4JJNB

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
b'GAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
molecule tags Dna binding protein/dna
source organism Saccharomyces cerevisiae
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
total genus 25
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4jjnB00
3AZGD 5AV8C 5AV8D 3WKJB 4QLCA 4Z5TB 4XUJB 4YS3B 5GXQA 1WWSA 3VH5T 5B0YC 1KX4A 3B0DC 4ZBJC 3A6NC 1P3BD 5F99C 1P3AB 3B6GC 3MVDA 1P3FB 5BO0B 3X1VC 4AWLC 4G91B 5B40D 2CWEA 4X23A 5GSUB 3RELC 1F66A 3LJAC 2PYOA 5KDMA 4LD9C 3VH5W 4WU8D 3B6GB 1ZLAD 1M18C 1P34C 1B6WA 4X23C 1TZYC 5AV9B 4E45A 3C1CD 3X1VA 3WAAC 3AZNA 3WKJD 5B1LA 4Z2MH 5AV5D 1P3MA 4M6BA 3WKJC 3W96D 4J8UB 4EO5B 2F8ND 3MGSB 1U35A 5CP6A 1TZYD 4WU9D 5CPKD 1BH8B 2YFVA 4NE5A 4UUZA 5F99A 3V9RA 3C1BD 3MGPB 4J8WB 1P3BA 4CSRA 5DNMB 2HIOA 3AZFC 3B6GD 4R8PB 5F99D 1P3FA 5B2JA 3AV2A 1HQ3A 3A6ND 4ZUXA 1P3BC 3KXBD 3MGQB 3AZJB 3AZLC 1ZLAA 2AROD 3W98A 1HQ3C 5AV5C 3B6FC 3W99B 3X1UD 4G91C 5B40B 5B1MA 3REID 3W96A 3MGPD 4J8WD 5B24C 3AZGB 1F66D 1M1AB 5B33D 5AY8A 4XUJD 3AZFB 5KDMB 1F66C 5C3IC 4WNNA 5AV6D 3AZIA 5DNMA 4WU9B 5CPKB 1P3LA 2RVQD 1R4VA 1M18B 4HGAC 5B0YA 3TU4B 3AZMA 3VH6A 3AZEB 1KX3A 4DRAA 2AROC 3REHA 3UTAD 2FJ7D 3R45A 4QLCB 1BH8A 3C1BA 3AN2C 1A7WA 1S32B 5E5AD 5B2ID 4Z5TD 1F1EA 3MGQC 5GSUC 3RELB 5AV8A 3AZHC 1KX3D 5B32G 2IO5B 3LZ1D 4H9RA 3LZ0D 1KX5A 3A6NA 3AFAA 3O62D 3MNND 3X1TA 4E44A 5B32B 4R8PC 5AV6A 4J8VC 1P3OC 1ZLAB 4Z66C 5B0ZC 5B31C 3X1UA 4JJNB 3UTAB 3AZLA 5BS7A 4KGCC 3KWQD 1KX4B 4KGCD 1P3LB 1M1AD 3KXBB 3UT9B 1JFIB 3AZNC 3AZJD 1P34D 3WKJA 3AV1C 4Z2MG 1P3LC 5DNNC 3O62C 1M19C 1M1AA 4WV4B 5BNXA 1S32A 3WA9C 4EO5C 5BNVB 5CPIB 1KX3C 4KHAA 1P3KC 3REJB 4G92C 1P3GA 5B1LB 5B0YD 5AV9C 4KUDB 3B0DB 3B6GA 1P3GC 3W98B 3AZHB 1P3KA 3REHB 1P3GD 4Z5TA 1ULYA 3UTBB 5JRGB 4CSRB 5AV6C 1S32C 3AFAD 1P3PB 2NQBA 5CPJC 4ZUXB 3LELD 5CPJD 5GT3C 5CHLB 3REJD 3AZFA 5DNND 1KX4C 1S32D 1P3LD 1N1JB 5B2JC 3AZKC 3AV2C 5B24D 4HGAB 3X1TC 3B0CW 3AV1B 5GT3B 5CPJA 4J8XB 3REHD 1P3GB 3W98C 5B1MB 3NQJB 4WZSB 5FUGA 1HQ3D 1TZYB 3MGSA 5B0ZD 5JRGD 3R45B 3MGRC 4J8VD 1P3OD 4G92B 2IO5C 2BYMA 3AYWA 1P3AC 2L5AA 3MNNC 5G49B 1AOIB 3MVDB 4KUDD 5JRGA 2HIOB 3LZ1B 3AYWD 5AV5B 3WA9B 4YM6D 5AVCB 3AV1D 3MGQD 5AY8B 5E5AC 5B2IC 2CV5A 3AZND 4KUDA 5B24A 5AV9A 5CPID 3C1BB 1U35D 3AV1A 5GT0A 5B32C 4H9PB 5GXQC 4R8PD 5BO0A 5B0ZA 5FUGB 4H9RB 3VH5A 1ZLAC 3AZGA 1BH9A 4CAYA 3LELA 4KGCA 2NZDB 5GT0D 2HIOD 3MVDC 4H9QA 3LZ1C 4J8UC 1N1JA 3KSYA 4JJNA 3AZLB 3X1SC 2BYKB 3LZ1A 4YM6A 3TU4D 3MGQA 4J8XA 5B0YB 2FJ7C 5B31A 3X1UC 3UT9A 3B6FD 2YFVB 3TU4C 2NQBC 3KXBC 5GT0B 5AVCD 2AROB 4NE6A 5BNVA 5AY8D 1P3KD 3AZMC 3O62B 4XUJC 5B0ZB 5C3IB 3AFAB 1P34A 5GT0C 5AVCA 2YFWB 4QLCD 5B24B 1P3MC 5E5AB 5B2IB 1M18A 1WWIA 3UTAA 5DNNA 3UTBA 1M1AC 2BYKA 3KWQC 4LD9A 4YM6B 4J8XD 5B31D 3LZ0B 1P3IA 3KXBA 1JFIA 3C1CC 5JA4A 4X23D 1P3KB 1M18D 4Z66A 3REIB 1TAFA 4YM6C 1KX5D 4LD9D 4WU8A 3AZIB 3MGRA 3KUYB 3REKA 5B33B 1ID3B 2F8NK 5AV5A 1EQZA 3X1TB 5BS7C 3AZKB 4XZQD 3UT9D 3AZEA 2NQBD 4WU9C 5CPKC 3MGRD 4J8XC 1EQZC 3AZGC 1P3IC 5CP6C 5G49A 1AOIA 3NQJA 4LD9B 4J8UA 4WU8C 1Q9CA 5B2JD 5AVBB 3AV2D 3B6FB 4ZUXD 3LELB 1KX4D 4KGCB 1BFMA 3WAAB 3RELD 1ID3D 5B40C 4UUZB 4DRBA 1B67A 5B32A 5F99B 1ID3C 4NFTA 4H9QB 2YFWA 5AY8C 1P3BB 2PYOD 5AVCC 3MGRB 3REKB 3REIC 1ID3A 3NQUB 3W97A 3B0CT 5B32D 1HQ3B 3MNNA 2CV5B 1P3ID 4NE3A 5DNMC 5B1LD 3KWQB 3WTPC 3W97D 4XUJA 3KUYD 3UT9C 5AV9D 5BNXB 3X1SD 3MGSC 5AVBC 3AZEC 3AYWC 3AZFD 1P3AA 4J8UD 1M19B 2F8NB 3WA9D 1BH9B 4CAYB 4XZQA 4X23B 4R8PA 1EQZB 1KX5C 3W99D 5BT1C 2HUEB 3AZHA 2F8NG 5GXQD 5CPJB 4YS3A 2FJ7B 1U35C 4J8VA 1P3OA 3W99A 3W97B 3WAAD 2AROA 3REHC 3W98D 4H9PA 3LZ0A 3W96B 5JA4B 3UTBC 2NZDD 1KX3B 5GSUA 4ZBJB 5B1MD 3REIA 2PYOB 1TAFB 3WAAA 3REKD 3LELC 3C1CA 3X1VD 4KUDC 3LJAA 4WNNB 3AZED 3WA9A 3AN2B 5B2JB 5AVBD 5DNNB 4Z5TC 4H9SC 3AV2B 1F66B 1P3MB 1TZYA 3UTAC 5CP6B 2BYMB 5AV6B 3V9RB 4H9SA 2JSSA 1P3PC 3WTPE 3AZNB 5B40A 1H3OB 3RELA 1HTAA 2PYOC 1P3FD 2NZDA 1M19A 4H9OA 4JJNC 1AOIC 4Z66B 3B0BA 3AZKA 5B33C 1AOID 4JJND 3REKC 2HIOC 3MVDD 3X1SB 5B1MC 4H9NB 1P3FC 3C1CB 2NZDC 3AZJC 4YS3D 3LJAB 5CP6D 4WU9A 5CPKA 2F8NH 1EQZD 5CPIC 2CV5D 1P3IB 3AZLD 1U35B 1KU5A 3KWQA 5GXQB 4XZQC 5BT1D 3AZID 4WU8B 5AV8B 1H3OA 3VH6T 3WTPA 3KUYA 5AVBA 1M19D 4KHAB 4XZQB 3AZHD 1P34B 3C1BC 3AN2A 3AZIC 1P3PA 5B31B 2NQBB 3MNNB 3MGSD 1P3AD 3AZMB 3UTBD 3KUYC 3W97C 3WTPD 5JRGC 5B1LC 4AWLB 3X1VB 5E5AA 5B2IA 2CV5C 3W96C 3X1UB 5B31G 4Z66D 2HUEC 2RVQC 1P3MD 3TU4A 4YS3C 4QLCC 3O62A 2F8NA 3X1TD 3W99C 3B6FA 3A6NB 3AZKD 3MGPA 4H9OB 4J8WA 3LJAD 3REJC 3AYWB 5GT3D 3LZ0C 3AFAC 3X1SA 3VH6W 5CPIA 5B33A 4H9NA 4ZUXC 3AZMD 5GSUD 3REJA 1KX5B 3WTPB 2FJ7A 3MGPC 4J8WC 4J8VB 3NQUA 1P3OB 3AN2D 2LY8A 5GT3A 1P3PD 3AZJA 5DNMD
