4JJNB

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
GAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4jjnB00
5DNMC 1M19B 1M19C 1P3MB 3WA9C 2CV5B 1P3MC 3LZ1D 3AZMB 3KXBB 1N1JB 5B32B 3KXBC 4Z5TD 5B32G 3UTBD 3AZIA 3REHC 3A6NB 3C1CD 5B40D 2PYOA 3AZFB 2F8ND 3AZFC 1F1EA 5CPJD 3B6GA 5B24D 3UT9A 5B33B 4J8VA 3X1VB 1TZYA 2YFVB 3X1VC 1KX4B 3MGRB 5AV5A 4YM6C 3W98B 4EO5B 4WU8A 5AVBD 3O62D 5AV9D 3WTPB 4UUZB 4CAYB 3WTPC 4J8UB 3W99A 1S32C 3C1BC 4Z66B 4Z66C 1P3IC 3KUYA 1JFIB 5AV6C 4E45A 5B0YA 4Z5TB 3UTBB 3UTBC 3B6GD 4H9OA 3C1CB 3C1CC 5B40B 5B40C 5CPIA 2F8NB 2F8NG 2BYMB 5G49A 5B24B 3WKJA 5BT1D 4WNNB 2IO5B 1P34D 1P3FD 4G91B 2IO5C 3W96A 4DRAA 4G91C 5B2IA 3AV1D 4WU8D 4X23D 4H9NA 3UTAA 1P3PD 1HQ3D 3W97A 5AVBB 3O62B 3O62C 2NZDA 5AV9B 3KSYA 5BS7A 5JRGC 3RELC 1P3GA 2HIOA 5CPKC 4KUDA 3B0DB 3TU4A 5E5AC 3B0DC 3AFAA 3MGQD 5B31A 5B0ZA 1ID3A 2AROA 3AZHA 4G92B 3REJA 3LJAA 3X1TA 4XZQC 4ZUXD 1P34B 1P3FB 3MNNA 1P34C 1P3FC 2BYKA 5GXQA 4R8PA 1M1AD 1M18C 1P3BA 4X23B 4YS3A 4X23C 1P3PB 4QLCA 1P3AC 4E44A 1HQ3B 1HQ3C 3AYWB 3AYWC 3AZEA 3WA9A 3MGPB 5B1MD 3MGPC 1KX3A 4JJND 3LZ0D 3AZJA 3REHA 3NQJB 2NQBC 5BO0B 4KGCA 1P3KA 3REJD 4J8WA 3MGSC 2FJ7D 1P3OA 3B0BA 5B2JB 5B2JC 2JSSA 5GSUA 3KWQD 1F66D 3R45A 5BNVB 1U35A 3AN2A 1ZLAD 3LELA 4YM6A 4Z2MG 4ZUXB 4YS3D 4AWLB 1P3LC 4ZUXC 4AWLC 4CSRA 4XUJA 5BNXB 1M1AB 3VH5A 1B6WA 3X1UC 3C1BA 3AZGD 1S32A 4H9RB 5GT3B 4Z66A 1P3IA 5GT3C 5B1MB 3X1SC 5B1MC 5AV6A 5JA4A 4WU9D 5KDMA 4JJNB 3LZ0B 1EQZA 3LZ0C 2CV5C 5GT0D 5CP6D 3AZMC 3AZLD 5B32C 2FJ7B 3AV2A 1U35D 2FJ7C 3AN2D 3A6NC 3AZKD 3KWQB 1F66B 2YFWB 3KWQC 3V9RA 1F66C 2CWEA 3VH6T 1ZLAB 1ZLAC 4NE3A 5B33C 3REIA 3VH6W 1KX4C 3MGRC 3W98C 4EO5C 4H9PB 3NQUA 3AZGB 5JRGA 3VH5W 3AZGC 3WTPE 3RELA 3WAAD 4LD9D 2HUEB 5CPKA 1AOIA 4NFTA 4WU9B 4HGAB 4WU9C 5E5AA 4HGAC 4J8XA 1BH8B 2RVQD 4J8UC 5CHLB 5AY8A 3AZID 3LZ1B 5GT0B 5FUGB 5CP6B 3LZ1C 5GT0C 5CP6C 3AZLB 3AZNA 2PYOD 5AV8A 4Z5TC 4XZQA 4WZSB 3AZKB 3UT9D 3AZKC 4J8VD 3REID 1M18A 5CPJB 1TZYD 5CPJC 5B24C 1P3AA 4KHAA 5AV5D 1H3OA 3AYWA 1BH9B 5DNNA 2F8NH 3WAAB 3W99D 3WAAC 5AVBC 1KX5A 2NQBA 3KUYD 5AV9C 5B0YD 2RVQC 3MGSA 4H9SC 3AZIB 5B2JA 2PYOB 5F99A 5CPID 4DRBA 2PYOC 3B6GB 3B6GC 1P3LA 3REKA 3WKJD 3UT9B 4G92C 4J8VB 4J8VC 3W96D 5B2ID 2LY8A 1TZYB 3UTAD 5AV5B 3B0CW 5BT1C 5AVCA 5AV5C 3AV1B 3W97D 3X1UA 3AV1C 4WU8B 4WU8C 5B1LA 5GT3A 3X1SA 1P3PC 3B6FA 3MVDA 2NZDD 5DNMA 1M19A 3W99B 1P3GD 1P3MA 2CV5A 2HIOD 3KUYB 3KUYC 3AZMA 3KXBA 1N1JA 4KUDD 5B0YB 5B32A 3TU4D 5B0YC 3AFAD 1WWSA 5B31D 4H9OB 3A6NA 5B0ZD 1ID3D 2AROD 1KU5A 3AZHD 3AZFA 5CPIB 5CPIC 3MGQB 4H9QB 5G49B 3LJAD 3MGQC 3X1TD 5B33A 3WKJB 3WKJC 3X1VA 3MNND 3W96B 2YFVA 5B2IB 1ULYA 5GXQD 5B2IC 4R8PD 1P3BD 3MGRA 1KX4A 4H9NB 3UTAB 3W98A 3UTAC 4QLCD 1M1AC 1B67A 3AZED 3WA9D 3WTPA 4UUZA 1KX3D 4CAYA 4J8UA 1TAFB 1P3GB 4Z2MH 3REHD 3AZJD 2HIOB 1P3GC 1JFIA 3LZ1A 4JJNC 4KUDB 4KGCD 4KUDC 3TU4B 1P3KD 4Z5TA 3AFAB 3TU4C 3UTBA 3AFAC 4J8WD 5B31B 3C1CA 1P3OD 1ID3B 5B31G 2AROB 5B40A 5GSUD 3REJB 2F8NA 3REJC 2BYMA 5B24A 3LJAB 3LJAC 3X1TB 3LELD 4YM6D 4WNNA 3MNNB 4XUJD 2BYKB 5GXQB 4R8PB 1P3BB 1P3BC 4YS3B 4YS3C 4QLCB 5AVBA 3C1BD 3VH5T 1S32D 3AZEB 4Z66D 3O62A 3AZEC 1P3ID 3WA9B 5AV9A 1KX3B 5AV6D 1KX3C 4H9SA 1EQZD 3AZJB 3REHB 2HUEC 3AZJC 2L5AA 1A7WA 4KGCB 1P3KB 4KGCC 5C3IB 1P3KC 5C3IC 4J8WB 4J8WC 1P3OB 3AV2D 2F8NK 1P3OC 5GSUB 3AZLC 5GSUC 3R45B 1U35B 3AN2B 1U35C 3LELB 4YM6B 3AN2C 3LELC 1P34A 1P3FA 3AV1A 4CSRB 4M6BA 4XUJB 4XUJC 4X23A 1P3PA 1HQ3A 1S32B 3C1BB 5JRGD 3RELD 3MGPA 1P3IB 5CPKD 1AOID 5AV6B 5JA4B 5KDMB 4LD9B 5E5AD 4J8XD 4LD9C 1EQZB 5AY8D 1EQZC 3NQJA 5BO0A 3AZND 4WV4B 1BFMA 5AV8D 3MGQA 4H9QA 3AZIC 3AV2B 4XZQD 4ZBJB 3AV2C 3WAAA 4ZBJC 1R4VA 3V9RB 5BNVA 1M18D 4ZUXA 1P3AD 3B0CT 5BNXA 3UT9C 3REIB 3REIC 1M1AA 3AYWD 1TZYC 3MGPD 1TAFA 3NQUB 5DNND 4H9RA 5JRGB 3RELB 1KX5D 5B1MA 5CPKB 1AOIB 2NQBD 4JJNA 1AOIC 5E5AB 4J8XB 3LZ0A 4J8XC 3W99C 5AY8B 5AY8C 3MGSD 5B2JD 3AZNB 3AZNC 5AV8B 5F99D 5AV8C 2FJ7A 4XZQB 1P3LD 3KWQA 3REKD 1F66A 2YFWA 1M18B 1ZLAA 1P3AB 4KHAB 1H3OB 5AVCD 3X1UD 3W96C 5B1LD 5GT3D 3X1SD 3B6FD 3W97B 4H9PA 3MVDD 3AZGA 3W97C 5DNNB 5DNMD 5DNNC 4NE5A 1M19D 1KX5B 1KX5C 1P3MD 2NQBB 1WWIA 2CV5D 4WU9A 2NZDB 2NZDC 3AZMD 1BH8A 3KXBD 5B32D 5BS7C 3MGSB 2HIOC 5GT0A 5FUGA 5CP6A 3A6ND 3AZLA 3AZFD 5F99B 5F99C 5B0ZB 5B31C 1P3LB 5B0ZC 3AZHB 3VH6A 2AROC 5B33D 3REKB 3AZHC 3REKC 3AZKA 1ID3C 3X1VD 5CPJA 4NE6A 3X1TC 1KX4D 3MGRD 3W98D 5AVCB 5AVCC 3X1UB 3MNNC 5GXQC 4R8PC 1Q9CA 5B1LB 5B1LC 3X1SB 3B6FB 1BH9A 4QLCC 3B6FC 3MVDB 3WTPD 1HTAA 3MVDC 4LD9A 4J8UD 5DNMB
