3AZKC

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkC00
4NE5A 3R45A 3AZND 3VH6W 5KDMA 2NZDB 3KUYB 3RELA 3C1BA 5B2JD 1P3KB 4Z66B 1P3LB 3MGQD 3LJAC 3VH5A 2RVQD 1P3BC 5CPJC 4J8WD 1ZLAA 1U35B 3NQJA 5B1LD 1M18A 2YFVB 3REIC 1P3AB 3AZNC 2F8NK 4KHAA 5B1MB 4HGAB 5AV8D 3MVDB 3MGQC 3LJAA 2RVQC 5CPJA 1TZYD 4R8PD 4J8WC 5B1LC 4ZBJB 4J8VD 4AWLB 4WU8B 3REIA 3AZNA 3REKC 3R45B 5KDMB 5GXQD 5B2JA 3C1BB 5AV6D 3REHC 5AV8C 3MGQA 1M19D 3X1UC 4G92C 1TZYC 4R8PC 5B1LA 1ZLAB 3NQJB 4J8VC 1M18B 3VH5W 1JFIA 4KUDD 1P3PD 3LZ0D 5GXQC 4KHAB 5AV8A 2CV5D 3LJAB 5AV5D 5CPJB 1TZYA 4R8PA 3AZLD 3REIB 4WZSB 3AZNB 3WKJD 4KUDC 5CPID 3LZ0C 1P3PC 5AV6A 5B2JB 1M19A 4NE3A 3MGQB 2CV5C 1S32D 5AV5C 3MNND 5B1LB 3LZ1C 3AZHD 1JFIB 3WKJC 3O62D 1P3PA 3LZ0A 5CPIC 1HTAA 5AV8B 1B6WA 2CV5A 5AV5A 4G92B 1S32C 3B0CW 1TZYB 4R8PB 3MNNC 4J8VB 3AZLA 5DNMD 3UTBD 3WKJA 3O62C 4H9NA 5GXQB 2HIOD 5GSUD 5AV6B 3WAAC 1M19B 3C1CD 3MNNA 4YS3D 3UTBC 5B33D 3AZHA 5AY8D 4CAYA 5GT3C 5AVCD 3O62A 1P3PB 3LZ0B 5GSUC 2HIOC 3AZFD 3W98D 5GT0D 2CV5B 3C1CC 4LD9D 5AV5B 4DRBA 4YS3C 5B40D 3LELD 1P34D 5DNMA 3AZLB 3UTBA 4ZUXA 5B33C 3WKJB 5AVCC 1KX5D 5GSUA 2HIOA 5CPIB 3AZFC 3W98C 5GT0C 3C1CA 5JA4A 1S32B 1N1JA 4YS3A 3MNNB 3REJD 5B40C 3LELC 5DNND 1P34C 3VH5T 4Z5TD 5AY8A 3AZHB 4CAYB 5AVCA 1KX5C 3O62B 3AZFA 3W98A 5BNXA 5GT0A 4LD9A 3V9RA 1P3BD 5B40A 3LELA 1P34A 5DNMB 4WU8A 3UTBB 1HQ3C 4Z5TC 4ZUXB 1KX5A 4H9QA 5GSUB 2HIOB 3AZKA 1BH9B 3C1CB 5JA4B 1N1JB 3REJA 2BYMA 4YS3B 5DNNA 3MGSD 3W99A 2FJ7D 1WWIA 5AY8B 3REKD 5AVCB 3AZED 2HUEC 3AZFB 3W98B 4NE6A 3REHD 5BNXB 3B6GD 5GT0B 3AZJD 3X1UD 4LD9B 3V9RB 1P3BA 5C3IB 5B40B 3LELB 1P34B 3MGSC 2FJ7C 1KU5A 1KX3C 3AZEC 1KX5B 4H9QB 3X1VC 3AV2D 1M1AD 3AZGD 3B6GC 3AZKB 3AZJC 4YM6D 4J8WA 4NFTA 5F99C 3REJB 2BYMB 3MGSA 4JJND 5DNNB 5BT1D 3W99B 5AVBD 1KX4C 3REKA 3AZEA 3B0DC 3UTAD 3AV2C 3REHA 1M1AC 3AZGC 1ID3D 3B6GA 3X1UA 3WTPD 4YM6C 1P3BB 4QLCD 4E45A 4J8VA 4JJNC 5BT1C 3LZ1D 5AVBC 4H9OA 5CP6D 4XUJD 5GXQA 3UTAC 3AV2A 1M1AA 3AZGA 1ID3C 1F1EA 3WTPC 4YM6A 4J8WB 4QLCC 4X23D 4JJNA 3MGSB 1P3FD 1P3MD 3REKB 5CP6C 3AZEB 4XUJC 4KUDA 3UTAA 3WTPE 5B32G 3REHB 3WAAD 3B6GB 1BFMA 3WTPA 3AZJB 3X1UB 4WV4B 3A6ND 4QLCA 4X23C 3W97D 3LZ1A 1P3FC 4H9OB 3VH6T 1P3MC 5CP6A 4XUJA 5GT3D 5CPIA 3AV2B 1M1AB 3AZGB 4WNNA 1S32A 2F8ND 4YM6B 3A6NC 3W96D 4X23A 4JJNB 1P3FA 3W97C 5AVBB 4KUDB 3UTAB 3AN2C 3WAAA 1ID3B 3AZID 3WTPB 3A6NA 5B31G 3W96C 3W97A 4QLCB 5B0ZD 3LZ1B 3WA9C 5CP6B 5GT3A 4XUJB 2JSSA 3KXBD 4E44A 3AZIC 1BH9A 4WNNB 3W96A 5B24C 4X23B 2NZDC 5B0ZC 1P3FB 1P3OD 5B33A 1HQ3D 4H9RA 4Z66C 1P3LC 3TU4D 3KXBC 3WAAB 3AZIA 3A6NB 1P3GD 5BS7C 5B0ZA 3W97B 3RELD 1P3OC 3NQUA 5B32D 2BYKA 5GT3B 3TU4C 5B2ID 3KXBA 3AV1D 2IO5C 4J8UD 5BNVB 3W96B 5BS7A 1P3GC 1P3OA 3RELC 1HQ3A 4Z5TA 1H3OA 5JRGD 5B33B 5B32C 1KX3D 4H9RB 3TU4A 3X1VD 4Z2MG 5B2IC 4J8XD 3AFAD 2CWEA 3AZIB 3AV1C 4J8UC 3B0CT 1M18C 4WU9D 5AV9D 4UUZA 1P3GA 5F99D 1EQZD 3KSYA 5B0ZB 4DRAA 5B32A 5JRGC 5B0YD 3NQUB 1KX4D 2F8NG 1AOID 2BYKB 2F8NH 5B2IA 3KXBB 4J8XC 5B31D 3AFAC 3AV1A 4J8UA 2LY8A 3X1SD 4WU9C 5AV9C 1EQZC 1P3OB 2FJ7A 5JRGA 1KX3A 1HQ3B 4Z5TB 1H3OB 5B2JC 5B0YC 3MGPD 1AOIC 1R4VA 3AZMD 3X1VA 3TU4B 3UT9D 4J8XA 3X1TD 3AFAA 5B31C 2IO5B 4G91C 3AZJA 4WU9A 5AV9A 3X1SC 5F99A 4UUZB 1P3GB 1EQZA 3RELB 5B0YA 1KX4A 5B32B 1AOIA 4M6BA 3MGPC 3B6FD 3AZMC 5FUGA 2HUEB 1P3ID 5BO0A 3UT9C 5B2IB 5B31A 3X1TC 4H9SC 4J8UB 3AV1B 3X1SA 5AVBA 2FJ7B 5JRGB 1KX3B 3AYWD 5CHLB 5AV6C 3MGPA 3B6FC 4KGCD 3AZMA 1P3IC 2L5AA 1M19C 3UT9A 3X1VB 3X1TA 4J8XB 3AFAB 4H9SA 1ID3A 1B67A 2NQBD 4WU9B 2YFWA 5AV9B 5E5AD 5F99B 5CPKD 1EQZB 1F66D 2AROD 4H9PA 5B0YB 3AYWC 1KX4B 3B6FA 1AOIB 1TAFA 4KGCC 3B0DB 1P3IA 5FUGB 5G49A 4EO5C 5BO0B 3AN2D 5B31B 4G91B 2PYOD 3AZLC 2NQBC 3X1SB 3KWQD 5E5AC 5CPKC 1F66C 2AROC 3AYWA 1P3MA 3WA9D 4KGCA 3MGPB 1WWSA 3AZMB 4XZQD 3MGRD 3UT9B 3X1TB 2PYOC 2NQBA 4CSRA 4ZUXD 3KWQC 2YFWB 5E5AA 5B24D 3AZHC 5CPKA 2NZDD 1F66A 3KUYD 2AROA 4H9PB 3B6FB 1TAFB 1P3KD 4XZQC 4Z66D 1P3LD 1P3IB 5G49B 3B0BA 3AN2A 3MGRC 2PYOA 1U35D 2F8NA 5DNMC 3KWQA 4ZUXC 1P3AD 3KUYC 1A7WA 3WA9A 3AYWB 1P3MB 4KGCB 5B1MD 4XZQA 1P3KC 3MVDD 4EO5B 3MGRA 1BH8A 3VH6A 1U35C 2NQBB 4CSRB 1ULYA 4WU8D 5B24A 5AY8C 5BNVA 5E5AB 1P3AC 5CPKB 2NZDA 3KUYA 1F66B 2AROB 4H9NB 3C1BD 5B1MC 1P3KA 4HGAC 4Z66A 1P3LA 3MVDC 3AZKD 1Q9CA 3AN2B 4LD9C 5C3IC 1U35A 1ZLAD 2PYOB 4ZBJC 3W99D 4AWLC 1M18D 3KWQB 2YFVA 4WU8C 2F8NB 1P3AA 3WA9B 3C1BC 5B1MA 3MVDA 4XZQB 3AZKC 3LJAD 3MGRB 5CPJD 1BH8B 4Z2MH 3REJC 1ZLAC 5DNNC 3W99C 3REID 5B24B
