3C1BC

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1bC00
5GT3A 5CPKC 4WU8D 4XZQB 2F8NH 2NZDC 3TU4C 3AZKC 3NQJA 3AZIC 4R8PC 3REKB 3W96C 3MGSA 5AY8B 3AZJA 1M1AB 5CPJB 1P3KB 4Z2MH 3LJAA 4J8XC 1S32C 3X1TD 1P3BB 5AV6A 5DNMA 5JRGD 1P3AA 3VH5W 5AVBA 3KWQB 1P3OD 3W98D 1BH9A 4JJNB 3B6GD 4QLCB 4X23D 3X1UB 4ZUXB 1U35C 3KUYC 1JFIA 2AROD 3VH5T 2CV5D 3X1SA 3W99C 3RELD 4KHAA 1P34A 5GT0D 3KXBB 4Z66B 5GXQB 5AV5D 3AFAB 2CWEA 3W97B 1H3OA 5CPIB 5BNVB 3C1BA 1M18A 1P3AC 5B33D 3REIC 3WTPC 1P3GB 5E5AC 5JA4A 3UTBA 3A6ND 3AN2B 4UUZA 3UT9C 5B1MD 3TU4B 4AWLB 5B32A 5AV9D 3AZKB 1P3IC 1P3MB 1F66D 2PYOA 1ULYA 3X1SC 1B67A 4WU9D 4H9OA 3W96B 3AZNC 3LZ1D 1KX4D 5B0ZC 2BYMB 4J8XB 4XUJD 3AV2A 5B0YD 1P3FA 1M18C 1KX3D 4LD9A 1N1JB 4NFTA 5F99A 3LELD 5FUGA 5BO0A 2HIOD 5GT3B 5BS7A 5B31G 3O62C 4KUDC 3WAAD 1ID3D 3NQJB 4NE3A 4Z5TA 5DNNA 1P3LD 3MGSB 3AZJB 3X1VA 3LJAB 4J8VA 3AV2C 3WKJD 3VH6W 4WNNA 1P3PA 5AV6B 5B40C 3AYWA 3REKA 3REIB 1P3AB 5BS7C 5AVBB 3AV1A 3MGQD 5E5AB 5CPJA 1BH9B 1ZLAA 3VH6T 3AZEA 3UT9B 4NE5A 5B2JD 1JFIB 4Z5TC 1AOID 5DNNC 2F8NK 5AV8D 1HQ3C 3X1SB 3AZMA 3NQUA 5GSUD 4KHAB 3X1VC 1P34B 4J8VC 1EQZC 5B2ID 5AVCA 1M19D 1H3OB 1M18B 5CHLB 3AZHD 2F8NA 4M6BA 3MGRD 3AZFA 5JA4B 3UTBB 1ZLAC 3AZEC 4UUZB 4XZQD 3AZLC 3B0CW 5B32B 5B24A 4G92B 4H9OB 2RVQD 5AY8D 5CP6D 3MVDD 1M1AD 1P3KD 5AVCC 3LZ0D 5CPKA 3MGPD 3B0CT 3AV2B 1P3FB 4LD9B 4H9PA 1P3BD 2NZDA 5FUGB 3AZIA 4R8PA 5BO0B 2FJ7C 5BT1C 3KWQD 3B6FD 4JJND 4QLCD 1KX5C 4ZUXD 5B24C 4WZSB 4Z5TB 1S32A 5DNNB 1HQ3B 3X1VB 4J8VB 5GXQD 5B31C 3W97D 4EO5C 4WNNB 3REHD 1P3PB 3KSYA 4DRBA 3B0DB 1U35A 3KUYA 3AYWB 3REJD 3X1TA 1P3GD 3AV1B 2NQBD 3W99A 3UTAD 4J8UD 1ZLAB 3AN2D 3AZEB 2IO5C 