZMA 3AV1D 3AZFC 1S32A 1JFIA 5G49B 4KGCB 2VQRA 4M6BA 4J8VD 3C1CC 1W2EA 5B2JA 1P3OA 3B6GD 3MGQA 3MGRC 2Y2JA 3REKC 3W97B 3W98D 3AZNC 2Y2HA 1ZLAB 2Y2LA 5AVBC 3WKJB 4YS3C 3AN2C 1M19C 2HIOA 1M18D 1EQZB 5GSUC 4LD9D 2BYKA 1P34A 3KUYB 3AZEB 1KX5A 3EPKA 5AV8C 1T3UA 3KXBC 3X1UB 4JJNC 1U35D 1R4VA 4CAYB 3AZJB 5BS7A 5DNMA 2G5HC 4WU9B 1P3GB 3UT9D 3UTAA 5B40A 3AZGD 3LZ0A 2HUEB 2PYOB 5BNVB 4YM6C 4J8WD 2CV5D 4UUZB 5CP6D 3A1KA 5B33B 3C1BA 1ID3A 3MVDC 5B1MA 1AOIB 5B1LC 4ZBJC 4NE3A 3REJD 5B24C 3AZKB 3AZIB 3X1VD 5CPKD 2FJ7A 3B6FB 3VH5A 5AV6D 5B0ZC 3WAAB 5B0YB 5B32A 5CHLB 5JRGC 1BH9A 1KX3B 2YFVA 3A6ND 2RVQD 3MGPD 3WA9C 5AV9C 3O62C 1P3LB 3AV2A 5DNNB 4R8PD 1Z2CB 3UTBB 3B0DC 4YS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 B;  5BO0 B;  1M19 A;  4H9O B;  4XUJ D;  5GSU A;  4KUD D;  5CPJ D;  4XZQ A;  1P3K C;  4ZUX D;  3WTP D;  2ARO A;  1HTA A;  5AV8 A;  3LZ1 B;  1EQZ C;  5CPI B;  3W96 A;  3B0B A;  2F8N B;  3NQU B;  3AZH D;  2YFW A;  3W98 B;  4KGC D;  4KHA A;  3KUY C;  3MGS B;  3X1U C;  4H9P B;  1P3M D;  3AZJ C;  3AYW B;  1P3G C;  5B1L A;  3W97 D;  2HIO B;  1TZY D;  5B0Z A;  2HUE C;  5AVC B;  1ZLA D;  3VH5 T;  3WKJ D;  4G91 B;  3MNN A;  1U35 B;  5AV5 C;  3AFA D;  1AOI C;  3WA9 A;  5AV9 A;  3O62 A;  3UT9 B;  3AZK C;  5F99 B;  5B0Y C;  3AZE D;  1P3F B;  1KX3 C;  5CP6 B;  4NFT A;  5GXQ B;  4WU9 D;  5GT0 D;  3NQJ B;  1P3L C;  3REJ B;  4J8U A;  1P3I B;  1P3K A;  2PYO D;  3X1V B;  5B33 D;  3X1T C;  4NE6 A;  5B31 C;  5B32 B;  2NQB D;  1P3B D;  1H3O B;  3A6N B;  3X1S B;  3MGP B;  3AZI D;  3B6F D;  3AV1 C;  2NZD D;  3WAA D;  1F66 A;  3R45 A;  5B2I D;  5GT3 B;  4R8P B;  1N1J B;  5B31 G;  4J8V C;  3B6G C;  3V9R A;  5AY8 B;  5DNN D;  3W98 C;  4ZUX B;  3UTB D;  4J8X D;  4DRB A;  5AV5 A;  1WWI A;  3LJA B;  3AZM D;  3VH6 A;  1M18 C;  2F8N G;  1TAF A;  4LD9 C;  1S32 D;  3AZH B;  3AZL A;  5C3I B;  1U35 C;  3LZ1 D;  1P3M B;  5CPI D;  5B2J D;  3TU4 A;  2F8N D;  3UT9 C;  3AZG C;  4WU8 A;  1TZY B;  1M1A B;  3MGS D;  4J8W C;  3X1T A;  4Z2M G;  2CV5 C;  2BYM A;  5CP6 C;  3AYW D;  3AFA B;  2HIO D;  4X23 B;  3AV1 A;  3REJ C;  4H9R A;  5AVC D;  3X1V C;  5CPK C;  3LEL A;  5AV6 C;  1P34 D;  1KX5 D;  4E45 A;  4J8V A;  3A6N C;  2RVQ C;  1Q9C A;  3MGP C;  1HQ3 B;  3B6G A;  5F99 D;  4WNN A;  3UTA D;  5GT0 B;  3REH A;  3LZ0 D;  1P3F D;  4R8P C;  5JA4 B;  5GXQ D;  3C1B D;  1P3A B;  4Z5T B;  2NQB B;  1P3B B;  4EO5 B;  1M18 A;  4XUJ C;  3AZF A;  1P3I D;  5KDM A;  2FJ7 D;  2NZD B;  5BNX A;  4KUD C;  4LD9 A;  5E5A B;  5CPJ C;  4ZUX C;  1BH8 B;  5FUG B;  4Z2M H;  5B2I B;  1P3P B;  3WTP C;  1F66 B;  5B32 D;  3REI B;  3C1C A;  4H9S C;  3X1S D;  4AWL C;  3W99 B;  4WZS B;  4QLC B;  3MGR A;  3REK