chains in the Genus database with same CATH superfamily
4NE5A 3R45A 3AZND 3VH6W 5KDMA 2NZDB 3KUYB 3RELA 3C1BA 5B2JD 1P3KB 4Z66B 1P3LB 3MGQD 3LJAC 3VH5A 2RVQD 1P3BC 5CPJC 4J8WD 1ZLAA 1U35B 3NQJA 5B1LD 1M18A 2YFVB 3REIC 1P3AB 3AZNC 2F8NK 4KHAA 5B1MB 4HGAB 5AV8D 3MVDB 3MGQC 3LJAA 2RVQC 5CPJA 1TZYD 4R8PD 4J8WC 5B1LC 2Y2OA 4ZBJB 4J8VD 4AWLB 4WU8B 3REIA 3AZNA 3REKC 3R45B 5KDMB 4DQYB 5GXQD 5B2JA 3C1BB 5AV6D 3REHC 5AV8C 3MGQA 1M19D 3X1UC 3H0RC 4G92C 4UPKA 1TZYC 4R8PC 5B1LA 1ZLAB 3NQJB 4J8VC 1M18B 3A1IA 3VH5W 1JFIA 4KUDD 1P3PD 2J8PA 5GXQC 3LZ0D 4KHAB 5AV8A 2CV5D 3LJAB 5AV5D 5CPJB 1TZYA 4R8PA 3AZLD 3REIB 4WZSB 3AZNB 3WKJD 2Y2JA 4KUDC 5CPID 3LZ0C 1P3PC 5AV6A 5B2JB 1M19A 4NE3A 3MGQB 2CV5C 2ZY5A 1S32D 5AV5C 3MNND 5B1LB 3LZ1C 3AZHD 1JFIB 3WKJC 3O62D 1P3PA 3LZ0A 5CPIC 3H0MC 1HTAA 5AV8B 1B6WA 2CV5A 5AV5A 4G92B 1S32C 3B0CW 1TZYB 4R8PB 3MNNC 3EPJA 4J8VB 3AZLA 5DNMD 3UTBD 3WKJA 3O62C 4H9NA 5GXQB 2HIOD 3FDDA 5GSUD 5AV6B 3WAAC 1M19B 3C1CD 3MNNA 4YS3D 3UTBC 5B33D 3AZHA 5AY8D 4CAYA 5GT3C 5AVCD 3O62A 1P3PB 3LZ0B 5GSUC 2HIOC 3AZFD 3W98D 2XD1A 5GT0D 2CV5B 2FFFB 3C1CC 4LD9D 5AV5B 4DRBA 4YS3C 5B40D 3LELD 1P34D 5DNMA 3AZLB 3UTBA 4ZUXA 5B33C 2XD5A 3WKJB 5AVCC 1KX5D 5GSUA 2HIOA 5CPIB 3AZFC 3W98C 5GT0C 3C1CA 5JA4A 1S32B 1N1JA 4YS3A 3MNNB 4WJ3C 3REJD 5B40C 3LELC 5DNND 1P34C 3VH5T 4Z5TD 5AY8A 3AZHB 4CAYB 5AVCA 1KX5C 3O62B 3AZFA 3W98A 5BNXA 5GT0A 4LD9A 3V9RA 2G5HC 1P3BD 2Y2MA 5B40A 3LELA 1P34A 5DNMB 4WU8A 3UTBB 1HQ3C 4Z5TC 4ZUXB 1KX5A 2Y2HA 4H9QA 5GSUB 2HIOB 2UWXA 3AZKA 1BH9B 3C1CB 5JA4B 1N1JB 3REJA 2BYMA 4YS3B 5DNNA 3MGSD 3W99A 2FJ7D 1WWIA 5AY8B 3REKD 5AVCB 3AZED 2HUEC 3AZFB 3W98B 4NE6A 3REHD 5BNXB 1W2EA 3B6GD 5GT0B 2DQNC 3AZJD 3X1UD 4LD9B 3V9RB 1P3BA 5C3IB 5B40B 3LELB 1P34B 3MGSC 2FJ7C 1KU5A 1KX3C 3AZEC 1KX5B 4H9QB 3X1VC 3AV2D 1M1AD 3AZGD 3B6GC 3AZKB 3AZJC 4YM6D 1PZRA 4J8WA 4NFTA 5F99C 3REJB 2BYMB 3MGSA 4JJND 5DNNB 5BT1D 3W99B 5AVBD 3EPHA 1KX4C 3REKA 3AZEA 3B0DC 3UTAD 3AV2C 3REHA 1M1AC 3AZGC 1ID3D 3B6GA 3X1UA 3WTPD 4YM6C 1P3BB 4QLCD 4E45A 4J8VA 4JJNC 5BT1C 3LZ1D 5AVBC 4H9OA 5CP6D 4XUJD 5GXQA 3UTAC 3AV2A 1M1AA 3AZGA 1ID3C 1F1EA 3WTPC 4YM6A 2Y2PA 4J8WB 4QLCC 4X23D 4JJNA 3MGSB 1P3FD 1P3MD 3REKB 5CP6C 3AZEB 4XUJC 4KUDA 3UTAA 3WTPE 5B32G 3REHB 3WAAD 3B6GB 1BFMA 3H0LC 3WTPA 3X1UB 3AZJB 2Y2IA 4WV4B 3A6ND 4QLCA 5B24B 4X23C 3W97D 3LZ1A 1P3FC 4H9OB 3VH6T 1P3MC 5CP6A 4XUJA 5GT3D 5CPIA 3AV2B 1M1AB 3AZGB 1T3UA 4WNNA 1S32A 2F8ND 4YM6B 2Y2NA 3A6NC 3W96D 4X23A 4JJNB 1P3FA 3W97C 5AVBB 3A1KA 4KUDB 3UTAB 3AN2C 3WAAA 2VQRA 1ID3B 3AZID 3WTPB 1Z2CB 3A6NA 5B31G 3W96C 3W97A 4QLCB 5B0ZD 3LZ1B 3WA9C 3IP4C 5CP6B 5GT3A 4XUJB 2JSSA 3KXBD 4E44A 3EG5B 3AZIC 1BH9A 4WNNB 3W96A 5B24C 4X23B 2NZDC 5B0ZC 1P3FB 1P3OD 5B33A 1HQ3D 4H9RA 4Z66C 1P3LC 2ZY2A 3TU4D 3KXBC 3WAAB 3AZIA 3A6NB 1P3GD 3KFUG 5BS7C 5B0ZA 3W97B 3RELD 1P3OC 3NQUA 5B32D 2BYKA 5GT3B 3TU4C 5B2ID 3KXBA 3AV1D 2IO5C 4J8UD 3W96B 5BS7A 1P3GC 2Y2LA 1P3OA 3RELC 1HQ3A 4Z5TA 1H3OA 5JRGD 5B33B 5B32C 1KX3D 4H9RB 3TU4A 3X1VD 4Z2MG 5B2IC 4J8XD 3AFAD 2CWEA 3AZIB 3AV1C 4J8UC 2G5IC 3B0CT 1M18C 4WU9D 5AV9D 4UUZA 1P3GA 5F99D 1EQZD 3KSYA 5B0ZB 4DRAA 5B32A 5JRGC 5B0YD 3NQUB 1KX4D 2F8NG 1AOID 2BYKB 2F8NH 2F2AC 2JCHA 5B2IA 3KXBB 4J8XC 5B31D 3AFAC 3AV1A 4J8UA 2LY8A 3X1SD 4WU9C 5AV9C 1EQZC 1P3OB 2FJ7A 5JRGA 1KX3A 5B0YC 1HQ3B 4Z5TB 1H3OB 2Y2QA 5B2JC 3MGPD 1R4VA 1AOIC 3AZMD 3X1VA 3TU4B 3UT9D 4J8XA 3X1TD 3AFAA 2DF4C 5B31C 2IO5B 4G91C 3AZJA 4WU9A 5AV9A 3X1SC 5F99A 4UUZB 1P3GB 1EQZA 3RELB 5B0YA 1KX4A 5B32B 1AOIA 4M6BA 3MGPC 2W8SA 3B6FD 3AZMC 5FUGA 2HUEB 1P3ID 5BO0A 3UT9C 5B2IB 5B31A 3X1TC 4H9SC 4J8UB 3AV1B 3X1SA 5AVBA 2FJ7B 5JRGB 1KX3B 3AYWD 5CHLB 5AV6C 3MGPA 3B6FC 4KGCD 3AZMA 1P3IC 2L5AA 1M19C 3UT9A 3X1VB 3X1TA 2Y2KA 4J8XB 3AFAB 4H9SA 1ID3A 1B67A 2NQBD 4WU9B 2YFWA 5AV9B 5E5AD 5F99B 5CPKD 1EQZB 1F66D 2AROD 4H9PA 5B0YB 3AYWC 1KX4B 3B6FA 1AOIB 1TAFA 4KGCC 3B0DB 1P3IA 5FUGB 5G49A 4EO5C 5BO0B 2JE5A 3AN2D 5B31B 4G91B 2PYOD 3AZLC 2NQBC 3X1SB 3KWQD 5E5AC 5CPKC 1F66C 2AROC 3AYWA 1P3MA 3WA9D 4KGCA 3MGPB 1WWSA 3AZMB 4XZQD 3MGRD 3UT9B 3X1TB 2PYOC 2NQBA 4CSRA 4ZUXD 3KWQC 2YFWB 5E5AA 5B24D 3AZHC 5CPKA 2NZDD 1F66A 3KUYD 2AROA 4H9PB 3B6FB 1TAFB 1P3KD 4XZQC 4Z66D 1P3LD 1P3IB 5G49B 3B0BA 3AN2A 3MGRC 2PYOA 1U35D 2F8NA 2RIQA 5DNMC 3KWQA 4ZUXC 1P3AD 3AL0C 3KUYC 1A7WA 3WA9A 3AYWB 1P3MB 4KGCB 5B1MD 2Y2GA 4XZQA 1P3KC 3MVDD 4EO5B 3MGRA 3EPLA 3EPKA 3F6TA 1BH8A 3VH6A 1U35C 2NQBB 4CSRB 1ULYA 4WU8D 5BNVA 5AY8C 5B24A 5E5AB 2ZY3A 5CPKB 1P3AC 2NZDA 3KUYA 1F66B 2AROB 4H9NB 3C1BD 5B1MC 1P3KA 4HGAC 4Z66A 1P3LA 3MVDC 3AZKD 2BG1A 1Q9CA 3AN2B 4LD9C 5C3IC 1U35A 1ZLAD 2PYOB 4ZBJC 3W99D 2ZM5A 4AWLC 3KWQB 2YFVA 4WU8C 1M18D 2F8NB 1P3AA 3WA9B 3C1BC 5B1MA 2ZY4A 3MVDA 4XZQB 3AZKC 3LJAD 3MGRB 5CPJD 1BH8B 4Z2MH 3REJC 3P5JB 1ZLAC 5DNNC 3W99C 3REID 5BNVB
