5CP6B

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6B00
3AZIB 3MGPB 3MGRB 1N1JB 2AROD 3KUYA 4J8WD 3X1SC 3W96C 5CPKD 5BNVB 3C1BD 3AYWD 3X1SA 1P3ID 3W96A 5E5AC 3B6FD 2NZDD 4QLCB 3AZHA 3MNNB 1M18D 5GT3C 1ZLAC 3VH5T 4G92C 5B24C 2F8NB 4G91C 1P3AD 3B0DB 1H3OB 4H9PA 3REID 5BT1C 2YFWB 4HGAC 3REJA 2IO5B 5F99C 3MGQD 5F99A 1KX5D 5BS7C 5BS7A 3MGSD 3WA9B 1S32C 2BYKA 5B1LA 5GT0B 1TZYC 4NE3A 1S32A 1P3LB 5KDMA 4H9OA 5B32G 4R8PB 3LZ1B 2YFVA 4EO5B 3UTAC 3AZKD 5CPID 1P3PD 3AZLA 5AV9D 5B33D 4WZSB 1A7WA 3MGRD 1WWSA 1P3GB 1HQ3C 5AV8B 5CPJB 1P3BC 5AV5B 3KWQD 3AV1C 3MNND 4YS3C 4H9RA 3AV1A 4YS3A 5AVBC 3AZFC 2F8ND 4H9NB 5AVBA 3VH6A 5B2JC 5B2JA 5B0ZC 5GSUC 3LZ0B 2CWEA 3KXBC 5GSUA 1U35C 4XZQA 3TU4B 3NQJB 1ID3C 5B32B 4CSRA 5GT0D 4WU9B 1KX3C 3B6GC 4J8UC 4JJNC 5CP6C 1P3LD 3R45B 1KX3A 3B6GA 4J8UA 1EQZB 3AZMB 4Z66D 3UTBB 5JRGB 5B1MC 3MVDC 3RELA 5B1MA 1KU5A 3WTPB 1B67A 1P3GD 2L5AA 4Z5TB 3AZEB 3LJAC 5CPJD 4KUDC 3REKC 4M6BA 5AV5D 4WV4B 3REKA 3AN2B 2NQBD 5B31C 3AZNB 3C1CC 1M1AC 1P3KB 3C1CA 1M1AA 3LZ0D 2FJ7C 4X23A 5CPKC 4E44A 3C1BC 1P3IB 2AROA 4J8WA 5CPKA 3TU4D 3C1BA 1Q9CA 1TAFA 3AYWA 1M18B 1P3FC 5B32D 2HIOC 3AZGC 3WAAD 5GXQC 3B6FA 2NZDA 1P3FA 3AZGA 4J8VD 4WU9D 1P3AC 4KHAA 1EQZD 5JA4B 1P3AA 3W99B 2LY8A 3UTBD 3REIA 3W97C 1F66C 2RVQC 4WU8D 3MGQC 3WTPD 3X1UC 1KX5C 4Z5TD 3MGQA 3AZED 1KX5A 3AV2C 3MGSA 3AV2A 4ZUXC 3AN2D 4XUJB 2JSSA 1BH9A 1ULYA 4ZUXA 1KX4C 3A6NC 5CPIC 3LELC 3AZJB 3AZKC 3WKJB 5DNMC 3A6NA 5AV9C 5CPIA 4NE6A 5BO0B 3AZKA 1P3PA 5B33C 1P3KD 3KUYC 3REHB 5AV9A 3AZIC 3NQUB 3MGPC 5B33A 3MGRC 1R4VA 4H9QB 3AZIA 3UT9B 3MGPA 3MGRA 3B0CW 3AZHC 1N1JA 4ZBJB 5B2ID 3KWQB 5BNVA 4QLCC 5C3IB 3W98B 5B40B 4QLCA 3MNNA 3X1VB 2CV5D 5AV6B 3B0DC 3REJC 3W99D 4UUZB 1P3OB 2YFWA 5BNXB 3X1TB 5B1LC 3WA9C 5E5AB 5GT0C 5GT3B 3WA9A 4XUJD 1ZLAB 5GT0A 3O62B 2PYOB 5B24B 3AZLC 1P3LA 4Z66B 4R8PC 3LZ1C 4G91B 4EO5C 3AZJD 3WKJD 4R8PA 3LZ1A 3REHD 4HGAB 1P3GC 1BH8B 3UT9D 5AV8C 4LD9D 1P3GA 1JFIB 5AV5C 5AV8A 5CPJA 3W98D 5B40D 5AV5A 2NQBB 3X1VD 1TZYB 5AY8B 5AV6D 4H9NA 3UTAB 4E45A 1P3OD 3LZ0C 4XZQC 3LZ0A 3X1SD 3X1TD 1HQ3B 3WAAB 3VH6W 1P3BB 4KGCB 3TU4A 5FUGB 3NQJA 5E5AD 4CAYB 4J8VB 5B32A 5GT3D 4WU9C 1AOIB 1ZLAD 3O62D 4WU9A 2PYOD 3WTPE 5B24D 3AZFB 3AZMC 3R45A 4WNNB 3RELC 1EQZA 3UTBC 3AZMA 5JRGC 5BT1D 4WU8B 3UTBA 5JRGA 5B0ZB 5B31G 5F99D 5DNNB 3AZEC 3WTPA 3KXBB 1U35B 4Z5TA 3AZEA 1ID3B 1S32D 1TZYD 3AZNC 4JJNB 5AY8D 5CP6B 3AZNA 5AVCB 1BFMA 3UTAD 4X23C 1P3KA 3MVDB 2AROC 4J8WC 3AYWC 1P3IC 5B2IB 3B6FC 1HQ3D 3LJAB 1M18C 4Z2MG 1P3IA 4KUDB 1P3BD 4KGCD 1M18A 2HUEB 2CV5B 4Z2MH 1AOID 5B31B 5AVBD 3AZFD 3REIC 1B6WA 5JA4A 4YM6B 3C1CB 3W99A 3VH5A 3AFAB 5B0ZD 4DRAA 1HTAA 2FJ7B 5DNND 2BYMB 3MGSC 3KXBD 1U35D 1ID3D 2HIOB 1M19B 5GXQB 4XUJA 4J8UD 4JJND 1P3PC 5CP6D 3WKJC 5AVCD 4AWLB 3AZJA 1P34B 3WKJA 5BO0A 5B1MD 4NE5A 3V9RB 3MVDD 3REHA 1F66B 3W97B 4LD9B 3NQUA 5B0YB 4ZBJC 3X1UB 4H9QA 1P3MB 3UT9A 3KWQC 3LJAD 5C3IC 3MNNC 4KUDD 3KSYA 3KWQA 3REKD 3W98A 5B40A 4J8XB 5G49B 3X1VA 1KX4B 5B31D 2F8NA 5AV6A 3LELB 1H3OA 5DNMB 4YM6D 2IO5C 3C1CD 4UUZA 3KUYB 3AFAD 1P3OA 3X1SB 2FJ7D 3W96B 3X1TC 3AZHB 5BNXA 3X1TA 1P3FD 2HIOD 3AZGD 1M19D 5GXQD 5E5AA 1P3LC 3O62C 5GT3A 4G92B 2PYOC 4H9PB 1ZLAA 4DRBA 3O62A 4Z66C 2PYOA 5B24A 4Z66A 1P34D 3REJB 5F99B 3W97D 1F66D 3B0CT 2RVQD 5CPJC 2F8NK 5B0YD 1BH8A 3X1UD 1P3MD 2BYKB 5B1LB 3AV2D 1JFIA 1S32B 2NQBC 5KDMB 4H9OB 4ZUXD 2NQBA 4J8XD 5AY8C 5CHLB 2YFVB 1TZYA 1KX4D 1F1EA 3AZLB 5AY8A 4H9SC 3A6ND 3LELD 1WWIA 4H9SA 5DNMD 3UTAA 2NZDC 3KUYD 3AZID 3MGPD 3TU4C 3W96D 3WAAC 5B32C 3AZHD 4KGCC 4H9RB 1HQ3A 3AV1B 3WAAA 4QLCD 4J8VC 4YS3B 1P3BA 4KGCA 5FUGA 4CAYA 1AOIC 4J8VA 5AVBB 1EQZC 1AOIA 5B2JB 3AZFA 4WNNA 3REJD 4WU8C 3WTPC 5GSUB 4WU8A 4Z5TC 4XZQB 5DNNC 5B0ZA 4CSRB 5DNNA 3KXBA 5B1LD 1U35A 3AN2C 3WA9D 1ID3A 3AN2A 1KX3B 3B6GB 4J8UB 5AVCC 4JJNA 3AZLD 5CP6A 4R8PD 3LZ1D 1P3KC 5AVCA 3RELB 5B1MB 3MVDA 5B2IC 3VH6T 5AV8D 5B2IA 3REKB 3LJAA 2HUEC 3AV1D 2CV5C 4KUDA 4YS3D 2CV5A 3W99C 5B31A 5B2JD 1M1AB 4YM6C 3B0BA 4X23B 3AFAC 4YM6A 5GSUD 2AROB 4J8WB 3AFAA 4XZQD 5CPKB 3C1BB 1TAFB 3AYWB 2FJ7A 3B6FB 2NZDB 2BYMA 1P3FB 3AZGB 1M19C 4XUJC 3VH5W 2HIOA 1M19A 1KX3D 4KHAB 5GXQA 3B6GD 3AZJC 1P3AB 4AWLC 3AZMD 3REIB 1P34C 3REHC 3RELD 1P34A 5JRGD 2F8NG 3UT9C 3MGQB 4LD9C 3W97A 3V9RA 5B0YC 1KX5B 1F66A 1P3MC 2F8NH 4LD9A 5B0YA 3W98C 3MGSB 3X1UA 5B40C 3AV2B 1P3MA 1BH9B 3X1VC 4ZUXB 4J8XC 5AV6C 4J8XA 3AZND 3A6NB 5G49A 5CPIB 1P3PB 3AZKB 1KX4A 5AV9B 4NFTA 1M1AD 3LELA 1P3OC 5B33B 5DNMA 4X23D