A;  3AZG A;  4Z66 B;  5GT3 D;  3AZH C;  4H9Q A;  3AV2 D;  1KU5 A;  3AZN A;  3KWQ B;  4KGC C;  1KX4 B;  4J8W A;  5AVB A;  2CV5 A;  3REL B;  1ULY A;  1P3M C;  3AN2 A;  4J8X B;  5AY8 D;  3W97 C;  3AZM B;  1TZY C;  4XZQ D;  5AV6 A;  4H9N A;  1S32 B;  1ZLA C;  3VH6 W;  3WKJ C;  2ARO D;  1JFI B;  3KXB A;  4JJN A;  2LY8 A;  3LJA D;  3AFA C;  5B2J B;  1P3O B;  3MGQ B;  4G92 B;  3TU4 B;  3W96 D;  4DRA A;  4YM6 A;  3AZE C;  4NE5 A;  2BYM B;  3MVD A;  4WU9 C;  4XUJ A;  5B24 A;  5GT0 C;  1M1A D;  4KUD A;  5CPJ A;  4CSR A;  2PYO C;  2BYK B;  4H9R B;  5JRG A;  5B33 C;  1P34 B;  1KX5 B;  4H9S A;  3MNN D;  2NQB C;  1P3B C;  4X23 D;  5DNM B;  3AZI C;  3B6F C;  2NZD C;  3UTA B;  3WAA C;  5B40 B;  5B2I C;  3LZ0 B;  2IO5 B;  3C1B B;  1ID3 B;  1HQ3 D;  3W97 A;  5B1M B;  4J8U D;  5DNN C;  2FJ7 B;  3UTB C;  3WKJ A;  1BFM A;  1P3A D;  4Z5T D;  1BH9 B;  4J8X C;  2YFV B;  1EQZ A;  3AZM C;  5E5A D;  1P3P D;  1F66 D;  1S32 C;  3KUY A;  3REI D;  3AZE A;  3AV2 B;  3X1U A;  3W99 D;  4CAY A;  3AZJ A;  4QLC D;  3LZ1 C;  4YS3 B;  4WU9 A;  1P3G A;  5CPI C;  5B2J C;  1M19 B;  2F8N K;  4Z66 D;  5GSU B;  3KWQ D;  1KX4 D;  5BNV A;  4XZQ B;  3B0C T;  4UUZ A;  3REL D;  3MGS C;  5B33 A;  2ARO B;  5AV8 B;  1AOI A;  3AYW C;  2CWE A;  3AZK A;  2HIO C;  3B6F A;  5AVC C;  3W96 B;  5B0Y A;  2YFW B;  3AZL D;  4G91 C;  1KX3 A;  4KHA B;  4YM6 B;  1KX5 C;  1P3O D;  5BS7 C;  3MGQ D;  3TU4 D;  1P3L A;  5F99 C;  5B1L B;  4ZBJ B;  3UTA C;  4WU8 D;  3LZ0 C;  1P3F C;  1F1E A;  5B0Z B;  5B31 A;  3C1B C;  3B0C W;  5GXQ C;  3MNN B;  4H9O A;  1P3I C;  3WA9 B;  5AV9 B;  3O62 B;  2FJ7 C;  5BT1 D;  3LEL D;  2L5A A;  1A7W A;  5B32 C;  3WTP E;  3B0D B;  3LZ1 A;  5DNM D;  3X1S C;  5CPI A;  2F8N H;  2F8N A;  5B40 D;  3NQU A;  3W98 A;  3REH D;  5GT3 C;  4J8U B;  3AV2 C;  1P3K B;  4HGA B;  3MGS A;  4H9P A;  1ID3 D;  5B32 G;  3AYW A;  5B1M D;  5AY8 C;  3AZF D;  3VH6 T;  5AVC A;  4XZQ C;  3R45 B;  2ARO C;  1U35 A;  3C1C D;  3LJA C;  3MGR D;  3UT9 A;  5F99 A;  3REK D;  3W96 C;  3V9R B;  5C3I C;  1P3F A;  3AZN D;  5AVB D;  5CP6 A;  4YS3 D;  5GXQ A;  3AN2 D;  5AV5 B;  1M19 D;  3NQJ A;  5GSU D;  3REJ A;  1P3I A;  3KSY A;  1WWS A;  3X1V A;  5CPK A;  1M1A C;  1TAF B;  1B67 A;  4WV4 B;  3AZL B;  5AV8 D;  3KXB D;  4JJN D;  1H3O A;  3A6N A;  3MNN C;  3X1S A;  3MGP A;  4X23 C;  5GT3 A;  4WU8 B;  4R8P A;  1N1J A;  4YM6 D;  3X1T B;  1HQ3 C;  3MVD D;  5B1L D;  5AY8 A;  5B24 D;  3AV1 B;  5B0Z D;  4J8U C;  4ZUX A;  4HGA C;  3WTP A;  3LEL B;  5JRG D;  1P3A C;  4Z5T C;  3LJA A;  4J8V B;  4EO5 C;  3WA9 D;  2JSS A;  5AV9 D;  3O62 D;  3B6G B;  5E5A C;  4WNN B;  3AZH A;  1P3P C;  5G49 A;  1F66 C;  3REH B;  4KGC A;  3REI C;  