chains in the Genus database with same CATH topology
4NE5A 3R45A 3AZND 3VH6W 5KDMA 2NZDB 3KUYB 3RELA 3C1BA 5B2JD 1P3KB 4Z66B 1P3LB 3MGQD 3LJAC 3VH5A 2RVQD 1P3BC 5CPJC 4J8WD 1ZLAA 1U35B 3NQJA 5B1LD 1M18A 2YFVB 3REIC 1P3AB 3AZNC 2F8NK 4KHAA 5B1MB 4HGAB 5AV8D 3MVDB 3MGQC 3LJAA 2RVQC 5CPJA 1TZYD 4R8PD 4J8WC 5B1LC 2Y2OA 4ZBJB 4J8VD 4AWLB 4WU8B 3REIA 3AZNA 3REKC 3R45B 5KDMB 4DQYB 5GXQD 5B2JA 3C1BB 5AV6D 3REHC 5AV8C 3MGQA 1M19D 3X1UC 3H0RC 4G92C 4UPKA 1TZYC 4R8PC 5B1LA 1ZLAB 3NQJB 4J8VC 1M18B 3A1IA 3VH5W 1JFIA 4KUDD 1P3PD 2J8PA 5GXQC 3LZ0D 4KHAB 5AV8A 2CV5D 3LJAB 5AV5D 5CPJB 1TZYA 4R8PA 3AZLD 3REIB 4WZSB 3AZNB 3WKJD 2Y2JA 4KUDC 5CPID 3LZ0C 1P3PC 5AV6A 5B2JB 1M19A 4NE3A 3MGQB 2CV5C 2ZY5A 1S32D 5AV5C 3MNND 5B1LB 3LZ1C 3AZHD 1JFIB 3WKJC 3O62D 1P3PA 3LZ0A 5CPIC 3H0MC 1HTAA 5AV8B 1B6WA 2CV5A 5AV5A 4G92B 1S32C 3B0CW 1TZYB 4R8PB 3MNNC 3EPJA 4J8VB 3AZLA 5DNMD 3UTBD 3WKJA 3O62C 4H9NA 5GXQB 2HIOD 3FDDA 5GSUD 5AV6B 3WAAC 1M19B 3C1CD 3MNNA 4YS3D 3UTBC 5B33D 3AZHA 5AY8D 4CAYA 5GT3C 5AVCD 3O62A 1P3PB 3LZ0B 5GSUC 2HIOC 3AZFD 3W98D 2XD1A 5GT0D 2CV5B 2FFFB 3C1CC 4LD9D 5AV5B 4DRBA 4YS3C 5B40D 3LELD 1P34D 5DNMA 3AZLB 3UTBA 4ZUXA 5B33C 2XD5A 3WKJB 5AVCC 1KX5D 5GSUA 2HIOA 5CPIB 3AZFC 3W98C 5GT0C 3C1CA 5JA4A 1S32B 1N1JA 4YS3A 3MNNB 4WJ3C 3REJD 5B40C 3LELC 5DNND 1P34C 3VH5T 4Z5TD 5AY8A 3AZHB 4CAYB 5AVCA 1KX5C 3O62B 3AZFA 3W98A 5BNXA 5GT0A 4LD9A 3V9RA 2G5HC 1P3BD 2Y2MA 5B40A 3LELA 1P34A 5DNMB 4WU8A 3UTBB 1HQ3C 4Z5TC 4ZUXB 1KX5A 2Y2HA 4H9QA 5GSUB 2HIOB 2UWXA 3AZKA 1BH9B 3C1CB 5JA4B 1N1JB 3REJA 2BYMA 4YS3B 5DNNA 3MGSD 3W99A 2FJ7D 1WWIA 5AY8B 3REKD 5AVCB 3AZED 2HUEC 3AZFB 3W98B 4NE6A 3REHD 5BNXB 1W2EA 3B6GD 5GT0B 2DQNC 3AZJD 3X1UD 4LD9B 3V9RB 1P3BA 5C3IB 5B40B 3LELB 1P34B 3MGSC 2FJ7C 1KU5A 1KX3C 3AZEC 1KX5B 4H9QB 3X1VC 3AV2D 1M1AD 3AZGD 3B6GC 3AZKB 3AZJC 4YM6D 1PZRA 4J8WA 4NFTA 5F99C 3REJB 2BYMB 3MGSA 4JJND 5DNNB 5BT1D 3W99B 5AVBD 3EPHA 1KX4C 3REKA 3AZEA 3B0DC 3UTAD 3AV2C 3REHA 1M1AC 3AZGC 1ID3D 3B6GA 3X1UA 3WTPD 4YM6C 1P3BB 4QLCD 4E45A 4J8VA 4JJNC 5BT1C 3LZ1D 5AVBC 4H9OA 5CP6D 4XUJD 5GXQA 3UTAC 3AV2A 1M1AA 3AZGA 1ID3C 1F1EA 3WTPC 4YM6A 2Y2PA 4J8WB 4QLCC 4X23D 4JJNA 3MGSB 1P3FD 1P3MD 3REKB 5CP6C 3AZEB 4XUJC 4KUDA 3UTAA 3WTPE 5B32G 3REHB 3WAAD 3B6GB 1BFMA 3H0LC 3WTPA 3X1UB 3AZJB 2Y2IA 4WV4B 3A6ND 4QLCA 5B24B 4X23C 3W97D 3LZ1A 1P3FC 4H9OB 3VH6T 1P3MC 5CP6A 4XUJA 5GT3D 5CPIA 3AV2B 1M1AB 3AZGB 1T3UA 4WNNA 1S32A 2F8ND 4YM6B 2Y2NA 3A6NC 3W96D 4X23A 4JJNB 1P3FA 3W97C 5AVBB 3A1KA 4KUDB 3UTAB 3AN2C 3WAAA 2VQRA 1ID3B 3AZID 3WTPB 1Z2CB 3A6NA 5B31G 3W96C 3W97A 4QLCB 5B0ZD 3LZ1B 3WA9C 3IP4C 5CP6B 5GT3A 4XUJB 2JSSA 3KXBD 4E44A 3EG5B 3AZIC 1BH9A 4WNNB 3W96A 5B24C 4X23B 2NZDC 5B0ZC 1P3FB 1P3OD 5B33A 1HQ3D 4H9RA 4Z66C 1P3LC 2ZY2A 3TU4D 3KXBC 3WAAB 3AZIA 3A6NB 1P3GD 3KFUG 5BS7C 5B0ZA 3W97B 3RELD 1P3OC 3NQUA 5B32D 2BYKA 5GT3B 3TU4C 5B2ID 3KXBA 3AV1D 2IO5C 4J8UD 3W96B 5BS7A 1P3GC 2Y2LA 1P3OA 3RELC 1HQ3A 4Z5TA 1H3OA 5JRGD 5B33B 5B32C 1KX3D 4H9RB 3TU4A 3X1VD 4Z2MG 5B2IC 4J8XD 3AFAD 2CWEA 3AZIB 3AV1C 4J8UC 2G5IC 3B0CT 1M18C 4WU9D 5AV9D 4UUZA 1P3GA 5F99D 1EQZD 3KSYA 5B0ZB 4DRAA 5B32A 5JRGC 5B0YD 3NQUB 1KX4D 2F8NG 1AOID 2BYKB 2F8NH 2F2AC 2JCHA 5B2IA 3KXBB 4J8XC 5B31D 3AFAC 3AV1A 4J8UA 2LY8A 3X1SD 4WU9C 5AV9C 1EQZC 1P3OB 2FJ7A 5JRGA 1KX3A 5B0YC 1HQ3B 4Z5TB 1H3OB 2Y2QA 5B2JC 3MGPD 1R4VA 1AOIC 3AZMD 3X1VA 3TU4B 3UT9D 4J8XA 3X1TD 3AFAA 2DF4C 5B31C 2IO5B 4G91C 3AZJA 4WU9A 5AV9A 3X1SC 5F99A 4UUZB 1P3GB 1EQZA 3RELB 5B0YA 1KX4A 5B32B 1AOIA 4M6BA 3MGPC 2W8SA 3B6FD 3AZMC 5FUGA 2HUEB 1P3ID 5BO0A 3UT9C 5B2IB 5B31A 3X1TC 4H9SC 4J8UB 3AV1B 3X1SA 5AVBA 2FJ7B 5JRGB 1KX3B 3AYWD 5CHLB 5AV6C 3MGPA 3B6FC 4KGCD 3AZMA 1P3IC 2L5AA 1M19C 3UT9A 3X1VB 3X1TA 2Y2KA 4J8XB 3AFAB 4H9SA 1ID3A 1B67A 2NQBD 4WU9B 2YFWA 5AV9B 5E5AD 5F99B 5CPKD 1EQZB 1F66D 2AROD 4H9PA 5B0YB 3AYWC 1KX4B 3B6FA 1AOIB 1TAFA 4KGCC 3B0DB 1P3IA 5FUGB 