chains in the Genus database with same CATH superfamily
5DNMC 1M19B 1M19C 1P3MB 3WA9C 2CV5B 1P3MC 3LZ1D 3AZMB 3KXBB 1N1JB 2G5HC 5B32B 3KXBC 4Z5TD 5B32G 3UTBD 3AZIA 3REHC 1P3LB 3A6NB 3C1CD 5B40D 2PYOA 3AZFB 2F8ND 3AZFC 1F1EA 5CPJD 3B6GA 5B24D 3UT9A 5B33B 4J8VA 3X1VB 1TZYA 2YFVB 3X1VC 3A1KA 1KX4B 3MGRB 5AV5A 4YM6C 3W98B 4EO5B 4WU8A 5AVBD 3O62D 5AV9D 3WTPB 4UUZB 4CAYB 3WTPC 4J8UB 3W99A 1S32C 3C1BC 4Z66B 4Z66C 1P3IC 3KUYA 2Y2IA 1JFIB 2F2AC 5AV6C 4E45A 5B0YA 4Z5TB 3UTBB 3UTBC 3B6GD 4H9OA 3C1CB 3C1CC 5B40B 5B40C 5CPIA 4UPKA 2F8NB 2F8NG 2BYMB 5G49A 5B24B 3WKJA 5BT1D 4WNNB 2IO5B 1P34D 1P3FD 4G91B 2IO5C 3H0RC 3W96A 5B2IA 4G91C 4DRAA 3AV1D 4WU8D 4X23D 4H9NA 3UTAA 1P3PD 1HQ3D 3W97A 5AVBB 3O62B 3O62C 1Z2CB 2NZDA 5AV9B 3KSYA 5BS7A 5JRGC 3RELC 1P3GA 2HIOA 5CPKC 4KUDA 3B0DB 3TU4A 5E5AC 3B0DC 3AFAA 3MGQD 5B31A 5B0ZA 1ID3A 2AROA 3AZHA 4G92B 3REJA 3LJAA 3X1TA 4XZQC 4DQYB 4ZUXD 1P34B 1P3FB 3MNNA 1P34C 1P3FC 2BYKA 5GXQA 4R8PA 1M1AD 1M18C 1P3BA 4X23B 4YS3A 4X23C 1P3PB 4QLCA 1P3AC 4E44A 1HQ3B 1HQ3C 3AYWB 3AYWC 2Y2JA 3AZEA 3WA9A 3MGPB 5B1MD 3MGPC 1KX3A 4JJND 3LZ0D 3AZJA 3REHA 3NQJB 2NQBC 5BO0B 4KGCA 1P3KA 3REJD 4J8WA 3MGSC 2FJ7D 1P3OA 2W8SA 3B0BA 5B2JB 5B2JC 2JSSA 5GSUA 3KWQD 1F66D 3R45A 5BNVB 1U35A 3AN2A 1ZLAD 3LELA 4YM6A 4Z2MG 4ZUXB 4YS3D 2ZM5A 4AWLB 4ZUXC 4AWLC 4CSRA 1P3LC 4XUJA 5BNXB 1M1AB 1PZRA 3VH5A 1B6WA 3X1UC 3C1BA 3AZGD 1S32A 4H9RB 5GT3B 4Z66A 1P3IA 5GT3C 2Y2GA 5B1MB 3X1SC 5B1MC 5AV6A 5JA4A 4WU9D 5KDMA 4JJNB 3LZ0B 2VQRA 1EQZA 3LZ0C 3KFUG 2CV5C 5GT0D 5CP6D 3AZMC 2Y2PA 3AZLD 2Y2MA 5B32C 2FJ7B 3AV2A 1U35D 2FJ7C 3AN2D 3A6NC 3AZKD 3KWQB 1F66B 2YFWB 3KWQC 3V9RA 1F66C 2CWEA 3VH6T 1ZLAB 1ZLAC 4NE3A 5B33C 3REIA 2Y2LA 3VH6W 1KX4C 3MGRC 3W98C 4EO5C 4H9PB 3NQUA 3AZGB 5JRGA 3VH5W 3AZGC 3WTPE 3RELA 3WAAD 4LD9D 2HUEB 5CPKA 1AOIA 4NFTA 4WU9B 4HGAB 3A1IA 4WU9C 5E5AA 4HGAC 4J8XA 1BH8B 2RVQD 4J8UC 5CHLB 5AY8A 3AZID 3LZ1B 5GT0B 5FUGB 5CP6B 3LZ1C 5GT0C 5CP6C 3AZLB 3AZNA 2PYOD 5AV8A 4Z5TC 4XZQA 4WZSB 3AZKB 3UT9D 3AZKC 4J8VD 3REID 1M18A 5CPJB 1TZYD 5CPJC 5B24C 1P3AA 4KHAA 5AV5D 1H3OA 3AYWA 1BH9B 5DNNA 2F8NH 3WAAB 3W99D 3WAAC 5AVBC 1KX5A 2NQBA 3KUYD 2DQNC 5AV9C 5B0YD 2RVQC 3MGSA 4H9SC 3AZIB 1W2EA 5B2JA 2PYOB 5F99A 5CPID 4DRBA 2PYOC 3B6GB 3B6GC 1P3LA 3REKA 3WKJD 3UT9B 4G92C 4J8VB 4J8VC 3W96D 5B2ID 2LY8A 1TZYB 3UTAD 5AV5B 3B0CW 5BT1C 5AVCA 5AV5C 3AV1B 3W97D 3X1UA 3AV1C 4WU8B 4WU8C 5B1LA 5GT3A 3X1SA 1P3PC 3B6FA 3MVDA 2NZDD 3EPLA 5DNMA 1M19A 3W99B 2ZY5A 1P3GD 1P3MA 2CV5A 2HIOD 3KUYB 3KUYC 3AZMA 3KXBA 1N1JA 4KUDD 5B0YB 5B32A 3TU4D 5B0YC 3AFAD 1WWSA 5B31D 4H9OB 3A6NA 5B0ZD 1ID3D 2AROD 1KU5A 3AZHD 3AZFA 5CPIB 5CPIC 2XD5A 3EPHA 3MGQB 4H9QB 5G49B 3LJAD 3MGQC 3X1TD 5B33A 3WKJB 2FFFB 3WKJC 3X1VA 3MNND 3W96B 2YFVA 5B2IB 1ULYA 5GXQD 5B2IC 4R8PD 1P3BD 3MGRA 1KX4A 4H9NB 3UTAB 3W98A 3UTAC 4QLCD 2RIQA 1M1AC 1B67A 2Y2OA 3AZED 3WA9D 2ZY4A 3WTPA 4UUZA 1KX3D 4CAYA 4J8UA 1TAFB 1P3GB 4Z2MH 3REHD 3AZJD 2HIOB 1P3GC 1JFIA 3LZ1A 4JJNC 4KUDB 4KGCD 4KUDC 3TU4B 1P3KD 4Z5TA 3AFAB 3TU4C 3UTBA 3AFAC 4J8WD 5B31B 3C1CA 1P3OD 1ID3B 5B31G 2AROB 5B40A 5GSUD 3REJB 2F8NA 2ZY3A 3REJC 2BYMA 5B24A 3LJAB 3LJAC 3X1TB 3LELD 4YM6D 4WNNA 3MNNB 4XUJD 3AL0C 2BYKB 5GXQB 4R8PB 1P3BB 1P3BC 4YS3B 4YS3C 4QLCB 3EPKA 5AVBA 3C1BD 3VH5T 1S32D 3AZEB 4Z66D 3O62A 3AZEC 1P3ID 3WA9B 5AV9A 1KX3B 5AV6D 1KX3C 4H9SA 1EQZD 2Y2KA 3REHB 2HUEC 3AZJB 2JE5A 3AZJC 2L5AA 1A7WA 4KGCB 1P3KB 4KGCC 5C3IB 1P3KC 5C3IC 2BG1A 4J8WB 4J8WC 1P3OB 3AV2D 2F8NK 1P3OC 1T3UA 5GSUB 3AZLC 5GSUC 2Y2HA 3R45B 1U35B 2Y2QA 3AN2B 1U35C 3LELB 4YM6B 3AN2C 3LELC 1P34A 1P3FA 3AV1A 4CSRB 4M6BA 4XUJB 2ZY2A 4XUJC 4X23A 2G5IC 2UWXA 1P3PA 1HQ3A 2J8PA 2DF4C 3H0LC 1S32B 3C1BB 5JRGD 3RELD 3MGPA 1P3IB 5CPKD 1AOID 5AV6B 5JA4B 5KDMB 4LD9B 5E5AD 4J8XD 4LD9C 1EQZB 5AY8D 1EQZC 3NQJA 5BO0A 3AZND 4WV4B 1BFMA 5AV8D 3MGQA 4H9QA 3AZIC 3AV2B 4XZQD 4ZBJB 3AV2C 3WAAA 4ZBJC 1R4VA 3FDDA 3V9RB 5BNVA 2XD1A 1M18D 3IP4C 4ZUXA 1P3AD 3B0CT 5BNXA 3UT9C 3REIB 3P5JB 3REIC 2JCHA 1M1AA 3AYWD 1TZYC 3MGPD 1TAFA 3NQUB 5DNND 4H9RA 5JRGB 3RELB 1KX5D 5B1MA 5CPKB 1AOIB 2NQBD 4JJNA 1AOIC 5E5AB 4J8XB 3LZ0A 4J8XC 3W99C 5AY8B 5AY8C 3MGSD 5B2JD 3AZNB 3AZNC 5AV8B 5F99D 5AV8C 2FJ7A 2Y2NA 4XZQB 1P3LD 3KWQA 3REKD 1F66A 2YFWA 1M18B 1ZLAA 1P3AB 4KHAB 1H3OB 5AVCD 3X1UD 3W96C 5B1LD 5GT3D 3X1SD 3B6FD 3W97B 4H9PA 3MVDD 3AZGA 3W97C 5DNNB 5DNMD 5DNNC 4NE5A 1M19D 1KX5B 1KX5C 1P3MD 2NQBB 1WWIA 3EG5B 4WU9A 2CV5D 2NZDB 2NZDC 3F6TA 3AZMD 1BH8A 3KXBD 5B32D 5BS7C 3MGSB 2HIOC 5GT0A 5FUGA 5CP6A 3A6ND 3AZLA 3AZFD 5F99B 5F99C 5B0ZB 5B31C 3EPJA 5B0ZC 3AZHB 3VH6A 2AROC 5B33D 3REKB 3AZHC 3REKC 3AZKA 1ID3C 3X1VD 5CPJA 4NE6A 3H0MC 3X1TC 1KX4D 3MGRD 3W98D 5AVCB 5AVCC 3X1UB 3MNNC 4WJ3C 5GXQC 4R8PC 1Q9CA 5B1LB 5B1LC 3X1SB 3B6FB 1BH9A 4QLCC 3B6FC 3MVDB 3WTPD 1HTAA 3MVDC 4LD9A 4J8UD 5DNMB
