3AZKC

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkC00
5DNMC 1N1JA 4XZQA 3O62A 3X1VA 1EQZA 1P3IA 3REJD 4H9QB 4KHAA 4WU9A 2YFVA 5B0ZC 2NQBD 3AFAD 1KX5D 4R8PA 5BNXA 3AZGA 3KUYA 4J8XA 2PYOC 5DNNC 3AZEA 4G91C 5CP6D 5BO0A 3V9RB 4G92C 1AOIB 4Z66C 5AV9B 2CV5D 1BFMA 3VH5T 3MGSC 3AZND 3AV1C 3AZKB 4J8WA 5B2IB 1H3OB 1P3FD 3B6GB 3WAAC 4J8VA 5B40D 5AY8A 2HIOC 1P3PA 2JSSA 1P3BA 4NE5A 4NE6A 3RELD 4ZUXB 4JJNA 4X23A 5AV8B 5GT0C 1M19A 2FJ7C 5B32C 3REIA 1P34C 1S32B 3LELA 4WU8A 3AV2B 4Z5TB 5AVCB 4LD9B 4XUJB 1BH8A 5GXQB 3WA9B 3AZFB 3O62D 3REKB 1P3ID 4M6BA 3B0CW 4Z2MH 4WU9D 1P3AA 5KDMA 3AZLA 5JRGA 5BS7A 5BNVA 1A7WA 5FUGA 5C3IB 5DNNB 3WTPA 4G91B 4CAYB 2BYKA 4WNNA 4R8PD 5GSUA 3NQJA 3AZGD 3KUYD 3AZED 5B24C 5AVBA 3X1TA 3AV1B 3MGSB 3REHB 3AZJC 5B0YC 5F99B 3NQUA 3X1UC 1U35C 2AROC 3A6NB 3VH6A 4H9NB 3LZ1B 5CPKB 1F66A 4AWLB 2NZDC 5AV5C 4J8WD 3AYWB 3W99B 3UTBB 3AZMA 1P3GC 1M18B 2HIOB 1P3MD 5B31A 1ZLAC 3B6FD 3MVDA 4J8UB 4EO5C 4H9PA 3WKJC 3KSYA 4YS3B 5CPIB 1TZYC 1P3PD 4YM6D 1ID3A 4DRAA 3AZHC 5GT0B 1TAFA 5B32B 3REJB 3UT9D 2RVQD 4E45A 4X23D 3LZ0A 3WTPE 5B31G 3C1BC 1M19D 2NQBB 1KX5B 3REID 3LELD 4WU8D 5B2JA 5CPID 1P3KA 5GT3D 4H9SC 5CP6B 1P34A 2IO5B 5AV6D 1KX4C 5AV9C 3MGQA 3TU4C 1P3LA 3AZKC 5B2IC 5JA4B 3MGRD 3AZNB 3B6GC 3AZLD 5JRGD 3WTPD 5B24B 5B40B 5GSUD 3MNNA 3X1UB 1U35B 1BH9A 4KGCA 4QLCA 4ZUXC 5AVBD 3X1TD 5CHLB 5AV8C 5B33A 3RELB 1HQ3A 1P3GB 3KWQA 3VH5W 4YM6C 3MGPC 1S32C 1JFIA 1F66D 3UT9C 3WKJB 5CPJA 3AZMD 4Z5TC 5B0YA 5AVCC 3KXBA 3AV2C 1TZYB 5B31D 4XUJC 4LD9C 3AZHB 5GXQC 3MVDD 5B1MD 3WA9C 4UUZB 3AZFC 3REKC 1ID3D 3O62B 3C1BB 1P3IB 3B0BA 4KHAB 2F8NA 4WU9B 3W98A 5C3IC 3UTAA 3LZ0D 5B1LA 4H9QA 4R8PB 5E5AA 1KX4B 5B2JD 3W97D 1M1AD 3KUYB 3TU4B 4KUDC 3AZEB 1P3KD 4E44A 3REHC 3AZID 5F99C 3LJAD 3MGQD 5BO0B 3A6NC 1P3LD 3LZ1C 5CPKC 3W96C 4AWLC 4H9RA 1P3OC 3AYWC 3W99C 4DRBA 3UTBC 1AOIA 1M18C 4J8WB 3VH5A 3X1SC 1P3MB 4J8UC 3B6FB 1H3OA 5CPIC 4YS3C 4CSRB 3B6GA 3MNND 4KGCD 1P3PB 4QLCD 3REJC 4YM6B 3MGPB 3UT9B 5B33D 1HQ3D 3AN2D 4X23B 3KWQD 2NQBC 3AFAC 1KX5C 4ZUXA 1M19B 3C1CA 3REIB 5CPJD 4WU8B 4XZQD 3KXBD 3X1VD 1EQZD 4WZSB 1KX3A 5CP6C 2IO5C 5BT1D 5GT3B 2NZDA 1BH8B 5DNMA 5AV6B 4Z5TA 5G49B 2CV5C 3AZNC 5B0ZA 3W98D 3MGRB 2F8ND 4J8XD 3REKA 1P3FC 3UTAD 5B1LD 4KUDB 5FUGB 3WTPB 5B40C 2BYKB 4WNNB 5E5AD 2PYOA 5DNNA 5GSUB 3NQJB 3W96B 1P3OB 3RELC 5AVBB 4Z66A 2YFWA 4WV4B 3NQUB 3X1SB 3AV1A 3MGSA 4J8VD 3REHA 1F66B 1AOID 5AY8D 3WAAA 3AZMB 4H9NA 1P3BD 5B31B 3AYWA 3W99A 3MVDB 3UTBA 4JJND 5B1MB 2HIOA 4H9PB 3O62C 2BYMA 1P3IC 3AFAB 4J8UA 1ID3B 4WU9C 5BT1C 1B6WA 4H9OB 5GT0A 2FJ7A 3LZ0B 5B32A 1Q9CA 4R8PC 3C1CD 3KUYC 3AZGC 5B2JB 3AZEC 3W97B 1M1AB 2CV5B 1KX3D 1P3KB 3AZIB 4NE3A 1P3AD 2NZDD 5DNMD 2HUEC 3LJAB 1P3FB 1P3LB 5B0ZD 4J8WC 1P3MC 3B6FC 3R45B 5AY8C 2PYOD 2F8NH 5DNND 1P3PC 3MNNB 5B24A 4QLCB 5B40A 2RVQC 3AZJA 3X1UA 4X23C 1U35A 4Z66D 5B33B 2AROA 1HQ3B 4ZBJB 3AN2B 1M19C 3KWQB 3AV1D 5AV5A 3REIC 1JFIB 3LELC 4WU8C 1P3GA 1ULYA 1N1JB 5CPJB 3WAAD 1ZLAA 4XZQB 3KXBB 3X1VB 1EQZB 5GT3C 5AV6C 3WKJA 2YFVB 2HIOD 1TZYA 1HTAA 3AZHA 3MGRC 5BNXB 4UUZA 2F8NB 3AZGB 3AZLC 5BS7C 5JRGC 4J8XB 3WTPC 5GT0D 3C1BA 3UTAB 2FJ7D 5B32D 5B1LB 1P34D 2F8NG 5GSUC 2L5AA 5E5AB 2HUEB 4H9SA 5AVBC 2LY8A 3V9RA 3X1TC 1KX4A 5AV9A 3TU4A 3AZKA 5B2IA 1F66C 1R4VA 4H9RB 4J8VB 3AZMC 3B0DB 5AY8B 4HGAB 5B31C 1P3BB 3MVDC 5B1MC 1WWIA 4JJNB 1P3MA 1ID3C 5B24D 3B6FA 5AV8A 2CWEA 4CSRA 3LELB 3AZJD 5B0YD 3X1UD 1U35D 3LZ0C 2AROD 4YM6A 3MGPA 1S32A 3UT9A 5AV5D 3VH6W 5B2JC 3AV2A 1P3GD 3W97C 5AVCA 1M1AC 3C1CB 4LD9A 4XUJA 1ZLAD 5GXQA 1P3KC 3AZIC 1KX3B 1WWSA 3WA9A 3WKJD 3AZFA 3LJAC 3MGQC 1P3AB 5KDMB 2NZDB 1TZYD 5DNMB 3AZLB 5JRGB 1P3LC 5BNVB 3AZHD 5GT3A 5AV6A 5B0ZB 5G49A 4CAYA 3C1BD 3MGRA 3X1TB 3MNNC 2PYOB 4KGCC 4KUDA 1F1EA 4QLCC 5F99A 1KX4D 3VH6T 5B33C 5AV9D 3A6NA 4G92B 1HQ3C 4ZBJC 3TU4D 3AN2C 4Z66B 3LZ1A 3W96A 2YFWB 3KWQC 5CPKA 3AZKD 1P3OA 5B2ID 1M18A 3B6GD 5CPJC 1KU5A 4XZQC 3X1VC 3X1SA 3KXBC 1EQZC 3WAAB 1TAFB 4YS3A 5CPIA 3REJA 4ZUXD 2BYMB 3B0CT 4NFTA 5B1MA 5AV8D 3W98C 4J8XC 3UTAC 2NQBA 3AFAA 5B1LC 1KX5A 4Z2MG 3MGPD 1S32D 2FJ7B 1P34B 5E5AC 3AV2D 4Z5TD 4H9OA 5AVCD 3MGQB 4LD9D 4XUJD 5CP6A 5B32G 5GXQD 3WA9D 3AZFD 3REKD 3W97A 1M1AA 2CV5A 5JA4A 3AZNA 4J8VC 3AZIA 3B0DC 1AOIC 4HGAC 3LJAA 1P3FA 1P3BC 4KGCB 1BH9B 2F8NK 4JJNC 3R45A 4KUDD 3MGSD 3REHD 3RELA 5F99D 1B67A 3A6ND 3AZJB 5B0YB 3LZ1D 5CPKD 3W96D 2AROB 1P3OD 3AYWD 3W99D 3UTBD 1M18D 5AV5B 3C1CC 3AN2A 3X1SD 4J8UD 1KX3C 1ZLAB 1P3AC 4YS3D 4EO5B 3W98B
