5CP6B

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6B00
4J8XC 3W98A 5AV6A 5BNXB 3KXBB 3AV2D 4YS3D 1TZYC 3UTAA 5GT0A 3C1CD 3RELD 2BYKB 5AVBC 5GSUC 4R8PC 3O62B 3AFAB 4JJNC 3AZFB 3WAAB 3W96C 3B0CT 3REHB 3AN2D 2AROC 2CV5B 1P3IB 1F66A 5B24A 4G91C 3AZIB 5B0YD 3B6GC 5B0ZD 4XUJD 3UT9A 1M18B 3MGPD 4H9OA 3AZLB 3W99D 5DNMD 3AZHD 3KXBC 4J8XD 4HGAB 1F1EA 3AV2A 4YS3A 3O62C 3AFAC 1TZYD 3C1CA 3AZKA 3WAAC 3AZFC 3NQUA 3REHC 2NZDB 5AVBD 5GSUD 4R8PD 2CV5C 1P3IC 3AZIC 1Q9CA 3X1VB 4JJND 5KDMB 1U35B 4ZUXB 3AN2A 3W96D 2AROD 5B0YA 4AWLB 1M18C 3AZLC 4H9QB 3B6GD 5B0ZA 4XUJA 3MGPA 3W99A 4HGAC 5DNMA 3KXBD 4J8XA 2YFVA 2NZDC 3R45A 3O62D 1HQ3B 3AFAD 3X1VC 1AOIB 1U35C 5F99A 3AZFD 4ZUXC 5AVBA 3WAAD 3REHD 4R8PA 2CV5D 1P3ID 4AWLC 3AZID 4JJNA 1N1JB 5GT0B 2AROA 2PYOB 1M18D 5CP6A 5GT3B 3B6GA 3WA9A 3KWQB 5B33B 3KXBA 1BFMA 3MGRB 3KSYA 2RVQC 1HQ3C 1AOIC 3MGSB 3UT9B 2BYKA 2NZDD 4H9OB 3VH6W 3O62A 3AFAA 4Z66B 3AZFA 3X1VD 3WAAA 1U35D 5GT0C 4H9SC 4ZUXD 2CV5A 3AZNB 1P3IA 1P3MB 2PYOC 3AZIA 4H9RB 5GT3C 5CPJB 3AZKB 4NE3A 3NQUB 3KWQC 1M18A 3VH5W 5B33C 3MGRC 3AZMA 3MGSC 3UT9C 4WU8B 3X1SB 4H9PB 2RVQD 1HQ3D 4Z66C 1AOID 2HIOB 5CPKB 3AZNC 1P3MC 2F8NK 1BH9B 3REIB 3X1VA 5B31G 1U35A 5KDMA 4Z2MH 4ZUXA 5CPJC 5GT0D 3AZKC 4G92B 3R45B 1P3OB 2PYOD 5B2JB 4H9QA 3VH6A 5GT3D 5F99B 3KWQD 5BT1C 4WU8C 5B33D 4YM6B 3X1SC 1P34B 3MGRD 3WTPB 5AY8B 1A7WA 3MGSD 4UUZB 2HIOC 3UT9D 5CP6B 5CPKC 3REIC 1HQ3A 3VH5A 4X23A 3WA9B 1AOIA 4Z66D 5B32A 1P3AB 3C1BB 4G92C 3AZND 1P3MD 1P3OC 1N1JA 5B2JC 4H9SA 5CPJD 3AZKD 5F99C 1ID3B 2PYOA 3LZ0B 1KU5A 5GT3A 4YM6C 1P34C 3KUYB 3WTPC 1P3LB 5AY8C 3KWQA 2YFWB 1B67A 3AV1A 1ZLAB 4J8UA 3A6NB 5BT1D 1BH8B 5B33A 4WU8D 3MGRA 5CP6C 3X1SD 3MNNB 3WA9C 3MGSA 3AZEB 2HIOD 1P3AC 3C1BC 5CPKD 3REID 4Z66A 4WV4B 3AZMB 3AZNA 1P3MA 2F8NB 1ID3C 3LZ0C 1P3OD 4KUDA 1KX5A 4H9RA 5CPJA 5B2JD 3KUYC 1P3LC 5F99D 1KX4B 1ZLAC 3B0DB 3A6NC 4YM6D 1P34D 4J8WB 3WTPD 3MNNC 5AY8D 3AZEC 4WU8A 3X1SA 4H9PA 5CP6D 1M1AB 3WA9D 3AZMC 2HIOA 4DRAA 5CPKA 4KGCB 1P3AD 1BH9A 3C1BD 3REIA 1EQZB 4CSRB 2IO5B 4LD9A 4NE5A 5C3IB 3REJB 1KX4C 1P3OA 3X1TA 3B0DC 3LZ0D 1ID3D 2FJ7A 4X23B 5B2JA 5CHLB 5B1LB 1HTAA 4J8WC 3KUYD 1P3LD 5B32B 1S32B 3LJAB 1ZLAD 5G49B 3A6ND 4YM6A 1P34A 3WTPA 5AY8A 4KHAB 3MNND 1M1AC 4UUZA 1P3PB 3AZED 4KGCC 1EQZC 3AZMD 3AV1B 3AZGB 4J8UB 2IO5C 1P3AA 3C1BA 1WWSA 5C3IC 3REJC 2F8ND 1ULYA 4X23C 5B1LC 4EO5B 5B2IA 5B32C 1S32C 3LZ0A 3LJAC 1P3KA 1KX4D 1ID3A 5JRGA 2CWEA 3KUYA 1P3LA 4J8WD 4Z2MG 2YFWA 1ZLAA 3W97B 3A6NA 1BH8A 5B40A 1P3PC 4KUDB 1KX5B 5JA4B 4WNNB 1P3BA 3MNNA 1M1AD 1R4VA 3AZEA 3AV1C 3AZGC 4J8UC 5AV9A 2NQBB 4KGCD 4WU9D 1EQZD 3X1UB 3AZJB 5GXQA 4EO5C 2F8NA 4XZQB 3REJD 1P3FB 4X23D 5B1LD 3WKJB 1KX4A 1P3GA 3W97C 5B32D 1S32D 3LJAD 4KUDC 1KX5C 4J8WA 5BO0A 4NFTA 3B0CW 4LD9B 2FJ7B 3X1TB 1P3PD 2NQBC 1M1AA 5DNNB 3X1UC 3AZJC 3AV1D 3AZGD 4QLCB 4J8UD 4KGCA 4XZQC 4WU9A 1KX3B 1EQZA 1P3FC 4CSRA 3WKJC 3REJA 5B31B 5B1LA 5AVCB 3REKB 3WTPE 3LJAA 1S32A 3W97D 4LD9C 5G49A 2FJ7C 3VH6T 3X1TC 4KUDD 1KX5D 2HUEB 4KHAA 1TAFB 4M6BA 5B2IB 5DNNC 3TU4B 1P3KB 1P3PA 3AYWB 4QLCC 5JRGB 2NQBD 1KX3C 5B1MB 3AZGA 3X1UD 3AZJD 5B40B 3VH5T 4XZQD 5AV5B 1P3BB 3NQJA 5B31C 1P3FD 5AVCC 3REKC 3WKJD 5AV9B 4Z5TB 4CAYA 2HUEC 3W97A 5GXQB 4J8VA 3V9RB 5B2IC 4LD9D 3TU4C 1P3KC 2FJ7D 3AYWC 2F8NG 3X1TD 5JA4A 4WNNA 5JRGC 2JSSA 3MGQA 5B1MC 1P3GB 5DNND 5FUGA 5B40C 4QLCD 2NQBA 3B6FB 5AV5C 1P3BC 1KX3D 5BO0B 1JFIA 3X1UA 3AZJA 1B6WA 4XZQA 5AV8A 2BYMB 5AV9C 3UTBB 2L5AA 1P3FA 4Z5TC 5B31D 4E45A 3WKJA 5AVCD 3REKD 5GXQC 4WU9B 3LZ1B 5CPIB 3RELA 5B2ID 1P3GC 2F8NH 3TU4D 1P3KD 3AYWD 3B6FC 5JRGD 1H3OB 4H9NA 4ZBJB 5DNNA 5B1MD 4QLCA 5B32G 5B40D 3UTBC 1KX3A 5AV5D 1P3BD 5AV9D 5E5AB 3AZHA 4WU9C 5B31A 1M19B 4Z5TD 5BNVB 5AVCA 3LZ1C 3REKA 3LELB 5GXQD 5CPIC 4WZSB 3MVDB 3NQJB 3B0BA 1TZYA 1TAFA 4ZBJC 3TU4A 1P3GD 5AV6B 3AYWA 5GSUA 3W98B 3B6FD 4CAYB 5B1MA 3W96A 3UTAB 4J8VB 5AV5A 3UTBD 5E5AC 3MGQB 3AZLD 1M19C 5FUGB 5BS7C 3LELC 1F66B 5B24B 5BNXA 3MVDC 4NE6A 4Z5TA 1JFIB 3LZ1D 3V9RA 5CPID 3W98C 5AV8B 5AV6C 3UTAC 3REHA 4J8VC 3B6FA 3AV2B 4YS3B 4DRBA 3MGQC 3C1CB 3RELB 4E44A 2BYMA 3UTBA 1F66C 5B24C 3AZLA 5E5AD 4H9NB 1M19D 3AN2B 3LELD 5AV8C 5B0YB 3MVDD 3LZ1A 5B0ZB 4XUJB 5CPIA 1WWIA 3MGPB 2NZDA 3W98D 5AV6D 3W99B 5DNMB 3AZHB 3AV2C 4J8XB 2LY8A 1H3OA 4YS3C 3UTAD 3C1CC 2YFVB 4J8VD 3RELC 1TZYB 3MGQD 5AVBB 3AN2C 5GSUB 4R8PB 1F66D 5B24D 5E5AA 5B0YC 4JJNB 1M19A 3W96B 5BNVA 5BS7A 2AROB 3LELA 5B0ZC 4XUJC 4G91B 3MVDA 3MGPC 5AV8D 3W99C 5DNMC 3AZHC 3B6GB