chains in the Genus database with same CATH topology
5DNMC 1M19B 1M19C 1P3MB 3WA9C 2CV5B 1P3MC 3LZ1D 3AZMB 3KXBB 1N1JB 2G5HC 5B32B 3KXBC 4Z5TD 5B32G 3UTBD 3AZIA 3REHC 1P3LB 3A6NB 3C1CD 5B40D 2PYOA 3AZFB 2F8ND 3AZFC 1F1EA 5CPJD 3B6GA 5B24D 3UT9A 5B33B 4J8VA 3X1VB 1TZYA 2YFVB 3X1VC 3A1KA 1KX4B 3MGRB 5AV5A 4YM6C 3W98B 4EO5B 4WU8A 5AVBD 3O62D 5AV9D 3WTPB 4UUZB 4CAYB 3WTPC 4J8UB 3W99A 1S32C 3C1BC 4Z66B 4Z66C 1P3IC 3KUYA 2Y2IA 1JFIB 2F2AC 5AV6C 4E45A 5B0YA 4Z5TB 3UTBB 3UTBC 3B6GD 4H9OA 3C1CB 3C1CC 5B40B 5B40C 5CPIA 4UPKA 2F8NB 2F8NG 2BYMB 5G49A 5B24B 3WKJA 5BT1D 4WNNB 2IO5B 1P34D 1P3FD 4G91B 2IO5C 3H0RC 3W96A 5B2IA 4G91C 4DRAA 3AV1D 4WU8D 4X23D 4H9NA 3UTAA 1P3PD 1HQ3D 3W97A 5AVBB 3O62B 3O62C 1Z2CB 2NZDA 5AV9B 3KSYA 5BS7A 5JRGC 3RELC 1P3GA 2HIOA 5CPKC 4KUDA 3B0DB 3TU4A 5E5AC 3B0DC 3AFAA 3MGQD 5B31A 5B0ZA 1ID3A 2AROA 3AZHA 4G92B 3REJA 3LJAA 3X1TA 4XZQC 4DQYB 4ZUXD 1P34B 1P3FB 3MNNA 1P34C 1P3FC 2BYKA 5GXQA 4R8PA 1M1AD 1M18C 1P3BA 4X23B 4YS3A 4X23C 1P3PB 4QLCA 1P3AC 4E44A 1HQ3B 1HQ3C 3AYWB 3AYWC 2Y2JA 3AZEA 3WA9A 3MGPB 5B1MD 3MGPC 1KX3A 4JJND 3LZ0D 3AZJA 3REHA 3NQJB 2NQBC 5BO0B 4KGCA 1P3KA 3REJD 4J8WA 3MGSC 2FJ7D 1P3OA 2W8SA 3B0BA 5B2JB 5B2JC 2JSSA 5GSUA 3KWQD 1F66D 3R45A 5BNVB 1U35A 3AN2A 1ZLAD 3LELA 4YM6A 4Z2MG 4ZUXB 4YS3D 2ZM5A 4AWLB 4ZUXC 4AWLC 4CSRA 1P3LC 4XUJA 5BNXB 1M1AB 1PZRA 3VH5A 1B6WA 3X1UC 3C1BA 3AZGD 1S32A 4H9RB 5GT3B 4Z66A 1P3IA 5GT3C 2Y2GA 5B1MB 3X1SC 5B1MC 5AV6A 5JA4A 4WU9D 5KDMA 4JJNB 3LZ0B 2VQRA 1EQZA 3LZ0C 3KFUG 2CV5C 5GT0D 5CP6D 3AZMC 2Y2PA 3AZLD 2Y2MA 5B32C 2FJ7B 3AV2A 1U35D 2FJ7C 3AN2D 3A6NC 3AZKD 3KWQB 1F66B 2YFWB 3KWQC 3V9RA 1F66C 2CWEA 3VH6T 1ZLAB 1ZLAC 4NE3A 5B33C 3REIA 2Y2LA 3VH6W 1KX4C 3MGRC 3W98C 4EO5C 4H9PB 3NQUA 3AZGB 5JRGA 3VH5W 3AZGC 3WTPE 3RELA 3WAAD 4LD9D 2HUEB 5CPKA 1AOIA 4NFTA 4WU9B 4HGAB 3A1IA 4WU9C 5E5AA 4HGAC 4J8XA 1BH8B 2RVQD 4J8UC 5CHLB 5AY8A 3AZID 3LZ1B 5GT0B 5FUGB 5CP6B 3LZ1C 5GT0C 5CP6C 3AZLB 3AZNA 2PYOD 5AV8A 4Z5TC 4XZQA 4WZSB 3AZKB 3UT9D 3AZKC 4J8VD 3REID 1M18A 5CPJB 1TZYD 5CPJC 5B24C 1P3AA 4KHAA 5AV5D 1H3OA 3AYWA 1BH9B 5DNNA 2F8NH 3WAAB 3W99D 3WAAC 5AVBC 1KX5A 2NQBA 3KUYD 2DQNC 5AV9C 5B0YD 2RVQC 3MGSA 4H9SC 3AZIB 1W2EA 5B2JA 2PYOB 5F99A 5CPID 4DRBA 2PYOC 3B6GB 3B6GC 1P3LA 3REKA 3WKJD 3UT9B 4G92C 4J8VB 4J8VC 3W96D 5B2ID 2LY8A 1TZYB 3UTAD 5AV5B 3B0CW 5BT1C 5AVCA 5AV5C 3AV1B 3W97D 3X1UA 3AV1C 4WU8B 4WU8C 5B1LA 5GT3A 3X1SA 1P3PC 3B6FA 3MVDA 2NZDD 3EPLA 5DNMA 1M19A 3W99B 2ZY5A 1P3GD 1P3MA 2CV5A 2HIOD 3KUYB 3KUYC 3AZMA 3KXBA 1N1JA 4KUDD 5B0YB 5B32A 3TU4D 5B0YC 3AFAD 1WWSA 5B31D 4H9OB 3A6NA 5B0ZD 1ID3D 2AROD 1KU5A 3AZHD 3AZFA 5CPIB 5CPIC 2XD5A 3EPHA 3MGQB 4H9QB 5G49B 3LJAD 3MGQC 3X1TD 5B33A 3WKJB 2FFFB 3WKJC 3X1VA 3MNND 3W96B 2YFVA 5B2IB 1ULYA 5GXQD 5B2IC 4R8PD 1P3BD 3MGRA 1KX4A 4H9NB 3UTAB 3W98A 3UTAC 4QLCD 2RIQA 1M1AC 1B67A 2Y2OA 3AZED 3WA9D 2ZY4A 3WTPA 4UUZA 1KX3D 4CAYA 4J8UA 1TAFB 1P3GB 4Z2MH 3REHD 3AZJD 2HIOB 1P3GC 1JFIA 3LZ1A 4JJNC 4KUDB 4KGCD 4KUDC 3TU4B 1P3KD 4Z5TA 3AFAB 3TU4C 3UTBA 3AFAC 4J8WD 5B31B 3C1CA 1P3OD 1ID3B 5B31G 2AROB 5B40A 5GSUD 3REJB 2F8NA 2ZY3A 3REJC 2BYMA 5B24A 3LJAB 3LJAC 3X1TB 3LELD 4YM6D 4WNNA 3MNNB 4XUJD 3AL0C 2BYKB 5GXQB 4R8PB 1P3BB 1P3BC 4YS3B 4YS3C 4QLCB 3EPKA 5AVBA 3C1BD 3VH5T 1S32D 3AZEB 4Z66D 3O62A 3AZEC 1P3ID 3WA9B 5AV9A 1KX3B 5AV6D 1KX3C 4H9SA 1EQZD 2Y2KA 3REHB 2HUEC 3AZJB 2JE5A 3AZJC 2L5AA 1A7WA 4KGCB 1P3KB 4KGCC 5C3IB 1P3KC 5C3IC 2BG1A 4J8WB 4J8WC 1P3OB 3AV2D 2F8NK 1P3OC 1T3UA 5GSUB 3AZLC 5GSUC 2Y2HA 3R45B 1U35B 2Y2QA 3AN2B 1U35C 3LELB 4YM6B 3AN2C 3LELC 1P34A 1P3FA 3AV1A 4CSRB 4M6BA 4XUJB 2ZY2A 4XUJC 4X23A 2G5IC 2UWXA 1P3PA 1HQ3A 2J8PA 2DF4C 3H0LC 1S32B 3C1BB 5JRGD 3RELD 3MGPA 1P3IB 5CPKD 1AOID 5AV6B 5JA4B 5KDMB 4LD9B 5E5AD 4J8XD 4LD9C 1EQZB 5AY8D 1EQZC 3NQJA 5BO0A 3AZND 4WV4B 1BFMA 5AV8D 3MGQA 4H9QA 3AZIC 3AV2B 4XZQD 4ZBJB 3AV2C 