1P3M A;  3W99 C;  4QLC C;  4Z66 C;  1M18 B;  1TZY A;  3AZF B;  1P3K D;  1M1A A;  5KDM B;  3KWQ C;  1ZLA A;  5BNX B;  1KX4 C;  4LD9 B;  3REL C;  3AFA A;  3C1C B;  1EQZ D;  4X23 A;  3MGR B;  3REK B;  3AZG B;  3KUY D;  4H9Q B;  3AZL C;  3AZN B;  3X1U D;  4J8W B;  5AVB B;  3AZJ D;  2CV5 B;  1HQ3 A;  1P3G D;  3AN2 B;  1P3O C;  3MGQ C;  4G92 C;  3TU4 C;  5GT0 A;  4WU8 C;  2PYO A;  5CPK B;  5AV6 B;  4H9N B;  5JA4 A;  1P3A A;  4Z5T A;  2NQB A;  3KXB B;  5AV5 D;  4JJN B;  3VH5 W;  1P3B A;  1AOI D;  3AZI A;  1B6W A;  3AZK D;  2NZD A;  5E5A A;  3WAA A;  1BH8 A;  5FUG A;  5B0Y D;  5B2I A;  1P3P A;  5BT1 C;  3LEL C;  3REI A;  1P34 C;  1KX3 D;  3W99 A;  4QLC A;  5DNM C;  3MVD B;  1P3L D;  4Z66 A;  5B40 C;  4XUJ B;  5B24 B;  5DNN A;  3KWQ A;  3REH C;  1KX4 A;  4KUD B;  3UTB A;  4CSR B;  5CPJ B;  2IO5 C;  3X1T D;  3REL A;  3WTP B;  5JRG B;  5B31 D;  1ID3 C;  5BO0 A;  4J8X A;  4E44 A;  5B1M C;  4AWL B;  3AZM A;  3AV1 D;  3AZF C;  1S32 A;  1JFI A;  5G49 B;  4KGC B;  4M6B A;  4J8V D;  3C1C C;  5B2J A;  1P3O A;  3B6G D;  3MGQ A;  3MGR C;  3REK C;  3W97 B;  3W98 D;  3AZN C;  1ZLA B;  5AVB C;  3WKJ B;  4YS3 C;  3AN2 C;  1M19 C;  2HIO A;  1M18 D;  1EQZ B;  5GSU C;  4LD9 D;  2BYK A;  1P34 A;  3KUY B;  3AZE B;  1KX5 A;  5AV8 C;  3KXB C;  1U35 D;  3X1U B;  4JJN C;  1R4V A;  4CAY B;  3AZJ B;  5BS7 A;  5DNM A;  4WU9 B;  1P3G B;  3UT9 D;  3UTA A;  5B40 A;  3AZG D;  3LZ0 A;  2HUE B;  2PYO B;  5BNV B;  4YM6 C;  4J8W D;  2CV5 D;  4UUZ B;  5CP6 D;  3C1B A;  5B33 B;  1ID3 A;  3MVD C;  5B1M A;  1AOI B;  5B1L C;  4ZBJ C;  4NE3 A;  3REJ D;  5B24 C;  3AZK B;  3AZI B;  3X1V D;  5CPK D;  2FJ7 A;  3B6F B;  3VH5 A;  5AV6 D;  5B0Z C;  3WAA B;  5B0Y B;  5B32 A;  5CHL B;  5JRG C;  1BH9 A;  1KX3 B;  2YFV A;  3A6N D;  2RVQ D;  3MGP D;  3WA9 C;  5AV9 C;  3O62 C;  1P3L B;  3AV2 A;  5DNN B;  4R8P D;  3UTB B;  3B0D C;  4YS3 A; 
#chains in the Genus database with same CATH topology
 5B31 B;  5BO0 B;  1M19 A;  4H9O B;  4XUJ D;  5GSU A;  4KUD D;  5CPJ D;  4XZQ A;  1P3K C;  4ZUX D;  3WTP D;  3AL0 C;  2ARO A;  1HTA A;  2Y2N A;  5AV8 A;  3LZ1 B;  1EQZ C;  5CPI B;  3W96 A;  3B0B A;  2F8N B;  3NQU B;  3AZH D;  2YFW A;  3W98 B;  4KGC D;  4KHA A;  3KUY C;  3MGS B;  3X1U C;  4H9P B;  1P3M D;  3AZJ C;  3A1I A;  3AYW B;  1P3G C;  5B1L A;  3W97 D;  2HIO B;  1TZY D;  5B0Z A;  2HUE C;  5AVC B;  1ZLA D;  3VH5 T;  3WKJ D;  4G91 B;  3MNN A;  1U35 B;  4UPK A;  5AV5 C;  3AFA D;  1AOI C;  3WA9 A;  5AV9 A;  3O62 A;  3UT9 B;  3AZK C;  5F99 B;  3EPH A;  5B0Y C;  3AZE D;  1P3F B;  1KX3 C;  5CP6 B;  4NFT A;  5GXQ B;  2FFF B;  4WU9 D;  4WJ3 C;  5GT0 D;  3NQJ B;  1P3L C;  3REJ B;  4J8U A;  1P3I B;  1P3K A;  2PYO