5G49A 4EO5C 5BO0B 2JE5A 3AN2D 5B31B 4G91B 2PYOD 3AZLC 2NQBC 3X1SB 3KWQD 5E5AC 5CPKC 1F66C 2AROC 3AYWA 1P3MA 3WA9D 4KGCA 3MGPB 1WWSA 3AZMB 4XZQD 3MGRD 3UT9B 3X1TB 2PYOC 2NQBA 4CSRA 4ZUXD 3KWQC 2YFWB 5E5AA 5B24D 3AZHC 5CPKA 2NZDD 1F66A 3KUYD 2AROA 4H9PB 3B6FB 1TAFB 1P3KD 4XZQC 4Z66D 1P3LD 1P3IB 5G49B 3B0BA 3AN2A 3MGRC 2PYOA 1U35D 2F8NA 2RIQA 5DNMC 3KWQA 4ZUXC 1P3AD 3AL0C 3KUYC 1A7WA 3WA9A 3AYWB 1P3MB 4KGCB 5B1MD 2Y2GA 4XZQA 1P3KC 3MVDD 4EO5B 3MGRA 3EPLA 3EPKA 3F6TA 1BH8A 3VH6A 1U35C 2NQBB 4CSRB 1ULYA 4WU8D 5BNVA 5AY8C 5B24A 5E5AB 2ZY3A 5CPKB 1P3AC 2NZDA 3KUYA 1F66B 2AROB 4H9NB 3C1BD 5B1MC 1P3KA 4HGAC 4Z66A 1P3LA 3MVDC 3AZKD 2BG1A 1Q9CA 3AN2B 4LD9C 5C3IC 1U35A 1ZLAD 2PYOB 4ZBJC 3W99D 2ZM5A 4AWLC 3KWQB 2YFVA 4WU8C 1M18D 2F8NB 1P3AA 3WA9B 3C1BC 5B1MA 2ZY4A 3MVDA 4XZQB 3AZKC 3LJAD 3MGRB 5CPJD 1BH8B 4Z2MH 3REJC 3P5JB 1ZLAC 5DNNC 3W99C 3REID 5BNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE5 A;  3R45 A;  3AZN D;  3VH6 W;  5KDM A;  2NZD B;  3KUY B;  3REL A;  3C1B A;  5B2J D;  1P3K B;  4Z66 B;  1P3L B;  3MGQ D;  3LJA C;  3VH5 A;  2RVQ D;  1P3B C;  5CPJ C;  4J8W D;  1ZLA A;  1U35 B;  3NQJ A;  5B1L D;  1M18 A;  2YFV B;  3REI C;  1P3A B;  3AZN C;  2F8N K;  4KHA A;  5B1M B;  4HGA B;  5AV8 D;  3MVD B;  3MGQ C;  3LJA A;  2RVQ C;  5CPJ A;  1TZY D;  4R8P D;  4J8W C;  5B1L C;  4ZBJ B;  4J8V D;  4AWL B;  4WU8 B;  3REI A;  3AZN A;  3REK C;  3R45 B;  5KDM B;  5GXQ D;  5B2J A;  3C1B B;  5AV6 D;  3REH C;  5AV8 C;  3MGQ A;  1M19 D;  3X1U C;  4G92 C;  1TZY C;  4R8P C;  5B1L A;  1ZLA B;  3NQJ B;  4J8V C;  1M18 B;  3VH5 W;  1JFI A;  4KUD D;  1P3P D;  3LZ0 D;  5GXQ C;  4KHA B;  5AV8 A;  2CV5 D;  3LJA B;  5AV5 D;  5CPJ B;  1TZY A;  4R8P A;  3AZL D;  3REI B;  4WZS B;  3AZN B;  3WKJ D;  4KUD C;  5CPI D;  3LZ0 C;  1P3P C;  5AV6 A;  5B2J B;  1M19 A;  4NE3 A;  3MGQ B;  2CV5 C;  1S32 D;  5AV5 C;  3MNN D;  5B1L B;  3LZ1 C;  3AZH D;  1JFI B;  3WKJ C;  3O62 D;  1P3P A;  3LZ0 A;  5CPI C;  1HTA A;  5AV8 B;  1B6W A;  2CV5 A;  5AV5 A;  4G92 B;  1S32 C;  3B0C W;  1TZY B;  4R8P B;  3MNN C;  4J8V B;  3AZL A;  5DNM D;  3UTB D;  3WKJ A;  3O62 C;  4H9N A;  5GXQ B;  2HIO D;  5GSU D;  5AV6 B;  3WAA C;  1M19 B;  3C1C D;  3MNN A;  4YS3 D;  3UTB C;  5B33 D;  3AZH A;  5AY8 D;  4CAY A;  5GT3 C;  5AVC D;  3O62 A;  1P3P B;  3LZ0 B;  5GSU C;  2HIO C;  3AZF D;  3W98 D;  5GT0 D;  2CV5 B;  3C1C C;  4LD9 D;  5AV5 B;  4DRB A;  4YS3 C;  5B40 D;  3LEL D;  1P34 D;  5DNM A;  3AZL B;  3UTB A;  4ZUX A;  5B33 C;  3WKJ B;  5AVC C;  1KX5 D;  5GSU A;  2HIO A;  5CPI B;  3AZF C;  3W98 C;  5GT0 C;  3C1C A;  5JA4 A;  1S32 B;  1N1J A;  4YS3 A;  3MNN B;  3REJ D;  5B40 C;  3LEL C;  5DNN D;  1P34 C;  3VH5 T;  4Z5T D;  5AY8 A;  3AZH B;  4CAY B;  5AVC A;  1KX5 C;  3O62 B;  3AZF A;  3W98 A;  5BNX A;  5GT0 A;  4LD9 A;  3V9R A;  1P3B D;  5B40 A;  3LEL A;  1P34 A;  5DNM B;  4WU8 A;  3UTB B;  1HQ3 C;  4Z5T C;  4ZUX B;  1KX5 A;  4H9Q A;  5GSU B;  2HIO B;  3AZK A;  1BH9 B;  3C1C B;  5JA4 B;  1N1J B;  3REJ A;  2BYM A;  4YS3 B;  5DNN A;  3MGS D;  3W99 A;  2FJ7 D;  1WWI A;  5AY8 B;  3REK D;  5AVC B;  3AZE D;  2HUE C;  3AZF B;  3W98 B;  4NE6 A;  3REH D;  5BNX B;  3B6G D;  5GT0 B;  3AZJ D;  3X1U D;  4LD9 B;  3V9R B;  1P3B A;  5C3I B;  5B40 B;  3LEL B;  1P34 B;  3MGS C;  2FJ7 C;  1KU5 A;  1KX3 C;  3AZE C;  1KX5 B;  4H9Q B;  3X1V C;  3AV2 D;  1M1A D;  3AZG D;  3B6G C;  3AZK B;  3AZJ C;  4YM6 D;  4J8W A;  4NFT A;  5F99 C;  3REJ B;  2BYM B;  3MGS A;  4JJN D;  5DNN B;  5BT1 D;  3W99 B;  5AVB D;  1KX4 C;  3REK A;  3AZE A;  3B0D C;  3UTA D;  3AV2 C;  3REH A;  1M1A C;  3AZG C;  1ID3 D;  3B6G A;  3X1U A;  3WTP D;  4YM6 C;  1P3B B;  4QLC D;  4E45 A;  4J8V A;  4JJN C;  5BT1 C;  3LZ1 D;  5AVB C;  4H9O A;  5CP6 D;  4XUJ D;  5GXQ A;  3UTA C;  3AV2 A;  1M1A A;  3AZG A;  1ID3 C;  1F1E A;  3WTP C;  4YM6 A;  4J8W B;  4QLC C;  4X23 D;  4JJN A;  3MGS B;  1P3F D;  1P3M D;  3REK B;  5CP6 C;  3AZE B;  4XUJ C;  4KUD A;  3UTA A;  3WTP E;  5B32 G;  3REH B;  3WAA D;  3B6G B;  1BFM A;  3WTP A;  3AZJ B;  3X1U B;  4WV4 B;  3A6N D;  4QLC A;  4X23 C;  3W97 D;  3LZ1 A;  1P3F C;  4H9O B;  3VH6 T;  1P3M C;  5CP6 A;  4XUJ A;  5GT3 D;  5CPI A;  3AV2 B;  1M1A B;  3AZG B;  4WNN A;  1S32 A;  2F8N D;  4YM6 B;  3A6N C;  3W96 D;  4X23 A;  4JJN B;  1P3F A;  3W97 C;  5AVB B;  4KUD B;  3UTA B;  3AN2 C;  3WAA A;  1ID3 