chains in the Genus database with same CATH superfamily
4J8XC 3W98A 5AV6A 5BNXB 3KXBB 3AV2D 4YS3D 1TZYC 3UTAA 5GT0A 2F2AC 3C1CD 3RELD 2BYKB 5AVBC 5GSUC 4R8PC 3O62B 3AFAB 4JJNC 3AZFB 3WAAB 3W96C 3B0CT 3REHB 2DF4C 3AN2D 2AROC 2CV5B 1P3IB 1F66A 5B24A 4G91C 3AZIB 5B0YD 3B6GC 5B0ZD 4XUJD 3UT9A 2Y2GA 1M18B 3MGPD 4H9OA 3AZLB 3W99D 5DNMD 3AZHD 3KXBC 4J8XD 3IP4C 2JCHA 4HGAB 1F1EA 3AV2A 4YS3A 3O62C 3AFAC 1TZYD 3C1CA 3AZKA 3WAAC 3AZFC 3NQUA 3REHC 2NZDB 5AVBD 5GSUD 4R8PD 2CV5C 1P3IC 3AZIC 1Q9CA 3X1VB 4JJND 5KDMB 1U35B 4ZUXB 3AN2A 3W96D 2AROD 5B0YA 4AWLB 1M18C 3AZLC 4H9QB 3B6GD 3P5JB 5B0ZA 4XUJA 3A1KA 3MGPA 3W99A 4HGAC 5DNMA 3KXBD 4J8XA 2YFVA 2NZDC 3R45A 3O62D 1HQ3B 3AFAD 3X1VC 1AOIB 1U35C 5F99A 3AZFD 4ZUXC 5AVBA 3WAAD 3REHD 4R8PA 2CV5D 1P3ID 4AWLC 3AZID 4JJNA 1N1JB 5GT0B 2AROA 2PYOB 1M18D 5CP6A 5GT3B 3B6GA 3WA9A 3KWQB 5B33B 3KXBA 1BFMA 3MGRB 3KSYA 2RVQC 4DQYB 1HQ3C 2RIQA 1AOIC 3MGSB 3UT9B 2BYKA 2NZDD 4H9OB 2XD5A 3VH6W 3O62A 2BG1A 3AFAA 4Z66B 3AZFA 3X1VD 3WAAA 1U35D 5GT0C 4ZUXD 4H9SC 2Y2NA 2CV5A 3AZNB 1P3IA 1P3MB 2PYOC 3AZIA 2DQNC 4H9RB 5GT3C 5CPJB 3AZKB 2J8PA 4NE3A 3NQUB 3KWQC 1M18A 3VH5W 5B33C 3MGRC 3AZMA 3MGSC 3UT9C 4WU8B 3X1SB 1W2EA 1Z2CB 4H9PB 2RVQD 1HQ3D 4Z66C 1AOID 2HIOB 5CPKB 3AZNC 1P3MC 2F8NK 1BH9B 3REIB 3X1VA 5B31G 1U35A 5KDMA 4Z2MH 4ZUXA 5CPJC 5GT0D 3AZKC 2ZM5A 4G92B 3R45B 1P3OB 2PYOD 5B2JB 4H9QA 3VH6A 5GT3D 5F99B 3KWQD 5BT1C 4WU8C 5B33D 4YM6B 3X1SC 1P34B 3MGRD 3WTPB 5AY8B 1A7WA 3MGSD 4UUZB 2HIOC 3UT9D 5CP6B 5CPKC 3REIC 1HQ3A 3VH5A 4X23A 3WA9B 1AOIA 4Z66D 5B32A 1P3AB 3C1BB 4G92C 3AZND 1P3MD 2Y2LA 1P3OC 1N1JA 5B2JC 4H9SA 5CPJD 3AZKD 5F99C 1ID3B 2PYOA 3LZ0B 1KU5A 5GT3A 2ZY2A 4YM6C 1P34C 3KUYB 3WTPC 1P3LB 5AY8C 3KWQA 2YFWB 1B67A 2ZY5A 3AV1A 1ZLAB 4J8UA 3A6NB 5BT1D 1BH8B 5B33A 4WU8D 3MGRA 5CP6C 3X1SD 3MNNB 3WA9C 3MGSA 3AZEB 2HIOD 2G5HC 1P3AC 3C1BC 5CPKD 3EPHA 3REID 4Z66A 4WV4B 3AZMB 3EPJA 3AZNA 1P3MA 2F8NB 1ID3C 3LZ0C 1P3OD 4KUDA 1KX5A 4H9RA 5CPJA 5B2JD 2Y2PA 3KUYC 3EPKA 5F99D 1P3LC 1KX4B 1ZLAC 3B0DB 2VQRA 3AL0C 3A6NC 4YM6D 1P34D 4UPKA 4J8WB 3KFUG 3WTPD 3MNNC 5AY8D 3AZEC 4WU8A 3X1SA 4H9PA 5CP6D 1M1AB 3WA9D 3AZMC 2HIOA 4DRAA 5CPKA 4KGCB 1P3AD 1BH9A 3C1BD 3REIA 1EQZB 4CSRB 2IO5B 4LD9A 4NE5A 5C3IB 3REJB 1KX4C 1P3OA 3X1TA 3B0DC 3LZ0D 2Y2OA 1ID3D 2FJ7A 4X23B 5B2JA 5CHLB 5B1LB 1HTAA 4J8WC 3KUYD 1P3LD 5B32B 1S32B 3LJAB 2Y2KA 1ZLAD 5G49B 3A6ND 4YM6A 1P34A 3WTPA 5AY8A 4KHAB 3MNND 1M1AC 4UUZA 1P3PB 3AZED 4KGCC 1EQZC 3AZMD 3AV1B 3AZGB 4J8UB 2IO5C 1P3AA 3C1BA 1WWSA 5C3IC 3REJC 2F8ND 1ULYA 4X23C 5B1LC 4EO5B 5B2IA 2G5IC 5B32C 1S32C 3LZ0A 3LJAC 1P3KA 1KX4D 1ID3A 5JRGA 2CWEA 3KUYA 1P3LA 4J8WD 4Z2MG 2YFWA 1ZLAA 3W97B 3A6NA 1BH8A 5B40A 1P3PC 4KUDB 1KX5B 5JA4B 4WNNB 1P3BA 2Y2IA 3H0MC 3MNNA 1M1AD 1R4VA 3AZEA 3AV1C 3AZGC 4J8UC 5AV9A 2Y2QA 2NQBB 4KGCD 4WU9D 1EQZD 3X1UB 3AZJB 5GXQA 4EO5C 2F8NA 4XZQB 3REJD 3EG5B 1P3FB 4X23D 5B1LD 3WKJB 1KX4A 1P3GA 3W97C 5B32D 1S32D 3LJAD 3H0LC 4KUDC 1KX5C 4J8WA 5BO0A 4NFTA 3B0CW 4LD9B 2FJ7B 3X1TB 1P3PD 2NQBC 1M1AA 5DNNB 3X1UC 3AZJC 3AV1D 3AZGD 4QLCB 4J8UD 4KGCA 4XZQC 4WU9A 1KX3B 1EQZA 1P3FC 4CSRA 3FDDA 3WKJC 3REJA 5B31B 5B1LA 5AVCB 3REKB 3WTPE 3LJAA 1S32A 3W97D 4LD9C 5G49A 2FJ7C 3VH6T 3X1TC 4KUDD 1KX5D 2HUEB 4KHAA 1TAFB 4M6BA 5B2IB 5DNNC 3TU4B 1P3KB 1P3PA 3AYWB 4QLCC 5JRGB 2NQBD 1KX3C 5B1MB 3AZGA 3X1UD 3AZJD 5B40B 3VH5T 4XZQD 5AV5B 1P3BB 3NQJA 5B31C 1P3FD 5AVCC 3REKC 3WKJD 5AV9B 4Z5TB 4CAYA 2HUEC 3W97A 5GXQB 4J8VA 2JE5A 3V9RB 5B2IC 3TU4C 1P3KC 2FJ7D 3AYWC 2F8NG 3H0RC 3X1TD 4LD9D 5JA4A 4WNNA 5JRGC 2JSSA 3MGQA 3EPLA 5B1MC 1P3GB 5DNND 5FUGA 5B40C 4QLCD 2NQBA 3B6FB 5AV5C 1P3BC 1KX3D 5BO0B 1JFIA 3X1UA 3AZJA 1B6WA 4XZQA 5AV8A 2BYMB 5AV9C 3UTBB 2L5AA 1P3FA 4Z5TC 5B31D 4E45A 3WKJA 5AVCD 3REKD 5GXQC 4WU9B 3LZ1B 5CPIB 3RELA 5B2ID 1P3GC 2F8NH 3TU4D 1P3KD 3AYWD 3B6FC 2XD1A 5JRGD 1H3OB 4H9NA 4ZBJB 5DNNA 5B1MD 4QLCA 5B32G 5B40D 3UTBC 1KX3A 5AV5D 1P3BD 5AV9D 5E5AB 3AZHA 4WU9C 5B31A 1M19B 2ZY3A 4Z5TD 5BNVB 5AVCA 3LZ1C 3REKA 3LELB 5GXQD 5CPIC 4WZSB 3MVDB 3NQJB 3B0BA 1TZYA 1TAFA 4ZBJC 3TU4A 1P3GD 5AV6B 3AYWA 5GSUA 3W98B 3B6FD 4CAYB 5B1MA 3W96A 3UTAB 4J8VB 5AV5A 3UTBD 5E5AC 3MGQB 3AZLD 1M19C 5FUGB 2W8SA 5BS7C 3LELC 1F66B 5B24B 3F6TA 5BNXA 3MVDC 4NE6A 4Z5TA 1JFIB 3LZ1D 3V9RA 5CPID 2Y2HA 5AV8B 5AV6C 3W98C 3UTAC 3REHA 4J8VC 2Y2JA 2UWXA 3AV2B 3B6FA 2FFFB 4YS3B 4DRBA 3MGQC 3C1CB 1T3UA 3RELB 4E44A 2BYMA 3UTBA 1F66C 5B24C 3AZLA 5E5AD 4H9NB 1M19D 3AN2B 2Y2MA 3LELD 5AV8C 5B0YB 3MVDD 4WJ3C 3LZ1A 5B0ZB 3A1IA 4XUJB 5CPIA 1WWIA 3MGPB 2NZDA 3W98D 2ZY4A 5AV6D 3W99B 5DNMB 3AZHB 3AV2C 4J8XB 2LY8A 1H3OA 4YS3C 3UTAD 3C1CC 2YFVB 4J8VD 3RELC 1PZRA 1TZYB 3MGQD 5AVBB 3AN2C 5GSUB 4R8PB 1F66D 5B24D 5E5AA 5B0YC 4JJNB 1M19A 3W96B 5BNVA 5BS7A 2AROB 3LELA 5B0ZC 4XUJC 4G91B 3MVDA 3MGPC 5AV8D 3W99C 5DNMC 3AZHC 3B6GB