chains in the Genus database with same CATH superfamily
3AZGD 5AV8C 5AV8D 3WKJB 4QLCA 4Z5TB 4XUJB 4YS3B 5GXQA 1WWSA 3VH5T 5B0YC 1KX4A 3B0DC 4ZBJC 3A6NC 1P3BD 5F99C 1P3AB 3B6GC 3MVDA 1P3FB 5BO0B 3X1VC 4AWLC 4G91B 5B40D 2CWEA 4X23A 5GSUB 3RELC 1F66A 3LJAC 2PYOA 3KFUG 5KDMA 4LD9C 3VH5W 4WU8D 3B6GB 1ZLAD 2W8SA 1M18C 1P34C 1B6WA 3EPJA 4X23C 1TZYC 2F2AC 4E45A 5AV9B 3C1CD 3X1VA 3WAAC 3AZNA 3WKJD 5B1LA 4Z2MH 5AV5D 1P3MA 4M6BA 3WKJC 3W96D 4J8UB 4EO5B 2F8ND 3MGSB 1U35A 5CP6A 1TZYD 4WU9D 5CPKD 1BH8B 2YFVA 4NE5A 4UUZA 5F99A 3V9RA 3C1BD 3MGPB 4J8WB 1Z2CB 1P3BA 4CSRA 5DNMB 2HIOA 3AZFC 3B6GD 4R8PB 5F99D 2G5IC 1P3FA 5B2JA 3AV2A 1HQ3A 3A6ND 4ZUXA 1P3BC 3EPKA 3KXBD 3MGQB 3AZJB 3AZLC 1ZLAA 2AROD 3W98A 1HQ3C 5AV5C 3B6FC 3W99B 3X1UD 4G91C 3F6TA 5B40B 5B1MA 3REID 3W96A 3MGPD 4J8WD 5B24C 3AZGB 1F66D 1M1AB 5B33D 5AY8A 4XUJD 3AZFB 5KDMB 1F66C 5C3IC 4WNNA 5AV6D 3AZIA 2Y2NA 5DNMA 2JCHA 4WU9B 5CPKB 1P3LA 2RVQD 1R4VA 1M18B 4HGAC 5B0YA 3TU4B 3AZMA 3VH6A 3AZEB 1KX3A 4DRAA 2AROC 3REHA 3UTAD 2FJ7D 3R45A 4QLCB 1BH8A 3C1BA 3AN2C 1A7WA 1S32B 5E5AD 5B2ID 4Z5TD 1F1EA 3MGQC 5GSUC 3RELB 5AV8A 3AZHC 1KX3D 5B32G 2IO5B 3LZ1D 4H9RA 3LZ0D 1KX5A 3A6NA 3AFAA 2UWXA 3O62D 3MNND 3X1TA 4E44A 5B32B 4R8PC 5AV6A 4J8VC 1P3OC 1ZLAB 4Z66C 5B0ZC 5B31C 3X1UA 4JJNB 3UTAB 3AZLA 5BS7A 4KGCC 3KWQD 1KX4B 4KGCD 1P3LB 2XD5A 1M1AD 3KXBB 3UT9B 1JFIB 3P5JB 3AZNC 3AZJD 1P34D 3WKJA 3AV1C 4Z2MG 1P3LC 4DQYB 5DNNC 3O62C 1M19C 1M1AA 4WV4B 5BNXA 1S32A 3WA9C 4EO5C 5BNVB 5CPIB 1KX3C 4KHAA 2DF4C 1P3KC 3REJB 4G92C 1P3GA 5B1LB 5B0YD 5AV9C 4KUDB 3B0DB 3B6GA 1P3GC 3W98B 3AZHB 1P3KA 3REHB 1P3GD 4Z5TA 1ULYA 3UTBB 5JRGB 4CSRB 3H0MC 2Y2MA 5AV6C 1S32C 3AFAD 1P3PB 2NQBA 5CPJC 2VQRA 4ZUXB 5CPJD 3LELD 5GT3C 5CHLB 3REJD 3AZFA 5DNND 1KX4C 1S32D 1P3LD 1N1JB 5B2JC 3AZKC 3AV2C 5B24D 4HGAB 3X1TC 3B0CW 2XD1A 3AV1B 5GT3B 5CPJA 4J8XB 3REHD 1P3GB 3W98C 3AL0C 4UPKA 5B1MB 3NQJB 4WZSB 2Y2LA 1HQ3D 1TZYB 2G5HC 5FUGA 3MGSA 5B0ZD 5JRGD 3R45B 3MGRC 4J8VD 1P3OD 4G92B 2IO5C 2DQNC 2BYMA 2Y2PA 3AYWA 1P3AC 2L5AA 3MNNC 5G49B 1AOIB 3MVDB 4KUDD 2JE5A 5JRGA 2HIOB 3LZ1B 3AYWD 5AV5B 3WA9B 1W2EA 4YM6D 5AVCB 3AV1D 3MGQD 2J8PA 5AY8B 5E5AC 5B2IC 2CV5A 3AZND 4KUDA 5B24A 5AV9A 2Y2JA 5CPID 3C1BB 1U35D 3AV1A 5GT0A 5B32C 3H0LC 4H9PB 5GXQC 5BO0A 5FUGB 5B0ZA 4H9RB 3VH5A 4R8PD 1ZLAC 3AZGA 1BH9A 4CAYA 3LELA 4KGCA 2NZDB 5GT0D 2HIOD 3MVDC 4H9QA 2FFFB 3LZ1C 4J8UC 1N1JA 3FDDA 2Y2KA 3KSYA 4JJNA 3AZLB 3X1SC 2BYKB 2Y2OA 3LZ1A 4YM6A 3TU4D 3MGQA 4J8XA 5B0YB 2FJ7C 5B31A 3X1UC 3UT9A 3B6FD 2YFVB 3TU4C 2NQBC 3KXBC 5GT0B 5AVCD 2AROB 4NE6A 5BNVA 5AY8D 1P3KD 3AZMC 3O62B 4XUJC 2BG1A 3H0RC 5C3IB 5B0ZB 3EG5B 3AFAB 1P34A 5GT0C 5AVCA 2YFWB 4QLCD 5B24B 1P3MC 5E5AB 5B2IB 1M18A 1WWIA 3UTAA 5DNNA 3UTBA 1M1AC 2BYKA 3KWQC 4LD9A 4YM6B 4J8XD 5B31D 3LZ0B 1P3IA 3KXBA 1JFIA 3C1CC 5JA4A 2Y2GA 4X23D 1P3KB 1M18D 4Z66A 3REIB 1TAFA 4YM6C 1KX5D 4LD9D 4WU8A 1T3UA 3AZIB 3MGRA 3KUYB 3REKA 5B33B 1ID3B 2F8NK 5AV5A 1EQZA 3X1TB 5BS7C 3AZKB 4XZQD 2Y2IA 2Y2QA 3EPLA 3UT9D 3AZEA 2NQBD 4WU9C 5CPKC 3MGRD 3EPHA 4J8XC 1EQZC 3AZGC 1P3IC 5CP6C 5G49A 1AOIA 3NQJA 4LD9B 4WJ3C 4J8UA 4WU8C 1Q9CA 5B2JD 5AVBB 3AV2D 3B6FB 4ZUXD 3LELB 1KX4D 4KGCB 1BFMA 3WAAB 3RELD 1ID3D 5B40C 4UUZB 4DRBA 1B67A 5B32A 5F99B 1ID3C 4NFTA 4H9QB 2YFWA 5AY8C 1P3BB 2PYOD 5AVCC 3MGRB 3A1KA 3REKB 3REIC 1ID3A 3NQUB 3W97A 3B0CT 5B32D 2RIQA 1HQ3B 3MNNA 2CV5B 1P3ID 4NE3A 5DNMC 5B1LD 3KWQB 3WTPC 3W97D 4XUJA 3KUYD 3UT9C 5AV9D 5BNXB 3X1SD 3MGSC 5AVBC 3AZEC 3AYWC 3AZFD 2ZY5A 4J8UD 1P3AA 1M19B 3A1IA 2F8NB 3WA9D 1BH9B 4CAYB 4XZQA 4X23B 4R8PA 2ZY2A 1EQZB 1KX5C 3W99D 5BT1C 2HUEB 3AZHA 2ZM5A 2F8NG 5GXQD 5CPJB 4YS3A 2FJ7B 1U35C 4J8VA 1P3OA 3W99A 3W97B 3WAAD 2AROA 3REHC 3W98D 4H9PA 3LZ0A 3W96B 5JA4B 3UTBC 2NZDD 1KX3B 5GSUA 4ZBJB 5B1MD 3REIA 2ZY3A 1TAFB 2PYOB 3WAAA 3REKD 3LELC 3C1CA 3X1VD 4KUDC 2ZY4A 3LJAA 4WNNB 3AZED 3WA9A 3AN2B 1PZRA 5B2JB 5DNNB 4Z5TC 4H9SC 5AVBD 3AV2B 1F66B 1P3MB 1TZYA 3UTAC 5CP6B 2BYMB 5AV6B 3V9RB 4H9SA 2JSSA 1P3PC 3WTPE 3AZNB 5B40A 1H3OB 3RELA 1HTAA 2PYOC 1P3FD 2NZDA 1M19A 4H9OA 4JJNC 1AOIC 4Z66B 3B0BA 3AZKA 5B33C 1AOID 4JJND 3REKC 2HIOC 