chains in the Genus database with same CATH superfamily
5DNMC 1N1JA 4XZQA 3O62A 3X1VA 1EQZA 1P3IA 2J8PA 3REJD 2ZY2A 4H9QB 4KHAA 4WU9A 2YFVA 5B0ZC 4WJ3C 2NQBD 3AFAD 1KX5D 4R8PA 5BNXA 3AZGA 3KUYA 4J8XA 2PYOC 5DNNC 3AZEA 4G91C 5CP6D 5BO0A 3V9RB 3EPJA 4G92C 1AOIB 4Z66C 5AV9B 2CV5D 1BFMA 3VH5T 3MGSC 3AZND 3AV1C 3AZKB 4J8WA 5B2IB 1H3OB 1P3FD 3B6GB 3WAAC 4J8VA 5B40D 4DQYB 5AY8A 2HIOC 1P3PA 2JSSA 1P3BA 4NE5A 4NE6A 3RELD 4ZUXB 4JJNA 4X23A 5AV8B 5GT0C 1M19A 2FJ7C 5B32C 3REIA 1P34C 1S32B 3LELA 4WU8A 3AV2B 4Z5TB 5AVCB 4LD9B 2ZY3A 4XUJB 1BH8A 2Y2MA 5GXQB 3WA9B 3AZFB 3O62D 3REKB 1P3ID 4M6BA 3B0CW 3A1IA 4Z2MH 4WU9D 1P3AA 5KDMA 3AZLA 5BS7A 5JRGA 5BNVA 3H0RC 1A7WA 5FUGA 5C3IB 5DNNB 3WTPA 4G91B 4CAYB 2BYKA 4WNNA 4R8PD 5GSUA 3NQJA 3AZGD 3KUYD 3AZED 5B24C 5AVBA 3X1TA 3AV1B 3MGSB 3REHB 3AZJC 5B0YC 5F99B 3NQUA 3X1UC 1U35C 2AROC 3A6NB 3VH6A 4H9NB 3AL0C 3LZ1B 5CPKB 1F66A 4AWLB 2NZDC 2Y2QA 5AV5C 3EPHA 4J8WD 3AYWB 3W99B 3UTBB 3AZMA 1P3GC 1M18B 2HIOB 1P3MD 5B31A 1ZLAC 3B6FD 3MVDA 4J8UB 4EO5C 4H9PA 3WKJC 3KSYA 4YS3B 5CPIB 1TZYC 1P3PD 3A1KA 4YM6D 1ID3A 4DRAA 3AZHC 5GT0B 1TAFA 5B32B 3REJB 3UT9D 2RVQD 4E45A 4X23D 3LZ0A 3WTPE 5B31G 3C1BC 1M19D 2NQBB 1KX5B 3REID 3LELD 4WU8D 5B2JA 5CPID 2FFFB 1P3KA 5GT3D 4H9SC 3IP4C 5CP6B 1P34A 2IO5B 5AV6D 1KX4C 5AV9C 3MGQA 3TU4C 1P3LA 3AZKC 5B2IC 5JA4B 3MGRD 3AZNB 3B6GC 3AZLD 5JRGD 3WTPD 5B24B 5B40B 5GSUD 3MNNA 1T3UA 3X1UB 1U35B 1BH9A 2DQNC 4KGCA 4QLCA 4ZUXC 5AVBD 3X1TD 5CHLB 5AV8C 5B33A 3RELB 1HQ3A 1P3GB 3KWQA 3VH5W 4YM6C 3MGPC 1S32C 1JFIA 1F66D 3UT9C 3WKJB 5CPJA 3AZMD 4Z5TC 5B0YA 5AVCC 3KXBA 3AV2C 1TZYB 5B31D 4XUJC 4LD9C 3AZHB 5GXQC 3MVDD 5B1MD 3WA9C 4UUZB 3AZFC 3REKC 3FDDA 1ID3D 3O62B 3C1BB 1P3IB 3B0BA 4KHAB 2F8NA 4WU9B 3W98A 5C3IC 3UTAA 3LZ0D 5B1LA 4H9QA 4R8PB 5E5AA 1KX4B 5B2JD 3W97D 1M1AD 3KUYB 3TU4B 4KUDC 3AZEB 1P3KD 4E44A 3REHC 3AZID 5F99C 3LJAD 3MGQD 5BO0B 3A6NC 1P3LD 3LZ1C 5CPKC 3W96C 4AWLC 4H9RA 1P3OC 3AYWC 2Y2PA 3W99C 4DRBA 3UTBC 1AOIA 1M18C 4J8WB 1Z2CB 3VH5A 3X1SC 1P3MB 1W2EA 4J8UC 3B6FB 1H3OA 5CPIC 4YS3C 4CSRB 3B6GA 3MNND 4KGCD 1P3PB 4QLCD 3REJC 4YM6B 3MGPB 3UT9B 5B33D 3F6TA 1HQ3D 3AN2D 4X23B 3KWQD 2NQBC 3AFAC 1KX5C 4ZUXA 1M19B 3C1CA 3REIB 5CPJD 4WU8B 4XZQD 3KXBD 3EPKA 3X1VD 1EQZD 4WZSB 1KX3A 5CP6C 2IO5C 5BT1D 5GT3B 2NZDA 1BH8B 5DNMA 5AV6B 3H0MC 4Z5TA 5G49B 1PZRA 2CV5C 3AZNC 5B0ZA 3W98D 3MGRB 2F8ND 2VQRA 4J8XD 3REKA 1P3FC 3UTAD 5B1LD 4KUDB 5FUGB 3WTPB 5B40C 2BYKB 4WNNB 5E5AD 2PYOA 5DNNA 5GSUB 3NQJB 3W96B 1P3OB 3RELC 5AVBB 3KFUG 4Z66A 2YFWA 3H0LC 4WV4B 3NQUB 3X1SB 3AV1A 3MGSA 4J8VD 3REHA 1F66B 1AOID 5AY8D 3WAAA 3AZMB 4H9NA 1P3BD 5B31B 3AYWA 3W99A 3MVDB 3UTBA 4JJND 5B1MB 2HIOA 4H9PB 3O62C 2BYMA 1P3IC 3AFAB 4J8UA 1ID3B 4WU9C 5BT1C 1B6WA 4H9OB 5GT0A 2FJ7A 3LZ0B 5B32A 1Q9CA 4R8PC 3C1CD 3KUYC 3AZGC 3EPLA 2Y2JA 5B2JB 2UWXA 3AZEC 3W97B 2ZM5A 1M1AB 2CV5B 1KX3D 1P3KB 3AZIB 4NE3A 1P3AD 2NZDD 5DNMD 2HUEC 3LJAB 1P3FB 1P3LB 3P5JB 2G5IC 5B0ZD 4J8WC 1P3MC 2W8SA 3B6FC 3R45B 5AY8C 2PYOD 2F8NH 5DNND 1P3PC 3MNNB 5B24A 4QLCB 2ZY4A 5B40A 2RVQC 3AZJA 3X1UA 4X23C 1U35A 5B33B 4Z66D 2AROA 1HQ3B 4ZBJB 3AN2B 1M19C 3KWQB 3AV1D 2ZY5A 5AV5A 3REIC 2BG1A 1JFIB 3LELC 4WU8C 1P3GA 1ULYA 1N1JB 5CPJB 3WAAD 1ZLAA 4XZQB 3KXBB 3X1VB 1EQZB 5GT3C 5AV6C 3WKJA 2YFVB 2HIOD 1TZYA 1HTAA 3AZHA 3MGRC 5BNXB 2JCHA 2Y2NA 4UUZA 2F8NB 3AZGB 3AZLC 5BS7C 5JRGC 4J8XB 3WTPC 5GT0D 3C1BA 3UTAB 2FJ7D 5B32D 5B1LB 1P34D 2F8NG 5GSUC 2L5AA 2F2AC 5E5AB 2HUEB 4H9SA 5AVBC 2LY8A 3V9RA 3X1TC 1KX4A 5AV9A 3TU4A 3AZKA 2XD5A 5B2IA 1F66C 1R4VA 2Y2KA 4H9RB 2RIQA 4J8VB 2G5HC 3AZMC 3B0DB 5AY8B 4HGAB 2DF4C 5B31C 2Y2OA 1P3BB 3MVDC 5B1MC 1WWIA 2JE5A 4JJNB 1P3MA 4UPKA 1ID3C 5B24D 3B6FA 5AV8A 2CWEA 4CSRA 3LELB 3AZJD 5B0YD 3X1UD 1U35D 3LZ0C 2AROD 4YM6A 3MGPA 1S32A 3UT9A 5AV5D 3VH6W 5B2JC 3AV2A 1P3GD 3W97C 5AVCA 1M1AC 3C1CB 4LD9A 4XUJA 1ZLAD 5GXQA 1P3KC 3AZIC 1KX3B 1WWSA 3WA9A 3WKJD 3AZFA 3LJAC 3MGQC 1P3AB 5KDMB 2Y2GA 1TZYD 2Y2IA 5DNMB 2Y2LA 5JRGB 5BNVB 3AZLB 1P3LC 2NZDB 3AZHD 5GT3A 5AV6A 5B0ZB 5G49A 4CAYA 2Y2HA 3C1BD 3MGRA 3X1TB 3MNNC 2PYOB 4KGCC 4KUDA 1F1EA 4QLCC 5F99A 1KX4D 3VH6T 5B33C 5AV9D 3A6NA 4G92B 1HQ3C 4ZBJC 3TU4D 3AN2C 4Z66B 3LZ1A 3W96A 2YFWB 3KWQC 5CPKA 3AZKD 1P3OA 5B2ID 1M18A 3B6GD 5CPJC 1KU5A 4XZQC 3X1VC 3X1SA 3KXBC 1EQZC 3WAAB 1TAFB 4YS3A 5CPIA 3REJA 4ZUXD 2BYMB 3B0CT 4NFTA 5B1MA 5AV8D 3W98C 4J8XC 3UTAC 2NQBA 3AFAA 5B1LC 1KX5A 4Z2MG 3MGPD 1S32D 2FJ7B 1P34B 5E5AC 3AV2D 4Z5TD 4H9OA 5AVCD 3MGQB 4LD9D 4XUJD 5CP6A 5B32G 5GXQD 3WA9D 3AZFD 3REKD 3W97A 1M1AA 2CV5A 5JA4A 3AZNA 4J8VC 3AZIA 3B0DC 1AOIC 4HGAC 3LJAA 1P3FA 1P3BC 4KGCB 1BH9B 2F8NK 4JJNC 2XD1A 3R45A 4KUDD 3MGSD 3REHD 3RELA 5F99D 1B67A 3A6ND 3AZJB 5B0YB 3LZ1D 5CPKD 3W96D 2AROB 1P3OD 3AYWD 3W99D 3UTBD 1M18D 5AV5B 3C1CC 3AN2A 3X1SD 4J8UD 1KX3C 1ZLAB 3EG5B 1P3AC 4YS3D 4EO5B 3W98B