3WAAA 4ZBJC 1R4VA 3FDDA 3V9RB 5BNVA 2XD1A 1M18D 3IP4C 4ZUXA 1P3AD 3B0CT 5BNXA 3UT9C 3REIB 3P5JB 3REIC 2JCHA 1M1AA 3AYWD 1TZYC 3MGPD 1TAFA 3NQUB 5DNND 4H9RA 5JRGB 3RELB 1KX5D 5B1MA 5CPKB 1AOIB 2NQBD 4JJNA 1AOIC 5E5AB 4J8XB 3LZ0A 4J8XC 3W99C 5AY8B 5AY8C 3MGSD 5B2JD 3AZNB 3AZNC 5AV8B 5F99D 5AV8C 2FJ7A 2Y2NA 4XZQB 1P3LD 3KWQA 3REKD 1F66A 2YFWA 1M18B 1ZLAA 1P3AB 4KHAB 1H3OB 5AVCD 3X1UD 3W96C 5B1LD 5GT3D 3X1SD 3B6FD 3W97B 4H9PA 3MVDD 3AZGA 3W97C 5DNNB 5DNMD 5DNNC 4NE5A 1M19D 1KX5B 1KX5C 1P3MD 2NQBB 1WWIA 3EG5B 4WU9A 2CV5D 2NZDB 2NZDC 3F6TA 3AZMD 1BH8A 3KXBD 5B32D 5BS7C 3MGSB 2HIOC 5GT0A 5FUGA 5CP6A 3A6ND 3AZLA 3AZFD 5F99B 5F99C 5B0ZB 5B31C 3EPJA 5B0ZC 3AZHB 3VH6A 2AROC 5B33D 3REKB 3AZHC 3REKC 3AZKA 1ID3C 3X1VD 5CPJA 4NE6A 3H0MC 3X1TC 1KX4D 3MGRD 3W98D 5AVCB 5AVCC 3X1UB 3MNNC 4WJ3C 5GXQC 4R8PC 1Q9CA 5B1LB 5B1LC 3X1SB 3B6FB 1BH9A 4QLCC 3B6FC 3MVDB 3WTPD 1HTAA 3MVDC 4LD9A 4J8UD 5DNMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM C;  1M19 B;  1M19 C;  1P3M B;  3WA9 C;  2CV5 B;  1P3M C;  3LZ1 D;  3AZM B;  3KXB B;  1N1J B;  5B32 B;  3KXB C;  4Z5T D;  5B32 G;  3UTB D;  3AZI A;  3REH C;  3A6N B;  3C1C D;  5B40 D;  2PYO A;  3AZF B;  2F8N D;  3AZF C;  1F1E A;  5CPJ D;  3B6G A;  5B24 D;  3UT9 A;  5B33 B;  4J8V A;  3X1V B;  1TZY A;  2YFV B;  3X1V C;  1KX4 B;  3MGR B;  5AV5 A;  4YM6 C;  3W98 B;  4EO5 B;  4WU8 A;  5AVB D;  3O62 D;  5AV9 D;  3WTP B;  4UUZ B;  4CAY B;  3WTP C;  4J8U B;  3W99 A;  1S32 C;  3C1B C;  4Z66 B;  4Z66 C;  1P3I C;  3KUY A;  1JFI B;  5AV6 C;  4E45 A;  5B0Y A;  4Z5T B;  3UTB B;  3UTB C;  3B6G D;  4H9O A;  3C1C B;  3C1C C;  5B40 B;  5B40 C;  5CPI A;  2F8N B;  2F8N G;  2BYM B;  5G49 A;  5B24 B;  3WKJ A;  5BT1 D;  4WNN B;  2IO5 B;  1P34 D;  1P3F D;  4G91 B;  2IO5 C;  3W96 A;  4DRA A;  4G91 C;  5B2I A;  3AV1 D;  4WU8 D;  4X23 D;  4H9N A;  3UTA A;  1P3P D;  1HQ3 D;  3W97 A;  5AVB B;  3O62 B;  3O62 C;  2NZD A;  5AV9 B;  3KSY A;  5BS7 A;  5JRG C;  3REL C;  1P3G A;  2HIO A;  5CPK C;  4KUD A;  3B0D B;  3TU4 A;  5E5A C;  3B0D C;  3AFA A;  3MGQ D;  5B31 A;  5B0Z A;  1ID3 A;  2ARO A;  3AZH A;  4G92 B;  3REJ A;  3LJA A;  3X1T A;  4XZQ C;  4ZUX D;  1P34 B;  1P3F B;  3MNN A;  1P34 C;  1P3F C;  2BYK A;  5GXQ A;  4R8P A;  1M1A D;  1M18 C;  1P3B A;  4X23 B;  4YS3 A;  4X23 C;  1P3P B;  4QLC A;  1P3A C;  4E44 A;  1HQ3 B;  1HQ3 C;  3AYW B;  3AYW C;  3AZE A;  3WA9 A;  3MGP B;  5B1M D;  3MGP C;  1KX3 A;  4JJN D;  3LZ0 D;  3AZJ A;  3REH A;  3NQJ B;  2NQB C;  5BO0 B;  4KGC A;  1P3K A;  3REJ D;  4J8W A;  3MGS C;  2FJ7 D;  1P3O A;  3B0B A;  5B2J B;  5B2J C;  2JSS A;  5GSU A;  3KWQ D;  1F66 D;  3R45 A;  5BNV B;  1U35 A;  3AN2 A;  1ZLA D;  3LEL A;  4YM6 A;  4Z2M G;  4ZUX B;  4YS3 D;  4AWL B;  1P3L C;  4ZUX C;  4AWL C;  4CSR A;  4XUJ A;  5BNX B;  1M1A B;  3VH5 A;  1B6W A;  3X1U C;  3C1B A;  3AZG D;  1S32 A;  4H9R B;  5GT3 B;  4Z66 A;  1P3I A;  5GT3 C;  5B1M B;  3X1S C;  5B1M C;  5AV6 A;  5JA4 A;  4WU9 D;  5KDM A;  4JJN B;  3LZ0 B;  1EQZ A;  3LZ0 C;  2CV5 C;  5GT0 D;  5CP6 D;  3AZM C;  3AZL D;  5B32 C;  2FJ7 B;  3AV2 A;  1U35 D;  2FJ7 C;  3AN2 D;  3A6N C;  3AZK D;  3KWQ B;  1F66 B;  2YFW B;  3KWQ C;  3V9R A;  1F66 C;  2CWE A;  3VH6 T;  1ZLA B;  1ZLA C;  4NE3 A;  5B33 C;  3REI A;  3VH6 W;  1KX4 C;  3MGR C;  3W98 C;  4EO5 C;  4H9P B;  3NQU A;  3AZG B;  5JRG A;  3VH5 W;  3AZG C;  3WTP E;  3REL A;  3WAA D;  4LD9 D;  2HUE B;  5CPK A;  1AOI A;  4NFT A;  4WU9 B;  4HGA B;  4WU9 C;  5E5A A;  4HGA C;  4J8X A;  1BH8 B;  2RVQ D;  4J8U C;  5CHL B;  5AY8 A;  3AZI D;  3LZ1 B;  5GT0 B;  5FUG B;  5CP6 B;  3LZ1 C;  5GT0 C;  5CP6 C;  3AZL B;  3AZN A;  2PYO D;  5AV8 A;  4Z5T C;  4XZQ A;  4WZS B;  3AZK B;  3UT9 D;  3AZK C;  4J8V D;  3REI D;  1M18 A;  5CPJ B;  1TZY D;  5CPJ C;  5B24 C;  1P3A A;  4KHA A;  5AV5 D;  1H3O A;  3AYW A;  1BH9 B;  5DNN A;  2F8N H;  3WAA B;  3W99 D;  3WAA C;  5AVB C;  1KX5 A;  2NQB A;  3KUY D;  5AV9 C;  5B0Y D;  2RVQ C;  3MGS A;  4H9S C;  3AZI B;  5B2J A;  2PYO B;  5F99 A;  5CPI D;  4DRB A;  2PYO C;  3B6G B;  3B6G C;  1P3L A;  3REK A;  3WKJ D;  3UT9 B;  4G92 C;  4J8V B;  4J8V C;  3W96 D;  5B2I D;  2LY8 A;  1TZY B;  3UTA D;  5AV5 B;  3B0C W;  5BT1 C;  5AVC A;  5AV5 C;  3AV1 B;  3W97 D;  3X1U A;  3AV1 C;  4WU8 B;  4WU8 C;  5B1L A;  5GT3 A;  3X1S A;  1P3P C;  3B6F A;  3MVD A;  2NZD D;  5DNM A;  1M19 A;  3W99 B;  