D;  3X1V B;  5B33 D;  2ZM5 A;  3X1T C;  4NE6 A;  5B31 C;  5B32 B;  2NQB D;  1P3B D;  1H3O B;  2UWX A;  3A6N B;  2Y2P A;  3X1S B;  3MGP B;  3AZI D;  3B6F D;  3AV1 C;  2NZD D;  3WAA D;  3IP4 C;  1F66 A;  3R45 A;  5B2I D;  5GT3 B;  4R8P B;  1N1J B;  5B31 G;  4J8V C;  2JCH A;  3B6G C;  3V9R A;  5AY8 B;  2DF4 C;  5DNN D;  3W98 C;  4ZUX B;  3UTB D;  3KFU G;  4J8X D;  4DRB A;  5AV5 A;  1WWI A;  3LJA B;  3AZM D;  3VH6 A;  1M18 C;  2ZY4 A;  2F8N G;  1TAF A;  4LD9 C;  4DQY B;  1S32 D;  2XD1 A;  3AZH B;  3AZL A;  5C3I B;  1U35 C;  3LZ1 D;  1P3M B;  5CPI D;  5B2J D;  3TU4 A;  2F8N D;  3UT9 C;  3AZG C;  4WU8 A;  1TZY B;  1M1A B;  3MGS D;  4J8W C;  3X1T A;  4Z2M G;  2CV5 C;  2BYM A;  5CP6 C;  3AYW D;  3AFA B;  2HIO D;  4X23 B;  3AV1 A;  3REJ C;  4H9R A;  5AVC D;  3X1V C;  5CPK C;  3LEL A;  5AV6 C;  1P34 D;  1KX5 D;  2Y2M A;  4E45 A;  4J8V A;  3F6T A;  3A6N C;  2RVQ C;  1Q9C A;  3MGP C;  1HQ3 B;  3B6G A;  5F99 D;  4WNN A;  3UTA D;  5GT0 B;  3REH A;  3LZ0 D;  1P3F D;  4R8P C;  5JA4 B;  5GXQ D;  3C1B D;  1P3A B;  4Z5T B;  2NQB B;  1P3B B;  4EO5 B;  1M18 A;  4XUJ C;  3AZF A;  1P3I D;  5KDM A;  2FJ7 D;  2NZD B;  5BNX A;  4KUD C;  4LD9 A;  5E5A B;  5CPJ C;  4ZUX C;  1BH8 B;  5FUG B;  4Z2M H;  5B2I B;  1P3P B;  3WTP C;  1F66 B;  5B32 D;  3REI B;  3C1C A;  4H9S C;  3X1S D;  4AWL C;  3W99 B;  4WZS B;  4QLC B;  3MGR A;  3H0R C;  3REK A;  3AZG A;  2Y2Q A;  4Z66 B;  5GT3 D;  3AZH C;  4H9Q A;  3AV2 D;  1KU5 A;  3AZN A;  3KWQ B;  4KGC C;  1KX4 B;  4J8W A;  5AVB A;  2CV5 A;  3REL B;  1ULY A;  1P3M C;  3AN2 A;  4J8X B;  5AY8 D;  3W97 C;  3AZM B;  1TZY C;  4XZQ D;  5AV6 A;  4H9N A;  1S32 B;  1ZLA C;  3VH6 W;  3WKJ C;  2ARO D;  1JFI B;  3KXB A;  4JJN A;  2LY8 A;  3LJA D;  3AFA C;  5B2J B;  1P3O B;  3MGQ B;  4G92 B;  3TU4 B;  3W96 D;  3EG5 B;  2Y2G A;  4DRA A;  4YM6 A;  3AZE C;  4NE5 A;  2BYM B;  3MVD A;  4WU9 C;  4XUJ A;  5B24 A;  5GT0 C;  1M1A D;  4KUD A;  5CPJ A;  4CSR A;  2PYO C;  2BYK B;  4H9R B;  5JRG A;  5B33 C;  1P34 B;  1KX5 B;  4H9S A;  3MNN D;  2NQB C;  1P3B C;  4X23 D;  5DNM B;  3AZI C;  2J8P A;  3B6F C;  2NZD C;  3UTA B;  3WAA C;  5B40 B;  5B2I C;  3LZ0 B;  2IO5 B;  2XD5 A;  3H0M C;  3C1B B;  1ID3 B;  1HQ3 D;  3W97 A;  5B1M B;  4J8U D;  3FDD A;  5DNN C;  2FJ7 B;  2G5I C;  3UTB C;  3WKJ A;  1BFM A;  1P3A D;  4Z5T D;  1BH9 B;  4J8X C;  2YFV B;  1EQZ A;  3AZM C;  5E5A D;  1P3P D;  1F66 D;  1S32 C;  3KUY A;  3REI D;  3AZE A;  3AV2 B;  3X1U A;  3W99 D;  4CAY A;  3AZJ A;  4QLC D;  3LZ1 C;  4YS3 B;  4WU9 A;  1P3G A;  5CPI C;  5B2J C;  1M19 B;  2F8N K;  4Z66 D;  5GSU B;  2F2A C;  3KWQ D;  1KX4 D;  5BNV A;  2Y2K A;  4XZQ B;  3B0C T;  4UUZ A;  3REL D;  3MGS C;  