chains in the Genus database with same CATH superfamily
3AZIB 3MGPB 4DQYB 3MGRB 1N1JB 2AROD 3KUYA 4J8WD 3X1SC 3W96C 5CPKD 5BNVB 1W2EA 3C1BD 3AYWD 3X1SA 1P3ID 3W96A 5E5AC 3B6FD 2NZDD 4QLCB 3AZHA 3MNNB 1M18D 5GT3C 1ZLAC 3VH5T 3EPKA 4G92C 5B24C 2F8NB 4G91C 2DQNC 1P3AD 3B0DB 1H3OB 4H9PA 3REID 5BT1C 2YFWB 4HGAC 3REJA 2IO5B 5F99C 2ZY2A 3MGQD 5F99A 1KX5D 5BS7C 5BS7A 3MGSD 3WA9B 1S32C 2BYKA 5B1LA 5GT0B 1TZYC 4NE3A 1S32A 1P3LB 5KDMA 4H9OA 2ZY5A 5B32G 4R8PB 3LZ1B 2YFVA 4EO5B 3UTAC 3AZKD 5CPID 1P3PD 3AZLA 5AV9D 5B33D 4WZSB 1Z2CB 1A7WA 3MGRD 1WWSA 1P3GB 1HQ3C 5AV8B 5CPJB 1P3BC 5AV5B 3A1KA 3KWQD 3AV1C 3MNND 4YS3C 4H9RA 3AV1A 4YS3A 5AVBC 3AZFC 2F8ND 4H9NB 5AVBA 3VH6A 5B2JC 2Y2KA 5B2JA 5B0ZC 5GSUC 3LZ0B 2CWEA 3KXBC 5GSUA 1U35C 4XZQA 3TU4B 3NQJB 2G5IC 1ID3C 5B32B 4CSRA 5GT0D 2VQRA 4WU9B 1KX3C 3B6GC 4J8UC 4JJNC 5CP6C 1P3LD 3R45B 1KX3A 3B6GA 4J8UA 1EQZB 3AZMB 4Z66D 3UTBB 5JRGB 5B1MC 3MVDC 3RELA 2Y2IA 5B1MA 1KU5A 3WTPB 1B67A 1P3GD 2L5AA 1T3UA 4Z5TB 3LJAC 3AZEB 5CPJD 4KUDC 3REKC 4M6BA 5AV5D 2BG1A 4WV4B 3REKA 3AN2B 2NQBD 5B31C 3AZNB 3C1CC 1M1AC 1P3KB 3C1CA 1M1AA 3EG5B 3LZ0D 2FJ7C 4X23A 5CPKC 4E44A 2W8SA 3C1BC 1P3IB 2AROA 4J8WA 5CPKA 3TU4D 3C1BA 1Q9CA 1TAFA 3AYWA 1M18B 1P3FC 5B32D 2HIOC 3AZGC 3WAAD 5GXQC 3B6FA 2NZDA 1P3FA 3AZGA 4J8VD 4WU9D 2Y2NA 2J8PA 1P3AC 4KHAA 1EQZD 5JA4B 1P3AA 3W99B 2LY8A 3UTBD 3REIA 3W97C 1F66C 2RVQC 4WU8D 3MGQC 3WTPD 3X1UC 1KX5C 4Z5TD 3MGQA 3AZED 1KX5A 3AV2C 2RIQA 3MGSA 3AV2A 4ZUXC 3AN2D 2Y2LA 2JSSA 4XUJB 1BH9A 1ULYA 4ZUXA 1KX4C 3A6NC 5CPIC 3LELC 3AZJB 3AZKC 3WKJB 5DNMC 3A6NA 3H0LC 5AV9C 5CPIA 4NE6A 5BO0B 3AZKA 1P3PA 5B33C 1P3KD 3KUYC 3REHB 5AV9A 3AZIC 3NQUB 3MGPC 5B33A 3MGRC 1R4VA 4H9QB 3AZIA 3UT9B 3MGPA 3MGRA 3B0CW 3AZHC 1N1JA 4ZBJB 5B2ID 3KWQB 5BNVA 4QLCC 5C3IB 3W98B 5B40B 2Y2QA 4QLCA 3MNNA 3X1VB 2CV5D 3P5JB 5AV6B 3B0DC 3REJC 3W99D 4UUZB 1P3OB 2YFWA 5BNXB 3EPLA 3X1TB 5B1LC 3WA9C 5E5AB 5GT0C 5GT3B 3WA9A 4XUJD 1ZLAB 5GT0A 3O62B 2JE5A 2PYOB 5B24B 3AZLC 1P3LA 4Z66B 4R8PC 3LZ1C 4G91B 4EO5C 3AZJD 3WKJD 4R8PA 3LZ1A 3REHD 4HGAB 1P3GC 1BH8B 3UT9D 5AV8C 4LD9D 1P3GA 1JFIB 5AV5C 5AV8A 5CPJA 3W98D 5B40D 5AV5A 2ZY3A 2NQBB 3X1VD 1TZYB 5AY8B 5AV6D 4H9NA 3UTAB 4E45A 1P3OD 3LZ0C 4XZQC 3LZ0A 3X1SD 3X1TD 1HQ3B 3WAAB 2Y2PA 3VH6W 1P3BB 4KGCB 3TU4A 5FUGB 3NQJA 5E5AD 4CAYB 4J8VB 5B32A 5GT3D 4WU9C 1AOIB 1ZLAD 3O62D 4WU9A 2PYOD 3WTPE 5B24D 3AZFB 3AZMC 3R45A 4WNNB 3RELC 1EQZA 3UTBC 3AZMA 5JRGC 5BT1D 4WU8B 3UTBA 5JRGA 5B0ZB 5B31G 5F99D 5DNNB 3AZEC 3WTPA 3KXBB 1U35B 4Z5TA 3AZEA 2ZY4A 1ID3B 2Y2OA 2DF4C 1S32D 1TZYD 3AZNC 3H0MC 4JJNB 5AY8D 5CP6B 3AZNA 5AVCB 1BFMA 3UTAD 4X23C 1P3KA 3MVDB 1PZRA 2AROC 4J8WC 2FFFB 3AYWC 1P3IC 5B2IB 3B6FC 1HQ3D 3LJAB 1M18C 4Z2MG 1P3IA 4KUDB 1P3BD 4KGCD 1M18A 2HUEB 2CV5B 4Z2MH 1AOID 5B31B 5AVBD 3AZFD 3REIC 1B6WA 5JA4A 4YM6B 3C1CB 3W99A 3VH5A 3AFAB 5B0ZD 4DRAA 1HTAA 2FJ7B 5DNND 2BYMB 3MGSC 2XD1A 3KXBD 1U35D 3A1IA 1ID3D 2HIOB 1M19B 5GXQB 4XUJA 4J8UD 4JJND 1P3PC 5CP6D 3WKJC 5AVCD 4AWLB 3AZJA 1P34B 3WKJA 5BO0A 5B1MD 4NE5A 3V9RB 3MVDD 2UWXA 3REHA 1F66B 3W97B 4LD9B 3NQUA 5B0YB 4ZBJC 3X1UB 4H9QA 1P3MB 3UT9A 3KWQC 3LJAD 3IP4C 5C3IC 3MNNC 4KUDD 3KFUG 3KSYA 3KWQA 3REKD 3W98A 5B40A 4J8XB 5G49B 3X1VA 1KX4B 5B31D 2F8NA 5AV6A 3LELB 1H3OA 5DNMB 4UPKA 4YM6D 2IO5C 3C1CD 2G5HC 4UUZA 3KUYB 3AFAD 1P3OA 3X1SB 2FJ7D 3W96B 3X1TC 3AZHB 5BNXA 3X1TA 2XD5A 1P3FD 2HIOD 3AZGD 1M19D 5GXQD 5E5AA 1P3LC 3O62C 5GT3A 4G92B 2PYOC 4H9PB 1ZLAA 4DRBA 3O62A 4Z66C 2PYOA 3F6TA 5B24A 4Z66A 1P34D 3REJB 4WJ3C 5F99B 3W97D 1F66D 3B0CT 2RVQD 5CPJC 2F8NK 5B0YD 1BH8A 3X1UD 1P3MD 2BYKB 5B1LB 3AV2D 1JFIA 1S32B 2NQBC 2Y2JA 5KDMB 4H9OB 4ZUXD 2NQBA 4J8XD 5AY8C 5CHLB 2YFVB 1TZYA 1KX4D 1F1EA 3FDDA 3AZLB 5AY8A 4H9SC 3A6ND 2F2AC 3LELD 1WWIA 4H9SA 5DNMD 3UTAA 2NZDC 3KUYD 3AZID 3MGPD 3TU4C 3W96D 3WAAC 5B32C 3AZHD 4KGCC 4H9RB 1HQ3A 3AV1B 3WAAA 4QLCD 4J8VC 4YS3B 1P3BA 4KGCA 5FUGA 4CAYA 1AOIC 4J8VA 5AVBB 1EQZC 1AOIA 2JCHA 5B2JB 3AZFA 4WNNA 3REJD 2Y2GA 4WU8C 3WTPC 5GSUB 4WU8A 4Z5TC 4XZQB 5DNNC 5B0ZA 2ZM5A 4CSRB 5DNNA 3KXBA 5B1LD 1U35A 3AN2C 3WA9D 1ID3A 3AN2A 1KX3B 3B6GB 4J8UB 5AVCC 4JJNA 3AZLD 5CP6A 4R8PD 3LZ1D 1P3KC 5AVCA 3RELB 3H0RC 5B1MB 3MVDA 5B2IC 3VH6T 5AV8D 5B2IA 3REKB 3LJAA 2HUEC 3AV1D 2CV5C 4KUDA 4YS3D 2CV5A 2Y2HA 3W99C 5B31A 5B2JD 1M1AB 4YM6C 3B0BA 4X23B 3AFAC 4YM6A 5GSUD 2AROB 4J8WB 3AFAA 4XZQD 5CPKB 3C1BB 1TAFB 3AYWB 2FJ7A 3B6FB 2NZDB 2BYMA 1P3FB 3AZGB 1M19C 4XUJC 3VH5W 2HIOA 1M19A 1KX3D 4KHAB 5GXQA 3B6GD 3AZJC 1P3AB 4AWLC 3AZMD 3REIB 1P34C 3AL0C 3REHC 3RELD 1P34A 5JRGD 2F8NG 2Y2MA 3UT9C 3MGQB 4LD9C 3W97A 3V9RA 5B0YC 1KX5B 1F66A 1P3MC 2F8NH 4LD9A 5B0YA 3W98C 3MGSB 3X1UA 5B40C 3AV2B 1P3MA 1BH9B 3X1VC 4ZUXB 4J8XC 3EPJA 5AV6C 4J8XA 3AZND 3A6NB 5G49A 5CPIB 1P3PB 3EPHA 3AZKB 1KX4A 5AV9B 4NFTA 1M1AD 3LELA 1P3OC 5B33B 5DNMA 4X23D