B;  3AZI D;  3WTP B;  3A6N A;  5B31 G;  3W96 C;  3W97 A;  4QLC B;  5B0Z D;  3LZ1 B;  3WA9 C;  5CP6 B;  5GT3 A;  4XUJ B;  2JSS A;  3KXB D;  4E44 A;  3AZI C;  1BH9 A;  4WNN B;  3W96 A;  5B24 C;  4X23 B;  2NZD C;  5B0Z C;  1P3F B;  1P3O D;  5B33 A;  1HQ3 D;  4H9R A;  4Z66 C;  1P3L C;  3TU4 D;  3KXB C;  3WAA B;  3AZI A;  3A6N B;  1P3G D;  5BS7 C;  5B0Z A;  3W97 B;  3REL D;  1P3O C;  3NQU A;  5B32 D;  2BYK A;  5GT3 B;  3TU4 C;  5B2I D;  3KXB A;  3AV1 D;  2IO5 C;  4J8U D;  5BNV B;  3W96 B;  5BS7 A;  1P3G C;  1P3O A;  3REL C;  1HQ3 A;  4Z5T A;  1H3O A;  5JRG D;  5B33 B;  5B32 C;  1KX3 D;  4H9R B;  3TU4 A;  3X1V D;  4Z2M G;  5B2I C;  4J8X D;  3AFA D;  2CWE A;  3AZI B;  3AV1 C;  4J8U C;  3B0C T;  1M18 C;  4WU9 D;  5AV9 D;  4UUZ A;  1P3G A;  5F99 D;  1EQZ D;  3KSY A;  5B0Z B;  4DRA A;  5B32 A;  5JRG C;  5B0Y D;  3NQU B;  1KX4 D;  2F8N G;  1AOI D;  2BYK B;  2F8N H;  5B2I A;  3KXB B;  4J8X C;  5B31 D;  3AFA C;  3AV1 A;  4J8U A;  2LY8 A;  3X1S D;  4WU9 C;  5AV9 C;  1EQZ C;  1P3O B;  2FJ7 A;  5JRG A;  1KX3 A;  1HQ3 B;  4Z5T B;  1H3O B;  5B2J C;  5B0Y C;  3MGP D;  1AOI C;  1R4V A;  3AZM D;  3X1V A;  3TU4 B;  3UT9 D;  4J8X A;  3X1T D;  3AFA A;  5B31 C;  2IO5 B;  4G91 C;  3AZJ A;  4WU9 A;  5AV9 A;  3X1S C;  5F99 A;  4UUZ B;  1P3G B;  1EQZ A;  3REL B;  5B0Y A;  1KX4 A;  5B32 B;  1AOI A;  4M6B A;  3MGP C;  3B6F D;  3AZM C;  5FUG A;  2HUE B;  1P3I D;  5BO0 A;  3UT9 C;  5B2I B;  5B31 A;  3X1T C;  4H9S C;  4J8U B;  3AV1 B;  3X1S A;  5AVB A;  2FJ7 B;  5JRG B;  1KX3 B;  3AYW D;  5CHL B;  5AV6 C;  3MGP A;  3B6F C;  4KGC D;  3AZM A;  1P3I C;  2L5A A;  1M19 C;  3UT9 A;  3X1V B;  3X1T A;  4J8X B;  3AFA B;  4H9S A;  1ID3 A;  1B67 A;  2NQB D;  4WU9 B;  2YFW A;  5AV9 B;  5E5A D;  5F99 B;  5CPK D;  1EQZ B;  1F66 D;  2ARO D;  4H9P A;  5B0Y B;  3AYW C;  1KX4 B;  3B6F A;  1AOI B;  1TAF A;  4KGC C;  3B0D B;  1P3I A;  5FUG B;  5G49 A;  4EO5 C;  5BO0 B;  3AN2 D;  5B31 B;  4G91 B;  2PYO D;  3AZL C;  2NQB C;  3X1S B;  3KWQ D;  5E5A C;  5CPK C;  1F66 C;  2ARO C;  3AYW A;  1P3M A;  3WA9 D;  4KGC A;  3MGP B;  1WWS A;  3AZM B;  4XZQ D;  3MGR D;  3UT9 B;  3X1T B;  2PYO C;  2NQB A;  4CSR A;  4ZUX D;  3KWQ C;  2YFW B;  5E5A A;  5B24 D;  3AZH C;  5CPK A;  2NZD D;  1F66 A;  3KUY D;  2ARO A;  4H9P B;  3B6F B;  1TAF B;  1P3K D;  4XZQ C;  4Z66 D;  1P3L D;  1P3I B;  5G49 B;  3B0B A;  3AN2 A;  3MGR C;  2PYO A;  1U35 D;  2F8N A;  5DNM C;  3KWQ A;  4ZUX C;  1P3A D;  3KUY C;  1A7W A;  3WA9 A;  3AYW B;  1P3M B;  4KGC B;  5B1M D;  4XZQ A;  1P3K C;  3MVD D;  4EO5 B;  3MGR A;  1BH8 A;  3VH6 A;  1U35 C;  2NQB B;  4CSR B;  1ULY A;  4WU8 D;  5B24 A;  5AY8 C;  5BNV A;  5E5A B;  1P3A C;  5CPK B;  2NZD A;  3KUY A;  1F66 B;  2ARO B;  4H9N B;  3C1B D;  5B1M C;  1P3K A;  4HGA C;  4Z66 A;  1P3L A;  3MVD C;  3AZK D;  1Q9C A;  3AN2 B;  4LD9 C;  5C3I C;  1U35 A;  1ZLA D;  2PYO B;  4ZBJ C;  3W99 D;  4AWL C;  1M18 D;  3KWQ B;  2YFV A;  4WU8 C;  2F8N B;  1P3A A;  3WA9 B;  3C1B C;  5B1M A;  3MVD A;  4XZQ B;  3AZK C;  3LJA D;  3MGR B;  5CPJ D;  1BH8 B;  4Z2M H;  3REJ C;  1ZLA C;  5DNN C;  3W99 C;  3REI D;  5B24 B; 
#chains in the Genus database with same CATH topology
 4NE5 A;  3R45 A;  3AZN D;  3VH6 W;  5KDM A;  2NZD B;  3KUY B;  3REL A;  3C1B A;  5B2J D;  1P3K B;  4Z66 B;  1P3L B;  3MGQ D;  3LJA C;  3VH5 A;  2RVQ D;  1P3B C;  5CPJ C;  4J8W D;  1ZLA A;  1U35 B;  3NQJ A;  5B1L D;  1M18 A;  2YFV B;  3REI C;  1P3A B;  3AZN C;  2F8N K;  4KHA A;  5B1M B;  4HGA B;  5AV8 D;  3MVD B;  3MGQ C;  3LJA A;  2RVQ C;  5CPJ A;  1TZY D;  4R8P D;  4J8W C;  5B1L C;  2Y2O A;  4ZBJ B;  4J8V D;  4AWL B;  4WU8 B;  3REI A;  3AZN A;  3REK C;  3R45 B;  5KDM B;  4DQY B;  5GXQ D;  5B2J A;  3C1B B;  5AV6 D;  3REH C;  5AV8 C;  3MGQ A;  1M19 D;  3X1U C;  3H0R C;  4G92 C;  4UPK A;  1TZY C;  4R8P C;  5B1L A;  1ZLA B;  3NQJ B;  4J8V C;  1M18 B;  3A1I A;  3VH5 W;  1JFI A;  4KUD D;  1P3P D;  2J8P A;  5GXQ C;  3LZ0 D;  4KHA B;  5AV8 A;  2CV5 D;  3LJA B;  5AV5 D;  5CPJ B;  1TZY A;  4R8P A;  3AZL D;  3REI B;  4WZS B;  3AZN B;  3WKJ D;  2Y2J A;  4KUD C;  5CPI D;  3LZ0 C;  1P3P C;  5AV6 A;  5B2J B;  1M19 A;  4NE3 A;  3MGQ B;  2CV5 C;  2ZY5 A;  1S32 D;  5AV5 C;  3MNN D;  5B1L B;  3LZ1 C;  3AZH D;  1JFI B;  3WKJ C;  3O62 D;  1P3P A;  3LZ0 A;  5CPI C;  3H0M C;  1HTA A;  5AV8 B;  1B6W A;  2CV5 A;  5AV5 A;  