5B33 A;  2ARO B;  5AV8 B;  1AOI A;  3AYW C;  2CWE A;  3AZK A;  2HIO C;  3B6F A;  5AVC C;  3W96 B;  5B0Y A;  2YFW B;  3AZL D;  4G91 C;  1KX3 A;  4KHA B;  4YM6 B;  1KX5 C;  3H0L C;  1P3O D;  5BS7 C;  3MGQ D;  3TU4 D;  2ZY2 A;  1P3L A;  5F99 C;  5B1L B;  4ZBJ B;  3UTA C;  4WU8 D;  3EPJ A;  3LZ0 C;  1P3F C;  1F1E A;  5B0Z B;  5B31 A;  3C1B C;  3B0C W;  5GXQ C;  3MNN B;  4H9O A;  1P3I C;  3WA9 B;  5AV9 B;  3O62 B;  2Y2O A;  2FJ7 C;  5BT1 D;  3LEL D;  2L5A A;  1A7W A;  5B32 C;  3WTP E;  3B0D B;  3LZ1 A;  2ZY3 A;  5DNM D;  3X1S C;  5CPI A;  2F8N H;  2F8N A;  5B40 D;  3NQU A;  2DQN C;  3REH D;  3W98 A;  5GT3 C;  4J8U B;  3AV2 C;  1P3K B;  4HGA B;  3MGS A;  4H9P A;  1ID3 D;  5B32 G;  3AYW A;  5B1M D;  5AY8 C;  3AZF D;  3VH6 T;  1PZR A;  5AVC A;  2ZY5 A;  4XZQ C;  3R45 B;  2ARO C;  1U35 A;  3C1C D;  3LJA C;  3MGR D;  3UT9 A;  5F99 A;  3REK D;  3W96 C;  3V9R B;  5C3I C;  1P3F A;  3AZN D;  5AVB D;  5CP6 A;  4YS3 D;  5GXQ A;  3AN2 D;  5AV5 B;  1M19 D;  3NQJ A;  5GSU D;  3REJ A;  1P3I A;  3KSY A;  1WWS A;  3X1V A;  5CPK A;  1M1A C;  1TAF B;  1B67 A;  4WV4 B;  3AZL B;  5AV8 D;  3KXB D;  4JJN D;  1H3O A;  3A6N A;  3MNN C;  3X1S A;  3MGP A;  4X23 C;  5GT3 A;  4WU8 B;  4R8P A;  1N1J A;  4YM6 D;  3X1T B;  2BG1 A;  1HQ3 C;  3MVD D;  5B1L D;  5AY8 A;  5B24 D;  3AV1 B;  5B0Z D;  4J8U C;  4ZUX A;  4HGA C;  3WTP A;  3LEL B;  5JRG D;  1P3A C;  4Z5T C;  3LJA A;  4J8V B;  4EO5 C;  3WA9 D;  2JSS A;  5AV9 D;  3O62 D;  3B6G B;  5E5A C;  4WNN B;  3AZH A;  1P3P C;  5G49 A;  1F66 C;  3REH B;  4KGC A;  3REI C;  1P3M A;  3W99 C;  4QLC C;  2JE5 A;  4Z66 C;  1M18 B;  1TZY A;  3AZF B;  1P3K D;  1M1A A;  5KDM B;  3KWQ C;  1ZLA A;  5BNX B;  1KX4 C;  4LD9 B;  3REL C;  3AFA A;  3C1C B;  1EQZ D;  4X23 A;  3MGR B;  3REK B;  3AZG B;  3KUY D;  4H9Q B;  3AZL C;  3AZN B;  3X1U D;  4J8W B;  5AVB B;  3AZJ D;  2CV5 B;  1HQ3 A;  1P3G D;  3AN2 B;  1P3O C;  3MGQ C;  4G92 C;  3TU4 C;  5GT0 A;  4WU8 C;  2PYO A;  5CPK B;  5AV6 B;  4H9N B;  5JA4 A;  1P3A A;  4Z5T A;  2NQB A;  3KXB B;  5AV5 D;  4JJN B;  3VH5 W;  1P3B A;  1AOI D;  2Y2I A;  3AZI A;  1B6W A;  3AZK D;  2NZD A;  3P5J B;  5E5A A;  3WAA A;  1BH8 A;  5FUG A;  5B0Y D;  5B2I A;  1P3P A;  5BT1 C;  3LEL C;  3REI A;  1P34 C;  1KX3 D;  3W99 A;  4QLC A;  2W8S A;  5DNM C;  3MVD B;  1P3L D;  4Z66 A;  5B40 C;  4XUJ B;  5B24 B;  5DNN A;  3EPL A;  3KWQ A;  3REH C;  1KX4 A;  4KUD B;  3UTB A;  2RIQ A;  4CSR B;  5CPJ B;  2IO5 C;  3X1T D;  3REL A;  3WTP B;  5JRG B;  5B31 D;  1ID3 C;  5BO0 A;  4J8X A;  4E44 A;  5B1M C;  4AWL B;  3AZM A;  3AV1 D;  3AZF C;  1S32 A;  1JFI A;  5G49 B;  4KGC B;  2VQR A;  4M6B A;  4J8V D;  3C1C C;  1W2E A;  5B2J A;  1P3O