chains in the Genus database with same CATH topology
3AZIB 3MGPB 4DQYB 3MGRB 1N1JB 2AROD 3KUYA 4J8WD 3X1SC 3W96C 5CPKD 5BNVB 1W2EA 3C1BD 3AYWD 3X1SA 1P3ID 3W96A 5E5AC 3B6FD 2NZDD 4QLCB 3AZHA 3MNNB 1M18D 5GT3C 1ZLAC 3VH5T 3EPKA 4G92C 5B24C 2F8NB 4G91C 2DQNC 1P3AD 3B0DB 1H3OB 4H9PA 3REID 5BT1C 2YFWB 4HGAC 3REJA 2IO5B 5F99C 2ZY2A 3MGQD 5F99A 1KX5D 5BS7C 5BS7A 3MGSD 3WA9B 1S32C 2BYKA 5B1LA 5GT0B 1TZYC 4NE3A 1S32A 1P3LB 5KDMA 4H9OA 2ZY5A 5B32G 4R8PB 3LZ1B 2YFVA 4EO5B 3UTAC 3AZKD 5CPID 1P3PD 3AZLA 5AV9D 5B33D 4WZSB 1Z2CB 1A7WA 3MGRD 1WWSA 1P3GB 1HQ3C 5AV8B 5CPJB 1P3BC 5AV5B 3A1KA 3KWQD 3AV1C 3MNND 4YS3C 4H9RA 3AV1A 4YS3A 5AVBC 3AZFC 2F8ND 4H9NB 5AVBA 3VH6A 5B2JC 2Y2KA 5B2JA 5B0ZC 5GSUC 3LZ0B 2CWEA 3KXBC 5GSUA 1U35C 4XZQA 3TU4B 3NQJB 2G5IC 1ID3C 5B32B 4CSRA 5GT0D 2VQRA 4WU9B 1KX3C 3B6GC 4J8UC 4JJNC 5CP6C 1P3LD 3R45B 1KX3A 3B6GA 4J8UA 1EQZB 3AZMB 4Z66D 3UTBB 5JRGB 5B1MC 3MVDC 3RELA 2Y2IA 5B1MA 1KU5A 3WTPB 1B67A 1P3GD 2L5AA 1T3UA 4Z5TB 3LJAC 3AZEB 5CPJD 4KUDC 3REKC 4M6BA 5AV5D 2BG1A 4WV4B 3REKA 3AN2B 2NQBD 5B31C 3AZNB 3C1CC 1M1AC 1P3KB 3C1CA 1M1AA 3EG5B 3LZ0D 2FJ7C 4X23A 5CPKC 4E44A 2W8SA 3C1BC 1P3IB 2AROA 4J8WA 5CPKA 3TU4D 3C1BA 1Q9CA 1TAFA 3AYWA 1M18B 1P3FC 5B32D 2HIOC 3AZGC 3WAAD 5GXQC 3B6FA 2NZDA 1P3FA 3AZGA 4J8VD 4WU9D 2Y2NA 2J8PA 1P3AC 4KHAA 1EQZD 5JA4B 1P3AA 3W99B 2LY8A 3UTBD 3REIA 3W97C 1F66C 2RVQC 4WU8D 3MGQC 3WTPD 3X1UC 1KX5C 4Z5TD 3MGQA 3AZED 1KX5A 3AV2C 2RIQA 3MGSA 3AV2A 4ZUXC 3AN2D 2Y2LA 2JSSA 4XUJB 1BH9A 1ULYA 4ZUXA 1KX4C 3A6NC 5CPIC 3LELC 3AZJB 3AZKC 3WKJB 5DNMC 3A6NA 3H0LC 5AV9C 5CPIA 4NE6A 5BO0B 3AZKA 1P3PA 5B33C 1P3KD 3KUYC 3REHB 5AV9A 3AZIC 3NQUB 3MGPC 5B33A 3MGRC 1R4VA 4H9QB 3AZIA 3UT9B 3MGPA 3MGRA 3B0CW 3AZHC 1N1JA 4ZBJB 5B2ID 3KWQB 5BNVA 4QLCC 5C3IB 3W98B 5B40B 2Y2QA 4QLCA 3MNNA 3X1VB 2CV5D 3P5JB 5AV6B 3B0DC 3REJC 3W99D 4UUZB 1P3OB 2YFWA 5BNXB 3EPLA 3X1TB 5B1LC 3WA9C 5E5AB 5GT0C 5GT3B 3WA9A 4XUJD 1ZLAB 5GT0A 3O62B 2JE5A 2PYOB 5B24B 3AZLC 1P3LA 4Z66B 4R8PC 3LZ1C 4G91B 4EO5C 3AZJD 3WKJD 4R8PA 3LZ1A 3REHD 4HGAB 1P3GC 1BH8B 3UT9D 5AV8C 4LD9D 1P3GA 1JFIB 5AV5C 5AV8A 5CPJA 3W98D 5B40D 5AV5A 2ZY3A 2NQBB 3X1VD 1TZYB 5AY8B 5AV6D 4H9NA 3UTAB 4E45A 1P3OD 3LZ0C 4XZQC 3LZ0A 3X1SD 3X1TD 1HQ3B 3WAAB 2Y2PA 3VH6W 1P3BB 4KGCB 3TU4A 5FUGB 3NQJA 5E5AD 4CAYB 4J8VB 5B32A 5GT3D 4WU9C 1AOIB 1ZLAD 3O62D 4WU9A 2PYOD 3WTPE 5B24D 3AZFB 3AZMC 3R45A 4WNNB 3RELC 1EQZA 3UTBC 3AZMA 5JRGC 5BT1D 4WU8B 3UTBA 5JRGA 5B0ZB 5B31G 5F99D 5DNNB 3AZEC 3WTPA 3KXBB 1U35B 4Z5TA 3AZEA 2ZY4A 1ID3B 2Y2OA 2DF4C 1S32D 1TZYD 3AZNC 3H0MC 4JJNB 5AY8D 5CP6B 3AZNA 5AVCB 1BFMA 3UTAD 4X23C 1P3KA 3MVDB 1PZRA 2AROC 4J8WC 2FFFB 3AYWC 1P3IC 5B2IB 3B6FC 1HQ3D 3LJAB 1M18C 4Z2MG 1P3IA 4KUDB 1P3BD 4KGCD 1M18A 2HUEB 2CV5B 4Z2MH 1AOID 5B31B 5AVBD 3AZFD 3REIC 1B6WA 5JA4A 4YM6B 3C1CB 3W99A 3VH5A 3AFAB 5B0ZD 4DRAA 1HTAA 2FJ7B 5DNND 2BYMB 3MGSC 2XD1A 3KXBD 1U35D 3A1IA 1ID3D 2HIOB 1M19B 5GXQB 4XUJA 4J8UD 4JJND 1P3PC 5CP6D 3WKJC 5AVCD 4AWLB 3AZJA 1P34B 3WKJA 5BO0A 5B1MD 4NE5A 3V9RB 3MVDD 2UWXA 3REHA 1F66B 3W97B 4LD9B 3NQUA 5B0YB 4ZBJC 3X1UB 4H9QA 1P3MB 3UT9A 3KWQC 3LJAD 3IP4C 5C3IC 3MNNC 4KUDD 3KFUG 3KSYA 3KWQA 3REKD 3W98A 5B40A 4J8XB 5G49B 3X1VA 1KX4B 5B31D 2F8NA 5AV6A 3LELB 1H3OA 5DNMB 4UPKA 4YM6D 2IO5C 3C1CD 2G5HC 4UUZA 3KUYB 3AFAD 1P3OA 3X1SB 2FJ7D 3W96B 3X1TC 3AZHB 5BNXA 3X1TA 2XD5A 1P3FD 2HIOD 3AZGD 1M19D 5GXQD 5E5AA 1P3LC 3O62C 5GT3A 4G92B 2PYOC 4H9PB 1ZLAA 4DRBA 3O62A 4Z66C 2PYOA 3F6TA 5B24A 4Z66A 1P34D 3REJB 4WJ3C 5F99B 3W97D 1F66D 3B0CT 2RVQD 5CPJC 2F8NK 5B0YD 1BH8A 3X1UD 1P3MD 2BYKB 5B1LB 3AV2D 1JFIA 1S32B 2NQBC 2Y2JA 5KDMB 4H9OB 4ZUXD 2NQBA 4J8XD 5AY8C 5CHLB 2YFVB 1TZYA 1KX4D 1F1EA 3FDDA 3AZLB 5AY8A 4H9SC 3A6ND 2F2AC 3LELD 1WWIA 4H9SA 5DNMD 3UTAA 2NZDC 3KUYD 3AZID 3MGPD 3TU4C 3W96D 3WAAC 5B32C 3AZHD 4KGCC 4H9RB 1HQ3A 3AV1B 3WAAA 4QLCD 4J8VC 4YS3B 1P3BA 4KGCA 5FUGA 4CAYA 1AOIC 4J8VA 