4G92 B;  1S32 C;  3B0C W;  1TZY B;  4R8P B;  3MNN C;  3EPJ A;  4J8V B;  3AZL A;  5DNM D;  3UTB D;  3WKJ A;  3O62 C;  4H9N A;  5GXQ B;  2HIO D;  3FDD A;  5GSU D;  5AV6 B;  3WAA C;  1M19 B;  3C1C D;  3MNN A;  4YS3 D;  3UTB C;  5B33 D;  3AZH A;  5AY8 D;  4CAY A;  5GT3 C;  5AVC D;  3O62 A;  1P3P B;  3LZ0 B;  5GSU C;  2HIO C;  3AZF D;  3W98 D;  2XD1 A;  5GT0 D;  2CV5 B;  2FFF B;  3C1C C;  4LD9 D;  5AV5 B;  4DRB A;  4YS3 C;  5B40 D;  3LEL D;  1P34 D;  5DNM A;  3AZL B;  3UTB A;  4ZUX A;  5B33 C;  2XD5 A;  3WKJ B;  5AVC C;  1KX5 D;  5GSU A;  2HIO A;  5CPI B;  3AZF C;  3W98 C;  5GT0 C;  3C1C A;  5JA4 A;  1S32 B;  1N1J A;  4YS3 A;  3MNN B;  4WJ3 C;  3REJ D;  5B40 C;  3LEL C;  5DNN D;  1P34 C;  3VH5 T;  4Z5T D;  5AY8 A;  3AZH B;  4CAY B;  5AVC A;  1KX5 C;  3O62 B;  3AZF A;  3W98 A;  5BNX A;  5GT0 A;  4LD9 A;  3V9R A;  2G5H C;  1P3B D;  2Y2M A;  5B40 A;  3LEL A;  1P34 A;  5DNM B;  4WU8 A;  3UTB B;  1HQ3 C;  4Z5T C;  4ZUX B;  1KX5 A;  2Y2H A;  4H9Q A;  5GSU B;  2HIO B;  2UWX A;  3AZK A;  1BH9 B;  3C1C B;  5JA4 B;  1N1J B;  3REJ A;  2BYM A;  4YS3 B;  5DNN A;  3MGS D;  3W99 A;  2FJ7 D;  1WWI A;  5AY8 B;  3REK D;  5AVC B;  3AZE D;  2HUE C;  3AZF B;  3W98 B;  4NE6 A;  3REH D;  5BNX B;  1W2E A;  3B6G D;  5GT0 B;  2DQN C;  3AZJ D;  3X1U D;  4LD9 B;  3V9R B;  1P3B A;  5C3I B;  5B40 B;  3LEL B;  1P34 B;  3MGS C;  2FJ7 C;  1KU5 A;  1KX3 C;  3AZE C;  1KX5 B;  4H9Q B;  3X1V C;  3AV2 D;  1M1A D;  3AZG D;  3B6G C;  3AZK B;  3AZJ C;  4YM6 D;  1PZR A;  4J8W A;  4NFT A;  5F99 C;  3REJ B;  2BYM B;  3MGS A;  4JJN D;  5DNN B;  5BT1 D;  3W99 B;  5AVB D;  3EPH A;  1KX4 C;  3REK A;  3AZE A;  3B0D C;  3UTA D;  3AV2 C;  3REH A;  1M1A C;  3AZG C;  1ID3 D;  3B6G A;  3X1U A;  3WTP D;  4YM6 C;  1P3B B;  4QLC D;  4E45 A;  4J8V A;  4JJN C;  5BT1 C;  3LZ1 D;  5AVB C;  4H9O A;  5CP6 D;  4XUJ D;  5GXQ A;  3UTA C;  3AV2 A;  1M1A A;  3AZG A;  1ID3 C;  1F1E A;  3WTP C;  4YM6 A;  2Y2P A;  4J8W B;  4QLC C;  4X23 D;  4JJN A;  3MGS B;  1P3F D;  1P3M D;  3REK B;  5CP6 C;  3AZE B;  4XUJ C;  4KUD A;  3UTA A;  3WTP E;  5B32 G;  3REH B;  3WAA D;  3B6G B;  1BFM A;  3H0L C;  3WTP A;  3X1U B;  3AZJ B;  2Y2I A;  4WV4 B;  3A6N D;  4QLC A;  5B24 B;  4X23 C;  3W97 D;  3LZ1 A;  1P3F C;  4H9O B;  3VH6 T;  1P3M C;  5CP6 A;  4XUJ A;  5GT3 D;  5CPI A;  3AV2 B;  1M1A B;  3AZG B;  1T3U A;  4WNN A;  1S32 A;  2F8N D;  4YM6 B;  2Y2N A;  3A6N C;  3W96 D;  4X23 A;  4JJN B;  1P3F A;  3W97 C;  5AVB B;  3A1K A;  4KUD B;  3UTA B;  3AN2 C;  3WAA A;  2VQR A;  1ID3 B;  3AZI D;  3WTP B;  1Z2C B;  3A6N A;  5B31 G;  3W96 C;  3W97 A;  4QLC B;  5B0Z D;  3LZ1 B;  3WA9 C;  3IP4 C;  5CP6 B;  5GT3 A;  4XUJ B;  2JSS A;  3KXB D;  4E44 A;  3EG5 B;  3AZI C;  1BH9 A;  4WNN B;  3W96 A;  5B24 C;  4X23 B;  2NZD C;  5B0Z C;  1P3F B;  1P3O D;  5B33 A;  1HQ3 D;  4H9R A;  4Z66 C;  1P3L C;  2ZY2 A;  3TU4 D;  3KXB C;  3WAA B;  3AZI A;  3A6N B;  1P3G D;  3KFU G;  5BS7 C;  5B0Z A;  3W97 B;  3REL D;  1P3O C;  3NQU A;  5B32 D;  2BYK A;  5GT3 B;  3TU4 C;  5B2I D;  3KXB A;  3AV1 D;  2IO5 C;  4J8U D;  3W96 B;  5BS7 A;  1P3G C;  2Y2L A;  1P3O A;  3REL C;  1HQ3 A;  4Z5T A;  1H3O A;  5JRG D;  5B33 B;  5B32 C;  1KX3 D;  4H9R B;  3TU4 A;  3X1V D;  4Z2M G;  5B2I C;  4J8X D;  3AFA D;  2CWE A;  3AZI B;  3AV1 C;  4J8U C;  2G5I C;  3B0C T;  1M18 C;  4WU9 D;  5AV9 D;  4UUZ A;  1P3G A;  5F99 D;  1EQZ D;  3KSY A;  5B0Z B;  4DRA A;  5B32 A;  5JRG C;  5B0Y D;  3NQU B;  1KX4 D;  2F8N G;  1AOI D;  2BYK B;  2F8N H;  2F2A C;  2JCH A;  5B2I A;  3KXB B;  4J8X C;  5B31 D;  3AFA C;  3AV1 A;  4J8U A;  2LY8 A;  3X1S D;  4WU9 C;  5AV9 C;  1EQZ C;  1P3O B;  2FJ7 A;  5JRG A;  1KX3 A;  5B0Y C;  1HQ3 B;  4Z5T B;  1H3O B;  2Y2Q A;  5B2J C;  3MGP D;  1R4V A;  1AOI C;  3AZM D;  3X1V A;  3TU4 B;  3UT9 D;  4J8X A;  3X1T D;  3AFA A;  2DF4 C;  5B31 C;  2IO5 B;  4G91 C;  3AZJ A;  4WU9 A;  5AV9 A;  3X1S C;  5F99 A;  4UUZ B;  1P3G B;  1EQZ A;  3REL B;  5B0Y A;  1KX4 A;  5B32 B;  1AOI A;  4M6B A;  3MGP C;  2W8S A;  3B6F D;  3AZM C;  5FUG A;  2HUE B;  1P3I D;  5BO0 A;  3UT9 C;  5B2I B;  5B31 A;  3X1T C;  4H9S C;  4J8U B;  3AV1 B;  3X1S A;  5AVB A;  2FJ7 B;  5JRG B;  1KX3 B;  3AYW D;  5CHL B;  5AV6 C;  3MGP A;  3B6F C;  4KGC D;  3AZM A;  1P3I C;  2L5A A;  1M19 C;  3UT9 A;  3X1V B;  3X1T A;  2Y2K A;  4J8X B;  3AFA B;  4H9S A;  1ID3 A;  1B67 