A;  3B6G D;  3MGQ A;  3MGR C;  2Y2J A;  3REK C;  3W97 B;  3W98 D;  3AZN C;  2Y2H A;  1ZLA B;  2Y2L A;  5AVB C;  3WKJ B;  4YS3 C;  3AN2 C;  1M19 C;  2HIO A;  1M18 D;  1EQZ B;  5GSU C;  4LD9 D;  2BYK A;  1P34 A;  3KUY B;  3AZE B;  1KX5 A;  3EPK A;  5AV8 C;  1T3U A;  3KXB C;  3X1U B;  4JJN C;  1U35 D;  1R4V A;  4CAY B;  3AZJ B;  5BS7 A;  5DNM A;  2G5H C;  4WU9 B;  1P3G B;  3UT9 D;  3UTA A;  5B40 A;  3AZG D;  3LZ0 A;  2HUE B;  2PYO B;  5BNV B;  4YM6 C;  4J8W D;  2CV5 D;  4UUZ B;  5CP6 D;  3A1K A;  5B33 B;  3C1B A;  1ID3 A;  3MVD C;  5B1M A;  1AOI B;  5B1L C;  4ZBJ C;  4NE3 A;  3REJ D;  5B24 C;  3AZK B;  3AZI B;  3X1V D;  5CPK D;  2FJ7 A;  3B6F B;  3VH5 A;  5AV6 D;  5B0Z C;  3WAA B;  5B0Y B;  5B32 A;  5CHL B;  5JRG C;  1BH9 A;  1KX3 B;  2YFV A;  3A6N D;  2RVQ D;  3MGP D;  3WA9 C;  5AV9 C;  3O62 C;  1P3L B;  3AV2 A;  5DNN B;  4R8P D;  1Z2C B;  3UTB B;  3B0D C;  4YS3 A; 
#chains in the Genus database with same CATH homology
 5B31 B;  5BO0 B;  1M19 A;  4H9O B;  4XUJ D;  5GSU A;  4KUD D;  5CPJ D;  4XZQ A;  1P3K C;  4ZUX D;  3WTP D;  3AL0 C;  2ARO A;  1HTA A;  2Y2N A;  5AV8 A;  3LZ1 B;  1EQZ C;  5CPI B;  3W96 A;  3B0B A;  2F8N B;  3NQU B;  3AZH D;  2YFW A;  3W98 B;  4KGC D;  4KHA A;  3KUY C;  3MGS B;  3X1U C;  4H9P B;  1P3M D;  3AZJ C;  3A1I A;  3AYW B;  1P3G C;  5B1L A;  3W97 D;  2HIO B;  1TZY D;  5B0Z A;  2HUE C;  5AVC B;  1ZLA D;  3VH5 T;  3WKJ D;  4G91 B;  3MNN A;  1U35 B;  4UPK A;  5AV5 C;  3AFA D;  1AOI C;  3WA9 A;  5AV9 A;  3O62 A;  3UT9 B;  3AZK C;  5F99 B;  3EPH A;  5B0Y C;  3AZE D;  1P3F B;  1KX3 C;  5CP6 B;  4NFT A;  5GXQ B;  2FFF B;  4WU9 D;  4WJ3 C;  5GT0 D;  3NQJ B;  1P3L C;  3REJ B;  4J8U A;  1P3I B;  1P3K A;  2PYO D;  3X1V B;  5B33 D;  2ZM5 A;  3X1T C;  4NE6 A;  5B31 C;  5B32 B;  2NQB D;  1P3B D;  1H3O B;  2UWX A;  3A6N B;  2Y2P A;  3X1S B;  3MGP B;  3AZI D;  3B6F D;  3AV1 C;  2NZD D;  3WAA D;  3IP4 C;  1F66 A;  3R45 A;  5B2I D;  5GT3 B;  4R8P B;  1N1J B;  5B31 G;  4J8V C;  2JCH A;  3B6G C;  3V9R A;  5AY8 B;  2DF4 C;  5DNN D;  3W98 C;  4ZUX B;  3UTB D;  3KFU G;  4J8X D;  4DRB A;  5AV5 A;  1WWI A;  3LJA B;  3AZM D;  3VH6 A;  1M18 C;  2ZY4 A;  2F8N G;  1TAF A;  4LD9 C;  4DQY B;  1S32 D;  2XD1 A;  3AZH B;  3AZL A;  5C3I B;  1U35 C;  3LZ1 D;  1P3M B;  5CPI D;  5B2J D;  3TU4 A;  2F8N D;  3UT9 C;  3AZG C;  4WU8 A;  1TZY B;  1M1A B;  3MGS D;  4J8W C;  3X1T A;  4Z2M G;  2CV5 C;  2BYM A;  5CP6 C;  3AYW D;  3AFA B;  2HIO D;  4X23 B;  3AV1 A;  3REJ C;  4H9R A;  5AVC D;  3X1V C;  5CPK C;  3LEL A;  5AV6 C;  1P34 D;  1KX5 D;  2Y2M A;  4E45 A;  4J8V A;  3F6T A;  3A6N C;  2RVQ C;  1Q9C A;  3MGP C;  1HQ3 B;  3B6G A;  5F99 D;  4WNN A;  3UTA