5AVBB 1EQZC 1AOIA 2JCHA 5B2JB 3AZFA 4WNNA 3REJD 2Y2GA 4WU8C 3WTPC 5GSUB 4WU8A 4Z5TC 4XZQB 5DNNC 5B0ZA 2ZM5A 4CSRB 5DNNA 3KXBA 5B1LD 1U35A 3AN2C 3WA9D 1ID3A 3AN2A 1KX3B 3B6GB 4J8UB 5AVCC 4JJNA 3AZLD 5CP6A 4R8PD 3LZ1D 1P3KC 5AVCA 3RELB 3H0RC 5B1MB 3MVDA 5B2IC 3VH6T 5AV8D 5B2IA 3REKB 3LJAA 2HUEC 3AV1D 2CV5C 4KUDA 4YS3D 2CV5A 2Y2HA 3W99C 5B31A 5B2JD 1M1AB 4YM6C 3B0BA 4X23B 3AFAC 4YM6A 5GSUD 2AROB 4J8WB 3AFAA 4XZQD 5CPKB 3C1BB 1TAFB 3AYWB 2FJ7A 3B6FB 2NZDB 2BYMA 1P3FB 3AZGB 1M19C 4XUJC 3VH5W 2HIOA 1M19A 1KX3D 4KHAB 5GXQA 3B6GD 3AZJC 1P3AB 4AWLC 3AZMD 3REIB 1P34C 3AL0C 3REHC 3RELD 1P34A 5JRGD 2F8NG 2Y2MA 3UT9C 3MGQB 4LD9C 3W97A 3V9RA 5B0YC 1KX5B 1F66A 1P3MC 2F8NH 4LD9A 5B0YA 3W98C 3MGSB 3X1UA 5B40C 3AV2B 1P3MA 1BH9B 3X1VC 4ZUXB 4J8XC 3EPJA 5AV6C 4J8XA 3AZND 3A6NB 5G49A 5CPIB 1P3PB 3EPHA 3AZKB 1KX4A 5AV9B 4NFTA 1M1AD 3LELA 1P3OC 5B33B 5DNMA 4X23D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI B;  3MGP B;  3MGR B;  1N1J B;  2ARO D;  3KUY A;  4J8W D;  3X1S C;  3W96 C;  5CPK D;  5BNV B;  3C1B D;  3AYW D;  3X1S A;  1P3I D;  3W96 A;  5E5A C;  3B6F D;  2NZD D;  4QLC B;  3AZH A;  3MNN B;  1M18 D;  5GT3 C;  1ZLA C;  3VH5 T;  4G92 C;  5B24 C;  2F8N B;  4G91 C;  1P3A D;  3B0D B;  1H3O B;  4H9P A;  3REI D;  5BT1 C;  2YFW B;  4HGA C;  3REJ A;  2IO5 B;  5F99 C;  3MGQ D;  5F99 A;  1KX5 D;  5BS7 C;  5BS7 A;  3MGS D;  3WA9 B;  1S32 C;  2BYK A;  5B1L A;  5GT0 B;  1TZY C;  4NE3 A;  1S32 A;  1P3L B;  5KDM A;  4H9O A;  5B32 G;  4R8P B;  3LZ1 B;  2YFV A;  4EO5 B;  3UTA C;  3AZK D;  5CPI D;  1P3P D;  3AZL A;  5AV9 D;  5B33 D;  4WZS B;  1A7W A;  3MGR D;  1WWS A;  1P3G B;  1HQ3 C;  5AV8 B;  5CPJ B;  1P3B C;  5AV5 B;  3KWQ D;  3AV1 C;  3MNN D;  4YS3 C;  4H9R A;  3AV1 A;  4YS3 A;  5AVB C;  3AZF C;  2F8N D;  4H9N B;  5AVB A;  3VH6 A;  5B2J C;  5B2J A;  5B0Z C;  5GSU C;  3LZ0 B;  2CWE A;  3KXB C;  5GSU A;  1U35 C;  4XZQ A;  3TU4 B;  3NQJ B;  1ID3 C;  5B32 B;  4CSR A;  5GT0 D;  4WU9 B;  1KX3 C;  3B6G C;  4J8U C;  4JJN C;  5CP6 C;  1P3L D;  3R45 B;  1KX3 A;  3B6G A;  4J8U A;  1EQZ B;  3AZM B;  4Z66 D;  3UTB B;  5JRG B;  5B1M C;  3MVD C;  3REL A;  5B1M A;  1KU5 A;  3WTP B;  1B67 A;  1P3G D;  2L5A A;  4Z5T B;  3AZE B;  3LJA C;  5CPJ D;  4KUD C;  3REK C;  4M6B A;  5AV5 D;  4WV4 B;  3REK A;  3AN2 B;  2NQB D;  5B31 C;  3AZN B;  3C1C C;  1M1A C;  1P3K B;  3C1C A;  1M1A A;  3LZ0 D;  2FJ7 C;  4X23 A;  5CPK C;  4E44 A;  3C1B C;  1P3I B;  2ARO A;  4J8W A;  5CPK A;  3TU4 D;  3C1B A;  1Q9C A;  1TAF A;  3AYW A;  1M18 B;  1P3F C;  5B32 D;  2HIO C;  3AZG C;  3WAA D;  5GXQ C;  3B6F A;  2NZD A;  1P3F A;  3AZG A;  4J8V D;  4WU9 D;  1P3A C;  4KHA A;  1EQZ D;  5JA4 B;  1P3A A;  3W99 B;  2LY8 A;  3UTB D;  3REI A;  3W97 C;  1F66 C;  2RVQ C;  4WU8 D;  3MGQ C;  3WTP D;  3X1U C;  1KX5 C;  4Z5T D;  3MGQ A;  3AZE D;  1KX5 A;  3AV2 C;  3MGS A;  3AV2 A;  4ZUX C;  3AN2 D;  4XUJ B;  2JSS A;  1BH9 A;  1ULY A;  4ZUX A;  1KX4 C;  3A6N C;  5CPI C;  3LEL C;  3AZJ B;  3AZK C;  3WKJ B;  5DNM C;  3A6N A;  5AV9 C;  5CPI A;  4NE6 A;  5BO0 B;  3AZK A;  1P3P A;  5B33 C;  1P3K D;  3KUY C;  3REH B;  5AV9 A;  3AZI C;  3NQU B;  3MGP C;  5B33 A;  3MGR C;  1R4V A;  4H9Q B;  3AZI A;  3UT9 B;  3MGP A;  3MGR A;  3B0C W;  3AZH C;  1N1J A;  4ZBJ B;  5B2I D;  3KWQ B;  5BNV A;  4QLC C;  5C3I B;  3W98 B;  5B40 B;  4QLC A;  3MNN A;  3X1V B;  2CV5 D;  5AV6 B;  3B0D C;  3REJ C;  3W99 D;  4UUZ B;  1P3O B;  2YFW A;  5BNX B;  3X1T B;  5B1L C;  3WA9 C;  5E5A B;  5GT0 C;  5GT3 B;  3WA9 A;  4XUJ D;  1ZLA B;  5GT0 A;  3O62 B;  2PYO B;  5B24 B;  3AZL C;  1P3L A;  4Z66 B;  4R8P C;  3LZ1 C;  4G91 B;  4EO5 C;  3AZJ D;  3WKJ D;  4R8P A;  3LZ1 A;  3REH D;  4HGA B;  1P3G C;  1BH8 B;  3UT9 D;  5AV8 C;  4LD9 D;  1P3G A;  1JFI B;  5AV5 C;  5AV8 A;  5CPJ A;  3W98 D;  5B40 D;  5AV5 A;  2NQB B;  3X1V D;  1TZY B;  5AY8 B;  5AV6 D;  4H9N A;  3UTA B;  4E45 A;  1P3O D;  3LZ0 C;  4XZQ C;  3LZ0 A;  3X1S D;  3X1T D;  1HQ3 B;  3WAA B;  3VH6 W;  1P3B B;  4KGC B;  3TU4 A;  5FUG B;  3NQJ A;  5E5A D;  4CAY B;  4J8V B;  5B32 A;  5GT3 D;  4WU9 C;  1AOI B;  1ZLA D;  3O62 D;  4WU9 A;  2PYO D;  3WTP E;  5B24 D;  3AZF B;  3AZM C;  3R45 A;  4WNN B;  3REL C;  1EQZ A;  3UTB C;  3AZM A;  5JRG C;  5BT1 D;  4WU8 B;  3UTB A;  5JRG A;  5B0Z B;  5B31 G;  5F99 D;  5DNN B;  3AZE C;  3WTP A;  3KXB B;  1U35 B;  4Z5T A;  3AZE