3MVDD 3X1SB 5B1MC 4H9NB 1P3FC 3C1CB 2NZDC 3AZJC 4YS3D 3LJAB 5CP6D 4WU9A 5CPKA 2F8NH 1EQZD 5CPIC 2CV5D 1P3IB 3AZLD 1U35B 1KU5A 3KWQA 5GXQB 4XZQC 5BT1D 3AZID 4WU8B 5AV8B 1H3OA 3VH6T 3WTPA 3KUYA 5AVBA 1M19D 4KHAB 4XZQB 3AZHD 1P34B 3C1BC 3AN2A 3AZIC 1P3PA 3IP4C 5B31B 2NQBB 3MNNB 3MGSD 1P3AD 3AZMB 3UTBD 3KUYC 3W97C 3WTPD 5JRGC 5B1LC 4AWLB 3X1VB 5E5AA 5B2IA 2CV5C 3W96C 2Y2HA 3X1UB 5B31G 4Z66D 2HUEC 2RVQC 1P3MD 3TU4A 4YS3C 4QLCC 3O62A 2F8NA 3X1TD 3W99C 3B6FA 3A6NB 3AZKD 3MGPA 4H9OB 4J8WA 3LJAD 3REJC 3AYWB 5GT3D 3LZ0C 3AFAC 3X1SA 3VH6W 5CPIA 5B33A 4H9NA 4ZUXC 3AZMD 5GSUD 3REJA 1KX5B 3WTPB 2FJ7A 3MGPC 4J8WC 4J8VB 3NQUA 1P3OB 3AN2D 2LY8A 5GT3A 1P3PD 3AZJA 5DNMD
chains in the Genus database with same CATH topology
3AZGD 5AV8C 5AV8D 3WKJB 4QLCA 4Z5TB 4XUJB 4YS3B 5GXQA 1WWSA 3VH5T 5B0YC 1KX4A 3B0DC 4ZBJC 3A6NC 1P3BD 5F99C 1P3AB 3B6GC 3MVDA 1P3FB 5BO0B 3X1VC 4AWLC 4G91B 5B40D 2CWEA 4X23A 5GSUB 3RELC 1F66A 3LJAC 2PYOA 3KFUG 5KDMA 4LD9C 3VH5W 4WU8D 3B6GB 1ZLAD 2W8SA 1M18C 1P34C 1B6WA 3EPJA 4X23C 1TZYC 2F2AC 4E45A 5AV9B 3C1CD 3X1VA 3WAAC 3AZNA 3WKJD 5B1LA 4Z2MH 5AV5D 1P3MA 4M6BA 3WKJC 3W96D 4J8UB 4EO5B 2F8ND 3MGSB 1U35A 5CP6A 1TZYD 4WU9D 5CPKD 1BH8B 2YFVA 4NE5A 4UUZA 5F99A 3V9RA 3C1BD 3MGPB 4J8WB 1Z2CB 1P3BA 4CSRA 5DNMB 2HIOA 3AZFC 3B6GD 4R8PB 5F99D 2G5IC 1P3FA 5B2JA 3AV2A 1HQ3A 3A6ND 4ZUXA 1P3BC 3EPKA 3KXBD 3MGQB 3AZJB 3AZLC 1ZLAA 2AROD 3W98A 1HQ3C 5AV5C 3B6FC 3W99B 3X1UD 4G91C 3F6TA 5B40B 5B1MA 3REID 3W96A 3MGPD 4J8WD 5B24C 3AZGB 1F66D 1M1AB 5B33D 5AY8A 4XUJD 3AZFB 5KDMB 1F66C 5C3IC 4WNNA 5AV6D 3AZIA 2Y2NA 5DNMA 2JCHA 4WU9B 5CPKB 1P3LA 2RVQD 1R4VA 1M18B 4HGAC 5B0YA 3TU4B 3AZMA 3VH6A 3AZEB 1KX3A 4DRAA 2AROC 3REHA 3UTAD 2FJ7D 3R45A 4QLCB 1BH8A 3C1BA 3AN2C 1A7WA 1S32B 5E5AD 5B2ID 4Z5TD 1F1EA 3MGQC 5GSUC 3RELB 5AV8A 3AZHC 1KX3D 5B32G 2IO5B 3LZ1D 4H9RA 3LZ0D 1KX5A 3A6NA 3AFAA 2UWXA 3O62D 3MNND 3X1TA 4E44A 5B32B 4R8PC 5AV6A 4J8VC 1P3OC 1ZLAB 4Z66C 5B0ZC 5B31C 3X1UA 4JJNB 3UTAB 3AZLA 5BS7A 4KGCC 3KWQD 1KX4B 4KGCD 1P3LB 2XD5A 1M1AD 3KXBB 3UT9B 1JFIB 3P5JB 3AZNC 3AZJD 1P34D 3WKJA 3AV1C 4Z2MG 1P3LC 4DQYB 5DNNC 3O62C 1M19C 1M1AA 4WV4B 5BNXA 1S32A 3WA9C 4EO5C 5BNVB 5CPIB 1KX3C 4KHAA 2DF4C 1P3KC 3REJB 4G92C 1P3GA 5B1LB 5B0YD 5AV9C 4KUDB 3B0DB 3B6GA 1P3GC 3W98B 3AZHB 1P3KA 3REHB 1P3GD 4Z5TA 1ULYA 3UTBB 5JRGB 4CSRB 3H0MC 2Y2MA 5AV6C 1S32C 3AFAD 1P3PB 2NQBA 5CPJC 2VQRA 4ZUXB 5CPJD 3LELD 5GT3C 5CHLB 3REJD 3AZFA 5DNND 1KX4C 1S32D 1P3LD 1N1JB 5B2JC 3AZKC 3AV2C 5B24D 4HGAB 3X1TC 3B0CW 2XD1A 3AV1B 5GT3B 5CPJA 4J8XB 3REHD 1P3GB 3W98C 3AL0C 4UPKA 5B1MB 3NQJB 4WZSB 2Y2LA 1HQ3D 1TZYB 2G5HC 5FUGA 3MGSA 5B0ZD 5JRGD 3R45B 3MGRC 4J8VD 1P3OD 4G92B 2IO5C 2DQNC 2BYMA 2Y2PA 3AYWA 1P3AC 2L5AA 3MNNC 5G49B 1AOIB 3MVDB 4KUDD 2JE5A 5JRGA 2HIOB 3LZ1B 3AYWD 5AV5B 3WA9B 1W2EA 4YM6D 5AVCB 3AV1D 3MGQD 2J8PA 5AY8B 5E5AC 5B2IC 2CV5A 3AZND 4KUDA 5B24A 5AV9A 2Y2JA 5CPID 3C1BB 1U35D 3AV1A 5GT0A 5B32C 3H0LC 4H9PB 5GXQC 5BO0A 5FUGB 5B0ZA 4H9RB 3VH5A 4R8PD 1ZLAC 3AZGA 1BH9A 4CAYA 3LELA 4KGCA 2NZDB 5GT0D 2HIOD 3MVDC 4H9QA 2FFFB 3LZ1C 4J8UC 1N1JA 3FDDA 2Y2KA 3KSYA 4JJNA 3AZLB 3X1SC 2BYKB 2Y2OA 3LZ1A 4YM6A 3TU4D 3MGQA 4J8XA 5B0YB 2FJ7C 5B31A 3X1UC 3UT9A 3B6FD 2YFVB 3TU4C 2NQBC 3KXBC 5GT0B 5AVCD 2AROB 4NE6A 5BNVA 5AY8D 1P3KD 3AZMC 3O62B 4XUJC 2BG1A 3H0RC 5C3IB 5B0ZB 3EG5B 3AFAB 1P34A 5GT0C 5AVCA 2YFWB 4QLCD 5B24B 1P3MC 5E5AB 5B2IB 1M18A 1WWIA 3UTAA 5DNNA 3UTBA 1M1AC 2BYKA 3KWQC 4LD9A 4YM6B 4J8XD 5B31D 3LZ0B 1P3IA 3KXBA 1JFIA 3C1CC 5JA4A 2Y2GA 4X23D 1P3KB 1M18D 4Z66A 3REIB 1TAFA 4YM6C 1KX5D 4LD9D 4WU8A 1T3UA 3AZIB 3MGRA 3KUYB 3REKA 5B33B 1ID3B 2F8NK 5AV5A 1EQZA 3X1TB 5BS7C 3AZKB 4XZQD 2Y2IA 2Y2QA 3EPLA 3UT9D 3AZEA 2NQBD 4WU9C 5CPKC 3MGRD 3EPHA 4J8XC 1EQZC 3AZGC 1P3IC 5CP6C 5G49A 1AOIA 3NQJA 4LD9B 4WJ3C 4J8UA 4WU8C 1Q9CA 5B2JD 5AVBB 3AV2D 3B6FB 4ZUXD 3LELB 1KX4D 4KGCB 1BFMA 3WAAB 3RELD 1ID3D 5B40C 4UUZB 4DRBA 1B67A 5B32A 5F99B 1ID3C 4NFTA 4H9QB 2YFWA 5AY8C 1P3BB 2PYOD 5AVCC 3MGRB 3A1KA 3REKB 3REIC 1ID3A 3NQUB 3W97A 3B0CT 5B32D 2RIQA 1HQ3B 3MNNA 2CV5B 1P3ID 4NE3A 5DNMC 5B1LD 3KWQB 3WTPC 3W97D 4XUJA 3KUYD 3UT9C 5AV9D 5BNXB 3X1SD 3MGSC 5AVBC 3AZEC 3AYWC 3AZFD 2ZY5A 4J8UD 1P3AA 1M19B 3A1IA 2F8NB 3WA9D 1BH9B 4CAYB 4XZQA 4X23B 4R8PA 2ZY2A 1EQZB 1KX5C 3W99D 5BT1C 2HUEB 3AZHA 2ZM5A 2F8NG 5GXQD 5CPJB 4YS3A 2FJ7B 1U35C 4J8VA 1P3OA 3W99A 3W97B 3WAAD 2AROA 3REHC 3W98D 4H9PA 3LZ0A 3W96B 5JA4B 3UTBC 