chains in the Genus database with same CATH topology
5DNMC 1N1JA 4XZQA 3O62A 3X1VA 1EQZA 1P3IA 2J8PA 3REJD 2ZY2A 4H9QB 4KHAA 4WU9A 2YFVA 5B0ZC 4WJ3C 2NQBD 3AFAD 1KX5D 4R8PA 5BNXA 3AZGA 3KUYA 4J8XA 2PYOC 5DNNC 3AZEA 4G91C 5CP6D 5BO0A 3V9RB 3EPJA 4G92C 1AOIB 4Z66C 5AV9B 2CV5D 1BFMA 3VH5T 3MGSC 3AZND 3AV1C 3AZKB 4J8WA 5B2IB 1H3OB 1P3FD 3B6GB 3WAAC 4J8VA 5B40D 4DQYB 5AY8A 2HIOC 1P3PA 2JSSA 1P3BA 4NE5A 4NE6A 3RELD 4ZUXB 4JJNA 4X23A 5AV8B 5GT0C 1M19A 2FJ7C 5B32C 3REIA 1P34C 1S32B 3LELA 4WU8A 3AV2B 4Z5TB 5AVCB 4LD9B 2ZY3A 4XUJB 1BH8A 2Y2MA 5GXQB 3WA9B 3AZFB 3O62D 3REKB 1P3ID 4M6BA 3B0CW 3A1IA 4Z2MH 4WU9D 1P3AA 5KDMA 3AZLA 5BS7A 5JRGA 5BNVA 3H0RC 1A7WA 5FUGA 5C3IB 5DNNB 3WTPA 4G91B 4CAYB 2BYKA 4WNNA 4R8PD 5GSUA 3NQJA 3AZGD 3KUYD 3AZED 5B24C 5AVBA 3X1TA 3AV1B 3MGSB 3REHB 3AZJC 5B0YC 5F99B 3NQUA 3X1UC 1U35C 2AROC 3A6NB 3VH6A 4H9NB 3AL0C 3LZ1B 5CPKB 1F66A 4AWLB 2NZDC 2Y2QA 5AV5C 3EPHA 4J8WD 3AYWB 3W99B 3UTBB 3AZMA 1P3GC 1M18B 2HIOB 1P3MD 5B31A 1ZLAC 3B6FD 3MVDA 4J8UB 4EO5C 4H9PA 3WKJC 3KSYA 4YS3B 5CPIB 1TZYC 1P3PD 3A1KA 4YM6D 1ID3A 4DRAA 3AZHC 5GT0B 1TAFA 5B32B 3REJB 3UT9D 2RVQD 4E45A 4X23D 3LZ0A 3WTPE 5B31G 3C1BC 1M19D 2NQBB 1KX5B 3REID 3LELD 4WU8D 5B2JA 5CPID 2FFFB 1P3KA 5GT3D 4H9SC 3IP4C 5CP6B 1P34A 2IO5B 5AV6D 1KX4C 5AV9C 3MGQA 3TU4C 1P3LA 3AZKC 5B2IC 5JA4B 3MGRD 3AZNB 3B6GC 3AZLD 5JRGD 3WTPD 5B24B 5B40B 5GSUD 3MNNA 1T3UA 3X1UB 1U35B 1BH9A 2DQNC 4KGCA 4QLCA 4ZUXC 5AVBD 3X1TD 5CHLB 5AV8C 5B33A 3RELB 1HQ3A 1P3GB 3KWQA 3VH5W 4YM6C 3MGPC 1S32C 1JFIA 1F66D 3UT9C 3WKJB 5CPJA 3AZMD 4Z5TC 5B0YA 5AVCC 3KXBA 3AV2C 1TZYB 5B31D 4XUJC 4LD9C 3AZHB 5GXQC 3MVDD 5B1MD 3WA9C 4UUZB 3AZFC 3REKC 3FDDA 1ID3D 3O62B 3C1BB 1P3IB 3B0BA 4KHAB 2F8NA 4WU9B 3W98A 5C3IC 3UTAA 3LZ0D 5B1LA 4H9QA 4R8PB 5E5AA 1KX4B 5B2JD 3W97D 1M1AD 3KUYB 3TU4B 4KUDC 3AZEB 1P3KD 4E44A 3REHC 3AZID 5F99C 3LJAD 3MGQD 5BO0B 3A6NC 1P3LD 3LZ1C 5CPKC 3W96C 4AWLC 4H9RA 1P3OC 3AYWC 2Y2PA 3W99C 4DRBA 3UTBC 1AOIA 1M18C 4J8WB 1Z2CB 3VH5A 3X1SC 1P3MB 1W2EA 4J8UC 3B6FB 1H3OA 5CPIC 4YS3C 4CSRB 3B6GA 3MNND 4KGCD 1P3PB 4QLCD 3REJC 4YM6B 3MGPB 3UT9B 5B33D 3F6TA 1HQ3D 3AN2D 4X23B 3KWQD 2NQBC 3AFAC 1KX5C 4ZUXA 1M19B 3C1CA 3REIB 5CPJD 4WU8B 4XZQD 3KXBD 3EPKA 3X1VD 1EQZD 4WZSB 1KX3A 5CP6C 2IO5C 5BT1D 5GT3B 2NZDA 1BH8B 5DNMA 5AV6B 3H0MC 4Z5TA 5G49B 1PZRA 2CV5C 3AZNC 5B0ZA 3W98D 3MGRB 2F8ND 2VQRA 4J8XD 3REKA 1P3FC 3UTAD 5B1LD 4KUDB 5FUGB 3WTPB 5B40C 2BYKB 4WNNB 5E5AD 2PYOA 5DNNA 5GSUB 3NQJB 3W96B 1P3OB 3RELC 5AVBB 3KFUG 4Z66A 2YFWA 3H0LC 4WV4B 3NQUB 3X1SB 3AV1A 3MGSA 4J8VD 3REHA 1F66B 1AOID 5AY8D 3WAAA 3AZMB 4H9NA 1P3BD 5B31B 3AYWA 3W99A 3MVDB 3UTBA 4JJND 5B1MB 2HIOA 4H9PB 3O62C 2BYMA 1P3IC 3AFAB 4J8UA 1ID3B 4WU9C 5BT1C 1B6WA 4H9OB 5GT0A 2FJ7A 3LZ0B 5B32A 1Q9CA 4R8PC 3C1CD 3KUYC 3AZGC 3EPLA 2Y2JA 5B2JB 2UWXA 3AZEC 3W97B 2ZM5A 1M1AB 2CV5B 1KX3D 1P3KB 3AZIB 4NE3A 1P3AD 2NZDD 5DNMD 2HUEC 3LJAB 1P3FB 1P3LB 3P5JB 2G5IC 5B0ZD 4J8WC 1P3MC 2W8SA 3B6FC 3R45B 5AY8C 2PYOD 2F8NH 5DNND 1P3PC 3MNNB 5B24A 4QLCB 2ZY4A 5B40A 2RVQC 3AZJA 3X1UA 4X23C 1U35A 5B33B 4Z66D 2AROA 1HQ3B 4ZBJB 3AN2B 1M19C 3KWQB 3AV1D 2ZY5A 5AV5A 3REIC 2BG1A 1JFIB 3LELC 4WU8C 1P3GA 1ULYA 1N1JB 5CPJB 3WAAD 1ZLAA 4XZQB 3KXBB 3X1VB 1EQZB 5GT3C 5AV6C 3WKJA 2YFVB 2HIOD 1TZYA 1HTAA 3AZHA 3MGRC 5BNXB 2JCHA 2Y2NA 4UUZA 2F8NB 3AZGB 3AZLC 5BS7C 5JRGC 4J8XB 3WTPC 5GT0D 3C1BA 3UTAB 2FJ7D 5B32D 5B1LB 1P34D 2F8NG 5GSUC 2L5AA 2F2AC 5E5AB 2HUEB 4H9SA 5AVBC 2LY8A 3V9RA 3X1TC 1KX4A 5AV9A 3TU4A 3AZKA 2XD5A 5B2IA 1F66C 1R4VA 2Y2KA 4H9RB 2RIQA 4J8VB 2G5HC 3AZMC 3B0DB 5AY8B 4HGAB 2DF4C 5B31C 2Y2OA 1P3BB 3MVDC 5B1MC 1WWIA 2JE5A 4JJNB 1P3MA 4UPKA 1ID3C 5B24D 3B6FA 5AV8A 2CWEA 4CSRA 3LELB 3AZJD 5B0YD 3X1UD 1U35D 3LZ0C 2AROD 4YM6A 3MGPA 1S32A 3UT9A 5AV5D 3VH6W 5B2JC 3AV2A 1P3GD 3W97C 5AVCA 1M1AC 3C1CB 4LD9A 4XUJA 1ZLAD 5GXQA 1P3KC 3AZIC 1KX3B 1WWSA 3WA9A 3WKJD 3AZFA 3LJAC 3MGQC 1P3AB 