chains in the Genus database with same CATH topology
4J8XC 3W98A 5AV6A 5BNXB 3KXBB 3AV2D 4YS3D 1TZYC 3UTAA 5GT0A 2F2AC 3C1CD 3RELD 2BYKB 5AVBC 5GSUC 4R8PC 3O62B 3AFAB 4JJNC 3AZFB 3WAAB 3W96C 3B0CT 3REHB 2DF4C 3AN2D 2AROC 2CV5B 1P3IB 1F66A 5B24A 4G91C 3AZIB 5B0YD 3B6GC 5B0ZD 4XUJD 3UT9A 2Y2GA 1M18B 3MGPD 4H9OA 3AZLB 3W99D 5DNMD 3AZHD 3KXBC 4J8XD 3IP4C 2JCHA 4HGAB 1F1EA 3AV2A 4YS3A 3O62C 3AFAC 1TZYD 3C1CA 3AZKA 3WAAC 3AZFC 3NQUA 3REHC 2NZDB 5AVBD 5GSUD 4R8PD 2CV5C 1P3IC 3AZIC 1Q9CA 3X1VB 4JJND 5KDMB 1U35B 4ZUXB 3AN2A 3W96D 2AROD 5B0YA 4AWLB 1M18C 3AZLC 4H9QB 3B6GD 3P5JB 5B0ZA 4XUJA 3A1KA 3MGPA 3W99A 4HGAC 5DNMA 3KXBD 4J8XA 2YFVA 2NZDC 3R45A 3O62D 1HQ3B 3AFAD 3X1VC 1AOIB 1U35C 5F99A 3AZFD 4ZUXC 5AVBA 3WAAD 3REHD 4R8PA 2CV5D 1P3ID 4AWLC 3AZID 4JJNA 1N1JB 5GT0B 2AROA 2PYOB 1M18D 5CP6A 5GT3B 3B6GA 3WA9A 3KWQB 5B33B 3KXBA 1BFMA 3MGRB 3KSYA 2RVQC 4DQYB 1HQ3C 2RIQA 1AOIC 3MGSB 3UT9B 2BYKA 2NZDD 4H9OB 2XD5A 3VH6W 3O62A 2BG1A 3AFAA 4Z66B 3AZFA 3X1VD 3WAAA 1U35D 5GT0C 4ZUXD 4H9SC 2Y2NA 2CV5A 3AZNB 1P3IA 1P3MB 2PYOC 3AZIA 2DQNC 4H9RB 5GT3C 5CPJB 3AZKB 2J8PA 4NE3A 3NQUB 3KWQC 1M18A 3VH5W 5B33C 3MGRC 3AZMA 3MGSC 3UT9C 4WU8B 3X1SB 1W2EA 1Z2CB 4H9PB 2RVQD 1HQ3D 4Z66C 1AOID 2HIOB 5CPKB 3AZNC 1P3MC 2F8NK 1BH9B 3REIB 3X1VA 5B31G 1U35A 5KDMA 4Z2MH 4ZUXA 5CPJC 5GT0D 3AZKC 2ZM5A 4G92B 3R45B 1P3OB 2PYOD 5B2JB 4H9QA 3VH6A 5GT3D 5F99B 3KWQD 5BT1C 4WU8C 5B33D 4YM6B 3X1SC 1P34B 3MGRD 3WTPB 5AY8B 1A7WA 3MGSD 4UUZB 2HIOC 3UT9D 5CP6B 5CPKC 3REIC 1HQ3A 3VH5A 4X23A 3WA9B 1AOIA 4Z66D 5B32A 1P3AB 3C1BB 4G92C 3AZND 1P3MD 2Y2LA 1P3OC 1N1JA 5B2JC 4H9SA 5CPJD 3AZKD 5F99C 1ID3B 2PYOA 3LZ0B 1KU5A 5GT3A 2ZY2A 4YM6C 1P34C 3KUYB 3WTPC 1P3LB 5AY8C 3KWQA 2YFWB 1B67A 2ZY5A 3AV1A 1ZLAB 4J8UA 3A6NB 5BT1D 1BH8B 5B33A 4WU8D 3MGRA 5CP6C 3X1SD 3MNNB 3WA9C 3MGSA 3AZEB 2HIOD 2G5HC 1P3AC 3C1BC 5CPKD 3EPHA 3REID 4Z66A 4WV4B 3AZMB 3EPJA 3AZNA 1P3MA 2F8NB 1ID3C 3LZ0C 1P3OD 4KUDA 1KX5A 4H9RA 5CPJA 5B2JD 2Y2PA 3KUYC 3EPKA 5F99D 1P3LC 1KX4B 1ZLAC 3B0DB 2VQRA 3AL0C 3A6NC 4YM6D 1P34D 4UPKA 4J8WB 3KFUG 3WTPD 3MNNC 5AY8D 3AZEC 4WU8A 3X1SA 4H9PA 5CP6D 1M1AB 3WA9D 3AZMC 2HIOA 4DRAA 5CPKA 4KGCB 1P3AD 1BH9A 3C1BD 3REIA 1EQZB 4CSRB 2IO5B 4LD9A 4NE5A 5C3IB 3REJB 1KX4C 1P3OA 3X1TA 3B0DC 3LZ0D 2Y2OA 1ID3D 2FJ7A 4X23B 5B2JA 5CHLB 5B1LB 1HTAA 4J8WC 3KUYD 1P3LD 5B32B 1S32B 3LJAB 2Y2KA 1ZLAD 5G49B 3A6ND 4YM6A 1P34A 3WTPA 5AY8A 4KHAB 3MNND 1M1AC 4UUZA 1P3PB 3AZED 4KGCC 1EQZC 3AZMD 3AV1B 3AZGB 4J8UB 2IO5C 1P3AA 3C1BA 1WWSA 5C3IC 3REJC 2F8ND 1ULYA 4X23C 5B1LC 4EO5B 5B2IA 2G5IC 5B32C 1S32C 3LZ0A 3LJAC 1P3KA 1KX4D 1ID3A 5JRGA 2CWEA 3KUYA 1P3LA 4J8WD 4Z2MG 2YFWA 1ZLAA 3W97B 3A6NA 1BH8A 5B40A 1P3PC 4KUDB 1KX5B 5JA4B 4WNNB 1P3BA 2Y2IA 3H0MC 3MNNA 1M1AD 1R4VA 3AZEA 3AV1C 3AZGC 4J8UC 5AV9A 2Y2QA 2NQBB 4KGCD 4WU9D 1EQZD 3X1UB 3AZJB 5GXQA 4EO5C 2F8NA 4XZQB 3REJD 3EG5B 1P3FB 4X23D 5B1LD 3WKJB 1KX4A 1P3GA 3W97C 5B32D 1S32D 3LJAD 3H0LC 4KUDC 1KX5C 4J8WA 5BO0A 4NFTA 3B0CW 4LD9B 2FJ7B 3X1TB 1P3PD 2NQBC 1M1AA 5DNNB 3X1UC 3AZJC 3AV1D 3AZGD 4QLCB 4J8UD 4KGCA 4XZQC 4WU9A 1KX3B 1EQZA 1P3FC 4CSRA 3FDDA 3WKJC 3REJA 5B31B 5B1LA 5AVCB 3REKB 3WTPE 3LJAA 1S32A 3W97D 4LD9C 5G49A 2FJ7C 3VH6T 3X1TC 4KUDD 1KX5D 2HUEB 4KHAA 1TAFB 4M6BA 5B2IB 5DNNC 3TU4B 1P3KB 1P3PA 3AYWB 4QLCC 5JRGB 2NQBD 1KX3C 5B1MB 3AZGA 3X1UD 3AZJD 5B40B 3VH5T 4XZQD 5AV5B 1P3BB 3NQJA 5B31C 1P3FD 5AVCC 3REKC 3WKJD 5AV9B 4Z5TB 4CAYA 2HUEC 3W97A 5GXQB 4J8VA 2JE5A 3V9RB 5B2IC 3TU4C 1P3KC 2FJ7D 3AYWC 2F8NG 3H0RC 3X1TD 4LD9D 5JA4A 4WNNA 5JRGC 2JSSA 3MGQA 3EPLA 5B1MC 1P3GB 5DNND 5FUGA 5B40C 4QLCD 2NQBA 3B6FB 5AV5C 1P3BC 1KX3D 5BO0B 1JFIA 3X1UA 3AZJA 1B6WA 4XZQA 5AV8A 2BYMB 5AV9C 3UTBB 2L5AA 1P3FA 4Z5TC 5B31D 4E45A 3WKJA 5AVCD 3REKD 5GXQC 4WU9B 3LZ1B 5CPIB 3RELA 5B2ID 1P3GC 2F8NH 3TU4D 1P3KD 3AYWD 3B6FC 2XD1A 5JRGD 1H3OB 4H9NA 4ZBJB 5DNNA 5B1MD 4QLCA 5B32G 5B40D 3UTBC 1KX3A 5AV5D 