2NZDD 1KX3B 5GSUA 4ZBJB 5B1MD 3REIA 2ZY3A 1TAFB 2PYOB 3WAAA 3REKD 3LELC 3C1CA 3X1VD 4KUDC 2ZY4A 3LJAA 4WNNB 3AZED 3WA9A 3AN2B 1PZRA 5B2JB 5DNNB 4Z5TC 4H9SC 5AVBD 3AV2B 1F66B 1P3MB 1TZYA 3UTAC 5CP6B 2BYMB 5AV6B 3V9RB 4H9SA 2JSSA 1P3PC 3WTPE 3AZNB 5B40A 1H3OB 3RELA 1HTAA 2PYOC 1P3FD 2NZDA 1M19A 4H9OA 4JJNC 1AOIC 4Z66B 3B0BA 3AZKA 5B33C 1AOID 4JJND 3REKC 2HIOC 3MVDD 3X1SB 5B1MC 4H9NB 1P3FC 3C1CB 2NZDC 3AZJC 4YS3D 3LJAB 5CP6D 4WU9A 5CPKA 2F8NH 1EQZD 5CPIC 2CV5D 1P3IB 3AZLD 1U35B 1KU5A 3KWQA 5GXQB 4XZQC 5BT1D 3AZID 4WU8B 5AV8B 1H3OA 3VH6T 3WTPA 3KUYA 5AVBA 1M19D 4KHAB 4XZQB 3AZHD 1P34B 3C1BC 3AN2A 3AZIC 1P3PA 3IP4C 5B31B 2NQBB 3MNNB 3MGSD 1P3AD 3AZMB 3UTBD 3KUYC 3W97C 3WTPD 5JRGC 5B1LC 4AWLB 3X1VB 5E5AA 5B2IA 2CV5C 3W96C 2Y2HA 3X1UB 5B31G 4Z66D 2HUEC 2RVQC 1P3MD 3TU4A 4YS3C 4QLCC 3O62A 2F8NA 3X1TD 3W99C 3B6FA 3A6NB 3AZKD 3MGPA 4H9OB 4J8WA 3LJAD 3REJC 3AYWB 5GT3D 3LZ0C 3AFAC 3X1SA 3VH6W 5CPIA 5B33A 4H9NA 4ZUXC 3AZMD 5GSUD 3REJA 1KX5B 3WTPB 2FJ7A 3MGPC 4J8WC 4J8VB 3NQUA 1P3OB 3AN2D 2LY8A 5GT3A 1P3PD 3AZJA 5DNMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG D;  5AV8 C;  5AV8 D;  3WKJ B;  4QLC A;  4Z5T B;  4XUJ B;  4YS3 B;  5GXQ A;  1WWS A;  3VH5 T;  5B0Y C;  1KX4 A;  3B0D C;  4ZBJ C;  3A6N C;  1P3B D;  5F99 C;  1P3A B;  3B6G C;  3MVD A;  1P3F B;  5BO0 B;  3X1V C;  4AWL C;  4G91 B;  5B40 D;  2CWE A;  4X23 A;  5GSU B;  3REL C;  1F66 A;  3LJA C;  2PYO A;  5KDM A;  4LD9 C;  3VH5 W;  4WU8 D;  3B6G B;  1ZLA D;  1M18 C;  1P34 C;  1B6W A;  4X23 C;  1TZY C;  5AV9 B;  4E45 A;  3C1C D;  3X1V A;  3WAA C;  3AZN A;  3WKJ D;  5B1L A;  4Z2M H;  5AV5 D;  1P3M A;  4M6B A;  3WKJ C;  3W96 D;  4J8U B;  4EO5 B;  2F8N D;  3MGS B;  1U35 A;  5CP6 A;  1TZY D;  4WU9 D;  5CPK D;  1BH8 B;  2YFV A;  4NE5 A;  4UUZ A;  5F99 A;  3V9R A;  3C1B D;  3MGP B;  4J8W B;  1P3B A;  4CSR A;  5DNM B;  2HIO A;  3AZF C;  3B6G D;  4R8P B;  5F99 D;  1P3F A;  5B2J A;  3AV2 A;  1HQ3 A;  3A6N D;  4ZUX A;  1P3B C;  3KXB D;  3MGQ B;  3AZJ B;  3AZL C;  1ZLA A;  2ARO D;  3W98 A;  1HQ3 C;  5AV5 C;  3B6F C;  3W99 B;  3X1U D;  4G91 C;  5B40 B;  5B1M A;  3REI D;  3W96 A;  3MGP D;  4J8W D;  5B24 C;  3AZG B;  1F66 D;  1M1A B;  5B33 D;  5AY8 A;  4XUJ D;  3AZF B;  5KDM B;  1F66 C;  5C3I C;  4WNN A;  5AV6 D;  3AZI A;  5DNM A;  4WU9 B;  5CPK B;  1P3L A;  2RVQ D;  1R4V A;  1M18 B;  4HGA C;  5B0Y A;  3TU4 B;  3AZM A;  3VH6 A;  3AZE B;  1KX3 A;  4DRA A;  2ARO C;  3REH A;  3UTA D;  2FJ7 D;  3R45 A;  4QLC B;  1BH8 A;  3C1B A;  3AN2 C;  1A7W A;  1S32 B;  5E5A D;  5B2I D;  4Z5T D;  1F1E A;  3MGQ C;  5GSU C;  3REL B;  5AV8 A;  3AZH C;  1KX3 D;  5B32 G;  2IO5 B;  3LZ1 D;  4H9R A;  3LZ0 D;  1KX5 A;  3A6N A;  3AFA A;  3O62 D;  3MNN D;  3X1T A;  4E44 A;  5B32 B;  4R8P C;  5AV6 A;  4J8V C;  1P3O C;  1ZLA B;  4Z66 C;  5B0Z C;  5B31 C;  3X1U A;  4JJN B;  3UTA B;  3AZL A;  5BS7 A;  4KGC C;  3KWQ D;  1KX4 B;  4KGC D;  1P3L B;  1M1A D;  3KXB B;  3UT9 B;  1JFI B;  3AZN C;  3AZJ D;  1P34 D;  3WKJ A;  3AV1 C;  4Z2M G;  1P3L C;  5DNN C;  3O62 C;  1M19 C;  1M1A A;  4WV4 B;  5BNX A;  1S32 A;  3WA9 C;  4EO5 C;  5BNV B;  5CPI B;  1KX3 C;  4KHA A;  1P3K C;  3REJ B;  4G92 C;  1P3G A;  5B1L B;  5B0Y D;  5AV9 C;  4KUD B;  3B0D B;  3B6G A;  1P3G C;  3W98 B;  3AZH B;  1P3K A;  3REH B;  1P3G D;  4Z5T A;  1ULY A;  3UTB B;  5JRG B;  4CSR B;  5AV6 C;  1S32 C;  3AFA D;  1P3P B;  2NQB A;  5CPJ C;  4ZUX B;  3LEL D;  5CPJ D;  5GT3 C;  5CHL B;  3REJ D;  3AZF A;  5DNN D;  1KX4 C;  1S32 D;  1P3L D;  1N1J B;  5B2J C;  3AZK C;  3AV2 C;  5B24 D;  4HGA B;  3X1T C;  3B0C W;  3AV1 B;  5GT3 B;  5CPJ A;  4J8X B;  3REH D;  1P3G B;  3W98 C;  5B1M B;  3NQJ B;  4WZS B;  5FUG A;  1HQ3 D;  1TZY B;  3MGS A;  5B0Z D;  5JRG D;  3R45 B;  3MGR C;  4J8V D;  1P3O D;  4G92 B;  2IO5 C;  2BYM A;  3AYW A;  1P3A C;  2L5A A;  3MNN C;  5G49 B;  1AOI B;  3MVD B;  4KUD D;  5JRG A;  2HIO B;  3LZ1 B;  3AYW D;  5AV5 B;  3WA9 B;  4YM6 D;  5AVC B;  3AV1 D;  3MGQ D;  5AY8 B;  5E5A C;  5B2I C;  2CV5 A;  3AZN D;  4KUD A;  5B24 A;  5AV9 A;  5CPI D;  3C1B B;  1U35 D;  3AV1 A;  5GT0 A;  5B32 C;  4H9P B;  5GXQ C;  4R8P D;  5BO0 A;  5B0Z A;  5FUG B;  4H9R B;  3VH5 A;  1ZLA C;  3AZG A;  1BH9 A;  4CAY A;  3LEL A;  4KGC A;  2NZD B;  5GT0 D;  2HIO D;  3MVD C;  4H9Q A;  3LZ1 C;  4J8U C;  1N1J A;  3KSY A;  4JJN A;  3AZL B;  3X1S C;  2BYK B;  3LZ1 A;  4YM6 A;  3TU4 D;  3MGQ A;  