5KDMB 2Y2GA 1TZYD 2Y2IA 5DNMB 2Y2LA 5JRGB 5BNVB 3AZLB 1P3LC 2NZDB 3AZHD 5GT3A 5AV6A 5B0ZB 5G49A 4CAYA 2Y2HA 3C1BD 3MGRA 3X1TB 3MNNC 2PYOB 4KGCC 4KUDA 1F1EA 4QLCC 5F99A 1KX4D 3VH6T 5B33C 5AV9D 3A6NA 4G92B 1HQ3C 4ZBJC 3TU4D 3AN2C 4Z66B 3LZ1A 3W96A 2YFWB 3KWQC 5CPKA 3AZKD 1P3OA 5B2ID 1M18A 3B6GD 5CPJC 1KU5A 4XZQC 3X1VC 3X1SA 3KXBC 1EQZC 3WAAB 1TAFB 4YS3A 5CPIA 3REJA 4ZUXD 2BYMB 3B0CT 4NFTA 5B1MA 5AV8D 3W98C 4J8XC 3UTAC 2NQBA 3AFAA 5B1LC 1KX5A 4Z2MG 3MGPD 1S32D 2FJ7B 1P34B 5E5AC 3AV2D 4Z5TD 4H9OA 5AVCD 3MGQB 4LD9D 4XUJD 5CP6A 5B32G 5GXQD 3WA9D 3AZFD 3REKD 3W97A 1M1AA 2CV5A 5JA4A 3AZNA 4J8VC 3AZIA 3B0DC 1AOIC 4HGAC 3LJAA 1P3FA 1P3BC 4KGCB 1BH9B 2F8NK 4JJNC 2XD1A 3R45A 4KUDD 3MGSD 3REHD 3RELA 5F99D 1B67A 3A6ND 3AZJB 5B0YB 3LZ1D 5CPKD 3W96D 2AROB 1P3OD 3AYWD 3W99D 3UTBD 1M18D 5AV5B 3C1CC 3AN2A 3X1SD 4J8UD 1KX3C 1ZLAB 3EG5B 1P3AC 4YS3D 4EO5B 3W98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM C;  1N1J A;  4XZQ A;  3O62 A;  3X1V A;  1EQZ A;  1P3I A;  3REJ D;  4H9Q B;  4KHA A;  4WU9 A;  2YFV A;  5B0Z C;  2NQB D;  3AFA D;  1KX5 D;  4R8P A;  5BNX A;  3AZG A;  3KUY A;  4J8X A;  2PYO C;  5DNN C;  3AZE A;  4G91 C;  5CP6 D;  5BO0 A;  3V9R B;  4G92 C;  1AOI B;  4Z66 C;  5AV9 B;  2CV5 D;  1BFM A;  3VH5 T;  3MGS C;  3AZN D;  3AV1 C;  3AZK B;  4J8W A;  5B2I B;  1H3O B;  1P3F D;  3B6G B;  3WAA C;  4J8V A;  5B40 D;  5AY8 A;  2HIO C;  1P3P A;  2JSS A;  1P3B A;  4NE5 A;  4NE6 A;  3REL D;  4ZUX B;  4JJN A;  4X23 A;  5AV8 B;  5GT0 C;  1M19 A;  2FJ7 C;  5B32 C;  3REI A;  1P34 C;  1S32 B;  3LEL A;  4WU8 A;  3AV2 B;  4Z5T B;  5AVC B;  4LD9 B;  4XUJ B;  1BH8 A;  5GXQ B;  3WA9 B;  3AZF B;  3O62 D;  3REK B;  1P3I D;  4M6B A;  3B0C W;  4Z2M H;  4WU9 D;  1P3A A;  5KDM A;  3AZL A;  5JRG A;  5BS7 A;  5BNV A;  1A7W A;  5FUG A;  5C3I B;  5DNN B;  3WTP A;  4G91 B;  4CAY B;  2BYK A;  4WNN A;  4R8P D;  5GSU A;  3NQJ A;  3AZG D;  3KUY D;  3AZE D;  5B24 C;  5AVB A;  3X1T A;  3AV1 B;  3MGS B;  3REH B;  3AZJ C;  5B0Y C;  5F99 B;  3NQU A;  3X1U C;  1U35 C;  2ARO C;  3A6N B;  3VH6 A;  4H9N B;  3LZ1 B;  5CPK B;  1F66 A;  4AWL B;  2NZD C;  5AV5 C;  4J8W D;  3AYW B;  3W99 B;  3UTB B;  3AZM A;  1P3G C;  1M18 B;  2HIO B;  1P3M D;  5B31 A;  1ZLA C;  3B6F D;  3MVD A;  4J8U B;  4EO5 C;  4H9P A;  3WKJ C;  3KSY A;  4YS3 B;  5CPI B;  1TZY C;  1P3P D;  4YM6 D;  1ID3 A;  4DRA A;  3AZH C;  5GT0 B;  1TAF A;  5B32 B;  3REJ B;  3UT9 D;  2RVQ D;  4E45 A;  4X23 D;  3LZ0 A;  3WTP E;  5B31 G;  3C1B C;  1M19 D;  2NQB B;  1KX5 B;  3REI D;  3LEL D;  4WU8 D;  5B2J A;  5CPI D;  1P3K A;  5GT3 D;  4H9S C;  5CP6 B;  1P34 A;  2IO5 B;  5AV6 D;  1KX4 C;  5AV9 C;  3MGQ A;  3TU4 C;  1P3L A;  3AZK C;  5B2I C;  5JA4 B;  3MGR D;  3AZN B;  3B6G C;  3AZL D;  5JRG D;  3WTP D;  5B24 B;  5B40 B;  5GSU D;  3MNN A;  3X1U B;  1U35 B;  1BH9 A;  4KGC A;  4QLC A;  4ZUX C;  5AVB D;  3X1T D;  5CHL B;  5AV8 C;  5B33 A;  3REL B;  1HQ3 A;  1P3G B;  3KWQ A;  3VH5 W;  4YM6 C;  3MGP C;  1S32 C;  1JFI A;  1F66 D;  3UT9 C;  3WKJ B;  5CPJ A;  3AZM D;  4Z5T C;  5B0Y A;  5AVC C;  3KXB A;  3AV2 C;  1TZY B;  5B31 D;  4XUJ C;  4LD9 C;  3AZH B;  5GXQ C;  3MVD D;  5B1M D;  3WA9 C;  4UUZ B;  3AZF C;  3REK C;  1ID3 D;  3O62 B;  3C1B B;  1P3I B;  3B0B A;  4KHA B;  2F8N A;  4WU9 B;  3W98 A;  5C3I C;  3UTA A;  3LZ0 D;  5B1L A;  4H9Q A;  4R8P B;  5E5A A;  1KX4 B;  5B2J D;  3W97 D;  1M1A D;  3KUY B;  3TU4 B;  4KUD C;  3AZE B;  1P3K D;  4E44 A;  3REH C;  3AZI D;  5F99 C;  3LJA D;  3MGQ D;  5BO0 B;  3A6N C;  1P3L D;  3LZ1 C;  5CPK C;  3W96 C;  4AWL C;  4H9R A;  1P3O C;  3AYW C;  3W99 C;  4DRB A;  3UTB C;  1AOI A;  1M18 C;  4J8W B;  3VH5 A;  3X1S C;  1P3M B;  4J8U C;  3B6F B;  1H3O A;  5CPI C;  4YS3 C;  4CSR B;  3B6G A;  3MNN D;  4KGC D;  1P3P B;  4QLC D;  3REJ C;  4YM6 B;  3MGP B;  3UT9 B;  5B33 D;  1HQ3 D;  3AN2 D;  4X23 B;  3KWQ D;  2NQB C;  3AFA C;  1KX5 C;  4ZUX A;  1M19 B;  3C1C A;  3REI B;  5CPJ D;  4WU8 B;  4XZQ D;  3KXB D;  3X1V D;  1EQZ D;  4WZS B;  1KX3 A;  5CP6 C;  2IO5 C;  5BT1 D;  5GT3 B;  2NZD A;  1BH8 B;  5DNM A;  5AV6 B;  4Z5T A;  5G49 B;  2CV5 C;  3AZN C;  5B0Z A;  3W98 D;  3MGR B;  2F8N D;  4J8X D;  3REK A;  1P3F C;  3UTA D;  5B1L D;  4KUD B;  5FUG B;  3WTP B;  5B40 C;  2BYK B;  4WNN B;  5E5A D;  2PYO A;  5DNN A;  5GSU B;  3NQJ B;  3W96 B;  1P3O B;  3REL C;  5AVB B;  4Z66 A;  2YFW