1P3OA 3W98A 4WU8C 1P3MD 3C1CD 3B6GA 4YS3D 3WA9D 3AZMB 4X23A 4YM6D 3NQUB 4J8WD 3REIA 3WTPA 2AROA 5AVCB 5E5AA 3UT9A 3X1TC 2F8NB 1P3IA 3AZFB 5GT3D 5JRGC 5KDMA 5B33A 1F1EA 3AZNA 1P3OC 3W98C 5B0ZA 3B6GC 5B24B 4X23C 3MGSD 3AZJD 2AROC 3LJAD 2CV5C 5CPKB 4E44A 3RELC 3O62A 4KUDA 3VH6A 4HGAC 5GT0C 4H9PB 2NZDB 5AV6D 5AV5C 5DNMD 3AZIB 4R8PB 5B0YA 4KGCA 1P3AD 4E45A 5AVBD 5C3IC 5B33C 3LELA 4H9SA 1S32B 5B1MC 5B40A 5AV9C 1F66C 1WWIA 1P34D 4WU9C 1P3LA 3LZ1C 2HUEC 1KX4C 3C1BD 1M18D 4XUJC 4KGCC 5B0YC 1U35B 1KX3C 3KUYB 3X1TB 1HQ3A 3V9RA 3LELC 3UTBD 3W99B 4H9SC 2HIOC 1EQZA 1R4VA 1P3OB 1KU5A 1B6WA 3W98B 1ID3C 5B32D 3B6GB 2PYOD 4X23B 1WWSA 1HTAA 3WTPB 2AROB 1P3LC 5AV8A 5GSUA 4LD9D 4HGAB 1P3FD 3AZLA 3WKJC 5F99D 4G91C 4ZBJC 5AV5B 3MNND 1P3IB 5C3IB 5KDMB 3AZHA 5B33B 3AZNB 3MGRA 3MGQC 5G49B 5B0ZB 1TAFA 1TZYD 5B2JC 5B1LA 5AV9B 3AZGD 5AV8C 2FJ7A 5GSUC 3O62B 4KUDB 5CP6A 3MVDA 2JSSA 5B2IC 1P3PD 1M19C 1KX5A 3MGPA 4KGCB 5B0YB 3AYWD 3REKD 3AV1D 3AZHC 3LELB 5CPJD 3MGRC 4NE6A 4H9RB 3AZED 3B6FA 3R45A 5B31A 4XZQC 5B1LC 5B40B 4CSRA 3AZMD 3VH5A 2RVQC 1P3LB 5CP6C 3MVDC 2BYKA 1P3KC 1M1AC 3LZ0C 3MGPC 3X1UD 3WKJB 4WU8A 2F8ND 3REHA 3V9RB 3AZFD 5BT1D 3KXBD 1EQZB 4Z66D 3KWQC 3B6FC 3AFAD 2NQBA 4JJNC 3UTAA 4J8UA 5CPID 4QLCC 4ZUXC 3C1CA 5AV8B 3WA9A 5CPKD 4YM6A 4J8WA 5JRGA 5GSUB 5B32G 5GXQC 3AZLB 2NZDD 3TU4D 3W97C 3AZKD 3REHC 3AZID 4R8PD 3W96D 3AZHB 3REJC 1P3GC 3MGRB 2CV5A 2NQBC 1TAFB 3RELA 4J8XD 4DRAA 3UTAC 4J8UC 5GT0A 3AN2C 1S32D 2LY8A 5B1LB 5AV5A 4AWLC 1P3MC 3C1CC 4YS3C 2FJ7B 3WA9C 4YM6C 4J8WC 5CP6B 3MVDB 5G49A 3LZ0B 3A6NA 1KX5B 3MGPB 1U35D 3KUYD 5B1MA 5AV9A 1F66A 3W99D 5BNXA 4WU9A 5GT3C 2YFWA 3B6FB 3R45B 5B31B 3LZ1A 