A;  1ID3 B;  1S32 D;  1TZY D;  3AZN C;  4JJN B;  5AY8 D;  5CP6 B;  3AZN A;  5AVC B;  1BFM A;  3UTA D;  4X23 C;  1P3K A;  3MVD B;  2ARO C;  4J8W C;  3AYW C;  1P3I C;  5B2I B;  3B6F C;  1HQ3 D;  3LJA B;  1M18 C;  4Z2M G;  1P3I A;  4KUD B;  1P3B D;  4KGC D;  1M18 A;  2HUE B;  2CV5 B;  4Z2M H;  1AOI D;  5B31 B;  5AVB D;  3AZF D;  3REI C;  1B6W A;  5JA4 A;  4YM6 B;  3C1C B;  3W99 A;  3VH5 A;  3AFA B;  5B0Z D;  4DRA A;  1HTA A;  2FJ7 B;  5DNN D;  2BYM B;  3MGS C;  3KXB D;  1U35 D;  1ID3 D;  2HIO B;  1M19 B;  5GXQ B;  4XUJ A;  4J8U D;  4JJN D;  1P3P C;  5CP6 D;  3WKJ C;  5AVC D;  4AWL B;  3AZJ A;  1P34 B;  3WKJ A;  5BO0 A;  5B1M D;  4NE5 A;  3V9R B;  3MVD D;  3REH A;  1F66 B;  3W97 B;  4LD9 B;  3NQU A;  5B0Y B;  4ZBJ C;  3X1U B;  4H9Q A;  1P3M B;  3UT9 A;  3KWQ C;  3LJA D;  5C3I C;  3MNN C;  4KUD D;  3KSY A;  3KWQ A;  3REK D;  3W98 A;  5B40 A;  4J8X B;  5G49 B;  3X1V A;  1KX4 B;  5B31 D;  2F8N A;  5AV6 A;  3LEL B;  1H3O A;  5DNM B;  4YM6 D;  2IO5 C;  3C1C D;  4UUZ A;  3KUY B;  3AFA D;  1P3O A;  3X1S B;  2FJ7 D;  3W96 B;  3X1T C;  3AZH B;  5BNX A;  3X1T A;  1P3F D;  2HIO D;  3AZG D;  1M19 D;  5GXQ D;  5E5A A;  1P3L C;  3O62 C;  5GT3 A;  4G92 B;  2PYO C;  4H9P B;  1ZLA A;  4DRB A;  3O62 A;  4Z66 C;  2PYO A;  5B24 A;  4Z66 A;  1P34 D;  3REJ B;  5F99 B;  3W97 D;  1F66 D;  3B0C T;  2RVQ D;  5CPJ C;  2F8N K;  5B0Y D;  1BH8 A;  3X1U D;  1P3M D;  2BYK B;  5B1L B;  3AV2 D;  1JFI A;  1S32 B;  2NQB C;  5KDM B;  4H9O B;  4ZUX D;  2NQB A;  4J8X D;  5AY8 C;  5CHL B;  2YFV B;  1TZY A;  1KX4 D;  1F1E A;  3AZL B;  5AY8 A;  4H9S C;  3A6N D;  3LEL D;  1WWI A;  4H9S A;  5DNM D;  3UTA A;  2NZD C;  3KUY D;  3AZI D;  3MGP D;  3TU4 C;  3W96 D;  3WAA C;  5B32 C;  3AZH D;  4KGC C;  4H9R B;  1HQ3 A;  3AV1 B;  3WAA A;  4QLC D;  4J8V C;  4YS3 B;  1P3B A;  4KGC A;  5FUG A;  4CAY A;  1AOI C;  4J8V A;  5AVB B;  1EQZ C;  1AOI A;  5B2J B;  3AZF A;  4WNN A;  3REJ D;  4WU8 C;  3WTP C;  5GSU B;  4WU8 A;  4Z5T C;  4XZQ B;  5DNN C;  5B0Z A;  4CSR B;  5DNN A;  3KXB A;  5B1L D;  1U35 A;  3AN2 C;  3WA9 D;  1ID3 A;  3AN2 A;  1KX3 B;  3B6G B;  4J8U B;  5AVC C;  4JJN A;  3AZL D;  5CP6 A;  4R8P D;  3LZ1 D;  1P3K C;  5AVC A;  3REL B;  5B1M B;  3MVD A;  5B2I C;  3VH6 T;  5AV8 D;  5B2I A;  3REK B;  3LJA A;  2HUE C;  3AV1 D;  2CV5 C;  4KUD A;  4YS3 D;  2CV5 A;  3W99 C;  5B31 A;  5B2J D;  1M1A B;  4YM6 C;  3B0B A;  4X23 B;  3AFA C;  4YM6 A;  5GSU D;  2ARO B;  4J8W B;  3AFA A;  4XZQ D;  5CPK B;  3C1B B;  1TAF B;  3AYW B;  2FJ7 A;  3B6F B;  2NZD B;  2BYM A;  1P3F B;  3AZG B;  1M19 C;  4XUJ C;  3VH5 W;  2HIO A;  1M19 A;  1KX3 D;  4KHA B;  5GXQ A;  3B6G D;  3AZJ C;  1P3A B;  4AWL C;  3AZM D;  3REI B;  1P34 C;  3REH C;  3REL D;  1P34 A;  5JRG D;  2F8N G;  3UT9 C;  3MGQ B;  4LD9 C;  3W97 A;  3V9R A;  5B0Y C;  1KX5 B;  1F66 A;  1P3M C;  2F8N H;  4LD9 A;  5B0Y A;  3W98 C;  3MGS B;  3X1U A;  5B40 C;  3AV2 B;  1P3M A;  1BH9 B;  3X1V C;  4ZUX B;  4J8X C;  5AV6 C;  4J8X A;  3AZN D;  3A6N B;  5G49 A;  5CPI B;  1P3P B;  3AZK B;  1KX4 A;  5AV9 B;  4NFT A;  1M1A D;  3LEL A;  1P3O C;  5B33 B;  5DNM A;  4X23 D; 
#chains in the Genus database with same CATH topology
 3AZI B;  3MGP B;  4DQY B;  3MGR B;  1N1J B;  2ARO D;  3KUY A;  4J8W D;  3X1S C;  3W96 C;  5CPK D;  5BNV B;  1W2E A;  3C1B D;  3AYW D;  3X1S A;  1P3I D;  3W96 A;  5E5A C;  3B6F D;  2NZD D;  4QLC B;  3AZH A;  3MNN B;  1M18 D;  5GT3 C;  1ZLA C;  3VH5 T;  3EPK A;  4G92 C;  5B24 C;  2F8N B;  4G91 C;  2DQN C;  1P3A D;  3B0D B;  1H3O B;  4H9P A;  3REI D;  5BT1 C;  2YFW B;  4HGA C;  3REJ A;  2IO5 B;  5F99 C;  2ZY2 A;  3MGQ D;  5F99 A;  1KX5 D;  5BS7 C;  5BS7 A;  3MGS D;  3WA9 B;  1S32 C;  2BYK A;  5B1L A;  5GT0 B;  1TZY C;  4NE3 A;  1S32 A;  1P3L B;  5KDM A;  4H9O A;  2ZY5 A;  5B32 G;  4R8P B;  3LZ1 B;  2YFV A;  4EO5 B;  3UTA C;  3AZK D;  5CPI D;  1P3P D;  3AZL A;  5AV9 D;  5B33 D;  4WZS B;  1Z2C B;  1A7W A;  3MGR D;  1WWS A;  1P3G B;  1HQ3 C;  5AV8 B;  5CPJ B;  1P3B C;  5AV5 B;  3A1K A;  3KWQ D;  3AV1 C;  3MNN D;  4YS3 C;  4H9R A;  3AV1 A;  4YS3 A;  5AVB C;  3AZF C;  2F8N D;  4H9N B;  5AVB A;  3VH6 A;  5B2J C;  2Y2K A;  5B2J A;  5B0Z C;  5GSU C;  3LZ0 B;  2CWE A;  3KXB C;  5GSU A;  1U35 C;  4XZQ A;  3TU4 B;  3NQJ B;  2G5I C;  1ID3 C;  5B32 B;  4CSR A;  5GT0 D;  2VQR A;  4WU9 B;  1KX3 C;  3B6G C;  4J8U C;  