A;  4WV4 B;  3NQU B;  3X1S B;  3AV1 A;  3MGS A;  4J8V D;  3REH A;  1F66 B;  1AOI D;  5AY8 D;  3WAA A;  3AZM B;  4H9N A;  1P3B D;  5B31 B;  3AYW A;  3W99 A;  3MVD B;  3UTB A;  4JJN D;  5B1M B;  2HIO A;  4H9P B;  3O62 C;  2BYM A;  1P3I C;  3AFA B;  4J8U A;  1ID3 B;  4WU9 C;  5BT1 C;  1B6W A;  4H9O B;  5GT0 A;  2FJ7 A;  3LZ0 B;  5B32 A;  1Q9C A;  4R8P C;  3C1C D;  3KUY C;  3AZG C;  5B2J B;  3AZE C;  3W97 B;  1M1A B;  2CV5 B;  1KX3 D;  1P3K B;  3AZI B;  4NE3 A;  1P3A D;  2NZD D;  5DNM D;  2HUE C;  3LJA B;  1P3F B;  1P3L B;  5B0Z D;  4J8W C;  1P3M C;  3B6F C;  3R45 B;  5AY8 C;  2PYO D;  2F8N H;  5DNN D;  1P3P C;  3MNN B;  5B24 A;  4QLC B;  5B40 A;  2RVQ C;  3AZJ A;  3X1U A;  4X23 C;  1U35 A;  4Z66 D;  5B33 B;  2ARO A;  1HQ3 B;  4ZBJ B;  3AN2 B;  1M19 C;  3KWQ B;  3AV1 D;  5AV5 A;  3REI C;  1JFI B;  3LEL C;  4WU8 C;  1P3G A;  1ULY A;  1N1J B;  5CPJ B;  3WAA D;  1ZLA A;  4XZQ B;  3KXB B;  3X1V B;  1EQZ B;  5GT3 C;  5AV6 C;  3WKJ A;  2YFV B;  2HIO D;  1TZY A;  1HTA A;  3AZH A;  3MGR C;  5BNX B;  4UUZ A;  2F8N B;  3AZG B;  3AZL C;  5BS7 C;  5JRG C;  4J8X B;  3WTP C;  5GT0 D;  3C1B A;  3UTA B;  2FJ7 D;  5B32 D;  5B1L B;  1P34 D;  2F8N G;  5GSU C;  2L5A A;  5E5A B;  2HUE B;  4H9S A;  5AVB C;  2LY8 A;  3V9R A;  3X1T C;  1KX4 A;  5AV9 A;  3TU4 A;  3AZK A;  5B2I A;  1F66 C;  1R4V A;  4H9R B;  4J8V B;  3AZM C;  3B0D B;  5AY8 B;  4HGA B;  5B31 C;  1P3B B;  3MVD C;  5B1M C;  1WWI A;  4JJN B;  1P3M A;  1ID3 C;  5B24 D;  3B6F A;  5AV8 A;  2CWE A;  4CSR A;  3LEL B;  3AZJ D;  5B0Y D;  3X1U D;  1U35 D;  3LZ0 C;  2ARO D;  4YM6 A;  3MGP A;  1S32 A;  3UT9 A;  5AV5 D;  3VH6 W;  5B2J C;  3AV2 A;  1P3G D;  3W97 C;  5AVC A;  1M1A C;  3C1C B;  4LD9 A;  4XUJ A;  1ZLA D;  5GXQ A;  1P3K C;  3AZI C;  1KX3 B;  1WWS A;  3WA9 A;  3WKJ D;  3AZF A;  3LJA C;  3MGQ C;  1P3A B;  5KDM B;  2NZD B;  1TZY D;  5DNM B;  3AZL B;  5JRG B;  1P3L C;  5BNV B;  3AZH D;  5GT3 A;  5AV6 A;  5B0Z B;  5G49 A;  4CAY A;  3C1B D;  3MGR A;  3X1T B;  3MNN C;  2PYO B;  4KGC C;  4KUD A;  1F1E A;  4QLC C;  5F99 A;  1KX4 D;  3VH6 T;  5B33 C;  5AV9 D;  3A6N A;  4G92 B;  1HQ3 C;  4ZBJ C;  3TU4 D;  3AN2 C;  4Z66 B;  3LZ1 A;  3W96 A;  2YFW B;  3KWQ C;  5CPK A;  3AZK D;  1P3O A;  5B2I D;  1M18 A;  3B6G D;  5CPJ C;  1KU5 A;  4XZQ C;  3X1V C;  3X1S A;  3KXB C;  1EQZ C;  3WAA B;  1TAF B;  4YS3 A;  5CPI A;  3REJ A;  4ZUX D;  2BYM B;  3B0C T;  4NFT A;  5B1M A;  5AV8 D;  3W98 C;  4J8X C;  3UTA C;  2NQB A;  3AFA A;  5B1L C;  1KX5 A;  4Z2M G;  3MGP D;  1S32 D;  2FJ7 B;  1P34 B;  5E5A C;  3AV2 D;  4Z5T D;  4H9O A;  5AVC D;  3MGQ B;  4LD9 D;  4XUJ D;  5CP6 A;  5B32 G;  5GXQ D;  3WA9 D;  3AZF D;  3REK D;  3W97 A;  1M1A A;  2CV5 A;  5JA4 A;  3AZN A;  4J8V C;  3AZI A;  3B0D C;  1AOI C;  4HGA C;  3LJA A;  1P3F A;  1P3B C;  4KGC B;  1BH9 B;  2F8N K;  4JJN C;  3R45 A;  4KUD D;  3MGS D;  3REH D;  3REL A;  5F99 D;  1B67 A;  3A6N D;  3AZJ B;  5B0Y B;  3LZ1 D;  5CPK D;  3W96 D;  2ARO B;  1P3O D;  3AYW D;  3W99 D;  3UTB D;  1M18 D;  5AV5 B;  3C1C C;  3AN2 A;  3X1S D;  4J8U D;  1KX3 C;  1ZLA B;  1P3A C;  4YS3 D;  4EO5 B;  3W98 B; 
#chains in the Genus database with same CATH topology
 5DNM C;  1N1J A;  4XZQ A;  3O62 A;  3X1V A;  1EQZ A;  1P3I A;  2J8P A;  3REJ D;  2ZY2 A;  4H9Q B;  4KHA A;  4WU9 A;  2YFV A;  5B0Z C;  4WJ3 C;  2NQB D;  3AFA D;  1KX5 D;  4R8P A;  5BNX A;  3AZG A;  3KUY A;  4J8X A;  2PYO C;  5DNN C;  3AZE A;  4G91 C;  5CP6 D;  5BO0 A;  3V9R B;  3EPJ A;  4G92 C;  1AOI B;  4Z66 C;  5AV9 B;  2CV5 D;  1BFM A;  3VH5 T;  3MGS C;  3AZN D;  3AV1 C;  3AZK B;  4J8W A;  5B2I B;  1H3O B;  1P3F D;  3B6G B;  3WAA C;  4J8V A;  5B40 D;  4DQY B;  5AY8 A;  2HIO C;  1P3P A;  2JSS A;  1P3B A;  4NE5 A;  4NE6 A;  3REL D;  4ZUX B;  4JJN A;  4X23 A;  5AV8 B;  5GT0 C;  1M19 A;  2FJ7 C;  5B32 C;  3REI A;  1P34 C;  1S32 B;  3LEL A;  4WU8 A;  3AV2 B;  4Z5T B;  5AVC B;  4LD9 B;  2ZY3 A;  4XUJ B;  1BH8 A;  2Y2M A;  5GXQ B;  3WA9 B;  3AZF B;  3O62 D;  3REK B;  1P3I D;  4M6B A;  3B0C W;  3A1I A;  4Z2M H;  4WU9 D;  1P3A A;  5KDM A;  3AZL A;  5BS7 A;  5JRG A;  5BNV A;  3H0R C;  1A7W A;  5FUG A;  5C3I B;  5DNN B;  3WTP A;  4G91 B;  4CAY B;  2BYK A;  4WNN A;  4R8P D;  5GSU A;  3NQJ A;  3AZG D;  3KUY D;  3AZE D;  5B24 C;  5AVB A;  3X1T A;  3AV1 B;  3MGS B;  3REH B;  3AZJ C;  5B0Y C;  5F99 B;  3NQU A;  