1P3BD 5AV9D 5E5AB 3AZHA 4WU9C 5B31A 1M19B 2ZY3A 4Z5TD 5BNVB 5AVCA 3LZ1C 3REKA 3LELB 5GXQD 5CPIC 4WZSB 3MVDB 3NQJB 3B0BA 1TZYA 1TAFA 4ZBJC 3TU4A 1P3GD 5AV6B 3AYWA 5GSUA 3W98B 3B6FD 4CAYB 5B1MA 3W96A 3UTAB 4J8VB 5AV5A 3UTBD 5E5AC 3MGQB 3AZLD 1M19C 5FUGB 2W8SA 5BS7C 3LELC 1F66B 5B24B 3F6TA 5BNXA 3MVDC 4NE6A 4Z5TA 1JFIB 3LZ1D 3V9RA 5CPID 2Y2HA 5AV8B 5AV6C 3W98C 3UTAC 3REHA 4J8VC 2Y2JA 2UWXA 3AV2B 3B6FA 2FFFB 4YS3B 4DRBA 3MGQC 3C1CB 1T3UA 3RELB 4E44A 2BYMA 3UTBA 1F66C 5B24C 3AZLA 5E5AD 4H9NB 1M19D 3AN2B 2Y2MA 3LELD 5AV8C 5B0YB 3MVDD 4WJ3C 3LZ1A 5B0ZB 3A1IA 4XUJB 5CPIA 1WWIA 3MGPB 2NZDA 3W98D 2ZY4A 5AV6D 3W99B 5DNMB 3AZHB 3AV2C 4J8XB 2LY8A 1H3OA 4YS3C 3UTAD 3C1CC 2YFVB 4J8VD 3RELC 1PZRA 1TZYB 3MGQD 5AVBB 3AN2C 5GSUB 4R8PB 1F66D 5B24D 5E5AA 5B0YC 4JJNB 1M19A 3W96B 5BNVA 5BS7A 2AROB 3LELA 5B0ZC 4XUJC 4G91B 3MVDA 3MGPC 5AV8D 3W99C 5DNMC 3AZHC 3B6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X C;  3W98 A;  5AV6 A;  5BNX B;  3KXB B;  3AV2 D;  4YS3 D;  1TZY C;  3UTA A;  5GT0 A;  3C1C D;  3REL D;  2BYK B;  5AVB C;  5GSU C;  4R8P C;  3O62 B;  3AFA B;  4JJN C;  3AZF B;  3WAA B;  3W96 C;  3B0C T;  3REH B;  3AN2 D;  2ARO C;  2CV5 B;  1P3I B;  1F66 A;  5B24 A;  4G91 C;  3AZI B;  5B0Y D;  3B6G C;  5B0Z D;  4XUJ D;  3UT9 A;  1M18 B;  3MGP D;  4H9O A;  3AZL B;  3W99 D;  5DNM D;  3AZH D;  3KXB C;  4J8X D;  4HGA B;  1F1E A;  3AV2 A;  4YS3 A;  3O62 C;  3AFA C;  1TZY D;  3C1C A;  3AZK A;  3WAA C;  3AZF C;  3NQU A;  3REH C;  2NZD B;  5AVB D;  5GSU D;  4R8P D;  2CV5 C;  1P3I C;  3AZI C;  1Q9C A;  3X1V B;  4JJN D;  5KDM B;  1U35 B;  4ZUX B;  3AN2 A;  3W96 D;  2ARO D;  5B0Y A;  4AWL B;  1M18 C;  3AZL C;  4H9Q B;  3B6G D;  5B0Z A;  4XUJ A;  3MGP A;  3W99 A;  4HGA C;  5DNM A;  3KXB D;  4J8X A;  2YFV A;  2NZD C;  3R45 A;  3O62 D;  1HQ3 B;  3AFA D;  3X1V C;  1AOI B;  1U35 C;  5F99 A;  3AZF D;  4ZUX C;  5AVB A;  3WAA D;  3REH D;  4R8P A;  2CV5 D;  1P3I D;  4AWL C;  3AZI D;  4JJN A;  1N1J B;  5GT0 B;  2ARO A;  2PYO B;  1M18 D;  5CP6 A;  5GT3 B;  3B6G A;  3WA9 A;  3KWQ B;  5B33 B;  3KXB A;  1BFM A;  3MGR B;  3KSY A;  2RVQ C;  1HQ3 C;  1AOI C;  3MGS B;  3UT9 B;  2BYK A;  2NZD D;  4H9O B;  3VH6 W;  3O62 A;  3AFA A;  4Z66 B;  3AZF A;  3X1V D;  3WAA A;  1U35 D;  5GT0 C;  4H9S C;  4ZUX D;  2CV5 A;  3AZN B;  1P3I A;  1P3M B;  2PYO C;  3AZI A;  4H9R B;  5GT3 C;  5CPJ B;  3AZK B;  4NE3 A;  3NQU B;  3KWQ C;  1M18 A;  3VH5 W;  5B33 C;  3MGR C;  3AZM A;  3MGS C;  3UT9 C;  4WU8 B;  3X1S B;  4H9P B;  2RVQ D;  1HQ3 D;  4Z66 C;  1AOI D;  2HIO B;  5CPK B;  3AZN C;  1P3M C;  2F8N K;  1BH9 B;  3REI B;  3X1V A;  5B31 G;  1U35 A;  5KDM A;  4Z2M H;  4ZUX A;  5CPJ C;  5GT0 D;  3AZK C;  4G92 B;  3R45 B;  1P3O B;  2PYO D;  5B2J B;  4H9Q A;  3VH6 A;  5GT3 D;  5F99 B;  3KWQ D;  5BT1 C;  4WU8 C;  5B33 D;  4YM6 B;  3X1S C;  1P34 B;  3MGR D;  3WTP B;  5AY8 B;  1A7W A;  3MGS D;  4UUZ B;  2HIO C;  3UT9 D;  5CP6 B;  5CPK C;  3REI C;  1HQ3 A;  3VH5 A;  4X23 A;  3WA9 B;  1AOI A;  4Z66 D;  5B32 A;  1P3A B;  3C1B B;  4G92 C;  3AZN D;  1P3M D;  1P3O C;  1N1J A;  5B2J C;  4H9S A;  5CPJ D;  3AZK D;  5F99 C;  1ID3 B;  2PYO A;  3LZ0 B;  1KU5 A;  5GT3 A;  4YM6 C;  1P34 C;  3KUY B;  3WTP C;  1P3L B;  5AY8 C;  3KWQ A;  2YFW B;  1B67 A;  3AV1 A;  1ZLA B;  4J8U A;  3A6N B;  5BT1 D;  1BH8 B;  5B33 A;  4WU8 D;  3MGR A;  5CP6 C;  3X1S D;  3MNN B;  3WA9 C;  3MGS A;  3AZE B;  2HIO D;  1P3A C;  3C1B C;  5CPK D;  3REI D;  4Z66 A;  4WV4 B;  3AZM B;  3AZN A;  1P3M A;  2F8N B;  1ID3 C;  3LZ0 C;  1P3O D;  4KUD A;  1KX5 A;  4H9R A;  5CPJ A;  5B2J D;  3KUY C;  1P3L C;  5F99 D;  1KX4 B;  1ZLA C;  3B0D B;  3A6N C;  4YM6 D;  1P34 D;  4J8W B;  3WTP D;  3MNN C;  5AY8 D;  3AZE C;  4WU8 A;  3X1S A;  4H9P A;  5CP6 D;  1M1A B;  3WA9 D;  3AZM C;  2HIO A;  4DRA A;  5CPK A;  4KGC B;  1P3A D;  1BH9 A;  3C1B D;  3REI A;  1EQZ B;  4CSR B;  2IO5 B;  4LD9 A;  4NE5 A;  5C3I B;  3REJ B;  1KX4 C;  1P3O A;  3X1T A;  3B0D C;  3LZ0 D;  1ID3 D;  2FJ7 A;  4X23 B;  5B2J A;  5CHL B;  5B1L B;  1HTA A;  4J8W C;  3KUY D;  1P3L D;  5B32 B;  1S32 B;  3LJA B;  1ZLA D;  5G49 B;  3A6N D;  4YM6 A;  1P34 A;  3WTP A;  5AY8 A;  4KHA B;  3MNN D;  1M1A C;  4UUZ A;  1P3P B;  3AZE D;  4KGC C;  1EQZ C;  3AZM D;  3AV1 B;  3AZG B;  4J8U B;  2IO5 C;  1P3A A;  3C1B A;  1WWS A;  5C3I C;  3REJ C;  2F8N D;  1ULY A;  4X23 