4EO5B 1KX4A 4CSRB 4XUJA 1KX3A 3REID 3WTPD 5E5AD 3MGSC 3AZJC 2BYKB 1BH8A 4H9RA 2HIOA 3LJAC 3A6NC 3UT9D 2IO5B 4WU8B 3WAAA 1ID3A 1P3ID 3REHB 5AV6C 5DNMC 4H9QB 3X1SD 2YFVA 3REJB 3AZND 5AVBC 5B0ZD 2NQBB 3B0BA 3UTAB 4J8UB 2F8NG 3WKJA 3C1CB 4YS3B 3WA9B 4CAYA 4YM6B 4J8WB 5JRGB 3O62D 1P34C 4KUDD 4Z2MG 3MGQA 3WAAC 4KGCD 3C1BC 5B2JA 3MNNA 1AOIA 3UTBC 2CV5B 3RELB 3AV2D 5GT0B 5B2IA 5B40D 1M19A 5B32C 2PYOC 1TZYA 4G92C 4H9NA 3AZGA 3A6NB 4LD9C 1P3FC 4Z5TD 4XZQA 5DNND 5F99C 5B1MB 3MNNC 1AOIC 1HQ3D 5DNMB 3AZGB 1F66B 3X1VD 5BNXB 4WV4B 4J8VD 4WU9B 2YFWB 1EQZD 5AY8A 1M1AA 1P3KA 3LZ1B 2HUEB 1KX4B 3LZ0A 4XUJB 1TZYC 3WTPE 1P3BA 1Q9CA 1KX3B 3AZGC 1BH8B 2HIOB 1ZLAD 3KWQA 3AZLD 3WAAB 1ID3B 1P3PC 4JJNA 4QLCA 3C1BB 2YFVB 3B0DC 3X1UA 4ZUXA 2L5AA 3REKC 3AYWC 3AV1C 5AVCD 5AY8C 5CPJC 3KXBA 4Z66A 5GXQA 5B1LD 3AFAA 4G91B 4ZBJB 3W97A 1P3BC 5CPIA 5BNVA 2PYOB 4H9QA 2FJ7D 1A7WA 4CAYB 3AZMC 3REJA 1P3GA 3MGQB 1KX5D 3AN2A 5B24D 5B2JB 3X1UC 5F99B 3MNNB 3TU4A 3AZKA 1P3MA 1AOIB 4YS3A 3AZFC 3W96A 3KXBC 5B31D 4Z66C 5B2IB 3AFAC 1M19B 2BYMA 4J8XA 5CPIC 1TZYB 1N1JA 1BFMA 4H9NB
chains in the Genus database with same CATH superfamily
5GT3A 5CPKC 4WU8D 4XZQB 2F8NH 2NZDC 3TU4C 3AZKC 3NQJA 3AZIC 4R8PC 3REKB 3W96C 3MGSA 5AY8B 3AZJA 1M1AB 5CPJB 1P3KB 4Z2MH 3LJAA 4J8XC 1S32C 2Y2IA 3X1TD 1P3BB 5AV6A 5DNMA 5JRGD 1P3AA 3VH5W 5AVBA 3KWQB 1P3OD 3W98D 1BH9A 4JJNB 2XD1A 3B6GD 4QLCB 4X23D 3X1UB 4ZUXB 1U35C 3KUYC 1JFIA 2AROD 2JE5A 3VH5T 2CV5D 3X1SA 3W99C 3RELD 4KHAA 1P34A 5GT0D 3KXBB 4Z66B 5GXQB 5AV5D 3AFAB 2CWEA 3W97B 1H3OA 5CPIB 5BNVB 3C1BA 1M18A 1P3AC 5B33D 3REIC 3WTPC 1P3GB 5E5AC 5JA4A 3UTBA 3A6ND 3AN2B 4UUZA 3UT9C 5B1MD 3TU4B 4AWLB 