3X1U C;  1U35 C;  2ARO C;  3A6N B;  3VH6 A;  4H9N B;  3AL0 C;  3LZ1 B;  5CPK B;  1F66 A;  4AWL B;  2NZD C;  2Y2Q A;  5AV5 C;  3EPH A;  4J8W D;  3AYW B;  3W99 B;  3UTB B;  3AZM A;  1P3G C;  1M18 B;  2HIO B;  1P3M D;  5B31 A;  1ZLA C;  3B6F D;  3MVD A;  4J8U B;  4EO5 C;  4H9P A;  3WKJ C;  3KSY A;  4YS3 B;  5CPI B;  1TZY C;  1P3P D;  3A1K A;  4YM6 D;  1ID3 A;  4DRA A;  3AZH C;  5GT0 B;  1TAF A;  5B32 B;  3REJ B;  3UT9 D;  2RVQ D;  4E45 A;  4X23 D;  3LZ0 A;  3WTP E;  5B31 G;  3C1B C;  1M19 D;  2NQB B;  1KX5 B;  3REI D;  3LEL D;  4WU8 D;  5B2J A;  5CPI D;  2FFF B;  1P3K A;  5GT3 D;  4H9S C;  3IP4 C;  5CP6 B;  1P34 A;  2IO5 B;  5AV6 D;  1KX4 C;  5AV9 C;  3MGQ A;  3TU4 C;  1P3L A;  3AZK C;  5B2I C;  5JA4 B;  3MGR D;  3AZN B;  3B6G C;  3AZL D;  5JRG D;  3WTP D;  5B24 B;  5B40 B;  5GSU D;  3MNN A;  1T3U A;  3X1U B;  1U35 B;  1BH9 A;  2DQN C;  4KGC A;  4QLC A;  4ZUX C;  5AVB D;  3X1T D;  5CHL B;  5AV8 C;  5B33 A;  3REL B;  1HQ3 A;  1P3G B;  3KWQ A;  3VH5 W;  4YM6 C;  3MGP C;  1S32 C;  1JFI A;  1F66 D;  3UT9 C;  3WKJ B;  5CPJ A;  3AZM D;  4Z5T C;  5B0Y A;  5AVC C;  3KXB A;  3AV2 C;  1TZY B;  5B31 D;  4XUJ C;  4LD9 C;  3AZH B;  5GXQ C;  3MVD D;  5B1M D;  3WA9 C;  4UUZ B;  3AZF C;  3REK C;  3FDD A;  1ID3 D;  3O62 B;  3C1B B;  1P3I B;  3B0B A;  4KHA B;  2F8N A;  4WU9 B;  3W98 A;  5C3I C;  3UTA A;  3LZ0 D;  5B1L A;  4H9Q A;  4R8P B;  5E5A A;  1KX4 B;  5B2J D;  3W97 D;  1M1A D;  3KUY B;  3TU4 B;  4KUD C;  3AZE B;  1P3K D;  4E44 A;  3REH C;  3AZI D;  5F99 C;  3LJA D;  3MGQ D;  5BO0 B;  3A6N C;  1P3L D;  3LZ1 C;  5CPK C;  3W96 C;  4AWL C;  4H9R A;  1P3O C;  3AYW C;  2Y2P A;  3W99 C;  4DRB A;  3UTB C;  1AOI A;  1M18 C;  4J8W B;  1Z2C B;  3VH5 A;  3X1S C;  1P3M B;  1W2E A;  4J8U C;  3B6F B;  1H3O A;  5CPI C;  4YS3 C;  4CSR B;  3B6G A;  3MNN D;  4KGC D;  1P3P B;  4QLC D;  3REJ C;  4YM6 B;  3MGP B;  3UT9 B;  5B33 D;  3F6T A;  1HQ3 D;  3AN2 D;  4X23 B;  3KWQ D;  2NQB C;  3AFA C;  1KX5 C;  4ZUX A;  1M19 B;  3C1C A;  3REI B;  5CPJ D;  4WU8 B;  4XZQ D;  3KXB D;  3EPK A;  3X1V D;  1EQZ D;  4WZS B;  1KX3 A;  5CP6 C;  2IO5 C;  5BT1 D;  5GT3 B;  2NZD A;  1BH8 B;  5DNM A;  5AV6 B;  3H0M C;  4Z5T A;  5G49 B;  1PZR A;  2CV5 C;  3AZN C;  5B0Z A;  3W98 D;  3MGR B;  2F8N D;  2VQR A;  4J8X D;  3REK A;  1P3F C;  3UTA D;  5B1L D;  4KUD B;  5FUG B;  3WTP B;  5B40 C;  2BYK B;  4WNN B;  5E5A D;  2PYO A;  5DNN A;  5GSU B;  3NQJ B;  3W96 B;  1P3O B;  3REL C;  5AVB B;  3KFU G;  4Z66 A;  2YFW A;  3H0L C;  4WV4 B;  3NQU B;  3X1S B;  3AV1 A;  3MGS A;  4J8V D;  3REH A;  1F66 B;  1AOI D;  5AY8 D;  3WAA A;  3AZM B;  4H9N A;  1P3B D;  5B31 B;  3AYW A;  3W99 A;  3MVD B;  3UTB A;  4JJN D;  5B1M B;  2HIO A;  4H9P B;  3O62 C;  2BYM A;  1P3I C;  3AFA B;  4J8U A;  1ID3 B;  4WU9 C;  5BT1 C;  1B6W A;  4H9O B;  5GT0 A;  2FJ7 A;  3LZ0 B;  5B32 A;  1Q9C A;  4R8P C;  3C1C D;  3KUY C;  3AZG C;  3EPL A;  2Y2J A;  5B2J B;  2UWX A;  3AZE C;  3W97 B;  2ZM5 A;  1M1A B;  2CV5 B;  1KX3 D;  1P3K B;  3AZI B;  4NE3 A;  1P3A D;  2NZD D;  5DNM D;  2HUE C;  3LJA B;  1P3F B;  1P3L B;  3P5J B;  2G5I C;  5B0Z D;  4J8W C;  1P3M C;  2W8S A;  3B6F C;  3R45 B;  5AY8 C;  2PYO D;  2F8N H;  5DNN D;  1P3P C;  3MNN B;  5B24 A;  4QLC B;  2ZY4 A;  5B40 A;  2RVQ C;  3AZJ A;  3X1U A;  4X23 C;  1U35 A;  5B33 B;  4Z66 D;  2ARO A;  1HQ3 B;  4ZBJ B;  3AN2 B;  1M19 C;  3KWQ B;  3AV1 D;  2ZY5 A;  5AV5 A;  3REI C;  2BG1 A;  1JFI B;  3LEL C;  4WU8 C;  1P3G A;  1ULY A;  1N1J B;  5CPJ B;  3WAA D;  1ZLA A;  4XZQ B;  3KXB B;  3X1V B;  1EQZ B;  5GT3 C;  5AV6 C;  3WKJ A;  2YFV B;  2HIO D;  1TZY A;  1HTA A;  3AZH A;  3MGR C;  5BNX B;  2JCH A;  2Y2N A;  4UUZ A;  2F8N B;  3AZG B;  3AZL C;  5BS7 C;  5JRG C;  4J8X B;  3WTP C;  5GT0 D;  3C1B A;  3UTA B;  2FJ7 D;  5B32 D;  5B1L B;  1P34 D;  2F8N G;  5GSU C;  2L5A A;  2F2A C;  5E5A B;  2HUE B;  4H9S A;  5AVB C;  2LY8 A;  3V9R A;  3X1T C;  1KX4 A;  5AV9 A;  3TU4 A;  3AZK A;  2XD5 A;  5B2I A;  1F66 C;  1R4V A;  2Y2K A;  4H9R B;  2RIQ A;  4J8V B;  2G5H C;  3AZM C;  3B0D B;  5AY8 B;  4HGA B;  2DF4 C;  5B31 C;  2Y2O A;  1P3B B;  3MVD C;  5B1M C;  1WWI A;  2JE5 A;  4JJN B;  1P3M A;  4UPK A;  1ID3 C;  5B24 D;  3B6F A;  5AV8 A;  2CWE A;  4CSR A;  3LEL B;  3AZJ D;  5B0Y D;  3X1U D;  1U35 D;  3LZ0 C;  2ARO D;  4YM6 A;  3MGP A;  1S32 A;  3UT9 A;  5AV5 D;  3VH6 