C;  5B1L C;  4EO5 B;  5B2I A;  5B32 C;  1S32 C;  3LZ0 A;  3LJA C;  1P3K A;  1KX4 D;  1ID3 A;  5JRG A;  2CWE A;  3KUY A;  1P3L A;  4J8W D;  4Z2M G;  2YFW A;  1ZLA A;  3W97 B;  3A6N A;  1BH8 A;  5B40 A;  1P3P C;  4KUD B;  1KX5 B;  5JA4 B;  4WNN B;  1P3B A;  3MNN A;  1M1A D;  1R4V A;  3AZE A;  3AV1 C;  3AZG C;  4J8U C;  5AV9 A;  2NQB B;  4KGC D;  4WU9 D;  1EQZ D;  3X1U B;  3AZJ B;  5GXQ A;  4EO5 C;  2F8N A;  4XZQ B;  3REJ D;  1P3F B;  4X23 D;  5B1L D;  3WKJ B;  1KX4 A;  1P3G A;  3W97 C;  5B32 D;  1S32 D;  3LJA D;  4KUD C;  1KX5 C;  4J8W A;  5BO0 A;  4NFT A;  3B0C W;  4LD9 B;  2FJ7 B;  3X1T B;  1P3P D;  2NQB C;  1M1A A;  5DNN B;  3X1U C;  3AZJ C;  3AV1 D;  3AZG D;  4QLC B;  4J8U D;  4KGC A;  4XZQ C;  4WU9 A;  1KX3 B;  1EQZ A;  1P3F C;  4CSR A;  3WKJ C;  3REJ A;  5B31 B;  5B1L A;  5AVC B;  3REK B;  3WTP E;  3LJA A;  1S32 A;  3W97 D;  4LD9 C;  5G49 A;  2FJ7 C;  3VH6 T;  3X1T C;  4KUD D;  1KX5 D;  2HUE B;  4KHA A;  1TAF B;  4M6B A;  5B2I B;  5DNN C;  3TU4 B;  1P3K B;  1P3P A;  3AYW B;  4QLC C;  5JRG B;  2NQB D;  1KX3 C;  5B1M B;  3AZG A;  3X1U D;  3AZJ D;  5B40 B;  3VH5 T;  4XZQ D;  5AV5 B;  1P3B B;  3NQJ A;  5B31 C;  1P3F D;  5AVC C;  3REK C;  3WKJ D;  5AV9 B;  4Z5T B;  4CAY A;  2HUE C;  3W97 A;  5GXQ B;  4J8V A;  3V9R B;  5B2I C;  4LD9 D;  3TU4 C;  1P3K C;  2FJ7 D;  3AYW C;  2F8N G;  3X1T D;  5JA4 A;  4WNN A;  5JRG C;  2JSS A;  3MGQ A;  5B1M C;  1P3G B;  5DNN D;  5FUG A;  5B40 C;  4QLC D;  2NQB A;  3B6F B;  5AV5 C;  1P3B C;  1KX3 D;  5BO0 B;  1JFI A;  3X1U A;  3AZJ A;  1B6W A;  4XZQ A;  5AV8 A;  2BYM B;  5AV9 C;  3UTB B;  2L5A A;  1P3F A;  4Z5T C;  5B31 D;  4E45 A;  3WKJ A;  5AVC D;  3REK D;  5GXQ C;  4WU9 B;  3LZ1 B;  5CPI B;  3REL A;  5B2I D;  1P3G C;  2F8N H;  3TU4 D;  1P3K D;  3AYW D;  3B6F C;  5JRG D;  1H3O B;  4H9N A;  4ZBJ B;  5DNN A;  5B1M D;  4QLC A;  5B32 G;  5B40 D;  3UTB C;  1KX3 A;  5AV5 D;  1P3B D;  5AV9 D;  5E5A B;  3AZH A;  4WU9 C;  5B31 A;  1M19 B;  4Z5T D;  5BNV B;  5AVC A;  3LZ1 C;  3REK A;  3LEL B;  5GXQ D;  5CPI C;  4WZS B;  3MVD B;  3NQJ B;  3B0B A;  1TZY A;  1TAF A;  4ZBJ C;  3TU4 A;  1P3G D;  5AV6 B;  3AYW A;  5GSU A;  3W98 B;  3B6F D;  4CAY B;  5B1M A;  3W96 A;  3UTA B;  4J8V B;  5AV5 A;  3UTB D;  5E5A C;  3MGQ B;  3AZL D;  1M19 C;  5FUG B;  5BS7 C;  3LEL C;  1F66 B;  5B24 B;  5BNX A;  3MVD C;  4NE6 A;  4Z5T A;  1JFI B;  3LZ1 D;  3V9R A;  5CPI D;  3W98 C;  5AV8 B;  5AV6 C;  3UTA C;  3REH A;  4J8V C;  3B6F A;  3AV2 B;  4YS3 B;  4DRB A;  3MGQ C;  3C1C B;  3REL B;  4E44 A;  2BYM A;  3UTB A;  1F66 C;  5B24 C;  3AZL A;  5E5A D;  4H9N B;  1M19 D;  3AN2 B;  3LEL D;  5AV8 C;  5B0Y B;  3MVD D;  3LZ1 A;  5B0Z B;  4XUJ B;  5CPI A;  1WWI A;  3MGP B;  2NZD A;  3W98 D;  5AV6 D;  3W99 B;  5DNM B;  3AZH B;  3AV2 C;  4J8X B;  2LY8 A;  1H3O A;  4YS3 C;  3UTA D;  3C1C C;  2YFV B;  4J8V D;  3REL C;  1TZY B;  3MGQ D;  5AVB B;  3AN2 C;  5GSU B;  4R8P B;  1F66 D;  5B24 D;  5E5A A;  5B0Y C;  4JJN B;  1M19 A;  3W96 B;  5BNV A;  5BS7 A;  2ARO B;  3LEL A;  5B0Z C;  4XUJ C;  4G91 B;  3MVD A;  3MGP C;  5AV8 D;  3W99 C;  5DNM C;  3AZH C;  3B6G B; 
#chains in the Genus database with same CATH topology
 4J8X C;  3W98 A;  5AV6 A;  5BNX B;  3KXB B;  3AV2 D;  4YS3 D;  1TZY C;  3UTA A;  5GT0 A;  2F2A C;  3C1C D;  3REL D;  2BYK B;  5AVB C;  5GSU C;  4R8P C;  3O62 B;  3AFA B;  4JJN C;  3AZF B;  3WAA B;  3W96 C;  3B0C T;  3REH B;  2DF4 C;  3AN2 D;  2ARO C;  2CV5 B;  1P3I B;  1F66 A;  5B24 A;  4G91 C;  3AZI B;  5B0Y D;  3B6G C;  5B0Z D;  4XUJ D;  3UT9 A;  2Y2G A;  1M18 B;  3MGP D;  4H9O A;  3AZL B;  3W99 D;  5DNM D;  3AZH D;  3KXB C;  4J8X D;  3IP4 C;  2JCH A;  4HGA B;  1F1E A;  3AV2 A;  4YS3 A;  3O62 C;  3AFA C;  1TZY D;  3C1C A;  3AZK A;  3WAA C;  3AZF C;  3NQU A;  3REH C;  2NZD B;  5AVB D;  5GSU D;  4R8P D;  2CV5 C;  1P3I C;  3AZI C;  1Q9C A;  3X1V B;  4JJN D;  5KDM B;  1U35 B;  4ZUX B;  3AN2 A;  3W96 D;  2ARO D;  5B0Y A;  4AWL B;  1M18 C;  3AZL C;  4H9Q B;  3B6G D;  3P5J B;  5B0Z A;  4XUJ A;  3A1K A;  3MGP A;  3W99 A;  4HGA C;  5DNM A;  3KXB D;  4J8X A;  2YFV A;  2NZD C;  3R45 A;  3O62 D;  1HQ3 B;  3AFA D;  3X1V C;  1AOI B;  1U35 C;  5F99 A;  3AZF D;  4ZUX C;  5AVB A;  3WAA D;  3REH D;  4R8P A;  2CV5 D;  1P3I D;  4AWL C;  3AZI D;  4JJN A;  1N1J B;  5GT0 B;  2ARO A;  2PYO B;  1M18 D;  5CP6 A;  5GT3 B;  