A;  2NQB D;  4WU9 B;  2YFW A;  5AV9 B;  5E5A D;  5F99 B;  5CPK D;  1EQZ B;  1F66 D;  2ARO D;  4H9P A;  5B0Y B;  3AYW C;  1KX4 B;  3B6F A;  1AOI B;  1TAF A;  4KGC C;  3B0D B;  1P3I A;  5FUG B;  5G49 A;  4EO5 C;  5BO0 B;  2JE5 A;  3AN2 D;  5B31 B;  4G91 B;  2PYO D;  3AZL C;  2NQB C;  3X1S B;  3KWQ D;  5E5A C;  5CPK C;  1F66 C;  2ARO C;  3AYW A;  1P3M A;  3WA9 D;  4KGC A;  3MGP B;  1WWS A;  3AZM B;  4XZQ D;  3MGR D;  3UT9 B;  3X1T B;  2PYO C;  2NQB A;  4CSR A;  4ZUX D;  3KWQ C;  2YFW B;  5E5A A;  5B24 D;  3AZH C;  5CPK A;  2NZD D;  1F66 A;  3KUY D;  2ARO A;  4H9P B;  3B6F B;  1TAF B;  1P3K D;  4XZQ C;  4Z66 D;  1P3L D;  1P3I B;  5G49 B;  3B0B A;  3AN2 A;  3MGR C;  2PYO A;  1U35 D;  2F8N A;  2RIQ A;  5DNM C;  3KWQ A;  4ZUX C;  1P3A D;  3AL0 C;  3KUY C;  1A7W A;  3WA9 A;  3AYW B;  1P3M B;  4KGC B;  5B1M D;  2Y2G A;  4XZQ A;  1P3K C;  3MVD D;  4EO5 B;  3MGR A;  3EPL A;  3EPK A;  3F6T A;  1BH8 A;  3VH6 A;  1U35 C;  2NQB B;  4CSR B;  1ULY A;  4WU8 D;  5BNV A;  5AY8 C;  5B24 A;  5E5A B;  2ZY3 A;  5CPK B;  1P3A C;  2NZD A;  3KUY A;  1F66 B;  2ARO B;  4H9N B;  3C1B D;  5B1M C;  1P3K A;  4HGA C;  4Z66 A;  1P3L A;  3MVD C;  3AZK D;  2BG1 A;  1Q9C A;  3AN2 B;  4LD9 C;  5C3I C;  1U35 A;  1ZLA D;  2PYO B;  4ZBJ C;  3W99 D;  2ZM5 A;  4AWL C;  3KWQ B;  2YFV A;  4WU8 C;  1M18 D;  2F8N B;  1P3A A;  3WA9 B;  3C1B C;  5B1M A;  2ZY4 A;  3MVD A;  4XZQ B;  3AZK C;  3LJA D;  3MGR B;  5CPJ D;  1BH8 B;  4Z2M H;  3REJ C;  3P5J B;  1ZLA C;  5DNN C;  3W99 C;  3REI D;  5BNV B; 
#chains in the Genus database with same CATH homology
 4NE5 A;  3R45 A;  3AZN D;  3VH6 W;  5KDM A;  2NZD B;  3KUY B;  3REL A;  3C1B A;  5B2J D;  1P3K B;  4Z66 B;  1P3L B;  3MGQ D;  3LJA C;  3VH5 A;  2RVQ D;  1P3B C;  5CPJ C;  4J8W D;  1ZLA A;  1U35 B;  3NQJ A;  5B1L D;  1M18 A;  2YFV B;  3REI C;  1P3A B;  3AZN C;  2F8N K;  4KHA A;  5B1M B;  4HGA B;  5AV8 D;  3MVD B;  3MGQ C;  3LJA A;  2RVQ C;  5CPJ A;  1TZY D;  4R8P D;  4J8W C;  5B1L C;  2Y2O A;  4ZBJ B;  4J8V D;  4AWL B;  4WU8 B;  3REI A;  3AZN A;  3REK C;  3R45 B;  5KDM B;  4DQY B;  5GXQ D;  5B2J A;  3C1B B;  5AV6 D;  3REH C;  5AV8 C;  3MGQ A;  1M19 D;  3X1U C;  3H0R C;  4G92 C;  4UPK A;  1TZY C;  4R8P C;  5B1L A;  1ZLA B;  3NQJ B;  4J8V C;  1M18 B;  3A1I A;  3VH5 W;  1JFI A;  4KUD D;  1P3P D;  2J8P A;  5GXQ C;  3LZ0 D;  4KHA B;  5AV8 A;  2CV5 D;  3LJA B;  5AV5 D;  5CPJ B;  1TZY A;  4R8P A;  3AZL D;  3REI B;  4WZS B;  3AZN B;  3WKJ D;  2Y2J A;  4KUD C;  5CPI D;  3LZ0 C;  1P3P C;  5AV6 A;  5B2J B;  1M19 A;  4NE3 A;  3MGQ B;  2CV5 C;  2ZY5 A;  1S32 D;  5AV5 C;  3MNN D;  5B1L B;  3LZ1 C;  3AZH D;  1JFI B;  3WKJ C;  3O62 D;  1P3P A;  3LZ0 A;  5CPI C;  3H0M C;  1HTA A;  5AV8 B;  1B6W A;  2CV5 A;  5AV5 A;  4G92 B;  1S32 C;  3B0C W;  1TZY B;  4R8P B;  3MNN C;  3EPJ A;  4J8V B;  3AZL A;  5DNM D;  3UTB D;  3WKJ A;  3O62 C;  4H9N A;  5GXQ B;  2HIO D;  3FDD A;  5GSU D;  5AV6 B;  3WAA C;  1M19 B;  3C1C D;  3MNN A;  4YS3 D;  3UTB C;  5B33 D;  3AZH A;  5AY8 D;  4CAY A;  5GT3 C;  5AVC D;  3O62 A;  1P3P B;  3LZ0 B;  5GSU C;  2HIO C;  3AZF D;  3W98 D;  2XD1 A;  5GT0 D;  2CV5 B;  2FFF B;  3C1C C;  4LD9 D;  5AV5 B;  4DRB A;  4YS3 C;  5B40 D;  3LEL D;  1P34 D;  5DNM A;  3AZL B;  3UTB A;  4ZUX A;  5B33 C;  2XD5 A;  3WKJ B;  5AVC C;  1KX5 D;  5GSU A;  2HIO A;  5CPI B;  3AZF C;  3W98 C;  5GT0 C;  3C1C A;  5JA4 A;  1S32 B;  1N1J A;  4YS3 A;  3MNN B;  4WJ3 C;  3REJ D;  5B40 C;  3LEL C;  5DNN D;  1P34 C;  3VH5 T;  4Z5T D;  5AY8 A;  3AZH B;  4CAY B;  5AVC A;  1KX5 C;  3O62 B;  3AZF A;  3W98 A;  5BNX A;  5GT0 A;  4LD9 A;  3V9R A;  2G5H C;  1P3B D;  2Y2M A;  5B40 A;  3LEL A;  1P34 A;  5DNM B;  4WU8 A;  3UTB B;  1HQ3 C;  4Z5T C;  4ZUX B;  1KX5 A;  2Y2H A;  4H9Q A;  5GSU B;  2HIO B;  2UWX A;  3AZK A;  1BH9 B;  3C1C B;  5JA4 B;  1N1J B;  3REJ A;  2BYM A;  4YS3 B;  5DNN A;  3MGS D;  3W99 A;  2FJ7 D;  1WWI A;  5AY8 B;  3REK D;  5AVC B;  3AZE D;  2HUE C;  3AZF B;  3W98 B;  4NE6 A;  3REH D;  5BNX B;  1W2E A;  3B6G D;  5GT0 B;  2DQN C;  3AZJ D;  3X1U D;  4LD9 B;  3V9R B;  1P3B A;  5C3I B;  5B40 B;  3LEL B;  1P34 B;  3MGS C;  2FJ7 C;  1KU5 A;  1KX3 C;  3AZE C;  1KX5 B;  4H9Q B;  3X1V C;  3AV2 D;  1M1A D;  3AZG D;  3B6G C;  3AZK B;  3AZJ C;  4YM6 D;  1PZR A;  4J8W A;  4NFT A;  5F99 C;  3REJ B;  2BYM B;  3MGS A;  4JJN D;  5DNN B;  