4JJN C;  5CP6 C;  1P3L D;  3R45 B;  1KX3 A;  3B6G A;  4J8U A;  1EQZ B;  3AZM B;  4Z66 D;  3UTB B;  5JRG B;  5B1M C;  3MVD C;  3REL A;  2Y2I A;  5B1M A;  1KU5 A;  3WTP B;  1B67 A;  1P3G D;  2L5A A;  1T3U A;  4Z5T B;  3LJA C;  3AZE B;  5CPJ D;  4KUD C;  3REK C;  4M6B A;  5AV5 D;  2BG1 A;  4WV4 B;  3REK A;  3AN2 B;  2NQB D;  5B31 C;  3AZN B;  3C1C C;  1M1A C;  1P3K B;  3C1C A;  1M1A A;  3EG5 B;  3LZ0 D;  2FJ7 C;  4X23 A;  5CPK C;  4E44 A;  2W8S A;  3C1B C;  1P3I B;  2ARO A;  4J8W A;  5CPK A;  3TU4 D;  3C1B A;  1Q9C A;  1TAF A;  3AYW A;  1M18 B;  1P3F C;  5B32 D;  2HIO C;  3AZG C;  3WAA D;  5GXQ C;  3B6F A;  2NZD A;  1P3F A;  3AZG A;  4J8V D;  4WU9 D;  2Y2N A;  2J8P A;  1P3A C;  4KHA A;  1EQZ D;  5JA4 B;  1P3A A;  3W99 B;  2LY8 A;  3UTB D;  3REI A;  3W97 C;  1F66 C;  2RVQ C;  4WU8 D;  3MGQ C;  3WTP D;  3X1U C;  1KX5 C;  4Z5T D;  3MGQ A;  3AZE D;  1KX5 A;  3AV2 C;  2RIQ A;  3MGS A;  3AV2 A;  4ZUX C;  3AN2 D;  2Y2L A;  2JSS A;  4XUJ B;  1BH9 A;  1ULY A;  4ZUX A;  1KX4 C;  3A6N C;  5CPI C;  3LEL C;  3AZJ B;  3AZK C;  3WKJ B;  5DNM C;  3A6N A;  3H0L C;  5AV9 C;  5CPI A;  4NE6 A;  5BO0 B;  3AZK A;  1P3P A;  5B33 C;  1P3K D;  3KUY C;  3REH B;  5AV9 A;  3AZI C;  3NQU B;  3MGP C;  5B33 A;  3MGR C;  1R4V A;  4H9Q B;  3AZI A;  3UT9 B;  3MGP A;  3MGR A;  3B0C W;  3AZH C;  1N1J A;  4ZBJ B;  5B2I D;  3KWQ B;  5BNV A;  4QLC C;  5C3I B;  3W98 B;  5B40 B;  2Y2Q A;  4QLC A;  3MNN A;  3X1V B;  2CV5 D;  3P5J B;  5AV6 B;  3B0D C;  3REJ C;  3W99 D;  4UUZ B;  1P3O B;  2YFW A;  5BNX B;  3EPL A;  3X1T B;  5B1L C;  3WA9 C;  5E5A B;  5GT0 C;  5GT3 B;  3WA9 A;  4XUJ D;  1ZLA B;  5GT0 A;  3O62 B;  2JE5 A;  2PYO B;  5B24 B;  3AZL C;  1P3L A;  4Z66 B;  4R8P C;  3LZ1 C;  4G91 B;  4EO5 C;  3AZJ D;  3WKJ D;  4R8P A;  3LZ1 A;  3REH D;  4HGA B;  1P3G C;  1BH8 B;  3UT9 D;  5AV8 C;  4LD9 D;  1P3G A;  1JFI B;  5AV5 C;  5AV8 A;  5CPJ A;  3W98 D;  5B40 D;  5AV5 A;  2ZY3 A;  2NQB B;  3X1V D;  1TZY B;  5AY8 B;  5AV6 D;  4H9N A;  3UTA B;  4E45 A;  1P3O D;  3LZ0 C;  4XZQ C;  3LZ0 A;  3X1S D;  3X1T D;  1HQ3 B;  3WAA B;  2Y2P A;  3VH6 W;  1P3B B;  4KGC B;  3TU4 A;  5FUG B;  3NQJ A;  5E5A D;  4CAY B;  4J8V B;  5B32 A;  5GT3 D;  4WU9 C;  1AOI B;  1ZLA D;  3O62 D;  4WU9 A;  2PYO D;  3WTP E;  5B24 D;  3AZF B;  3AZM C;  3R45 A;  4WNN B;  3REL C;  1EQZ A;  3UTB C;  3AZM A;  5JRG C;  5BT1 D;  4WU8 B;  3UTB A;  5JRG A;  5B0Z B;  5B31 G;  5F99 D;  5DNN B;  3AZE C;  3WTP A;  3KXB B;  1U35 B;  4Z5T A;  3AZE A;  2ZY4 A;  1ID3 B;  2Y2O A;  2DF4 C;  1S32 D;  1TZY D;  3AZN C;  3H0M C;  4JJN B;  5AY8 D;  5CP6 B;  3AZN A;  5AVC B;  1BFM A;  3UTA D;  4X23 C;  1P3K A;  3MVD B;  1PZR A;  2ARO C;  4J8W C;  2FFF B;  3AYW C;  1P3I C;  5B2I B;  3B6F C;  1HQ3 D;  3LJA B;  1M18 C;  4Z2M G;  1P3I A;  4KUD B;  1P3B D;  4KGC D;  1M18 A;  2HUE B;  2CV5 B;  4Z2M H;  1AOI D;  5B31 B;  5AVB D;  3AZF D;  3REI C;  1B6W A;  5JA4 A;  4YM6 B;  3C1C B;  3W99 A;  3VH5 A;  3AFA B;  5B0Z D;  4DRA A;  1HTA A;  2FJ7 B;  5DNN D;  2BYM B;  3MGS C;  2XD1 A;  3KXB D;  1U35 D;  3A1I A;  1ID3 D;  2HIO B;  1M19 B;  5GXQ B;  4XUJ A;  4J8U D;  4JJN D;  1P3P C;  5CP6 D;  3WKJ C;  5AVC D;  4AWL B;  3AZJ A;  1P34 B;  3WKJ A;  5BO0 A;  5B1M D;  4NE5 A;  3V9R B;  3MVD D;  2UWX A;  3REH A;  1F66 B;  3W97 B;  4LD9 B;  3NQU A;  5B0Y B;  4ZBJ C;  3X1U B;  4H9Q A;  1P3M B;  3UT9 A;  3KWQ C;  3LJA D;  3IP4 C;  5C3I C;  3MNN C;  4KUD D;  3KFU G;  3KSY A;  3KWQ A;  3REK D;  3W98 A;  5B40 A;  4J8X B;  5G49 B;  3X1V A;  1KX4 B;  5B31 D;  2F8N A;  5AV6 A;  3LEL B;  1H3O A;  5DNM B;  4UPK A;  4YM6 D;  2IO5 C;  3C1C D;  2G5H C;  4UUZ A;  3KUY B;  3AFA D;  1P3O A;  3X1S B;  2FJ7 D;  3W96 B;  3X1T C;  3AZH B;  5BNX A;  3X1T A;  2XD5 A;  1P3F D;  2HIO D;  3AZG D;  1M19 D;  5GXQ D;  5E5A A;  1P3L C;  3O62 C;  5GT3 A;  4G92 B;  2PYO C;  4H9P B;  1ZLA A;  4DRB A;  3O62 A;  4Z66 C;  2PYO A;  3F6T A;  5B24 A;  4Z66 A;  1P34 D;  3REJ B;  4WJ3 C;  5F99 B;  3W97 D;  1F66 D;  3B0C T;  2RVQ D;  5CPJ C;  2F8N K;  5B0Y D;  1BH8 A;  3X1U D;  1P3M D;  2BYK B;  5B1L B;  3AV2 D;  1JFI A;  1S32 B;  2NQB C;  2Y2J A;  5KDM B;  4H9O B;  4ZUX D;  2NQB A;  4J8X D;  5AY8 C;  5CHL B;  2YFV B;  1TZY A;  1KX4 D;  1F1E A;  3FDD A;  3AZL B;  5AY8 A;  4H9S C;  3A6N D;  2F2A C;  3LEL D;  1WWI A;  4H9S A;  5DNM D;  3UTA A;  2NZD C;  3KUY