1P3G D;  1P3M A;  2CV5 A;  2HIO D;  3KUY B;  3KUY C;  3AZM A;  3KXB A;  1N1J A;  4KUD D;  5B0Y B;  5B32 A;  3TU4 D;  5B0Y C;  3AFA D;  1WWS A;  5B31 D;  4H9O B;  3A6N A;  5B0Z D;  1ID3 D;  2ARO D;  1KU5 A;  3AZH D;  3AZF A;  5CPI B;  5CPI C;  3MGQ B;  4H9Q B;  5G49 B;  3LJA D;  3MGQ C;  3X1T D;  5B33 A;  3WKJ B;  3WKJ C;  3X1V A;  3MNN D;  3W96 B;  2YFV A;  5B2I B;  1ULY A;  5GXQ D;  5B2I C;  4R8P D;  1P3B D;  3MGR A;  1KX4 A;  4H9N B;  3UTA B;  3W98 A;  3UTA C;  4QLC D;  1M1A C;  1B67 A;  3AZE D;  3WA9 D;  3WTP A;  4UUZ A;  1KX3 D;  4CAY A;  4J8U A;  1TAF B;  1P3G B;  4Z2M H;  3REH D;  3AZJ D;  2HIO B;  1P3G C;  1JFI A;  3LZ1 A;  4JJN C;  4KUD B;  4KGC D;  4KUD C;  3TU4 B;  1P3K D;  4Z5T A;  3AFA B;  3TU4 C;  3UTB A;  3AFA C;  4J8W D;  5B31 B;  3C1C A;  1P3O D;  1ID3 B;  5B31 G;  2ARO B;  5B40 A;  5GSU D;  3REJ B;  2F8N A;  3REJ C;  2BYM A;  5B24 A;  3LJA B;  3LJA C;  3X1T B;  3LEL D;  4YM6 D;  4WNN A;  3MNN B;  4XUJ D;  2BYK B;  5GXQ B;  4R8P B;  1P3B B;  1P3B C;  4YS3 B;  4YS3 C;  4QLC B;  5AVB A;  3C1B D;  3VH5 T;  1S32 D;  3AZE B;  4Z66 D;  3O62 A;  3AZE C;  1P3I D;  3WA9 B;  5AV9 A;  1KX3 B;  5AV6 D;  1KX3 C;  4H9S A;  1EQZ D;  3AZJ B;  3REH B;  2HUE C;  3AZJ C;  2L5A A;  1A7W A;  4KGC B;  1P3K B;  4KGC C;  5C3I B;  1P3K C;  5C3I C;  4J8W B;  4J8W C;  1P3O B;  3AV2 D;  2F8N K;  1P3O C;  5GSU B;  3AZL C;  5GSU C;  3R45 B;  1U35 B;  3AN2 B;  1U35 C;  3LEL B;  4YM6 B;  3AN2 C;  3LEL C;  1P34 A;  1P3F A;  3AV1 A;  4CSR B;  4M6B A;  4XUJ B;  4XUJ C;  4X23 A;  1P3P A;  1HQ3 A;  1S32 B;  3C1B B;  5JRG D;  3REL D;  3MGP A;  1P3I B;  5CPK D;  1AOI D;  5AV6 B;  5JA4 B;  5KDM B;  4LD9 B;  5E5A D;  4J8X D;  4LD9 C;  1EQZ B;  5AY8 D;  1EQZ C;  3NQJ A;  5BO0 A;  3AZN D;  4WV4 B;  1BFM A;  5AV8 D;  3MGQ A;  4H9Q A;  3AZI C;  3AV2 B;  4XZQ D;  4ZBJ B;  3AV2 C;  3WAA A;  4ZBJ C;  1R4V A;  3V9R B;  5BNV A;  1M18 D;  4ZUX A;  1P3A D;  3B0C T;  5BNX A;  3UT9 C;  3REI B;  3REI C;  1M1A A;  3AYW D;  1TZY C;  3MGP D;  1TAF A;  3NQU B;  5DNN D;  4H9R A;  5JRG B;  3REL B;  1KX5 D;  5B1M A;  5CPK B;  1AOI B;  2NQB D;  4JJN A;  1AOI C;  5E5A B;  4J8X B;  3LZ0 A;  4J8X C;  3W99 C;  5AY8 B;  5AY8 C;  3MGS D;  5B2J D;  3AZN B;  3AZN C;  5AV8 B;  5F99 D;  5AV8 C;  2FJ7 A;  4XZQ B;  1P3L D;  3KWQ A;  3REK D;  1F66 A;  2YFW A;  1M18 B;  1ZLA A;  1P3A B;  4KHA B;  1H3O B;  5AVC D;  3X1U D;  3W96 C;  5B1L D;  5GT3 D;  3X1S D;  3B6F D;  3W97 B;  4H9P A;  3MVD D;  3AZG A;  3W97 C;  5DNN B;  5DNM D;  5DNN C;  4NE5 A;  1M19 D;  1KX5 B;  1KX5 C;  1P3M D;  2NQB B;  1WWI A;  2CV5 D;  4WU9 A;  2NZD B;  2NZD C;  3AZM D;  1BH8 A;  3KXB D;  5B32 D;  5BS7 C;  3MGS B;  2HIO C;  5GT0 A;  5FUG A;  5CP6 A;  3A6N D;  3AZL A;  3AZF D;  5F99 B;  5F99 C;  5B0Z B;  5B31 C;  1P3L B;  5B0Z C;  3AZH B;  3VH6 A;  2ARO C;  5B33 D;  3REK B;  3AZH C;  3REK C;  3AZK A;  1ID3 C;  3X1V D;  5CPJ A;  4NE6 A;  3X1T C;  1KX4 D;  3MGR D;  3W98 D;  5AVC B;  5AVC C;  3X1U B;  3MNN C;  5GXQ C;  4R8P C;  1Q9C A;  5B1L B;  5B1L C;  3X1S B;  3B6F B;  1BH9 A;  4QLC C;  3B6F C;  3MVD B;  3WTP D;  1HTA A;  3MVD C;  4LD9 A;  4J8U D;  5DNM B; 
#chains in the Genus database with same CATH topology
 5DNM C;  1M19 B;  1M19 C;  1P3M B;  3WA9 C;  2CV5 B;  1P3M C;  3LZ1 D;  3AZM B;  3KXB B;  1N1J B;  2G5H C;  5B32 B;  3KXB C;  4Z5T D;  5B32 G;  3UTB D;  3AZI A;  3REH C;  1P3L B;  3A6N B;  3C1C D;  5B40 D;  2PYO A;  3AZF B;  2F8N D;  3AZF C;  1F1E A;  5CPJ D;  3B6G A;  5B24 D;  3UT9 A;  5B33 B;  4J8V A;  3X1V B;  1TZY A;  2YFV B;  3X1V C;  3A1K A;  1KX4 B;  3MGR B;  5AV5 A;  4YM6 C;  3W98 B;  4EO5 B;  4WU8 A;  5AVB D;  3O62 D;  5AV9 D;  3WTP B;  4UUZ B;  4CAY B;  3WTP C;  4J8U B;  3W99 A;  1S32 C;  3C1B C;  4Z66 B;  4Z66 C;  1P3I C;  3KUY A;  2Y2I A;  1JFI B;  2F2A C;  5AV6 C;  4E45 A;  5B0Y A;  4Z5T B;  3UTB B;  3UTB C;  3B6G D;  4H9O A;  3C1C B;  3C1C C;  5B40 B;  5B40 C;  5CPI A;  4UPK A;  2F8N B;  2F8N G;  2BYM B;  5G49 A;  5B24 B;  3WKJ A;  5BT1 D;  4WNN B;  2IO5 B;  1P34 D;  1P3F D;  4G91 B;  2IO5 C;  3H0R C;  3W96 A;  5B2I A;  4G91 C;  4DRA A;  3AV1 D;  4WU8 D;  4X23 D;  4H9N A;  3UTA A;  1P3P D;  1HQ3 D;  3W97 A;  5AVB B;  3O62 B;  3O62 C;  1Z2C B;  2NZD A;  5AV9 B;  3KSY A;  5BS7 A;  5JRG C;  3REL C;  1P3G A;  2HIO A;  5CPK C;  4KUD A;  3B0D B;  3TU4 A;  5E5A C;  3B0D