W;  5B2J C;  3AV2 A;  1P3G D;  3W97 C;  5AVC A;  1M1A C;  3C1C B;  4LD9 A;  4XUJ A;  1ZLA D;  5GXQ A;  1P3K C;  3AZI C;  1KX3 B;  1WWS A;  3WA9 A;  3WKJ D;  3AZF A;  3LJA C;  3MGQ C;  1P3A B;  5KDM B;  2Y2G A;  1TZY D;  2Y2I A;  5DNM B;  2Y2L A;  5JRG B;  5BNV B;  3AZL B;  1P3L C;  2NZD B;  3AZH D;  5GT3 A;  5AV6 A;  5B0Z B;  5G49 A;  4CAY A;  2Y2H A;  3C1B D;  3MGR A;  3X1T B;  3MNN C;  2PYO B;  4KGC C;  4KUD A;  1F1E A;  4QLC C;  5F99 A;  1KX4 D;  3VH6 T;  5B33 C;  5AV9 D;  3A6N A;  4G92 B;  1HQ3 C;  4ZBJ C;  3TU4 D;  3AN2 C;  4Z66 B;  3LZ1 A;  3W96 A;  2YFW B;  3KWQ C;  5CPK A;  3AZK D;  1P3O A;  5B2I D;  1M18 A;  3B6G D;  5CPJ C;  1KU5 A;  4XZQ C;  3X1V C;  3X1S A;  3KXB C;  1EQZ C;  3WAA B;  1TAF B;  4YS3 A;  5CPI A;  3REJ A;  4ZUX D;  2BYM B;  3B0C T;  4NFT A;  5B1M A;  5AV8 D;  3W98 C;  4J8X C;  3UTA C;  2NQB A;  3AFA A;  5B1L C;  1KX5 A;  4Z2M G;  3MGP D;  1S32 D;  2FJ7 B;  1P34 B;  5E5A C;  3AV2 D;  4Z5T D;  4H9O A;  5AVC D;  3MGQ B;  4LD9 D;  4XUJ D;  5CP6 A;  5B32 G;  5GXQ D;  3WA9 D;  3AZF D;  3REK D;  3W97 A;  1M1A A;  2CV5 A;  5JA4 A;  3AZN A;  4J8V C;  3AZI A;  3B0D C;  1AOI C;  4HGA C;  3LJA A;  1P3F A;  1P3B C;  4KGC B;  1BH9 B;  2F8N K;  4JJN C;  2XD1 A;  3R45 A;  4KUD D;  3MGS D;  3REH D;  3REL A;  5F99 D;  1B67 A;  3A6N D;  3AZJ B;  5B0Y B;  3LZ1 D;  5CPK D;  3W96 D;  2ARO B;  1P3O D;  3AYW D;  3W99 D;  3UTB D;  1M18 D;  5AV5 B;  3C1C C;  3AN2 A;  3X1S D;  4J8U D;  1KX3 C;  1ZLA B;  3EG5 B;  1P3A C;  4YS3 D;  4EO5 B;  3W98 B; 
#chains in the Genus database with same CATH homology
 5DNM C;  1N1J A;  4XZQ A;  3O62 A;  3X1V A;  1EQZ A;  1P3I A;  2J8P A;  3REJ D;  2ZY2 A;  4H9Q B;  4KHA A;  4WU9 A;  2YFV A;  5B0Z C;  4WJ3 C;  2NQB D;  3AFA D;  1KX5 D;  4R8P A;  5BNX A;  3AZG A;  3KUY A;  4J8X A;  2PYO C;  5DNN C;  3AZE A;  4G91 C;  5CP6 D;  5BO0 A;  3V9R B;  3EPJ A;  4G92 C;  1AOI B;  4Z66 C;  5AV9 B;  2CV5 D;  1BFM A;  3VH5 T;  3MGS C;  3AZN D;  3AV1 C;  3AZK B;  4J8W A;  5B2I B;  1H3O B;  1P3F D;  3B6G B;  3WAA C;  4J8V A;  5B40 D;  4DQY B;  5AY8 A;  2HIO C;  1P3P A;  2JSS A;  1P3B A;  4NE5 A;  4NE6 A;  3REL D;  4ZUX B;  4JJN A;  4X23 A;  5AV8 B;  5GT0 C;  1M19 A;  2FJ7 C;  5B32 C;  3REI A;  1P34 C;  1S32 B;  3LEL A;  4WU8 A;  3AV2 B;  4Z5T B;  5AVC B;  4LD9 B;  2ZY3 A;  4XUJ B;  1BH8 A;  2Y2M A;  5GXQ B;  3WA9 B;  3AZF B;  3O62 D;  3REK B;  1P3I D;  4M6B A;  3B0C W;  3A1I A;  4Z2M H;  4WU9 D;  1P3A A;  5KDM A;  3AZL A;  5BS7 A;  5JRG A;  5BNV A;  3H0R C;  1A7W A;  5FUG A;  5C3I B;  5DNN B;  3WTP A;  4G91 B;  4CAY B;  2BYK A;  4WNN A;  4R8P D;  5GSU A;  3NQJ A;  3AZG D;  3KUY D;  3AZE D;  5B24 C;  5AVB A;  3X1T A;  3AV1 B;  3MGS B;  3REH B;  3AZJ C;  5B0Y C;  5F99 B;  3NQU A;  3X1U C;  1U35 C;  2ARO C;  3A6N B;  3VH6 A;  4H9N B;  3AL0 C;  3LZ1 B;  5CPK B;  1F66 A;  4AWL B;  2NZD C;  2Y2Q A;  5AV5 C;  3EPH A;  4J8W D;  3AYW B;  3W99 B;  3UTB B;  3AZM A;  1P3G C;  1M18 B;  2HIO B;  1P3M D;  5B31 A;  1ZLA C;  3B6F D;  3MVD A;  4J8U B;  4EO5 C;  4H9P A;  3WKJ C;  3KSY A;  4YS3 B;  5CPI B;  1TZY C;  1P3P D;  3A1K A;  4YM6 D;  1ID3 A;  4DRA A;  3AZH C;  5GT0 B;  1TAF A;  5B32 B;  3REJ B;  3UT9 D;  2RVQ D;  4E45 A;  4X23 D;  3LZ0 A;  3WTP E;  5B31 G;  3C1B C;  1M19 D;  2NQB B;  1KX5 B;  3REI D;  3LEL D;  4WU8 D;  5B2J A;  5CPI D;  2FFF B;  1P3K A;  5GT3 D;  4H9S C;  3IP4 C;  5CP6 B;  1P34 A;  2IO5 B;  5AV6 D;  1KX4 C;  5AV9 C;  3MGQ A;  3TU4 C;  1P3L A;  3AZK C;  5B2I C;  5JA4 B;  3MGR D;  3AZN B;  3B6G C;  3AZL D;  5JRG D;  3WTP D;  5B24 B;  5B40 B;  5GSU D;  3MNN A;  1T3U A;  3X1U B;  1U35 B;  1BH9 A;  2DQN C;  4KGC A;  4QLC A;  4ZUX C;  5AVB D;  3X1T D;  5CHL B;  5AV8 C;  5B33 A;  3REL B;  1HQ3 A;  1P3G B;  3KWQ A;  3VH5 W;  4YM6 C;  3MGP C;  1S32 C;  1JFI A;  1F66 D;  3UT9 C;  3WKJ B;  5CPJ A;  3AZM D;  4Z5T C;  5B0Y A;  5AVC C;  3KXB A;  3AV2 C;  1TZY B;  5B31 D;  4XUJ C;  4LD9 C;  3AZH B;  5GXQ C;  3MVD D;  5B1M D;  3WA9 C;  4UUZ B;  3AZF C;  3REK C;  3FDD A;  1ID3 D;  3O62 B;  3C1B B;  1P3I B;  3B0B A;  4KHA B;  2F8N A;  4WU9 B;  3W98 A;  5C3I C;  3UTA A;  3LZ0 D;  5B1L A;  4H9Q A;  4R8P B;  5E5A A;  1KX4 B;  5B2J D;  3W97 D;  1M1A D;  3KUY B;  3TU4 B;  4KUD C;  3AZE B;  1P3K D;  4E44 A;  3REH C;  3AZI D;  5F99 C;  3LJA D;  3MGQ D;  5BO0 B;  3A6N C;  1P3L D;  3LZ1 C;  