D;  5GT0 B;  3REH A;  3LZ0 D;  1P3F D;  4R8P C;  5JA4 B;  5GXQ D;  3C1B D;  1P3A B;  4Z5T B;  2NQB B;  1P3B B;  4EO5 B;  1M18 A;  4XUJ C;  3AZF A;  1P3I D;  5KDM A;  2FJ7 D;  2NZD B;  5BNX A;  4KUD C;  4LD9 A;  5E5A B;  5CPJ C;  4ZUX C;  1BH8 B;  5FUG B;  4Z2M H;  5B2I B;  1P3P B;  3WTP C;  1F66 B;  5B32 D;  3REI B;  3C1C A;  4H9S C;  3X1S D;  4AWL C;  3W99 B;  4WZS B;  4QLC B;  3MGR A;  3H0R C;  3REK A;  3AZG A;  2Y2Q A;  4Z66 B;  5GT3 D;  3AZH C;  4H9Q A;  3AV2 D;  1KU5 A;  3AZN A;  3KWQ B;  4KGC C;  1KX4 B;  4J8W A;  5AVB A;  2CV5 A;  3REL B;  1ULY A;  1P3M C;  3AN2 A;  4J8X B;  5AY8 D;  3W97 C;  3AZM B;  1TZY C;  4XZQ D;  5AV6 A;  4H9N A;  1S32 B;  1ZLA C;  3VH6 W;  3WKJ C;  2ARO D;  1JFI B;  3KXB A;  4JJN A;  2LY8 A;  3LJA D;  3AFA C;  5B2J B;  1P3O B;  3MGQ B;  4G92 B;  3TU4 B;  3W96 D;  3EG5 B;  2Y2G A;  4DRA A;  4YM6 A;  3AZE C;  4NE5 A;  2BYM B;  3MVD A;  4WU9 C;  4XUJ A;  5B24 A;  5GT0 C;  1M1A D;  4KUD A;  5CPJ A;  4CSR A;  2PYO C;  2BYK B;  4H9R B;  5JRG A;  5B33 C;  1P34 B;  1KX5 B;  4H9S A;  3MNN D;  2NQB C;  1P3B C;  4X23 D;  5DNM B;  3AZI C;  2J8P A;  3B6F C;  2NZD C;  3UTA B;  3WAA C;  5B40 B;  5B2I C;  3LZ0 B;  2IO5 B;  2XD5 A;  3H0M C;  3C1B B;  1ID3 B;  1HQ3 D;  3W97 A;  5B1M B;  4J8U D;  3FDD A;  5DNN C;  2FJ7 B;  2G5I C;  3UTB C;  3WKJ A;  1BFM A;  1P3A D;  4Z5T D;  1BH9 B;  4J8X C;  2YFV B;  1EQZ A;  3AZM C;  5E5A D;  1P3P D;  1F66 D;  1S32 C;  3KUY A;  3REI D;  3AZE A;  3AV2 B;  3X1U A;  3W99 D;  4CAY A;  3AZJ A;  4QLC D;  3LZ1 C;  4YS3 B;  4WU9 A;  1P3G A;  5CPI C;  5B2J C;  1M19 B;  2F8N K;  4Z66 D;  5GSU B;  2F2A C;  3KWQ D;  1KX4 D;  5BNV A;  2Y2K A;  4XZQ B;  3B0C T;  4UUZ A;  3REL D;  3MGS C;  5B33 A;  2ARO B;  5AV8 B;  1AOI A;  3AYW C;  2CWE A;  3AZK A;  2HIO C;  3B6F A;  5AVC C;  3W96 B;  5B0Y A;  2YFW B;  3AZL D;  4G91 C;  1KX3 A;  4KHA B;  4YM6 B;  1KX5 C;  3H0L C;  1P3O D;  5BS7 C;  3MGQ D;  3TU4 D;  2ZY2 A;  1P3L A;  5F99 C;  5B1L B;  4ZBJ B;  3UTA C;  4WU8 D;  3EPJ A;  3LZ0 C;  1P3F C;  1F1E A;  5B0Z B;  5B31 A;  3C1B C;  3B0C W;  5GXQ C;  3MNN B;  4H9O A;  1P3I C;  3WA9 B;  5AV9 B;  3O62 B;  2Y2O A;  2FJ7 C;  5BT1 D;  3LEL D;  2L5A A;  1A7W A;  5B32 C;  3WTP E;  3B0D B;  3LZ1 A;  2ZY3 A;  5DNM D;  3X1S C;  5CPI A;  2F8N H;  2F8N A;  5B40 D;  3NQU A;  2DQN C;  3REH D;  3W98 A;  5GT3 C;  4J8U B;  3AV2 C;  1P3K B;  4HGA B;  3MGS A;  4H9P A;  1ID3 D;  5B32 G;  3AYW A;  5B1M D;  5AY8 C;  3AZF D;  3VH6 T;  1PZR A;  5AVC A;  2ZY5 A;  4XZQ C;  3R45 B;  2ARO C;  1U35 A;  3C1C D;  3LJA C;  3MGR D;  3UT9 A;  5F99 A;  3REK D;  3W96 C;  3V9R B;  5C3I C;  1P3F A;  3AZN D;  5AVB D;  5CP6 A;  4YS3 D;  5GXQ A;  