4J8X A;  5B0Y B;  2FJ7 C;  5B31 A;  3X1U C;  3UT9 A;  3B6F D;  2YFV B;  3TU4 C;  2NQB C;  3KXB C;  5GT0 B;  5AVC D;  2ARO B;  4NE6 A;  5BNV A;  5AY8 D;  1P3K D;  3AZM C;  3O62 B;  4XUJ C;  5B0Z B;  5C3I B;  3AFA B;  1P34 A;  5GT0 C;  5AVC A;  2YFW B;  4QLC D;  5B24 B;  1P3M C;  5E5A B;  5B2I B;  1M18 A;  1WWI A;  3UTA A;  5DNN A;  3UTB A;  1M1A C;  2BYK A;  3KWQ C;  4LD9 A;  4YM6 B;  4J8X D;  5B31 D;  3LZ0 B;  1P3I A;  3KXB A;  1JFI A;  3C1C C;  5JA4 A;  4X23 D;  1P3K B;  1M18 D;  4Z66 A;  3REI B;  1TAF A;  4YM6 C;  1KX5 D;  4LD9 D;  4WU8 A;  3AZI B;  3MGR A;  3KUY B;  3REK A;  5B33 B;  1ID3 B;  2F8N K;  5AV5 A;  1EQZ A;  3X1T B;  5BS7 C;  3AZK B;  4XZQ D;  3UT9 D;  3AZE A;  2NQB D;  4WU9 C;  5CPK C;  3MGR D;  4J8X C;  1EQZ C;  3AZG C;  1P3I C;  5CP6 C;  5G49 A;  1AOI A;  3NQJ A;  4LD9 B;  4J8U A;  4WU8 C;  1Q9C A;  5B2J D;  5AVB B;  3AV2 D;  3B6F B;  4ZUX D;  3LEL B;  1KX4 D;  4KGC B;  1BFM A;  3WAA B;  3REL D;  1ID3 D;  5B40 C;  4UUZ B;  4DRB A;  1B67 A;  5B32 A;  5F99 B;  1ID3 C;  4NFT A;  4H9Q B;  2YFW A;  5AY8 C;  1P3B B;  2PYO D;  5AVC C;  3MGR B;  3REK B;  3REI C;  1ID3 A;  3NQU B;  3W97 A;  3B0C T;  5B32 D;  1HQ3 B;  3MNN A;  2CV5 B;  1P3I D;  4NE3 A;  5DNM C;  5B1L D;  3KWQ B;  3WTP C;  3W97 D;  4XUJ A;  3KUY D;  3UT9 C;  5AV9 D;  5BNX B;  3X1S D;  3MGS C;  5AVB C;  3AZE C;  3AYW C;  3AZF D;  1P3A A;  4J8U D;  1M19 B;  2F8N B;  3WA9 D;  1BH9 B;  4CAY B;  4XZQ A;  4X23 B;  4R8P A;  1EQZ B;  1KX5 C;  3W99 D;  5BT1 C;  2HUE B;  3AZH A;  2F8N G;  5GXQ D;  5CPJ B;  4YS3 A;  2FJ7 B;  1U35 C;  4J8V A;  1P3O A;  3W99 A;  3W97 B;  3WAA D;  2ARO A;  3REH C;  3W98 D;  4H9P A;  3LZ0 A;  3W96 B;  5JA4 B;  3UTB C;  2NZD D;  1KX3 B;  5GSU A;  4ZBJ B;  5B1M D;  3REI A;  2PYO B;  1TAF B;  3WAA A;  3REK D;  3LEL C;  3C1C A;  3X1V D;  4KUD C;  3LJA A;  4WNN B;  3AZE D;  3WA9 A;  3AN2 B;  5B2J B;  5AVB D;  5DNN B;  4Z5T C;  4H9S C;  3AV2 B;  1F66 B;  1P3M B;  1TZY A;  3UTA C;  5CP6 B;  2BYM B;  5AV6 B;  3V9R B;  4H9S A;  2JSS A;  1P3P C;  3WTP E;  3AZN B;  5B40 A;  1H3O B;  3REL A;  1HTA A;  2PYO C;  1P3F D;  2NZD A;  1M19 A;  4H9O A;  4JJN C;  1AOI C;  4Z66 B;  3B0B A;  3AZK A;  5B33 C;  1AOI D;  4JJN D;  3REK C;  2HIO C;  3MVD D;  3X1S B;  5B1M C;  4H9N B;  1P3F C;  3C1C B;  2NZD C;  3AZJ C;  4YS3 D;  3LJA B;  5CP6 D;  4WU9 A;  5CPK A;  2F8N H;  1EQZ D;  5CPI C;  2CV5 D;  1P3I B;  3AZL D;  1U35 B;  1KU5 A;  3KWQ A;  5GXQ B;  4XZQ C;  5BT1 D;  3AZI D;  4WU8 B;  5AV8 B;  1H3O A;  3VH6 T;  3WTP A;  3KUY A;  5AVB A;  1M19 D;  4KHA B;  4XZQ B;  3AZH D;  1P34 B;  3C1B C;  3AN2 A;  3AZI C;  1P3P A;  5B31 B;  2NQB B;  3MNN B;  3MGS D;  1P3A D;  3AZM B;  3UTB D;  3KUY C;  3W97 C;  3WTP D;  5JRG C;  5B1L C;  4AWL B;  3X1V B;  5E5A A;  5B2I A;  2CV5 C;  3W96 C;  3X1U B;  5B31 G;  4Z66 D;  2HUE C;  2RVQ C;  1P3M D;  3TU4 A;  4YS3 C;  4QLC C;  3O62 A;  2F8N A;  3X1T D;  3W99 C;  3B6F A;  3A6N B;  3AZK D;  3MGP A;  4H9O B;  4J8W A;  3LJA D;  3REJ C;  3AYW B;  5GT3 D;  3LZ0 C;  3AFA C;  3X1S A;  3VH6 W;  5CPI A;  5B33 A;  4H9N A;  4ZUX C;  3AZM D;  5GSU D;  3REJ A;  1KX5 B;  3WTP B;  2FJ7 A;  3MGP C;  4J8W C;  4J8V B;  3NQU A;  1P3O B;  3AN2 D;  2LY8 A;  5GT3 A;  1P3P D;  3AZJ A;  5DNM D; 
#chains in the Genus database with same CATH topology
 3AZG D;  5AV8 C;  5AV8 D;  3WKJ B;  4QLC A;  4Z5T B;  4XUJ B;  4YS3 B;  5GXQ A;  1WWS A;  3VH5 T;  5B0Y C;  1KX4 A;  3B0D C;  4ZBJ C;  3A6N C;  1P3B D;  5F99 C;  1P3A B;  3B6G C;  3MVD A;  1P3F B;  5BO0 B;  3X1V C;  4AWL C;  4G91 B;  5B40 D;  2CWE A;  4X23 A;  5GSU B;  3REL C;  1F66 A;  3LJA C;  2PYO A;  3KFU G;  5KDM A;  4LD9 C;  3VH5 W;  4WU8 D;  3B6G B;  1ZLA D;  2W8S A;  1M18 C;  1P34 C;  1B6W A;  3EPJ A;  4X23 C;  1TZY C;  2F2A C;  4E45 A;  5AV9 B;  3C1C D;  3X1V A;  3WAA C;  3AZN A;  3WKJ D;  5B1L A;  4Z2M H;  5AV5 D;  1P3M A;  4M6B A;  3WKJ C;  3W96 D;  4J8U B;  4EO5 B;  2F8N D;  3MGS B;  1U35 A;  5CP6 A;  1TZY D;  4WU9 D;  5CPK D;  1BH8 B;  2YFV A;  4NE5 A;  4UUZ A;  5F99 A;  3V9R A;  3C1B D;  3MGP B;  4J8W B;  1Z2C B;  1P3B A;  4CSR A;  5DNM B;  2HIO A;  3AZF C;  3B6G D;  4R8P B;  5F99 D;  2G5I C;  1P3F A;  5B2J A;  3AV2 A;  1HQ3 A;  3A6N D;  4ZUX A;  1P3B C;  3EPK A;  3KXB D;  3MGQ B;  3AZJ B;  3AZL C;  1ZLA A;  2ARO D;  3W98 A;  1HQ3 C;  5AV5 C;  3B6F C;  3W99 B;  3X1U D;  4G91 C;  3F6T A;  