D;  3AZI D;  3MGP D;  3TU4 C;  3W96 D;  3WAA C;  5B32 C;  3AZH D;  4KGC C;  4H9R B;  1HQ3 A;  3AV1 B;  3WAA A;  4QLC D;  4J8V C;  4YS3 B;  1P3B A;  4KGC A;  5FUG A;  4CAY A;  1AOI C;  4J8V A;  5AVB B;  1EQZ C;  1AOI A;  2JCH A;  5B2J B;  3AZF A;  4WNN A;  3REJ D;  2Y2G A;  4WU8 C;  3WTP C;  5GSU B;  4WU8 A;  4Z5T C;  4XZQ B;  5DNN C;  5B0Z A;  2ZM5 A;  4CSR B;  5DNN A;  3KXB A;  5B1L D;  1U35 A;  3AN2 C;  3WA9 D;  1ID3 A;  3AN2 A;  1KX3 B;  3B6G B;  4J8U B;  5AVC C;  4JJN A;  3AZL D;  5CP6 A;  4R8P D;  3LZ1 D;  1P3K C;  5AVC A;  3REL B;  3H0R C;  5B1M B;  3MVD A;  5B2I C;  3VH6 T;  5AV8 D;  5B2I A;  3REK B;  3LJA A;  2HUE C;  3AV1 D;  2CV5 C;  4KUD A;  4YS3 D;  2CV5 A;  2Y2H A;  3W99 C;  5B31 A;  5B2J D;  1M1A B;  4YM6 C;  3B0B A;  4X23 B;  3AFA C;  4YM6 A;  5GSU D;  2ARO B;  4J8W B;  3AFA A;  4XZQ D;  5CPK B;  3C1B B;  1TAF B;  3AYW B;  2FJ7 A;  3B6F B;  2NZD B;  2BYM A;  1P3F B;  3AZG B;  1M19 C;  4XUJ C;  3VH5 W;  2HIO A;  1M19 A;  1KX3 D;  4KHA B;  5GXQ A;  3B6G D;  3AZJ C;  1P3A B;  4AWL C;  3AZM D;  3REI B;  1P34 C;  3AL0 C;  3REH C;  3REL D;  1P34 A;  5JRG D;  2F8N G;  2Y2M A;  3UT9 C;  3MGQ B;  4LD9 C;  3W97 A;  3V9R A;  5B0Y C;  1KX5 B;  1F66 A;  1P3M C;  2F8N H;  4LD9 A;  5B0Y A;  3W98 C;  3MGS B;  3X1U A;  5B40 C;  3AV2 B;  1P3M A;  1BH9 B;  3X1V C;  4ZUX B;  4J8X C;  3EPJ A;  5AV6 C;  4J8X A;  3AZN D;  3A6N B;  5G49 A;  5CPI B;  1P3P B;  3EPH A;  3AZK B;  1KX4 A;  5AV9 B;  4NFT A;  1M1A D;  3LEL A;  1P3O C;  5B33 B;  5DNM A;  4X23 D; 
#chains in the Genus database with same CATH homology
 3AZI B;  3MGP B;  4DQY B;  3MGR B;  1N1J B;  2ARO D;  3KUY A;  4J8W D;  3X1S C;  3W96 C;  5CPK D;  5BNV B;  1W2E A;  3C1B D;  3AYW D;  3X1S A;  1P3I D;  3W96 A;  5E5A C;  3B6F D;  2NZD D;  4QLC B;  3AZH A;  3MNN B;  1M18 D;  5GT3 C;  1ZLA C;  3VH5 T;  3EPK A;  4G92 C;  5B24 C;  2F8N B;  4G91 C;  2DQN C;  1P3A D;  3B0D B;  1H3O B;  4H9P A;  3REI D;  5BT1 C;  2YFW B;  4HGA C;  3REJ A;  2IO5 B;  5F99 C;  2ZY2 A;  3MGQ D;  5F99 A;  1KX5 D;  5BS7 C;  5BS7 A;  3MGS D;  3WA9 B;  1S32 C;  2BYK A;  5B1L A;  5GT0 B;  1TZY C;  4NE3 A;  1S32 A;  1P3L B;  5KDM A;  4H9O A;  2ZY5 A;  5B32 G;  4R8P B;  3LZ1 B;  2YFV A;  4EO5 B;  3UTA C;  3AZK D;  5CPI D;  1P3P D;  3AZL A;  5AV9 D;  5B33 D;  4WZS B;  1Z2C B;  1A7W A;  3MGR D;  1WWS A;  1P3G B;  1HQ3 C;  5AV8 B;  5CPJ B;  1P3B C;  5AV5 B;  3A1K A;  3KWQ D;  3AV1 C;  3MNN D;  4YS3 C;  4H9R A;  3AV1 A;  4YS3 A;  5AVB C;  3AZF C;  2F8N D;  4H9N B;  5AVB A;  3VH6 A;  5B2J C;  2Y2K A;  5B2J A;  5B0Z C;  5GSU C;  3LZ0 B;  2CWE A;  3KXB C;  5GSU A;  1U35 C;  4XZQ A;  3TU4 B;  3NQJ B;  2G5I C;  1ID3 C;  5B32 B;  4CSR A;  5GT0 D;  2VQR A;  4WU9 B;  1KX3 C;  3B6G C;  4J8U C;  4JJN C;  5CP6 C;  1P3L D;  3R45 B;  1KX3 A;  3B6G A;  4J8U A;  1EQZ B;  3AZM B;  4Z66 D;  3UTB B;  5JRG B;  5B1M C;  3MVD C;  3REL A;  2Y2I A;  5B1M A;  1KU5 A;  3WTP B;  1B67 A;  1P3G D;  2L5A A;  1T3U A;  4Z5T B;  3LJA C;  3AZE B;  5CPJ D;  4KUD C;  3REK C;  4M6B A;  5AV5 D;  2BG1 A;  4WV4 B;  3REK A;  3AN2 B;  2NQB D;  5B31 C;  3AZN B;  3C1C C;  1M1A C;  1P3K B;  3C1C A;  1M1A A;  3EG5 B;  3LZ0 D;  2FJ7 C;  4X23 A;  5CPK C;  4E44 A;  2W8S A;  3C1B C;  1P3I B;  2ARO A;  4J8W A;  5CPK A;  3TU4 D;  3C1B A;  1Q9C A;  1TAF A;  3AYW A;  1M18 B;  1P3F C;  5B32 D;  2HIO C;  3AZG C;  3WAA D;  5GXQ C;  3B6F A;  2NZD A;  1P3F A;  3AZG A;  4J8V D;  4WU9 D;  2Y2N A;  2J8P A;  1P3A C;  4KHA A;  1EQZ D;  5JA4 B;  1P3A A;  3W99 B;  2LY8 A;  3UTB D;  3REI A;  3W97 C;  1F66 C;  2RVQ C;  4WU8 D;  3MGQ C;  3WTP D;  3X1U C;  1KX5 C;  4Z5T D;  3MGQ A;  3AZE D;  1KX5 A;  3AV2 C;  2RIQ A;  3MGS A;  3AV2 A;  4ZUX C;  3AN2 D;  2Y2L A;  2JSS A;  4XUJ B;  1BH9 A;  1ULY A;  4ZUX A;  1KX4 C;  3A6N C;  5CPI C;  3LEL C;  3AZJ B;  3AZK C;  3WKJ B;  5DNM C;  3A6N A;  3H0L C;  5AV9 C;  5CPI A;  4NE6 A;  5BO0 B;  3AZK A;  1P3P A;  5B33 C;  1P3K D;  3KUY C;  3REH B;  5AV9 A;  3AZI C;  3NQU B;  3MGP C;  5B33 A;  3MGR C;  1R4V A;  4H9Q B;  3AZI A;  3UT9 B;  3MGP A;  3MGR A;  3B0C W;  3AZH C;  1N1J A;  4ZBJ B;  5B2I D;  3KWQ B;  5BNV A;  4QLC C;  5C3I B;  3W98 B;  5B40 B;  2Y2Q A;  4QLC A;  3MNN A;  3X1V B;  2CV5 D;  3P5J B;  5AV6 B;  3B0D C;  3REJ C;  3W99 D;  4UUZ B;  1P3O B;  2YFW A;  5BNX B;  3EPL A;  3X1T B;  5B1L C;  3WA9 C;  