5BT1 D;  3W99 B;  5AVB D;  3EPH A;  1KX4 C;  3REK A;  3AZE A;  3B0D C;  3UTA D;  3AV2 C;  3REH A;  1M1A C;  3AZG C;  1ID3 D;  3B6G A;  3X1U A;  3WTP D;  4YM6 C;  1P3B B;  4QLC D;  4E45 A;  4J8V A;  4JJN C;  5BT1 C;  3LZ1 D;  5AVB C;  4H9O A;  5CP6 D;  4XUJ D;  5GXQ A;  3UTA C;  3AV2 A;  1M1A A;  3AZG A;  1ID3 C;  1F1E A;  3WTP C;  4YM6 A;  2Y2P A;  4J8W B;  4QLC C;  4X23 D;  4JJN A;  3MGS B;  1P3F D;  1P3M D;  3REK B;  5CP6 C;  3AZE B;  4XUJ C;  4KUD A;  3UTA A;  3WTP E;  5B32 G;  3REH B;  3WAA D;  3B6G B;  1BFM A;  3H0L C;  3WTP A;  3X1U B;  3AZJ B;  2Y2I A;  4WV4 B;  3A6N D;  4QLC A;  5B24 B;  4X23 C;  3W97 D;  3LZ1 A;  1P3F C;  4H9O B;  3VH6 T;  1P3M C;  5CP6 A;  4XUJ A;  5GT3 D;  5CPI A;  3AV2 B;  1M1A B;  3AZG B;  1T3U A;  4WNN A;  1S32 A;  2F8N D;  4YM6 B;  2Y2N A;  3A6N C;  3W96 D;  4X23 A;  4JJN B;  1P3F A;  3W97 C;  5AVB B;  3A1K A;  4KUD B;  3UTA B;  3AN2 C;  3WAA A;  2VQR A;  1ID3 B;  3AZI D;  3WTP B;  1Z2C B;  3A6N A;  5B31 G;  3W96 C;  3W97 A;  4QLC B;  5B0Z D;  3LZ1 B;  3WA9 C;  3IP4 C;  5CP6 B;  5GT3 A;  4XUJ B;  2JSS A;  3KXB D;  4E44 A;  3EG5 B;  3AZI C;  1BH9 A;  4WNN B;  3W96 A;  5B24 C;  4X23 B;  2NZD C;  5B0Z C;  1P3F B;  1P3O D;  5B33 A;  1HQ3 D;  4H9R A;  4Z66 C;  1P3L C;  2ZY2 A;  3TU4 D;  3KXB C;  3WAA B;  3AZI A;  3A6N B;  1P3G D;  3KFU G;  5BS7 C;  5B0Z A;  3W97 B;  3REL D;  1P3O C;  3NQU A;  5B32 D;  2BYK A;  5GT3 B;  3TU4 C;  5B2I D;  3KXB A;  3AV1 D;  2IO5 C;  4J8U D;  3W96 B;  5BS7 A;  1P3G C;  2Y2L A;  1P3O A;  3REL C;  1HQ3 A;  4Z5T A;  1H3O A;  5JRG D;  5B33 B;  5B32 C;  1KX3 D;  4H9R B;  3TU4 A;  3X1V D;  4Z2M G;  5B2I C;  4J8X D;  3AFA D;  2CWE A;  3AZI B;  3AV1 C;  4J8U C;  2G5I C;  3B0C T;  1M18 C;  4WU9 D;  5AV9 D;  4UUZ A;  1P3G A;  5F99 D;  1EQZ D;  3KSY A;  5B0Z B;  4DRA A;  5B32 A;  5JRG C;  5B0Y D;  3NQU B;  1KX4 D;  2F8N G;  1AOI D;  2BYK B;  2F8N H;  2F2A C;  2JCH A;  5B2I A;  3KXB B;  4J8X C;  5B31 D;  3AFA C;  3AV1 A;  4J8U A;  2LY8 A;  3X1S D;  4WU9 C;  5AV9 C;  1EQZ C;  1P3O B;  2FJ7 A;  5JRG A;  1KX3 A;  5B0Y C;  1HQ3 B;  4Z5T B;  1H3O B;  2Y2Q A;  5B2J C;  3MGP D;  1R4V A;  1AOI C;  3AZM D;  3X1V A;  3TU4 B;  3UT9 D;  4J8X A;  3X1T D;  3AFA A;  2DF4 C;  5B31 C;  2IO5 B;  4G91 C;  3AZJ A;  4WU9 A;  5AV9 A;  3X1S C;  5F99 A;  4UUZ B;  1P3G B;  1EQZ A;  3REL B;  5B0Y A;  1KX4 A;  5B32 B;  1AOI A;  4M6B A;  3MGP C;  2W8S A;  3B6F D;  3AZM C;  5FUG A;  2HUE B;  1P3I D;  5BO0 A;  3UT9 C;  5B2I B;  5B31 A;  3X1T C;  4H9S C;  4J8U B;  3AV1 B;  3X1S A;  5AVB A;  2FJ7 B;  5JRG B;  1KX3 B;  3AYW D;  5CHL B;  5AV6 C;  3MGP A;  3B6F C;  4KGC D;  3AZM A;  1P3I C;  2L5A A;  1M19 C;  3UT9 A;  3X1V B;  3X1T A;  2Y2K A;  4J8X B;  3AFA B;  4H9S A;  1ID3 A;  1B67 A;  2NQB D;  4WU9 B;  2YFW A;  5AV9 B;  5E5A D;  5F99 B;  5CPK D;  1EQZ B;  1F66 D;  2ARO D;  4H9P A;  5B0Y B;  3AYW C;  1KX4 B;  3B6F A;  1AOI B;  1TAF A;  4KGC C;  3B0D B;  1P3I A;  5FUG B;  5G49 A;  4EO5 C;  5BO0 B;  2JE5 A;  3AN2 D;  5B31 B;  4G91 B;  2PYO D;  3AZL C;  2NQB C;  3X1S B;  3KWQ D;  5E5A C;  5CPK C;  1F66 C;  2ARO C;  3AYW A;  1P3M A;  3WA9 D;  4KGC A;  3MGP B;  1WWS A;  3AZM B;  4XZQ D;  3MGR D;  3UT9 B;  3X1T B;  2PYO C;  2NQB A;  4CSR A;  4ZUX D;  3KWQ C;  2YFW B;  5E5A A;  5B24 D;  3AZH C;  5CPK A;  2NZD D;  1F66 A;  3KUY D;  2ARO A;  4H9P B;  3B6F B;  1TAF B;  1P3K D;  4XZQ C;  4Z66 D;  1P3L D;  1P3I B;  5G49 B;  3B0B A;  3AN2 A;  3MGR C;  2PYO A;  1U35 D;  2F8N A;  2RIQ A;  5DNM C;  3KWQ A;  4ZUX C;  1P3A D;  3AL0 C;  3KUY C;  1A7W A;  3WA9 A;  3AYW B;  1P3M B;  4KGC B;  5B1M D;  2Y2G A;  4XZQ A;  1P3K C;  3MVD D;  4EO5 B;  3MGR A;  3EPL A;  3EPK A;  3F6T A;  1BH8 A;  3VH6 A;  1U35 C;  2NQB B;  4CSR B;  1ULY A;  4WU8 D;  5BNV A;  5AY8 C;  5B24 A;  5E5A B;  2ZY3 A;  5CPK B;  1P3A C;  2NZD A;  3KUY A;  1F66 B;  2ARO B;  4H9N B;  3C1B D;  5B1M C;  1P3K A;  4HGA C;  4Z66 A;  1P3L A;  3MVD C;  3AZK D;  2BG1 A;  1Q9C A;  3AN2 B;  4LD9 C;  5C3I C;  1U35 A;  1ZLA D;  2PYO B;  4ZBJ C;  3W99 D;  2ZM5 A;  4AWL C;  3KWQ B;  2YFV A;  4WU8 C;  1M18 D;  2F8N B;  1P3A A;  3WA9 B;  3C1B C;  5B1M A;  2ZY4 A;  3MVD A;  4XZQ B;  3AZK C;  3LJA D;  3MGR B;  5CPJ D;  1BH8 B;  4Z2M H;  3REJ C;  3P5J B;  1ZLA C;  5DNN C;  3W99 C;  3REI D;  5BNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...