5B40 B;  5B1M A;  3REI D;  3W96 A;  3MGP D;  4J8W D;  5B24 C;  3AZG B;  1F66 D;  1M1A B;  5B33 D;  5AY8 A;  4XUJ D;  3AZF B;  5KDM B;  1F66 C;  5C3I C;  4WNN A;  5AV6 D;  3AZI A;  2Y2N A;  5DNM A;  2JCH A;  4WU9 B;  5CPK B;  1P3L A;  2RVQ D;  1R4V A;  1M18 B;  4HGA C;  5B0Y A;  3TU4 B;  3AZM A;  3VH6 A;  3AZE B;  1KX3 A;  4DRA A;  2ARO C;  3REH A;  3UTA D;  2FJ7 D;  3R45 A;  4QLC B;  1BH8 A;  3C1B A;  3AN2 C;  1A7W A;  1S32 B;  5E5A D;  5B2I D;  4Z5T D;  1F1E A;  3MGQ C;  5GSU C;  3REL B;  5AV8 A;  3AZH C;  1KX3 D;  5B32 G;  2IO5 B;  3LZ1 D;  4H9R A;  3LZ0 D;  1KX5 A;  3A6N A;  3AFA A;  2UWX A;  3O62 D;  3MNN D;  3X1T A;  4E44 A;  5B32 B;  4R8P C;  5AV6 A;  4J8V C;  1P3O C;  1ZLA B;  4Z66 C;  5B0Z C;  5B31 C;  3X1U A;  4JJN B;  3UTA B;  3AZL A;  5BS7 A;  4KGC C;  3KWQ D;  1KX4 B;  4KGC D;  1P3L B;  2XD5 A;  1M1A D;  3KXB B;  3UT9 B;  1JFI B;  3P5J B;  3AZN C;  3AZJ D;  1P34 D;  3WKJ A;  3AV1 C;  4Z2M G;  1P3L C;  4DQY B;  5DNN C;  3O62 C;  1M19 C;  1M1A A;  4WV4 B;  5BNX A;  1S32 A;  3WA9 C;  4EO5 C;  5BNV B;  5CPI B;  1KX3 C;  4KHA A;  2DF4 C;  1P3K C;  3REJ B;  4G92 C;  1P3G A;  5B1L B;  5B0Y D;  5AV9 C;  4KUD B;  3B0D B;  3B6G A;  1P3G C;  3W98 B;  3AZH B;  1P3K A;  3REH B;  1P3G D;  4Z5T A;  1ULY A;  3UTB B;  5JRG B;  4CSR B;  3H0M C;  2Y2M A;  5AV6 C;  1S32 C;  3AFA D;  1P3P B;  2NQB A;  5CPJ C;  2VQR A;  4ZUX B;  5CPJ D;  3LEL D;  5GT3 C;  5CHL B;  3REJ D;  3AZF A;  5DNN D;  1KX4 C;  1S32 D;  1P3L D;  1N1J B;  5B2J C;  3AZK C;  3AV2 C;  5B24 D;  4HGA B;  3X1T C;  3B0C W;  2XD1 A;  3AV1 B;  5GT3 B;  5CPJ A;  4J8X B;  3REH D;  1P3G B;  3W98 C;  3AL0 C;  4UPK A;  5B1M B;  3NQJ B;  4WZS B;  2Y2L A;  1HQ3 D;  1TZY B;  2G5H C;  5FUG A;  3MGS A;  5B0Z D;  5JRG D;  3R45 B;  3MGR C;  4J8V D;  1P3O D;  4G92 B;  2IO5 C;  2DQN C;  2BYM A;  2Y2P A;  3AYW A;  1P3A C;  2L5A A;  3MNN C;  5G49 B;  1AOI B;  3MVD B;  4KUD D;  2JE5 A;  5JRG A;  2HIO B;  3LZ1 B;  3AYW D;  5AV5 B;  3WA9 B;  1W2E A;  4YM6 D;  5AVC B;  3AV1 D;  3MGQ D;  2J8P A;  5AY8 B;  5E5A C;  5B2I C;  2CV5 A;  3AZN D;  4KUD A;  5B24 A;  5AV9 A;  2Y2J A;  5CPI D;  3C1B B;  1U35 D;  3AV1 A;  5GT0 A;  5B32 C;  3H0L C;  4H9P B;  5GXQ C;  5BO0 A;  5FUG B;  5B0Z A;  4H9R B;  3VH5 A;  4R8P D;  1ZLA C;  3AZG A;  1BH9 A;  4CAY A;  3LEL A;  4KGC A;  2NZD B;  5GT0 D;  2HIO D;  3MVD C;  4H9Q A;  2FFF B;  3LZ1 C;  4J8U C;  1N1J A;  3FDD A;  2Y2K A;  3KSY A;  4JJN A;  3AZL B;  3X1S C;  2BYK B;  2Y2O A;  3LZ1 A;  4YM6 A;  3TU4 D;  3MGQ A;  4J8X A;  5B0Y B;  2FJ7 C;  5B31 A;  3X1U C;  3UT9 A;  3B6F D;  2YFV B;  3TU4 C;  2NQB C;  3KXB C;  5GT0 B;  5AVC D;  2ARO B;  4NE6 A;  5BNV A;  5AY8 D;  1P3K D;  3AZM C;  3O62 B;  4XUJ C;  2BG1 A;  3H0R C;  5C3I B;  5B0Z B;  3EG5 B;  3AFA B;  1P34 A;  5GT0 C;  5AVC A;  2YFW B;  4QLC D;  5B24 B;  1P3M C;  5E5A B;  5B2I B;  1M18 A;  1WWI A;  3UTA A;  5DNN A;  3UTB A;  1M1A C;  2BYK A;  3KWQ C;  4LD9 A;  4YM6 B;  4J8X D;  5B31 D;  3LZ0 B;  1P3I A;  3KXB A;  1JFI A;  3C1C C;  5JA4 A;  2Y2G A;  4X23 D;  1P3K B;  1M18 D;  4Z66 A;  3REI B;  1TAF A;  4YM6 C;  1KX5 D;  4LD9 D;  4WU8 A;  1T3U A;  3AZI B;  3MGR A;  3KUY B;  3REK A;  5B33 B;  1ID3 B;  2F8N K;  5AV5 A;  1EQZ A;  3X1T B;  5BS7 C;  3AZK B;  4XZQ D;  2Y2I A;  2Y2Q A;  3EPL A;  3UT9 D;  3AZE A;  2NQB D;  4WU9 C;  5CPK C;  3MGR D;  3EPH A;  4J8X C;  1EQZ C;  3AZG C;  1P3I C;  5CP6 C;  5G49 A;  1AOI A;  3NQJ A;  4LD9 B;  4WJ3 C;  4J8U A;  4WU8 C;  1Q9C A;  5B2J D;  5AVB B;  3AV2 D;  3B6F B;  4ZUX D;  3LEL B;  1KX4 D;  4KGC B;  1BFM A;  3WAA B;  3REL D;  1ID3 D;  5B40 C;  4UUZ B;  4DRB A;  1B67 A;  5B32 A;  5F99 B;  1ID3 C;  4NFT A;  4H9Q B;  2YFW A;  5AY8 C;  1P3B B;  2PYO D;  5AVC C;  3MGR B;  3A1K A;  3REK B;  3REI C;  1ID3 A;  3NQU B;  3W97 A;  3B0C T;  5B32 D;  2RIQ A;  1HQ3 B;  3MNN A;  2CV5 B;  1P3I D;  4NE3 A;  5DNM C;  5B1L D;  3KWQ B;  3WTP C;  3W97 D;  4XUJ A;  3KUY D;  3UT9 C;  5AV9 D;  5BNX B;  3X1S D;  3MGS C;  5AVB C;  3AZE C;  3AYW C;  3AZF D;  2ZY5 A;  4J8U D;  1P3A A;  1M19 B;  3A1I A;  2F8N B;  3WA9 D;  1BH9 B;  4CAY B;  4XZQ A;  4X23 B;  4R8P A;  2ZY2 A;  1EQZ B;  1KX5 C;  3W99 D;  5BT1 C;  2HUE B;  3AZH A;  2ZM5 A;  2F8N G;  5GXQ D;  5CPJ B;  4YS3 A;  2FJ7 B;  1U35 C;  4J8V A;  1P3O A;  3W99 A;  3W97 B;  3WAA D;  2ARO A;  3REH C;  3W98 D;  4H9P A;  3LZ0 A;  3W96 B;  5JA4 B;  