3B6G A;  3WA9 A;  3KWQ B;  5B33 B;  3KXB A;  1BFM A;  3MGR B;  3KSY A;  2RVQ C;  4DQY B;  1HQ3 C;  2RIQ A;  1AOI C;  3MGS B;  3UT9 B;  2BYK A;  2NZD D;  4H9O B;  2XD5 A;  3VH6 W;  3O62 A;  2BG1 A;  3AFA A;  4Z66 B;  3AZF A;  3X1V D;  3WAA A;  1U35 D;  5GT0 C;  4ZUX D;  4H9S C;  2Y2N A;  2CV5 A;  3AZN B;  1P3I A;  1P3M B;  2PYO C;  3AZI A;  2DQN C;  4H9R B;  5GT3 C;  5CPJ B;  3AZK B;  2J8P A;  4NE3 A;  3NQU B;  3KWQ C;  1M18 A;  3VH5 W;  5B33 C;  3MGR C;  3AZM A;  3MGS C;  3UT9 C;  4WU8 B;  3X1S B;  1W2E A;  1Z2C B;  4H9P B;  2RVQ D;  1HQ3 D;  4Z66 C;  1AOI D;  2HIO B;  5CPK B;  3AZN C;  1P3M C;  2F8N K;  1BH9 B;  3REI B;  3X1V A;  5B31 G;  1U35 A;  5KDM A;  4Z2M H;  4ZUX A;  5CPJ C;  5GT0 D;  3AZK C;  2ZM5 A;  4G92 B;  3R45 B;  1P3O B;  2PYO D;  5B2J B;  4H9Q A;  3VH6 A;  5GT3 D;  5F99 B;  3KWQ D;  5BT1 C;  4WU8 C;  5B33 D;  4YM6 B;  3X1S C;  1P34 B;  3MGR D;  3WTP B;  5AY8 B;  1A7W A;  3MGS D;  4UUZ B;  2HIO C;  3UT9 D;  5CP6 B;  5CPK C;  3REI C;  1HQ3 A;  3VH5 A;  4X23 A;  3WA9 B;  1AOI A;  4Z66 D;  5B32 A;  1P3A B;  3C1B B;  4G92 C;  3AZN D;  1P3M D;  2Y2L A;  1P3O C;  1N1J A;  5B2J C;  4H9S A;  5CPJ D;  3AZK D;  5F99 C;  1ID3 B;  2PYO A;  3LZ0 B;  1KU5 A;  5GT3 A;  2ZY2 A;  4YM6 C;  1P34 C;  3KUY B;  3WTP C;  1P3L B;  5AY8 C;  3KWQ A;  2YFW B;  1B67 A;  2ZY5 A;  3AV1 A;  1ZLA B;  4J8U A;  3A6N B;  5BT1 D;  1BH8 B;  5B33 A;  4WU8 D;  3MGR A;  5CP6 C;  3X1S D;  3MNN B;  3WA9 C;  3MGS A;  3AZE B;  2HIO D;  2G5H C;  1P3A C;  3C1B C;  5CPK D;  3EPH A;  3REI D;  4Z66 A;  4WV4 B;  3AZM B;  3EPJ A;  3AZN A;  1P3M A;  2F8N B;  1ID3 C;  3LZ0 C;  1P3O D;  4KUD A;  1KX5 A;  4H9R A;  5CPJ A;  5B2J D;  2Y2P A;  3KUY C;  3EPK A;  5F99 D;  1P3L C;  1KX4 B;  1ZLA C;  3B0D B;  2VQR A;  3AL0 C;  3A6N C;  4YM6 D;  1P34 D;  4UPK A;  4J8W B;  3KFU G;  3WTP D;  3MNN C;  5AY8 D;  3AZE C;  4WU8 A;  3X1S A;  4H9P A;  5CP6 D;  1M1A B;  3WA9 D;  3AZM C;  2HIO A;  4DRA A;  5CPK A;  4KGC B;  1P3A D;  1BH9 A;  3C1B D;  3REI A;  1EQZ B;  4CSR B;  2IO5 B;  4LD9 A;  4NE5 A;  5C3I B;  3REJ B;  1KX4 C;  1P3O A;  3X1T A;  3B0D C;  3LZ0 D;  2Y2O A;  1ID3 D;  2FJ7 A;  4X23 B;  5B2J A;  5CHL B;  5B1L B;  1HTA A;  4J8W C;  3KUY D;  1P3L D;  5B32 B;  1S32 B;  3LJA B;  2Y2K A;  1ZLA D;  5G49 B;  3A6N D;  4YM6 A;  1P34 A;  3WTP A;  5AY8 A;  4KHA B;  3MNN D;  1M1A C;  4UUZ A;  1P3P B;  3AZE D;  4KGC C;  1EQZ C;  3AZM D;  3AV1 B;  3AZG B;  4J8U B;  2IO5 C;  1P3A A;  3C1B A;  1WWS A;  5C3I C;  3REJ C;  2F8N D;  1ULY A;  4X23 C;  5B1L C;  4EO5 B;  5B2I A;  2G5I C;  5B32 C;  1S32 C;  3LZ0 A;  3LJA C;  1P3K A;  1KX4 D;  1ID3 A;  5JRG A;  2CWE A;  3KUY A;  1P3L A;  4J8W D;  4Z2M G;  2YFW A;  1ZLA A;  3W97 B;  3A6N A;  1BH8 A;  5B40 A;  1P3P C;  4KUD B;  1KX5 B;  5JA4 B;  4WNN B;  1P3B A;  2Y2I A;  3H0M C;  3MNN A;  1M1A D;  1R4V A;  3AZE A;  3AV1 C;  3AZG C;  4J8U C;  5AV9 A;  2Y2Q A;  2NQB B;  4KGC D;  4WU9 D;  1EQZ D;  3X1U B;  3AZJ B;  5GXQ A;  4EO5 C;  2F8N A;  4XZQ B;  3REJ D;  3EG5 B;  1P3F B;  4X23 D;  5B1L D;  3WKJ B;  1KX4 A;  1P3G A;  3W97 C;  5B32 D;  1S32 D;  3LJA D;  3H0L C;  4KUD C;  1KX5 C;  4J8W A;  5BO0 A;  4NFT A;  3B0C W;  4LD9 B;  2FJ7 B;  3X1T B;  1P3P D;  2NQB C;  1M1A A;  5DNN B;  3X1U C;  3AZJ C;  3AV1 D;  3AZG D;  4QLC B;  4J8U D;  4KGC A;  4XZQ C;  4WU9 A;  1KX3 B;  1EQZ A;  1P3F C;  4CSR A;  3FDD A;  3WKJ C;  3REJ A;  5B31 B;  5B1L A;  5AVC B;  3REK B;  3WTP E;  3LJA A;  1S32 A;  3W97 D;  4LD9 C;  5G49 A;  2FJ7 C;  3VH6 T;  3X1T C;  4KUD D;  1KX5 D;  2HUE B;  4KHA A;  1TAF B;  4M6B A;  5B2I B;  5DNN C;  3TU4 B;  1P3K B;  1P3P A;  3AYW B;  4QLC C;  5JRG B;  2NQB D;  1KX3 C;  5B1M B;  3AZG A;  3X1U D;  3AZJ D;  5B40 B;  3VH5 T;  4XZQ D;  5AV5 B;  1P3B B;  3NQJ A;  5B31 C;  1P3F D;  5AVC C;  3REK C;  3WKJ D;  5AV9 B;  4Z5T B;  4CAY A;  2HUE C;  3W97 A;  5GXQ B;  4J8V A;  2JE5 A;  3V9R B;  5B2I C;  3TU4 C;  1P3K C;  2FJ7 D;  3AYW C;  2F8N G;  3H0R C;  3X1T D;  4LD9 D;  5JA4 A;  4WNN A;  5JRG C;  2JSS A;  3MGQ A;  3EPL A;  5B1M C;  1P3G B;  5DNN D;  5FUG A;  5B40 C;  4QLC D;  2NQB A;  3B6F B;  5AV5 C;  1P3B C;  1KX3 D;  5BO0 B;  1JFI A;  3X1U A;  3AZJ A;  1B6W A;  4XZQ A;  5AV8 A;  2BYM B;  5AV9 C;  3UTB B;  2L5A A;  1P3F A;  4Z5T C;  5B31 D;  4E45 A;  3WKJ A;  5AVC D;  3REK D;  5GXQ C;  4WU9 B;  3LZ1 B;  5CPI