5E5A B;  5GT0 C;  5GT3 B;  3WA9 A;  4XUJ D;  1ZLA B;  5GT0 A;  3O62 B;  2JE5 A;  2PYO B;  5B24 B;  3AZL C;  1P3L A;  4Z66 B;  4R8P C;  3LZ1 C;  4G91 B;  4EO5 C;  3AZJ D;  3WKJ D;  4R8P A;  3LZ1 A;  3REH D;  4HGA B;  1P3G C;  1BH8 B;  3UT9 D;  5AV8 C;  4LD9 D;  1P3G A;  1JFI B;  5AV5 C;  5AV8 A;  5CPJ A;  3W98 D;  5B40 D;  5AV5 A;  2ZY3 A;  2NQB B;  3X1V D;  1TZY B;  5AY8 B;  5AV6 D;  4H9N A;  3UTA B;  4E45 A;  1P3O D;  3LZ0 C;  4XZQ C;  3LZ0 A;  3X1S D;  3X1T D;  1HQ3 B;  3WAA B;  2Y2P A;  3VH6 W;  1P3B B;  4KGC B;  3TU4 A;  5FUG B;  3NQJ A;  5E5A D;  4CAY B;  4J8V B;  5B32 A;  5GT3 D;  4WU9 C;  1AOI B;  1ZLA D;  3O62 D;  4WU9 A;  2PYO D;  3WTP E;  5B24 D;  3AZF B;  3AZM C;  3R45 A;  4WNN B;  3REL C;  1EQZ A;  3UTB C;  3AZM A;  5JRG C;  5BT1 D;  4WU8 B;  3UTB A;  5JRG A;  5B0Z B;  5B31 G;  5F99 D;  5DNN B;  3AZE C;  3WTP A;  3KXB B;  1U35 B;  4Z5T A;  3AZE A;  2ZY4 A;  1ID3 B;  2Y2O A;  2DF4 C;  1S32 D;  1TZY D;  3AZN C;  3H0M C;  4JJN B;  5AY8 D;  5CP6 B;  3AZN A;  5AVC B;  1BFM A;  3UTA D;  4X23 C;  1P3K A;  3MVD B;  1PZR A;  2ARO C;  4J8W C;  2FFF B;  3AYW C;  1P3I C;  5B2I B;  3B6F C;  1HQ3 D;  3LJA B;  1M18 C;  4Z2M G;  1P3I A;  4KUD B;  1P3B D;  4KGC D;  1M18 A;  2HUE B;  2CV5 B;  4Z2M H;  1AOI D;  5B31 B;  5AVB D;  3AZF D;  3REI C;  1B6W A;  5JA4 A;  4YM6 B;  3C1C B;  3W99 A;  3VH5 A;  3AFA B;  5B0Z D;  4DRA A;  1HTA A;  2FJ7 B;  5DNN D;  2BYM B;  3MGS C;  2XD1 A;  3KXB D;  1U35 D;  3A1I A;  1ID3 D;  2HIO B;  1M19 B;  5GXQ B;  4XUJ A;  4J8U D;  4JJN D;  1P3P C;  5CP6 D;  3WKJ C;  5AVC D;  4AWL B;  3AZJ A;  1P34 B;  3WKJ A;  5BO0 A;  5B1M D;  4NE5 A;  3V9R B;  3MVD D;  2UWX A;  3REH A;  1F66 B;  3W97 B;  4LD9 B;  3NQU A;  5B0Y B;  4ZBJ C;  3X1U B;  4H9Q A;  1P3M B;  3UT9 A;  3KWQ C;  3LJA D;  3IP4 C;  5C3I C;  3MNN C;  4KUD D;  3KFU G;  3KSY A;  3KWQ A;  3REK D;  3W98 A;  5B40 A;  4J8X B;  5G49 B;  3X1V A;  1KX4 B;  5B31 D;  2F8N A;  5AV6 A;  3LEL B;  1H3O A;  5DNM B;  4UPK A;  4YM6 D;  2IO5 C;  3C1C D;  2G5H C;  4UUZ A;  3KUY B;  3AFA D;  1P3O A;  3X1S B;  2FJ7 D;  3W96 B;  3X1T C;  3AZH B;  5BNX A;  3X1T A;  2XD5 A;  1P3F D;  2HIO D;  3AZG D;  1M19 D;  5GXQ D;  5E5A A;  1P3L C;  3O62 C;  5GT3 A;  4G92 B;  2PYO C;  4H9P B;  1ZLA A;  4DRB A;  3O62 A;  4Z66 C;  2PYO A;  3F6T A;  5B24 A;  4Z66 A;  1P34 D;  3REJ B;  4WJ3 C;  5F99 B;  3W97 D;  1F66 D;  3B0C T;  2RVQ D;  5CPJ C;  2F8N K;  5B0Y D;  1BH8 A;  3X1U D;  1P3M D;  2BYK B;  5B1L B;  3AV2 D;  1JFI A;  1S32 B;  2NQB C;  2Y2J A;  5KDM B;  4H9O B;  4ZUX D;  2NQB A;  4J8X D;  5AY8 C;  5CHL B;  2YFV B;  1TZY A;  1KX4 D;  1F1E A;  3FDD A;  3AZL B;  5AY8 A;  4H9S C;  3A6N D;  2F2A C;  3LEL D;  1WWI A;  4H9S A;  5DNM D;  3UTA A;  2NZD C;  3KUY D;  3AZI D;  3MGP D;  3TU4 C;  3W96 D;  3WAA C;  5B32 C;  3AZH D;  4KGC C;  4H9R B;  1HQ3 A;  3AV1 B;  3WAA A;  4QLC D;  4J8V C;  4YS3 B;  1P3B A;  4KGC A;  5FUG A;  4CAY A;  1AOI C;  4J8V A;  5AVB B;  1EQZ C;  1AOI A;  2JCH A;  5B2J B;  3AZF A;  4WNN A;  3REJ D;  2Y2G A;  4WU8 C;  3WTP C;  5GSU B;  4WU8 A;  4Z5T C;  4XZQ B;  5DNN C;  5B0Z A;  2ZM5 A;  4CSR B;  5DNN A;  3KXB A;  5B1L D;  1U35 A;  3AN2 C;  3WA9 D;  1ID3 A;  3AN2 A;  1KX3 B;  3B6G B;  4J8U B;  5AVC C;  4JJN A;  3AZL D;  5CP6 A;  4R8P D;  3LZ1 D;  1P3K C;  5AVC A;  3REL B;  3H0R C;  5B1M B;  3MVD A;  5B2I C;  3VH6 T;  5AV8 D;  5B2I A;  3REK B;  3LJA A;  2HUE C;  3AV1 D;  2CV5 C;  4KUD A;  4YS3 D;  2CV5 A;  2Y2H A;  3W99 C;  5B31 A;  5B2J D;  1M1A B;  4YM6 C;  3B0B A;  4X23 B;  3AFA C;  4YM6 A;  5GSU D;  2ARO B;  4J8W B;  3AFA A;  4XZQ D;  5CPK B;  3C1B B;  1TAF B;  3AYW B;  2FJ7 A;  3B6F B;  2NZD B;  2BYM A;  1P3F B;  3AZG B;  1M19 C;  4XUJ C;  3VH5 W;  2HIO A;  1M19 A;  1KX3 D;  4KHA B;  5GXQ A;  3B6G D;  3AZJ C;  1P3A B;  4AWL C;  3AZM D;  3REI B;  1P34 C;  3AL0 C;  3REH C;  3REL D;  1P34 A;  5JRG D;  2F8N G;  2Y2M A;  3UT9 C;  3MGQ B;  4LD9 C;  3W97 A;  3V9R A;  5B0Y C;  1KX5 B;  1F66 A;  1P3M C;  2F8N H;  4LD9 A;  5B0Y A;  3W98 C;  3MGS B;  3X1U A;  5B40 C;  3AV2 B;  1P3M A;  1BH9 B;  3X1V C;  4ZUX B;  4J8X C;  3EPJ A;  5AV6 C;  4J8X A;  3AZN D;  3A6N B;  5G49 A;  5CPI B;  1P3P B;  3EPH A;  3AZK B;  1KX4 A;  5AV9 B;  4NFT A;  1M1A D;  3LEL A;  1P3O C;  5B33 B;  5DNM A;  4X23 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...