3UTB C;  2NZD D;  1KX3 B;  5GSU A;  4ZBJ B;  5B1M D;  3REI A;  2ZY3 A;  1TAF B;  2PYO B;  3WAA A;  3REK D;  3LEL C;  3C1C A;  3X1V D;  4KUD C;  2ZY4 A;  3LJA A;  4WNN B;  3AZE D;  3WA9 A;  3AN2 B;  1PZR A;  5B2J B;  5DNN B;  4Z5T C;  4H9S C;  5AVB D;  3AV2 B;  1F66 B;  1P3M B;  1TZY A;  3UTA C;  5CP6 B;  2BYM B;  5AV6 B;  3V9R B;  4H9S A;  2JSS A;  1P3P C;  3WTP E;  3AZN B;  5B40 A;  1H3O B;  3REL A;  1HTA A;  2PYO C;  1P3F D;  2NZD A;  1M19 A;  4H9O A;  4JJN C;  1AOI C;  4Z66 B;  3B0B A;  3AZK A;  5B33 C;  1AOI D;  4JJN D;  3REK C;  2HIO C;  3MVD D;  3X1S B;  5B1M C;  4H9N B;  1P3F C;  3C1C B;  2NZD C;  3AZJ C;  4YS3 D;  3LJA B;  5CP6 D;  4WU9 A;  5CPK A;  2F8N H;  1EQZ D;  5CPI C;  2CV5 D;  1P3I B;  3AZL D;  1U35 B;  1KU5 A;  3KWQ A;  5GXQ B;  4XZQ C;  5BT1 D;  3AZI D;  4WU8 B;  5AV8 B;  1H3O A;  3VH6 T;  3WTP A;  3KUY A;  5AVB A;  1M19 D;  4KHA B;  4XZQ B;  3AZH D;  1P34 B;  3C1B C;  3AN2 A;  3AZI C;  1P3P A;  3IP4 C;  5B31 B;  2NQB B;  3MNN B;  3MGS D;  1P3A D;  3AZM B;  3UTB D;  3KUY C;  3W97 C;  3WTP D;  5JRG C;  5B1L C;  4AWL B;  3X1V B;  5E5A A;  5B2I A;  2CV5 C;  3W96 C;  2Y2H A;  3X1U B;  5B31 G;  4Z66 D;  2HUE C;  2RVQ C;  1P3M D;  3TU4 A;  4YS3 C;  4QLC C;  3O62 A;  2F8N A;  3X1T D;  3W99 C;  3B6F A;  3A6N B;  3AZK D;  3MGP A;  4H9O B;  4J8W A;  3LJA D;  3REJ C;  3AYW B;  5GT3 D;  3LZ0 C;  3AFA C;  3X1S A;  3VH6 W;  5CPI A;  5B33 A;  4H9N A;  4ZUX C;  3AZM D;  5GSU D;  3REJ A;  1KX5 B;  3WTP B;  2FJ7 A;  3MGP C;  4J8W C;  4J8V B;  3NQU A;  1P3O B;  3AN2 D;  2LY8 A;  5GT3 A;  1P3P D;  3AZJ A;  5DNM D; 
#chains in the Genus database with same CATH homology
 3AZG D;  5AV8 C;  5AV8 D;  3WKJ B;  4QLC A;  4Z5T B;  4XUJ B;  4YS3 B;  5GXQ A;  1WWS A;  3VH5 T;  5B0Y C;  1KX4 A;  3B0D C;  4ZBJ C;  3A6N C;  1P3B D;  5F99 C;  1P3A B;  3B6G C;  3MVD A;  1P3F B;  5BO0 B;  3X1V C;  4AWL C;  4G91 B;  5B40 D;  2CWE A;  4X23 A;  5GSU B;  3REL C;  1F66 A;  3LJA C;  2PYO A;  3KFU G;  5KDM A;  4LD9 C;  3VH5 W;  4WU8 D;  3B6G B;  1ZLA D;  2W8S A;  1M18 C;  1P34 C;  1B6W A;  3EPJ A;  4X23 C;  1TZY C;  2F2A C;  4E45 A;  5AV9 B;  3C1C D;  3X1V A;  3WAA C;  3AZN A;  3WKJ D;  5B1L A;  4Z2M H;  5AV5 D;  1P3M A;  4M6B A;  3WKJ C;  3W96 D;  4J8U B;  4EO5 B;  2F8N D;  3MGS B;  1U35 A;  5CP6 A;  1TZY D;  4WU9 D;  5CPK D;  1BH8 B;  2YFV A;  4NE5 A;  4UUZ A;  5F99 A;  3V9R A;  3C1B D;  3MGP B;  4J8W B;  1Z2C B;  1P3B A;  4CSR A;  5DNM B;  2HIO A;  3AZF C;  3B6G D;  4R8P B;  5F99 D;  2G5I C;  1P3F A;  5B2J A;  3AV2 A;  1HQ3 A;  3A6N D;  4ZUX A;  1P3B C;  3EPK A;  3KXB D;  3MGQ B;  3AZJ B;  3AZL C;  1ZLA A;  2ARO D;  3W98 A;  1HQ3 C;  5AV5 C;  3B6F C;  3W99 B;  3X1U D;  4G91 C;  3F6T A;  5B40 B;  5B1M A;  3REI D;  3W96 A;  3MGP D;  4J8W D;  5B24 C;  3AZG B;  1F66 D;  1M1A B;  5B33 D;  5AY8 A;  4XUJ D;  3AZF B;  5KDM B;  1F66 C;  5C3I C;  4WNN A;  5AV6 D;  3AZI A;  2Y2N A;  5DNM A;  2JCH A;  4WU9 B;  5CPK B;  1P3L A;  2RVQ D;  1R4V A;  1M18 B;  4HGA C;  5B0Y A;  3TU4 B;  3AZM A;  3VH6 A;  3AZE B;  1KX3 A;  4DRA A;  2ARO C;  3REH A;  3UTA D;  2FJ7 D;  3R45 A;  4QLC B;  1BH8 A;  3C1B A;  3AN2 C;  1A7W A;  1S32 B;  5E5A D;  5B2I D;  4Z5T D;  1F1E A;  3MGQ C;  5GSU C;  3REL B;  5AV8 A;  3AZH C;  1KX3 D;  5B32 G;  2IO5 B;  3LZ1 D;  4H9R A;  3LZ0 D;  1KX5 A;  3A6N A;  3AFA A;  2UWX A;  3O62 D;  3MNN D;  3X1T A;  4E44 A;  5B32 B;  4R8P C;  5AV6 A;  4J8V C;  1P3O C;  1ZLA B;  4Z66 C;  5B0Z C;  5B31 C;  3X1U A;  4JJN B;  3UTA B;  3AZL A;  5BS7 A;  4KGC C;  3KWQ D;  1KX4 B;  4KGC D;  1P3L B;  2XD5 A;  1M1A D;  3KXB B;  3UT9 B;  1JFI B;  3P5J B;  3AZN C;  3AZJ D;  1P34 D;  3WKJ A;  3AV1 C;  4Z2M G;  1P3L C;  4DQY B;  5DNN C;  3O62 C;  1M19 C;  1M1A A;  4WV4 B;  5BNX A;  1S32 A;  3WA9 C;  4EO5 C;  5BNV B;  5CPI B;  1KX3 C;  4KHA A;  2DF4 C;  1P3K C;  3REJ B;  4G92 C;  1P3G A;  5B1L B;  5B0Y D;  5AV9 C;  4KUD B;  3B0D B;  3B6G A;  1P3G C;  3W98 B;  3AZH B;  1P3K A;  3REH B;  1P3G D;  4Z5T A;  1ULY A;  3UTB B;  5JRG B;  4CSR B;  3H0M C;  2Y2M A;  5AV6 C;  1S32 C;  3AFA D;  1P3P B;  2NQB A;  5CPJ C;  2VQR A;  4ZUX B;  5CPJ D;  3LEL D;  5GT3 C;  5CHL B;  3REJ D;  3AZF A;  5DNN D;  1KX4 C;  1S32 D;  1P3L D;  1N1J B;  5B2J C;  3AZK C;  3AV2 C;  5B24 D;  4HGA B;  3X1T C;  3B0C W;  2XD1 A;  3AV1 B;  5GT3 B;  5CPJ A;  4J8X B;  3REH D;  1P3G B;  3W98 C;  3AL0 C;  4UPK