C;  3AFA A;  3MGQ D;  5B31 A;  5B0Z A;  1ID3 A;  2ARO A;  3AZH A;  4G92 B;  3REJ A;  3LJA A;  3X1T A;  4XZQ C;  4DQY B;  4ZUX D;  1P34 B;  1P3F B;  3MNN A;  1P34 C;  1P3F C;  2BYK A;  5GXQ A;  4R8P A;  1M1A D;  1M18 C;  1P3B A;  4X23 B;  4YS3 A;  4X23 C;  1P3P B;  4QLC A;  1P3A C;  4E44 A;  1HQ3 B;  1HQ3 C;  3AYW B;  3AYW C;  2Y2J A;  3AZE A;  3WA9 A;  3MGP B;  5B1M D;  3MGP C;  1KX3 A;  4JJN D;  3LZ0 D;  3AZJ A;  3REH A;  3NQJ B;  2NQB C;  5BO0 B;  4KGC A;  1P3K A;  3REJ D;  4J8W A;  3MGS C;  2FJ7 D;  1P3O A;  2W8S A;  3B0B A;  5B2J B;  5B2J C;  2JSS A;  5GSU A;  3KWQ D;  1F66 D;  3R45 A;  5BNV B;  1U35 A;  3AN2 A;  1ZLA D;  3LEL A;  4YM6 A;  4Z2M G;  4ZUX B;  4YS3 D;  2ZM5 A;  4AWL B;  4ZUX C;  4AWL C;  4CSR A;  1P3L C;  4XUJ A;  5BNX B;  1M1A B;  1PZR A;  3VH5 A;  1B6W A;  3X1U C;  3C1B A;  3AZG D;  1S32 A;  4H9R B;  5GT3 B;  4Z66 A;  1P3I A;  5GT3 C;  2Y2G A;  5B1M B;  3X1S C;  5B1M C;  5AV6 A;  5JA4 A;  4WU9 D;  5KDM A;  4JJN B;  3LZ0 B;  2VQR A;  1EQZ A;  3LZ0 C;  3KFU G;  2CV5 C;  5GT0 D;  5CP6 D;  3AZM C;  2Y2P A;  3AZL D;  2Y2M A;  5B32 C;  2FJ7 B;  3AV2 A;  1U35 D;  2FJ7 C;  3AN2 D;  3A6N C;  3AZK D;  3KWQ B;  1F66 B;  2YFW B;  3KWQ C;  3V9R A;  1F66 C;  2CWE A;  3VH6 T;  1ZLA B;  1ZLA C;  4NE3 A;  5B33 C;  3REI A;  2Y2L A;  3VH6 W;  1KX4 C;  3MGR C;  3W98 C;  4EO5 C;  4H9P B;  3NQU A;  3AZG B;  5JRG A;  3VH5 W;  3AZG C;  3WTP E;  3REL A;  3WAA D;  4LD9 D;  2HUE B;  5CPK A;  1AOI A;  4NFT A;  4WU9 B;  4HGA B;  3A1I A;  4WU9 C;  5E5A A;  4HGA C;  4J8X A;  1BH8 B;  2RVQ D;  4J8U C;  5CHL B;  5AY8 A;  3AZI D;  3LZ1 B;  5GT0 B;  5FUG B;  5CP6 B;  3LZ1 C;  5GT0 C;  5CP6 C;  3AZL B;  3AZN A;  2PYO D;  5AV8 A;  4Z5T C;  4XZQ A;  4WZS B;  3AZK B;  3UT9 D;  3AZK C;  4J8V D;  3REI D;  1M18 A;  5CPJ B;  1TZY D;  5CPJ C;  5B24 C;  1P3A A;  4KHA A;  5AV5 D;  1H3O A;  3AYW A;  1BH9 B;  5DNN A;  2F8N H;  3WAA B;  3W99 D;  3WAA C;  5AVB C;  1KX5 A;  2NQB A;  3KUY D;  2DQN C;  5AV9 C;  5B0Y D;  2RVQ C;  3MGS A;  4H9S C;  3AZI B;  1W2E A;  5B2J A;  2PYO B;  5F99 A;  5CPI D;  4DRB A;  2PYO C;  3B6G B;  3B6G C;  1P3L A;  3REK A;  3WKJ D;  3UT9 B;  4G92 C;  4J8V B;  4J8V C;  3W96 D;  5B2I D;  2LY8 A;  1TZY B;  3UTA D;  5AV5 B;  3B0C W;  5BT1 C;  5AVC A;  5AV5 C;  3AV1 B;  3W97 D;  3X1U A;  3AV1 C;  4WU8 B;  4WU8 C;  5B1L A;  5GT3 A;  3X1S A;  1P3P C;  3B6F A;  3MVD A;  2NZD D;  3EPL A;  5DNM A;  1M19 A;  3W99 B;  2ZY5 A;  1P3G D;  1P3M A;  2CV5 A;  2HIO D;  3KUY B;  3KUY C;  3AZM A;  3KXB A;  1N1J A;  4KUD D;  5B0Y B;  5B32 A;  3TU4 D;  5B0Y C;  3AFA D;  1WWS A;  5B31 D;  4H9O B;  3A6N A;  5B0Z D;  1ID3 D;  2ARO D;  1KU5 A;  3AZH D;  3AZF A;  5CPI B;  5CPI C;  2XD5 A;  3EPH A;  3MGQ B;  4H9Q B;  5G49 B;  3LJA D;  3MGQ C;  3X1T D;  5B33 A;  3WKJ B;  2FFF B;  3WKJ C;  3X1V A;  3MNN D;  3W96 B;  2YFV A;  5B2I B;  1ULY A;  5GXQ D;  5B2I C;  4R8P D;  1P3B D;  3MGR A;  1KX4 A;  4H9N B;  3UTA B;  3W98 A;  3UTA C;  4QLC D;  2RIQ A;  1M1A C;  1B67 A;  2Y2O A;  3AZE D;  3WA9 D;  2ZY4 A;  3WTP A;  4UUZ A;  1KX3 D;  4CAY A;  4J8U A;  1TAF B;  1P3G B;  4Z2M H;  3REH D;  3AZJ D;  2HIO B;  1P3G C;  1JFI A;  3LZ1 A;  4JJN C;  4KUD B;  4KGC D;  4KUD C;  3TU4 B;  1P3K D;  4Z5T A;  3AFA B;  3TU4 C;  3UTB A;  3AFA C;  4J8W D;  5B31 B;  3C1C A;  1P3O D;  1ID3 B;  5B31 G;  2ARO B;  5B40 A;  5GSU D;  3REJ B;  2F8N A;  2ZY3 A;  3REJ C;  2BYM A;  5B24 A;  3LJA B;  3LJA C;  3X1T B;  3LEL D;  4YM6 D;  4WNN A;  3MNN B;  4XUJ D;  3AL0 C;  2BYK B;  5GXQ B;  4R8P B;  1P3B B;  1P3B C;  4YS3 B;  4YS3 C;  4QLC B;  3EPK A;  5AVB A;  3C1B D;  3VH5 T;  1S32 D;  3AZE B;  4Z66 D;  3O62 A;  3AZE C;  1P3I D;  3WA9 B;  5AV9 A;  1KX3 B;  5AV6 D;  1KX3 C;  4H9S A;  1EQZ D;  2Y2K A;  3REH B;  2HUE C;  3AZJ B;  2JE5 A;  3AZJ C;  2L5A A;  1A7W A;  4KGC B;  1P3K B;  4KGC C;  5C3I B;  1P3K C;  5C3I C;  2BG1 A;  4J8W B;  4J8W C;  1P3O B;  3AV2 D;  2F8N K;  1P3O C;  1T3U A;  5GSU B;  3AZL C;  5GSU C;  2Y2H A;  3R45 B;  1U35 B;  2Y2Q A;  3AN2 B;  1U35 C;  3LEL B;  4YM6 B;  3AN2 C;  3LEL C;  1P34 A;  1P3F A;  3AV1 A;  4CSR B;  4M6B A;  4XUJ B;  2ZY2 A;  4XUJ C;  4X23 A;  2G5I C;  2UWX A;  1P3P A;  1HQ3 A;  2J8P A;  2DF4 C;  3H0L C;  1S32 B;  3C1B B;  5JRG D;  3REL D;  3MGP A;  1P3I B;  5CPK D;  1AOI D;  5AV6 B;  5JA4 B;  5KDM B;  4LD9 B;  5E5A D;  4J8X D;  