5B32A 5AV9D 3AZKB 1P3IC 1P3MB 1F66D 2PYOA 1ULYA 3X1SC 1B67A 4WU9D 4H9OA 3W96B 3AZNC 3LZ1D 1KX4D 5B0ZC 2BYMB 4J8XB 4XUJD 3AV2A 5B0YD 1P3FA 1M18C 1KX3D 4LD9A 1N1JB 4NFTA 5F99A 3LELD 5FUGA 5BO0A 2HIOD 1W2EA 5GT3B 5BS7A 5B31G 3O62C 4KUDC 3WAAD 1ID3D 3NQJB 4NE3A 4Z5TA 5DNNA 2G5HC 1P3LD 3MGSB 3AZJB 3X1VA 3LJAB 4J8VA 3AV2C 3WKJD 3VH6W 4WNNA 1P3PA 5AV6B 5B40C 3H0RC 3AYWA 3REKA 3REIB 1P3AB 5BS7C 5AVBB 3AV1A 3MGQD 5E5AB 5CPJA 1BH9B 1ZLAA 3VH6T 3AZEA 3UT9B 4NE5A 5B2JD 2Y2KA 4Z5TC 1JFIB 1AOID 5DNNC 2F8NK 5AV8D 1HQ3C 3X1SB 3AZMA 3NQUA 5GSUD 4KHAB 3X1VC 2Y2HA 4J8VC 1P34B 1EQZC 5B2ID 5AVCA 1M19D 1H3OB 1M18B 5CHLB 2G5IC 3AZHD 2F8NA 4M6BA 3MGRD 3AZFA 5JA4B 3UTBB 1ZLAC 3AZEC 4UUZB 4XZQD 3AZLC 3B0CW 5B32B 5B24A 4G92B 4H9OB 2RVQD 5AY8D 5CP6D 3MVDD 1M1AD 1P3KD 5AVCC 3LZ0D 5CPKA 3MGPD 3B0CT 3AV2B 1P3FB 4LD9B 4H9PA 1P3BD 2NZDA 3AL0C 5FUGB 3AZIA 4R8PA 5BO0B 2FJ7C 5BT1C 3KWQD 3B6FD 4JJND 4QLCD 1KX5C 4ZUXD 5B24C 4WZSB 4Z5TB 1S32A 5DNNB 1HQ3B 2DQNC 3X1VB 4J8VB 5GXQD 5B31C 3W97D 4EO5C 4WNNB 3REHD 1P3PB 3KSYA 4DRBA 3EG5B 3B0DB 1U35A 3KUYA 3AYWB 3REJD 3X1TA 1P3GD 3AV1B 2JCHA 2NQBD 3W99A 3UTAD 4J8UD 1ZLAB 3AN2D 3AZEB 2IO5C 1P3OA 3W98A 4WU8C 1P3MD 3C1CD 3B6GA 4YS3D 3WA9D 3AZMB 4X23A 4YM6D 3NQUB 4J8WD 3REIA 3WTPA 2AROA 5AVCB 5E5AA 2Y2LA 3UT9A 3X1TC 2F8NB 1P3IA 2Y2GA 3AZFB 2Y2PA 5GT3D 5JRGC 5KDMA 5B33A 1F1EA 3AZNA 1P3OC 3W98C 5B0ZA 3B6GC 5B24B 4X23C 3EPLA 3MGSD 3AZJD 2AROC 3LJAD 2CV5C 5CPKB 4E44A 3RELC 3O62A 4KUDA 3VH6A 4HGAC 5GT0C 4H9PB 2NZDB 5AV6D 5AV5C 5DNMD 3AZIB 4R8PB 5B0YA 2FFFB 4KGCA 1P3AD 4E45A 5AVBD 5C3IC 5B33C 3LELA 2XD5A 2DF4C 4H9SA 1S32B 5B1MC 5B40A 5AV9C 1F66C 1WWIA 1P34D 4WU9C 1P3LA 3LZ1C 