A;  5B1M B;  3NQJ B;  4WZS B;  2Y2L A;  1HQ3 D;  1TZY B;  2G5H C;  5FUG A;  3MGS A;  5B0Z D;  5JRG D;  3R45 B;  3MGR C;  4J8V D;  1P3O D;  4G92 B;  2IO5 C;  2DQN C;  2BYM A;  2Y2P A;  3AYW A;  1P3A C;  2L5A A;  3MNN C;  5G49 B;  1AOI B;  3MVD B;  4KUD D;  2JE5 A;  5JRG A;  2HIO B;  3LZ1 B;  3AYW D;  5AV5 B;  3WA9 B;  1W2E A;  4YM6 D;  5AVC B;  3AV1 D;  3MGQ D;  2J8P A;  5AY8 B;  5E5A C;  5B2I C;  2CV5 A;  3AZN D;  4KUD A;  5B24 A;  5AV9 A;  2Y2J A;  5CPI D;  3C1B B;  1U35 D;  3AV1 A;  5GT0 A;  5B32 C;  3H0L C;  4H9P B;  5GXQ C;  5BO0 A;  5FUG B;  5B0Z A;  4H9R B;  3VH5 A;  4R8P D;  1ZLA C;  3AZG A;  1BH9 A;  4CAY A;  3LEL A;  4KGC A;  2NZD B;  5GT0 D;  2HIO D;  3MVD C;  4H9Q A;  2FFF B;  3LZ1 C;  4J8U C;  1N1J A;  3FDD A;  2Y2K A;  3KSY A;  4JJN A;  3AZL B;  3X1S C;  2BYK B;  2Y2O A;  3LZ1 A;  4YM6 A;  3TU4 D;  3MGQ A;  4J8X A;  5B0Y B;  2FJ7 C;  5B31 A;  3X1U C;  3UT9 A;  3B6F D;  2YFV B;  3TU4 C;  2NQB C;  3KXB C;  5GT0 B;  5AVC D;  2ARO B;  4NE6 A;  5BNV A;  5AY8 D;  1P3K D;  3AZM C;  3O62 B;  4XUJ C;  2BG1 A;  3H0R C;  5C3I B;  5B0Z B;  3EG5 B;  3AFA B;  1P34 A;  5GT0 C;  5AVC A;  2YFW B;  4QLC D;  5B24 B;  1P3M C;  5E5A B;  5B2I B;  1M18 A;  1WWI A;  3UTA A;  5DNN A;  3UTB A;  1M1A C;  2BYK A;  3KWQ C;  4LD9 A;  4YM6 B;  4J8X D;  5B31 D;  3LZ0 B;  1P3I A;  3KXB A;  1JFI A;  3C1C C;  5JA4 A;  2Y2G A;  4X23 D;  1P3K B;  1M18 D;  4Z66 A;  3REI B;  1TAF A;  4YM6 C;  1KX5 D;  4LD9 D;  4WU8 A;  1T3U A;  3AZI B;  3MGR A;  3KUY B;  3REK A;  5B33 B;  1ID3 B;  2F8N K;  5AV5 A;  1EQZ A;  3X1T B;  5BS7 C;  3AZK B;  4XZQ D;  2Y2I A;  2Y2Q A;  3EPL A;  3UT9 D;  3AZE A;  2NQB D;  4WU9 C;  5CPK C;  3MGR D;  3EPH A;  4J8X C;  1EQZ C;  3AZG C;  1P3I C;  5CP6 C;  5G49 A;  1AOI A;  3NQJ A;  4LD9 B;  4WJ3 C;  4J8U A;  4WU8 C;  1Q9C A;  5B2J D;  5AVB B;  3AV2 D;  3B6F B;  4ZUX D;  3LEL B;  1KX4 D;  4KGC B;  1BFM A;  3WAA B;  3REL D;  1ID3 D;  5B40 C;  4UUZ B;  4DRB A;  1B67 A;  5B32 A;  5F99 B;  1ID3 C;  4NFT A;  4H9Q B;  2YFW A;  5AY8 C;  1P3B B;  2PYO D;  5AVC C;  3MGR B;  3A1K A;  3REK B;  3REI C;  1ID3 A;  3NQU B;  3W97 A;  3B0C T;  5B32 D;  2RIQ A;  1HQ3 B;  3MNN A;  2CV5 B;  1P3I D;  4NE3 A;  5DNM C;  5B1L D;  3KWQ B;  3WTP C;  3W97 D;  4XUJ A;  3KUY D;  3UT9 C;  5AV9 D;  5BNX B;  3X1S D;  3MGS C;  5AVB C;  3AZE C;  3AYW C;  3AZF D;  2ZY5 A;  4J8U D;  1P3A A;  1M19 B;  3A1I A;  2F8N B;  3WA9 D;  1BH9 B;  4CAY B;  4XZQ A;  4X23 B;  4R8P A;  2ZY2 A;  1EQZ B;  1KX5 C;  3W99 D;  5BT1 C;  2HUE B;  3AZH A;  2ZM5 A;  2F8N G;  5GXQ D;  5CPJ B;  4YS3 A;  2FJ7 B;  1U35 C;  4J8V A;  1P3O A;  3W99 A;  3W97 B;  3WAA D;  2ARO A;  3REH C;  3W98 D;  4H9P A;  3LZ0 A;  3W96 B;  5JA4 B;  3UTB C;  2NZD D;  1KX3 B;  5GSU A;  4ZBJ B;  5B1M D;  3REI A;  2ZY3 A;  1TAF B;  2PYO B;  3WAA A;  3REK D;  3LEL C;  3C1C A;  3X1V D;  4KUD C;  2ZY4 A;  3LJA A;  4WNN B;  3AZE D;  3WA9 A;  3AN2 B;  1PZR A;  5B2J B;  5DNN B;  4Z5T C;  4H9S C;  5AVB D;  3AV2 B;  1F66 B;  1P3M B;  1TZY A;  3UTA C;  5CP6 B;  2BYM B;  5AV6 B;  3V9R B;  4H9S A;  2JSS A;  1P3P C;  3WTP E;  3AZN B;  5B40 A;  1H3O B;  3REL A;  1HTA A;  2PYO C;  1P3F D;  2NZD A;  1M19 A;  4H9O A;  4JJN C;  1AOI C;  4Z66 B;  3B0B A;  3AZK A;  5B33 C;  1AOI D;  4JJN D;  3REK C;  2HIO C;  3MVD D;  3X1S B;  5B1M C;  4H9N B;  1P3F C;  3C1C B;  2NZD C;  3AZJ C;  4YS3 D;  3LJA B;  5CP6 D;  4WU9 A;  5CPK A;  2F8N H;  1EQZ D;  5CPI C;  2CV5 D;  1P3I B;  3AZL D;  1U35 B;  1KU5 A;  3KWQ A;  5GXQ B;  4XZQ C;  5BT1 D;  3AZI D;  4WU8 B;  5AV8 B;  1H3O A;  3VH6 T;  3WTP A;  3KUY A;  5AVB A;  1M19 D;  4KHA B;  4XZQ B;  3AZH D;  1P34 B;  3C1B C;  3AN2 A;  3AZI C;  1P3P A;  3IP4 C;  5B31 B;  2NQB B;  3MNN B;  3MGS D;  1P3A D;  3AZM B;  3UTB D;  3KUY C;  3W97 C;  3WTP D;  5JRG C;  5B1L C;  4AWL B;  3X1V B;  5E5A A;  5B2I A;  2CV5 C;  3W96 C;  2Y2H A;  3X1U B;  5B31 G;  4Z66 D;  2HUE C;  2RVQ C;  1P3M D;  3TU4 A;  4YS3 C;  4QLC C;  3O62 A;  2F8N A;  3X1T D;  3W99 C;  3B6F A;  3A6N B;  3AZK D;  3MGP A;  4H9O B;  4J8W A;  3LJA D;  3REJ C;  3AYW B;  5GT3 D;  3LZ0 C;  3AFA C;  3X1S A;  3VH6 W;  5CPI A;  5B33 A;  4H9N A;  4ZUX C;  3AZM D;  5GSU D;  3REJ A;  1KX5 B;  3WTP B;  2FJ7 A;  3MGP C;  4J8W C;  4J8V B;  3NQU A;  1P3O B;  3AN2 D;  2LY8 A;  5GT3 A;  1P3P D;  3AZJ A;  5DNM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...