4LD9 C;  1EQZ B;  5AY8 D;  1EQZ C;  3NQJ A;  5BO0 A;  3AZN D;  4WV4 B;  1BFM A;  5AV8 D;  3MGQ A;  4H9Q A;  3AZI C;  3AV2 B;  4XZQ D;  4ZBJ B;  3AV2 C;  3WAA A;  4ZBJ C;  1R4V A;  3FDD A;  3V9R B;  5BNV A;  2XD1 A;  1M18 D;  3IP4 C;  4ZUX A;  1P3A D;  3B0C T;  5BNX A;  3UT9 C;  3REI B;  3P5J B;  3REI C;  2JCH A;  1M1A A;  3AYW D;  1TZY C;  3MGP D;  1TAF A;  3NQU B;  5DNN D;  4H9R A;  5JRG B;  3REL B;  1KX5 D;  5B1M A;  5CPK B;  1AOI B;  2NQB D;  4JJN A;  1AOI C;  5E5A B;  4J8X B;  3LZ0 A;  4J8X C;  3W99 C;  5AY8 B;  5AY8 C;  3MGS D;  5B2J D;  3AZN B;  3AZN C;  5AV8 B;  5F99 D;  5AV8 C;  2FJ7 A;  2Y2N A;  4XZQ B;  1P3L D;  3KWQ A;  3REK D;  1F66 A;  2YFW A;  1M18 B;  1ZLA A;  1P3A B;  4KHA B;  1H3O B;  5AVC D;  3X1U D;  3W96 C;  5B1L D;  5GT3 D;  3X1S D;  3B6F D;  3W97 B;  4H9P A;  3MVD D;  3AZG A;  3W97 C;  5DNN B;  5DNM D;  5DNN C;  4NE5 A;  1M19 D;  1KX5 B;  1KX5 C;  1P3M D;  2NQB B;  1WWI A;  3EG5 B;  4WU9 A;  2CV5 D;  2NZD B;  2NZD C;  3F6T A;  3AZM D;  1BH8 A;  3KXB D;  5B32 D;  5BS7 C;  3MGS B;  2HIO C;  5GT0 A;  5FUG A;  5CP6 A;  3A6N D;  3AZL A;  3AZF D;  5F99 B;  5F99 C;  5B0Z B;  5B31 C;  3EPJ A;  5B0Z C;  3AZH B;  3VH6 A;  2ARO C;  5B33 D;  3REK B;  3AZH C;  3REK C;  3AZK A;  1ID3 C;  3X1V D;  5CPJ A;  4NE6 A;  3H0M C;  3X1T C;  1KX4 D;  3MGR D;  3W98 D;  5AVC B;  5AVC C;  3X1U B;  3MNN C;  4WJ3 C;  5GXQ C;  4R8P C;  1Q9C A;  5B1L B;  5B1L C;  3X1S B;  3B6F B;  1BH9 A;  4QLC C;  3B6F C;  3MVD B;  3WTP D;  1HTA A;  3MVD C;  4LD9 A;  4J8U D;  5DNM B; 
#chains in the Genus database with same CATH homology
 5DNM C;  1M19 B;  1M19 C;  1P3M B;  3WA9 C;  2CV5 B;  1P3M C;  3LZ1 D;  3AZM B;  3KXB B;  1N1J B;  2G5H C;  5B32 B;  3KXB C;  4Z5T D;  5B32 G;  3UTB D;  3AZI A;  3REH C;  1P3L B;  3A6N B;  3C1C D;  5B40 D;  2PYO A;  3AZF B;  2F8N D;  3AZF C;  1F1E A;  5CPJ D;  3B6G A;  5B24 D;  3UT9 A;  5B33 B;  4J8V A;  3X1V B;  1TZY A;  2YFV B;  3X1V C;  3A1K A;  1KX4 B;  3MGR B;  5AV5 A;  4YM6 C;  3W98 B;  4EO5 B;  4WU8 A;  5AVB D;  3O62 D;  5AV9 D;  3WTP B;  4UUZ B;  4CAY B;  3WTP C;  4J8U B;  3W99 A;  1S32 C;  3C1B C;  4Z66 B;  4Z66 C;  1P3I C;  3KUY A;  2Y2I A;  1JFI B;  2F2A C;  5AV6 C;  4E45 A;  5B0Y A;  4Z5T B;  3UTB B;  3UTB C;  3B6G D;  4H9O A;  3C1C B;  3C1C C;  5B40 B;  5B40 C;  5CPI A;  4UPK A;  2F8N B;  2F8N G;  2BYM B;  5G49 A;  5B24 B;  3WKJ A;  5BT1 D;  4WNN B;  2IO5 B;  1P34 D;  1P3F D;  4G91 B;  2IO5 C;  3H0R C;  3W96 A;  5B2I A;  4G91 C;  4DRA A;  3AV1 D;  4WU8 D;  4X23 D;  4H9N A;  3UTA A;  1P3P D;  1HQ3 D;  3W97 A;  5AVB B;  3O62 B;  3O62 C;  1Z2C B;  2NZD A;  5AV9 B;  3KSY A;  5BS7 A;  5JRG C;  3REL C;  1P3G A;  2HIO A;  5CPK C;  4KUD A;  3B0D B;  3TU4 A;  5E5A C;  3B0D C;  3AFA A;  3MGQ D;  5B31 A;  5B0Z A;  1ID3 A;  2ARO A;  3AZH A;  4G92 B;  3REJ A;  3LJA A;  3X1T A;  4XZQ C;  4DQY B;  4ZUX D;  1P34 B;  1P3F B;  3MNN A;  1P34 C;  1P3F C;  2BYK A;  5GXQ A;  4R8P A;  1M1A D;  1M18 C;  1P3B A;  4X23 B;  4YS3 A;  4X23 C;  1P3P B;  4QLC A;  1P3A C;  4E44 A;  1HQ3 B;  1HQ3 C;  3AYW B;  3AYW C;  2Y2J A;  3AZE A;  3WA9 A;  3MGP B;  5B1M D;  3MGP C;  1KX3 A;  4JJN D;  3LZ0 D;  3AZJ A;  3REH A;  3NQJ B;  2NQB C;  5BO0 B;  4KGC A;  1P3K A;  3REJ D;  4J8W A;  3MGS C;  2FJ7 D;  1P3O A;  2W8S A;  3B0B A;  5B2J B;  5B2J C;  2JSS A;  5GSU A;  3KWQ D;  1F66 D;  3R45 A;  5BNV B;  1U35 A;  3AN2 A;  1ZLA D;  3LEL A;  4YM6 A;  4Z2M G;  4ZUX B;  4YS3 D;  2ZM5 A;  4AWL B;  4ZUX C;  4AWL C;  4CSR A;  1P3L C;  4XUJ A;  5BNX B;  1M1A B;  1PZR A;  3VH5 A;  1B6W A;  3X1U C;  3C1B A;  3AZG D;  1S32 A;  4H9R B;  5GT3 B;  4Z66 A;  1P3I A;  5GT3 C;  2Y2G A;  5B1M B;  3X1S C;  5B1M C;  5AV6 A;  5JA4 A;  4WU9 D;  5KDM A;  4JJN B;  3LZ0 B;  2VQR A;  1EQZ A;  3LZ0 C;  3KFU G;  2CV5 C;  5GT0 D;  5CP6 D;  3AZM C;  2Y2P A;  3AZL D;  2Y2M A;  5B32 C;  2FJ7 B;  3AV2 A;  1U35 D;  2FJ7 C;  3AN2 D;  3A6N C;  3AZK D;  3KWQ B;  1F66 B;  2YFW B;  3KWQ C;  3V9R A;  1F66 C;  2CWE A;  3VH6 T;  1ZLA B;  1ZLA C;  4NE3 A;  5B33 C;  3REI A;  2Y2L A;  3VH6 W;  1KX4 C;  3MGR C;  3W98 C;  4EO5 C;  4H9P B;  3NQU A;  3AZG B;  5JRG A;  3VH5 W;  3AZG C;  3WTP E;  3REL A;  3WAA D;  4LD9 D;  2HUE B;  5CPK A;  1AOI A;  4NFT A;  4WU9 B;  4HGA B;  3A1I A;  4WU9 C;  5E5A A;  4HGA C;  4J8X A;  1BH8 B;  2RVQ D;  4J8U C;  5CHL B;  5AY8 A;  