B;  3REL A;  5B2I D;  1P3G C;  2F8N H;  3TU4 D;  1P3K D;  3AYW D;  3B6F C;  2XD1 A;  5JRG D;  1H3O B;  4H9N A;  4ZBJ B;  5DNN A;  5B1M D;  4QLC A;  5B32 G;  5B40 D;  3UTB C;  1KX3 A;  5AV5 D;  1P3B D;  5AV9 D;  5E5A B;  3AZH A;  4WU9 C;  5B31 A;  1M19 B;  2ZY3 A;  4Z5T D;  5BNV B;  5AVC A;  3LZ1 C;  3REK A;  3LEL B;  5GXQ D;  5CPI C;  4WZS B;  3MVD B;  3NQJ B;  3B0B A;  1TZY A;  1TAF A;  4ZBJ C;  3TU4 A;  1P3G D;  5AV6 B;  3AYW A;  5GSU A;  3W98 B;  3B6F D;  4CAY B;  5B1M A;  3W96 A;  3UTA B;  4J8V B;  5AV5 A;  3UTB D;  5E5A C;  3MGQ B;  3AZL D;  1M19 C;  5FUG B;  2W8S A;  5BS7 C;  3LEL C;  1F66 B;  5B24 B;  3F6T A;  5BNX A;  3MVD C;  4NE6 A;  4Z5T A;  1JFI B;  3LZ1 D;  3V9R A;  5CPI D;  2Y2H A;  5AV8 B;  5AV6 C;  3W98 C;  3UTA C;  3REH A;  4J8V C;  2Y2J A;  2UWX A;  3AV2 B;  3B6F A;  2FFF B;  4YS3 B;  4DRB A;  3MGQ C;  3C1C B;  1T3U A;  3REL B;  4E44 A;  2BYM A;  3UTB A;  1F66 C;  5B24 C;  3AZL A;  5E5A D;  4H9N B;  1M19 D;  3AN2 B;  2Y2M A;  3LEL D;  5AV8 C;  5B0Y B;  3MVD D;  4WJ3 C;  3LZ1 A;  5B0Z B;  3A1I A;  4XUJ B;  5CPI A;  1WWI A;  3MGP B;  2NZD A;  3W98 D;  2ZY4 A;  5AV6 D;  3W99 B;  5DNM B;  3AZH B;  3AV2 C;  4J8X B;  2LY8 A;  1H3O A;  4YS3 C;  3UTA D;  3C1C C;  2YFV B;  4J8V D;  3REL C;  1PZR A;  1TZY B;  3MGQ D;  5AVB B;  3AN2 C;  5GSU B;  4R8P B;  1F66 D;  5B24 D;  5E5A A;  5B0Y C;  4JJN B;  1M19 A;  3W96 B;  5BNV A;  5BS7 A;  2ARO B;  3LEL A;  5B0Z C;  4XUJ C;  4G91 B;  3MVD A;  3MGP C;  5AV8 D;  3W99 C;  5DNM C;  3AZH C;  3B6G B; 
#chains in the Genus database with same CATH homology
 4J8X C;  3W98 A;  5AV6 A;  5BNX B;  3KXB B;  3AV2 D;  4YS3 D;  1TZY C;  3UTA A;  5GT0 A;  2F2A C;  3C1C D;  3REL D;  2BYK B;  5AVB C;  5GSU C;  4R8P C;  3O62 B;  3AFA B;  4JJN C;  3AZF B;  3WAA B;  3W96 C;  3B0C T;  3REH B;  2DF4 C;  3AN2 D;  2ARO C;  2CV5 B;  1P3I B;  1F66 A;  5B24 A;  4G91 C;  3AZI B;  5B0Y D;  3B6G C;  5B0Z D;  4XUJ D;  3UT9 A;  2Y2G A;  1M18 B;  3MGP D;  4H9O A;  3AZL B;  3W99 D;  5DNM D;  3AZH D;  3KXB C;  4J8X D;  3IP4 C;  2JCH A;  4HGA B;  1F1E A;  3AV2 A;  4YS3 A;  3O62 C;  3AFA C;  1TZY D;  3C1C A;  3AZK A;  3WAA C;  3AZF C;  3NQU A;  3REH C;  2NZD B;  5AVB D;  5GSU D;  4R8P D;  2CV5 C;  1P3I C;  3AZI C;  1Q9C A;  3X1V B;  4JJN D;  5KDM B;  1U35 B;  4ZUX B;  3AN2 A;  3W96 D;  2ARO D;  5B0Y A;  4AWL B;  1M18 C;  3AZL C;  4H9Q B;  3B6G D;  3P5J B;  5B0Z A;  4XUJ A;  3A1K A;  3MGP A;  3W99 A;  4HGA C;  5DNM A;  3KXB D;  4J8X A;  2YFV A;  2NZD C;  3R45 A;  3O62 D;  1HQ3 B;  3AFA D;  3X1V C;  1AOI B;  1U35 C;  5F99 A;  3AZF D;  4ZUX C;  5AVB A;  3WAA D;  3REH D;  4R8P A;  2CV5 D;  1P3I D;  4AWL C;  3AZI D;  4JJN A;  1N1J B;  5GT0 B;  2ARO A;  2PYO B;  1M18 D;  5CP6 A;  5GT3 B;  3B6G A;  3WA9 A;  3KWQ B;  5B33 B;  3KXB A;  1BFM A;  3MGR B;  3KSY A;  2RVQ C;  4DQY B;  1HQ3 C;  2RIQ A;  1AOI C;  3MGS B;  3UT9 B;  2BYK A;  2NZD D;  4H9O B;  2XD5 A;  3VH6 W;  3O62 A;  2BG1 A;  3AFA A;  4Z66 B;  3AZF A;  3X1V D;  3WAA A;  1U35 D;  5GT0 C;  4ZUX D;  4H9S C;  2Y2N A;  2CV5 A;  3AZN B;  1P3I A;  1P3M B;  2PYO C;  3AZI A;  2DQN C;  4H9R B;  5GT3 C;  5CPJ B;  3AZK B;  2J8P A;  4NE3 A;  3NQU B;  3KWQ C;  1M18 A;  3VH5 W;  5B33 C;  3MGR C;  3AZM A;  3MGS C;  3UT9 C;  4WU8 B;  3X1S B;  1W2E A;  1Z2C B;  4H9P B;  2RVQ D;  1HQ3 D;  4Z66 C;  1AOI D;  2HIO B;  5CPK B;  3AZN C;  1P3M C;  2F8N K;  1BH9 B;  3REI B;  3X1V A;  5B31 G;  1U35 A;  5KDM A;  4Z2M H;  4ZUX A;  5CPJ C;  5GT0 D;  3AZK C;  2ZM5 A;  4G92 B;  3R45 B;  1P3O B;  2PYO D;  5B2J B;  4H9Q A;  3VH6 A;  5GT3 D;  5F99 B;  3KWQ D;  5BT1 C;  4WU8 C;  5B33 D;  4YM6 B;  3X1S C;  1P34 B;  3MGR D;  3WTP B;  5AY8 B;  1A7W A;  3MGS D;  4UUZ B;  2HIO C;  3UT9 D;  5CP6 B;  5CPK C;  3REI C;  1HQ3 A;  3VH5 A;  4X23 A;  3WA9 B;  1AOI A;  4Z66 D;  5B32 A;  1P3A B;  3C1B B;  4G92 C;  3AZN D;  1P3M D;  2Y2L A;  1P3O C;  1N1J A;  5B2J C;  4H9S A;  5CPJ D;  3AZK D;  5F99 C;  1ID3 B;  2PYO A;  3LZ0 B;  1KU5 A;  5GT3 A;  2ZY2 A;  4YM6 C;  1P34 C;  3KUY B;  3WTP C;  1P3L B;  5AY8 C;  3KWQ A;  2YFW B;  1B67 A;  2ZY5 A;  3AV1 A;  1ZLA B;  4J8U A;  3A6N B;  5BT1 D;  1BH8 B;  5B33 A;  4WU8 D;  3MGR A;  5CP6 C;  3X1S D;  3MNN B;  3WA9 C;  3MGS A;  3AZE B;  2HIO D;  2G5H C;  1P3A C;  3C1B C;  5CPK D;  3EPH A;  3REI D;  4Z66 A;  4WV4 B;  3AZM B;  3EPJ A;  