3AN2 D;  5AV5 B;  1M19 D;  3NQJ A;  5GSU D;  3REJ A;  1P3I A;  3KSY A;  1WWS A;  3X1V A;  5CPK A;  1M1A C;  1TAF B;  1B67 A;  4WV4 B;  3AZL B;  5AV8 D;  3KXB D;  4JJN D;  1H3O A;  3A6N A;  3MNN C;  3X1S A;  3MGP A;  4X23 C;  5GT3 A;  4WU8 B;  4R8P A;  1N1J A;  4YM6 D;  3X1T B;  2BG1 A;  1HQ3 C;  3MVD D;  5B1L D;  5AY8 A;  5B24 D;  3AV1 B;  5B0Z D;  4J8U C;  4ZUX A;  4HGA C;  3WTP A;  3LEL B;  5JRG D;  1P3A C;  4Z5T C;  3LJA A;  4J8V B;  4EO5 C;  3WA9 D;  2JSS A;  5AV9 D;  3O62 D;  3B6G B;  5E5A C;  4WNN B;  3AZH A;  1P3P C;  5G49 A;  1F66 C;  3REH B;  4KGC A;  3REI C;  1P3M A;  3W99 C;  4QLC C;  2JE5 A;  4Z66 C;  1M18 B;  1TZY A;  3AZF B;  1P3K D;  1M1A A;  5KDM B;  3KWQ C;  1ZLA A;  5BNX B;  1KX4 C;  4LD9 B;  3REL C;  3AFA A;  3C1C B;  1EQZ D;  4X23 A;  3MGR B;  3REK B;  3AZG B;  3KUY D;  4H9Q B;  3AZL C;  3AZN B;  3X1U D;  4J8W B;  5AVB B;  3AZJ D;  2CV5 B;  1HQ3 A;  1P3G D;  3AN2 B;  1P3O C;  3MGQ C;  4G92 C;  3TU4 C;  5GT0 A;  4WU8 C;  2PYO A;  5CPK B;  5AV6 B;  4H9N B;  5JA4 A;  1P3A A;  4Z5T A;  2NQB A;  3KXB B;  5AV5 D;  4JJN B;  3VH5 W;  1P3B A;  1AOI D;  2Y2I A;  3AZI A;  1B6W A;  3AZK D;  2NZD A;  3P5J B;  5E5A A;  3WAA A;  1BH8 A;  5FUG A;  5B0Y D;  5B2I A;  1P3P A;  5BT1 C;  3LEL C;  3REI A;  1P34 C;  1KX3 D;  3W99 A;  4QLC A;  2W8S A;  5DNM C;  3MVD B;  1P3L D;  4Z66 A;  5B40 C;  4XUJ B;  5B24 B;  5DNN A;  3EPL A;  3KWQ A;  3REH C;  1KX4 A;  4KUD B;  3UTB A;  2RIQ A;  4CSR B;  5CPJ B;  2IO5 C;  3X1T D;  3REL A;  3WTP B;  5JRG B;  5B31 D;  1ID3 C;  5BO0 A;  4J8X A;  4E44 A;  5B1M C;  4AWL B;  3AZM A;  3AV1 D;  3AZF C;  1S32 A;  1JFI A;  5G49 B;  4KGC B;  2VQR A;  4M6B A;  4J8V D;  3C1C C;  1W2E A;  5B2J A;  1P3O A;  3B6G D;  3MGQ A;  3MGR C;  2Y2J A;  3REK C;  3W97 B;  3W98 D;  3AZN C;  2Y2H A;  1ZLA B;  2Y2L A;  5AVB C;  3WKJ B;  4YS3 C;  3AN2 C;  1M19 C;  2HIO A;  1M18 D;  1EQZ B;  5GSU C;  4LD9 D;  2BYK A;  1P34 A;  3KUY B;  3AZE B;  1KX5 A;  3EPK A;  5AV8 C;  1T3U A;  3KXB C;  3X1U B;  4JJN C;  1U35 D;  1R4V A;  4CAY B;  3AZJ B;  5BS7 A;  5DNM A;  2G5H C;  4WU9 B;  1P3G B;  3UT9 D;  3UTA A;  5B40 A;  3AZG D;  3LZ0 A;  2HUE B;  2PYO B;  5BNV B;  4YM6 C;  4J8W D;  2CV5 D;  4UUZ B;  5CP6 D;  3A1K A;  5B33 B;  3C1B A;  1ID3 A;  3MVD C;  5B1M A;  1AOI B;  5B1L C;  4ZBJ C;  4NE3 A;  3REJ D;  5B24 C;  3AZK B;  3AZI B;  3X1V D;  5CPK D;  2FJ7 A;  3B6F B;  3VH5 A;  5AV6 D;  5B0Z C;  3WAA B;  5B0Y B;  5B32 A;  5CHL B;  5JRG C;  1BH9 A;  1KX3 B;  2YFV A;  3A6N D;  2RVQ D;  3MGP D;  3WA9 C;  5AV9 C;  3O62 C;  1P3L B;  3AV2 A;  5DNN B;  4R8P D;  1Z2C B;  3UTB B;  3B0D C;  4YS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...