3AZI D;  3LZ1 B;  5GT0 B;  5FUG B;  5CP6 B;  3LZ1 C;  5GT0 C;  5CP6 C;  3AZL B;  3AZN A;  2PYO D;  5AV8 A;  4Z5T C;  4XZQ A;  4WZS B;  3AZK B;  3UT9 D;  3AZK C;  4J8V D;  3REI D;  1M18 A;  5CPJ B;  1TZY D;  5CPJ C;  5B24 C;  1P3A A;  4KHA A;  5AV5 D;  1H3O A;  3AYW A;  1BH9 B;  5DNN A;  2F8N H;  3WAA B;  3W99 D;  3WAA C;  5AVB C;  1KX5 A;  2NQB A;  3KUY D;  2DQN C;  5AV9 C;  5B0Y D;  2RVQ C;  3MGS A;  4H9S C;  3AZI B;  1W2E A;  5B2J A;  2PYO B;  5F99 A;  5CPI D;  4DRB A;  2PYO C;  3B6G B;  3B6G C;  1P3L A;  3REK A;  3WKJ D;  3UT9 B;  4G92 C;  4J8V B;  4J8V C;  3W96 D;  5B2I D;  2LY8 A;  1TZY B;  3UTA D;  5AV5 B;  3B0C W;  5BT1 C;  5AVC A;  5AV5 C;  3AV1 B;  3W97 D;  3X1U A;  3AV1 C;  4WU8 B;  4WU8 C;  5B1L A;  5GT3 A;  3X1S A;  1P3P C;  3B6F A;  3MVD A;  2NZD D;  3EPL A;  5DNM A;  1M19 A;  3W99 B;  2ZY5 A;  1P3G D;  1P3M A;  2CV5 A;  2HIO D;  3KUY B;  3KUY C;  3AZM A;  3KXB A;  1N1J A;  4KUD D;  5B0Y B;  5B32 A;  3TU4 D;  5B0Y C;  3AFA D;  1WWS A;  5B31 D;  4H9O B;  3A6N A;  5B0Z D;  1ID3 D;  2ARO D;  1KU5 A;  3AZH D;  3AZF A;  5CPI B;  5CPI C;  2XD5 A;  3EPH A;  3MGQ B;  4H9Q B;  5G49 B;  3LJA D;  3MGQ C;  3X1T D;  5B33 A;  3WKJ B;  2FFF B;  3WKJ C;  3X1V A;  3MNN D;  3W96 B;  2YFV A;  5B2I B;  1ULY A;  5GXQ D;  5B2I C;  4R8P D;  1P3B D;  3MGR A;  1KX4 A;  4H9N B;  3UTA B;  3W98 A;  3UTA C;  4QLC D;  2RIQ A;  1M1A C;  1B67 A;  2Y2O A;  3AZE D;  3WA9 D;  2ZY4 A;  3WTP A;  4UUZ A;  1KX3 D;  4CAY A;  4J8U A;  1TAF B;  1P3G B;  4Z2M H;  3REH D;  3AZJ D;  2HIO B;  1P3G C;  1JFI A;  3LZ1 A;  4JJN C;  4KUD B;  4KGC D;  4KUD C;  3TU4 B;  1P3K D;  4Z5T A;  3AFA B;  3TU4 C;  3UTB A;  3AFA C;  4J8W D;  5B31 B;  3C1C A;  1P3O D;  1ID3 B;  5B31 G;  2ARO B;  5B40 A;  5GSU D;  3REJ B;  2F8N A;  2ZY3 A;  3REJ C;  2BYM A;  5B24 A;  3LJA B;  3LJA C;  3X1T B;  3LEL D;  4YM6 D;  4WNN A;  3MNN B;  4XUJ D;  3AL0 C;  2BYK B;  5GXQ B;  4R8P B;  1P3B B;  1P3B C;  4YS3 B;  4YS3 C;  4QLC B;  3EPK A;  5AVB A;  3C1B D;  3VH5 T;  1S32 D;  3AZE B;  4Z66 D;  3O62 A;  3AZE C;  1P3I D;  3WA9 B;  5AV9 A;  1KX3 B;  5AV6 D;  1KX3 C;  4H9S A;  1EQZ D;  2Y2K A;  3REH B;  2HUE C;  3AZJ B;  2JE5 A;  3AZJ C;  2L5A A;  1A7W A;  4KGC B;  1P3K B;  4KGC C;  5C3I B;  1P3K C;  5C3I C;  2BG1 A;  4J8W B;  4J8W C;  1P3O B;  3AV2 D;  2F8N K;  1P3O C;  1T3U A;  5GSU B;  3AZL C;  5GSU C;  2Y2H A;  3R45 B;  1U35 B;  2Y2Q A;  3AN2 B;  1U35 C;  3LEL B;  4YM6 B;  3AN2 C;  3LEL C;  1P34 A;  1P3F A;  3AV1 A;  4CSR B;  4M6B A;  4XUJ B;  2ZY2 A;  4XUJ C;  4X23 A;  2G5I C;  2UWX A;  1P3P A;  1HQ3 A;  2J8P A;  2DF4 C;  3H0L C;  1S32 B;  3C1B B;  5JRG D;  3REL D;  3MGP A;  1P3I B;  5CPK D;  1AOI D;  5AV6 B;  5JA4 B;  5KDM B;  4LD9 B;  5E5A D;  4J8X D;  4LD9 C;  1EQZ B;  5AY8 D;  1EQZ C;  3NQJ A;  5BO0 A;  3AZN D;  4WV4 B;  1BFM A;  5AV8 D;  3MGQ A;  4H9Q A;  3AZI C;  3AV2 B;  4XZQ D;  4ZBJ B;  3AV2 C;  3WAA A;  4ZBJ C;  1R4V A;  3FDD A;  3V9R B;  5BNV A;  2XD1 A;  1M18 D;  3IP4 C;  4ZUX A;  1P3A D;  3B0C T;  5BNX A;  3UT9 C;  3REI B;  3P5J B;  3REI C;  2JCH A;  1M1A A;  3AYW D;  1TZY C;  3MGP D;  1TAF A;  3NQU B;  5DNN D;  4H9R A;  5JRG B;  3REL B;  1KX5 D;  5B1M A;  5CPK B;  1AOI B;  2NQB D;  4JJN A;  1AOI C;  5E5A B;  4J8X B;  3LZ0 A;  4J8X C;  3W99 C;  5AY8 B;  5AY8 C;  3MGS D;  5B2J D;  3AZN B;  3AZN C;  5AV8 B;  5F99 D;  5AV8 C;  2FJ7 A;  2Y2N A;  4XZQ B;  1P3L D;  3KWQ A;  3REK D;  1F66 A;  2YFW A;  1M18 B;  1ZLA A;  1P3A B;  4KHA B;  1H3O B;  5AVC D;  3X1U D;  3W96 C;  5B1L D;  5GT3 D;  3X1S D;  3B6F D;  3W97 B;  4H9P A;  3MVD D;  3AZG A;  3W97 C;  5DNN B;  5DNM D;  5DNN C;  4NE5 A;  1M19 D;  1KX5 B;  1KX5 C;  1P3M D;  2NQB B;  1WWI A;  3EG5 B;  4WU9 A;  2CV5 D;  2NZD B;  2NZD C;  3F6T A;  3AZM D;  1BH8 A;  3KXB D;  5B32 D;  5BS7 C;  3MGS B;  2HIO C;  5GT0 A;  5FUG A;  5CP6 A;  3A6N D;  3AZL A;  3AZF D;  5F99 B;  5F99 C;  5B0Z B;  5B31 C;  3EPJ A;  5B0Z C;  3AZH B;  3VH6 A;  2ARO C;  5B33 D;  3REK B;  3AZH C;  3REK C;  3AZK A;  1ID3 C;  3X1V D;  5CPJ A;  4NE6 A;  3H0M C;  3X1T C;  1KX4 D;  3MGR D;  3W98 D;  5AVC B;  5AVC C;  3X1U B;  3MNN C;  4WJ3 C;  5GXQ C;  4R8P C;  1Q9C A;  5B1L B;  5B1L C;  3X1S B;  3B6F B;  1BH9 A;  4QLC C;  3B6F C;  3MVD B;  3WTP D;  1HTA A;  3MVD C;  4LD9 A;  4J8U D;  5DNM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...