3AZN A;  1P3M A;  2F8N B;  1ID3 C;  3LZ0 C;  1P3O D;  4KUD A;  1KX5 A;  4H9R A;  5CPJ A;  5B2J D;  2Y2P A;  3KUY C;  3EPK A;  5F99 D;  1P3L C;  1KX4 B;  1ZLA C;  3B0D B;  2VQR A;  3AL0 C;  3A6N C;  4YM6 D;  1P34 D;  4UPK A;  4J8W B;  3KFU G;  3WTP D;  3MNN C;  5AY8 D;  3AZE C;  4WU8 A;  3X1S A;  4H9P A;  5CP6 D;  1M1A B;  3WA9 D;  3AZM C;  2HIO A;  4DRA A;  5CPK A;  4KGC B;  1P3A D;  1BH9 A;  3C1B D;  3REI A;  1EQZ B;  4CSR B;  2IO5 B;  4LD9 A;  4NE5 A;  5C3I B;  3REJ B;  1KX4 C;  1P3O A;  3X1T A;  3B0D C;  3LZ0 D;  2Y2O A;  1ID3 D;  2FJ7 A;  4X23 B;  5B2J A;  5CHL B;  5B1L B;  1HTA A;  4J8W C;  3KUY D;  1P3L D;  5B32 B;  1S32 B;  3LJA B;  2Y2K A;  1ZLA D;  5G49 B;  3A6N D;  4YM6 A;  1P34 A;  3WTP A;  5AY8 A;  4KHA B;  3MNN D;  1M1A C;  4UUZ A;  1P3P B;  3AZE D;  4KGC C;  1EQZ C;  3AZM D;  3AV1 B;  3AZG B;  4J8U B;  2IO5 C;  1P3A A;  3C1B A;  1WWS A;  5C3I C;  3REJ C;  2F8N D;  1ULY A;  4X23 C;  5B1L C;  4EO5 B;  5B2I A;  2G5I C;  5B32 C;  1S32 C;  3LZ0 A;  3LJA C;  1P3K A;  1KX4 D;  1ID3 A;  5JRG A;  2CWE A;  3KUY A;  1P3L A;  4J8W D;  4Z2M G;  2YFW A;  1ZLA A;  3W97 B;  3A6N A;  1BH8 A;  5B40 A;  1P3P C;  4KUD B;  1KX5 B;  5JA4 B;  4WNN B;  1P3B A;  2Y2I A;  3H0M C;  3MNN A;  1M1A D;  1R4V A;  3AZE A;  3AV1 C;  3AZG C;  4J8U C;  5AV9 A;  2Y2Q A;  2NQB B;  4KGC D;  4WU9 D;  1EQZ D;  3X1U B;  3AZJ B;  5GXQ A;  4EO5 C;  2F8N A;  4XZQ B;  3REJ D;  3EG5 B;  1P3F B;  4X23 D;  5B1L D;  3WKJ B;  1KX4 A;  1P3G A;  3W97 C;  5B32 D;  1S32 D;  3LJA D;  3H0L C;  4KUD C;  1KX5 C;  4J8W A;  5BO0 A;  4NFT A;  3B0C W;  4LD9 B;  2FJ7 B;  3X1T B;  1P3P D;  2NQB C;  1M1A A;  5DNN B;  3X1U C;  3AZJ C;  3AV1 D;  3AZG D;  4QLC B;  4J8U D;  4KGC A;  4XZQ C;  4WU9 A;  1KX3 B;  1EQZ A;  1P3F C;  4CSR A;  3FDD A;  3WKJ C;  3REJ A;  5B31 B;  5B1L A;  5AVC B;  3REK B;  3WTP E;  3LJA A;  1S32 A;  3W97 D;  4LD9 C;  5G49 A;  2FJ7 C;  3VH6 T;  3X1T C;  4KUD D;  1KX5 D;  2HUE B;  4KHA A;  1TAF B;  4M6B A;  5B2I B;  5DNN C;  3TU4 B;  1P3K B;  1P3P A;  3AYW B;  4QLC C;  5JRG B;  2NQB D;  1KX3 C;  5B1M B;  3AZG A;  3X1U D;  3AZJ D;  5B40 B;  3VH5 T;  4XZQ D;  5AV5 B;  1P3B B;  3NQJ A;  5B31 C;  1P3F D;  5AVC C;  3REK C;  3WKJ D;  5AV9 B;  4Z5T B;  4CAY A;  2HUE C;  3W97 A;  5GXQ B;  4J8V A;  2JE5 A;  3V9R B;  5B2I C;  3TU4 C;  1P3K C;  2FJ7 D;  3AYW C;  2F8N G;  3H0R C;  3X1T D;  4LD9 D;  5JA4 A;  4WNN A;  5JRG C;  2JSS A;  3MGQ A;  3EPL A;  5B1M C;  1P3G B;  5DNN D;  5FUG A;  5B40 C;  4QLC D;  2NQB A;  3B6F B;  5AV5 C;  1P3B C;  1KX3 D;  5BO0 B;  1JFI A;  3X1U A;  3AZJ A;  1B6W A;  4XZQ A;  5AV8 A;  2BYM B;  5AV9 C;  3UTB B;  2L5A A;  1P3F A;  4Z5T C;  5B31 D;  4E45 A;  3WKJ A;  5AVC D;  3REK D;  5GXQ C;  4WU9 B;  3LZ1 B;  5CPI B;  3REL A;  5B2I D;  1P3G C;  2F8N H;  3TU4 D;  1P3K D;  3AYW D;  3B6F C;  2XD1 A;  5JRG D;  1H3O B;  4H9N A;  4ZBJ B;  5DNN A;  5B1M D;  4QLC A;  5B32 G;  5B40 D;  3UTB C;  1KX3 A;  5AV5 D;  1P3B D;  5AV9 D;  5E5A B;  3AZH A;  4WU9 C;  5B31 A;  1M19 B;  2ZY3 A;  4Z5T D;  5BNV B;  5AVC A;  3LZ1 C;  3REK A;  3LEL B;  5GXQ D;  5CPI C;  4WZS B;  3MVD B;  3NQJ B;  3B0B A;  1TZY A;  1TAF A;  4ZBJ C;  3TU4 A;  1P3G D;  5AV6 B;  3AYW A;  5GSU A;  3W98 B;  3B6F D;  4CAY B;  5B1M A;  3W96 A;  3UTA B;  4J8V B;  5AV5 A;  3UTB D;  5E5A C;  3MGQ B;  3AZL D;  1M19 C;  5FUG B;  2W8S A;  5BS7 C;  3LEL C;  1F66 B;  5B24 B;  3F6T A;  5BNX A;  3MVD C;  4NE6 A;  4Z5T A;  1JFI B;  3LZ1 D;  3V9R A;  5CPI D;  2Y2H A;  5AV8 B;  5AV6 C;  3W98 C;  3UTA C;  3REH A;  4J8V C;  2Y2J A;  2UWX A;  3AV2 B;  3B6F A;  2FFF B;  4YS3 B;  4DRB A;  3MGQ C;  3C1C B;  1T3U A;  3REL B;  4E44 A;  2BYM A;  3UTB A;  1F66 C;  5B24 C;  3AZL A;  5E5A D;  4H9N B;  1M19 D;  3AN2 B;  2Y2M A;  3LEL D;  5AV8 C;  5B0Y B;  3MVD D;  4WJ3 C;  3LZ1 A;  5B0Z B;  3A1I A;  4XUJ B;  5CPI A;  1WWI A;  3MGP B;  2NZD A;  3W98 D;  2ZY4 A;  5AV6 D;  3W99 B;  5DNM B;  3AZH B;  3AV2 C;  4J8X B;  2LY8 A;  1H3O A;  4YS3 C;  3UTA D;  3C1C C;  2YFV B;  4J8V D;  3REL C;  1PZR A;  1TZY B;  3MGQ D;  5AVB B;  3AN2 C;  5GSU B;  4R8P B;  1F66 D;  5B24 D;  5E5A A;  5B0Y C;  4JJN B;  1M19 A;  3W96 B;  5BNV A;  5BS7 A;  2ARO B;  3LEL A;  5B0Z C;  4XUJ C;  4G91 B;  3MVD A;  3MGP C;  5AV8 D;  3W99 C;  5DNM C;  3AZH C;  3B6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...