5CPK C;  3W96 C;  4AWL C;  4H9R A;  1P3O C;  3AYW C;  2Y2P A;  3W99 C;  4DRB A;  3UTB C;  1AOI A;  1M18 C;  4J8W B;  1Z2C B;  3VH5 A;  3X1S C;  1P3M B;  1W2E A;  4J8U C;  3B6F B;  1H3O A;  5CPI C;  4YS3 C;  4CSR B;  3B6G A;  3MNN D;  4KGC D;  1P3P B;  4QLC D;  3REJ C;  4YM6 B;  3MGP B;  3UT9 B;  5B33 D;  3F6T A;  1HQ3 D;  3AN2 D;  4X23 B;  3KWQ D;  2NQB C;  3AFA C;  1KX5 C;  4ZUX A;  1M19 B;  3C1C A;  3REI B;  5CPJ D;  4WU8 B;  4XZQ D;  3KXB D;  3EPK A;  3X1V D;  1EQZ D;  4WZS B;  1KX3 A;  5CP6 C;  2IO5 C;  5BT1 D;  5GT3 B;  2NZD A;  1BH8 B;  5DNM A;  5AV6 B;  3H0M C;  4Z5T A;  5G49 B;  1PZR A;  2CV5 C;  3AZN C;  5B0Z A;  3W98 D;  3MGR B;  2F8N D;  2VQR A;  4J8X D;  3REK A;  1P3F C;  3UTA D;  5B1L D;  4KUD B;  5FUG B;  3WTP B;  5B40 C;  2BYK B;  4WNN B;  5E5A D;  2PYO A;  5DNN A;  5GSU B;  3NQJ B;  3W96 B;  1P3O B;  3REL C;  5AVB B;  3KFU G;  4Z66 A;  2YFW A;  3H0L C;  4WV4 B;  3NQU B;  3X1S B;  3AV1 A;  3MGS A;  4J8V D;  3REH A;  1F66 B;  1AOI D;  5AY8 D;  3WAA A;  3AZM B;  4H9N A;  1P3B D;  5B31 B;  3AYW A;  3W99 A;  3MVD B;  3UTB A;  4JJN D;  5B1M B;  2HIO A;  4H9P B;  3O62 C;  2BYM A;  1P3I C;  3AFA B;  4J8U A;  1ID3 B;  4WU9 C;  5BT1 C;  1B6W A;  4H9O B;  5GT0 A;  2FJ7 A;  3LZ0 B;  5B32 A;  1Q9C A;  4R8P C;  3C1C D;  3KUY C;  3AZG C;  3EPL A;  2Y2J A;  5B2J B;  2UWX A;  3AZE C;  3W97 B;  2ZM5 A;  1M1A B;  2CV5 B;  1KX3 D;  1P3K B;  3AZI B;  4NE3 A;  1P3A D;  2NZD D;  5DNM D;  2HUE C;  3LJA B;  1P3F B;  1P3L B;  3P5J B;  2G5I C;  5B0Z D;  4J8W C;  1P3M C;  2W8S A;  3B6F C;  3R45 B;  5AY8 C;  2PYO D;  2F8N H;  5DNN D;  1P3P C;  3MNN B;  5B24 A;  4QLC B;  2ZY4 A;  5B40 A;  2RVQ C;  3AZJ A;  3X1U A;  4X23 C;  1U35 A;  5B33 B;  4Z66 D;  2ARO A;  1HQ3 B;  4ZBJ B;  3AN2 B;  1M19 C;  3KWQ B;  3AV1 D;  2ZY5 A;  5AV5 A;  3REI C;  2BG1 A;  1JFI B;  3LEL C;  4WU8 C;  1P3G A;  1ULY A;  1N1J B;  5CPJ B;  3WAA D;  1ZLA A;  4XZQ B;  3KXB B;  3X1V B;  1EQZ B;  5GT3 C;  5AV6 C;  3WKJ A;  2YFV B;  2HIO D;  1TZY A;  1HTA A;  3AZH A;  3MGR C;  5BNX B;  2JCH A;  2Y2N A;  4UUZ A;  2F8N B;  3AZG B;  3AZL C;  5BS7 C;  5JRG C;  4J8X B;  3WTP C;  5GT0 D;  3C1B A;  3UTA B;  2FJ7 D;  5B32 D;  5B1L B;  1P34 D;  2F8N G;  5GSU C;  2L5A A;  2F2A C;  5E5A B;  2HUE B;  4H9S A;  5AVB C;  2LY8 A;  3V9R A;  3X1T C;  1KX4 A;  5AV9 A;  3TU4 A;  3AZK A;  2XD5 A;  5B2I A;  1F66 C;  1R4V A;  2Y2K A;  4H9R B;  2RIQ A;  4J8V B;  2G5H C;  3AZM C;  3B0D B;  5AY8 B;  4HGA B;  2DF4 C;  5B31 C;  2Y2O A;  1P3B B;  3MVD C;  5B1M C;  1WWI A;  2JE5 A;  4JJN B;  1P3M A;  4UPK A;  1ID3 C;  5B24 D;  3B6F A;  5AV8 A;  2CWE A;  4CSR A;  3LEL B;  3AZJ D;  5B0Y D;  3X1U D;  1U35 D;  3LZ0 C;  2ARO D;  4YM6 A;  3MGP A;  1S32 A;  3UT9 A;  5AV5 D;  3VH6 W;  5B2J C;  3AV2 A;  1P3G D;  3W97 C;  5AVC A;  1M1A C;  3C1C B;  4LD9 A;  4XUJ A;  1ZLA D;  5GXQ A;  1P3K C;  3AZI C;  1KX3 B;  1WWS A;  3WA9 A;  3WKJ D;  3AZF A;  3LJA C;  3MGQ C;  1P3A B;  5KDM B;  2Y2G A;  1TZY D;  2Y2I A;  5DNM B;  2Y2L A;  5JRG B;  5BNV B;  3AZL B;  1P3L C;  2NZD B;  3AZH D;  5GT3 A;  5AV6 A;  5B0Z B;  5G49 A;  4CAY A;  2Y2H A;  3C1B D;  3MGR A;  3X1T B;  3MNN C;  2PYO B;  4KGC C;  4KUD A;  1F1E A;  4QLC C;  5F99 A;  1KX4 D;  3VH6 T;  5B33 C;  5AV9 D;  3A6N A;  4G92 B;  1HQ3 C;  4ZBJ C;  3TU4 D;  3AN2 C;  4Z66 B;  3LZ1 A;  3W96 A;  2YFW B;  3KWQ C;  5CPK A;  3AZK D;  1P3O A;  5B2I D;  1M18 A;  3B6G D;  5CPJ C;  1KU5 A;  4XZQ C;  3X1V C;  3X1S A;  3KXB C;  1EQZ C;  3WAA B;  1TAF B;  4YS3 A;  5CPI A;  3REJ A;  4ZUX D;  2BYM B;  3B0C T;  4NFT A;  5B1M A;  5AV8 D;  3W98 C;  4J8X C;  3UTA C;  2NQB A;  3AFA A;  5B1L C;  1KX5 A;  4Z2M G;  3MGP D;  1S32 D;  2FJ7 B;  1P34 B;  5E5A C;  3AV2 D;  4Z5T D;  4H9O A;  5AVC D;  3MGQ B;  4LD9 D;  4XUJ D;  5CP6 A;  5B32 G;  5GXQ D;  3WA9 D;  3AZF D;  3REK D;  3W97 A;  1M1A A;  2CV5 A;  5JA4 A;  3AZN A;  4J8V C;  3AZI A;  3B0D C;  1AOI C;  4HGA C;  3LJA A;  1P3F A;  1P3B C;  4KGC B;  1BH9 B;  2F8N K;  4JJN C;  2XD1 A;  3R45 A;  4KUD D;  3MGS D;  3REH D;  3REL A;  5F99 D;  1B67 A;  3A6N D;  3AZJ B;  5B0Y B;  3LZ1 D;  5CPK D;  3W96 D;  2ARO B;  1P3O D;  3AYW D;  3W99 D;  3UTB D;  1M18 D;  5AV5 B;  3C1C C;  3AN2 A;  3X1S D;  4J8U D;  1KX3 C;  1ZLA B;  3EG5 B;  1P3A C;  4YS3 D;  4EO5 B;  3W98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...