2HUEC 1KX4C 3C1BD 1M18D 4XUJC 4KGCC 5B0YC 1U35B 1KX3C 3KUYB 3X1TB 1HQ3A 3V9RA 3LELC 2ZM5A 3UTBD 3W99B 4H9SC 2HIOC 1EQZA 1R4VA 1P3OB 1KU5A 1B6WA 3W98B 1ID3C 5B32D 3H0MC 2PYOD 3B6GB 4X23B 1WWSA 1HTAA 2Y2MA 3WTPB 2AROB 1P3LC 5AV8A 2ZY4A 5GSUA 4LD9D 4HGAB 1P3FD 3AZLA 3WKJC 5F99D 4G91C 4ZBJC 5AV5B 3MNND 1P3IB 5C3IB 5KDMB 3AZHA 5B33B 3AZNB 3MGRA 3MGQC 5G49B 5B0ZB 1TAFA 2Y2OA 1TZYD 3EPKA 5B2JC 5B1LA 5AV9B 3AZGD 5AV8C 2FJ7A 4UPKA 5GSUC 3O62B 4KUDB 5CP6A 3MVDA 2JSSA 5B2IC 1P3PD 1M19C 2Y2JA 1KX5A 3MGPA 4KGCB 5B0YB 3AYWD 3REKD 3AV1D 3AZHC 3LELB 5CPJD 3MGRC 4NE6A 4H9RB 3AZED 3B6FA 3R45A 5B31A 4XZQC 5B1LC 5B40B 4CSRA 3AZMD 3VH5A 2RVQC 3EPHA 1P3LB 5CP6C 3MVDC 2BYKA 1P3KC 1M1AC 3LZ0C 3MGPC 3X1UD 3WKJB 4WU8A 2F8ND 3REHA 3FDDA 3H0LC 3V9RB 3AZFD 5BT1D 3KXBD 1EQZB 4Z66D 3KWQC 3B6FC 4DQYB 3AFAD 2NQBA 3A1IA 4JJNC 3UTAA 4J8UA 5CPID 4QLCC 4ZUXC 3C1CA 1Z2CB 5AV8B 3WA9A 5CPKD 4YM6A 4J8WA 2W8SA 5GSUB 5JRGA 3A1KA 5GXQC 5B32G 3AZLB 2NZDD 3TU4D 3W97C 3AZKD 3REHC 3AZID 4R8PD 2BG1A 3W96D 3AZHB 3REJC 1P3GC 3MGRB 2CV5A 2NQBC 1TAFB 3RELA 4J8XD 4DRAA 3UTAC 4J8UC 5GT0A 3AN2C 1S32D 2LY8A 2Y2QA 5B1LB 5AV5A 4AWLC 1P3MC 3C1CC 1PZRA 4YS3C 2FJ7B 3WA9C 4YM6C 4J8WC 5CP6B 3MVDB 5G49A 3LZ0B 3A6NA 1KX5B 3MGPB 1U35D 3KUYD 5B1MA 5AV9A 1F66A 3KFUG 3W99D 5BNXA 4WU9A 5GT3C 2YFWA 3B6FB 3R45B 5B31B 3LZ1A 4EO5B 3EPJA 1KX4A 3IP4C 4CSRB 4XUJA 1KX3A 3REID 3WTPD 2RIQA 5E5AD 3MGSC 3AZJC 4WJ3C 2BYKB 1BH8A 4H9RA 2HIOA 3LJAC 3A6NC 3UT9D 2IO5B 4WU8B 3WAAA 1ID3A 1P3ID 3REHB 5AV6C 5DNMC 4H9QB 3X1SD 2YFVA 3REJB 3AZND 5AVBC 5B0ZD 2NQBB 3B0BA 3UTAB 4J8UB 2F8NG 3WKJA 3C1CB 2J8PA 4YS3B 3WA9B 4CAYA 2UWXA 4YM6B 5JRGB 3O62D 4J8WB 1P34C 4KUDD 4Z2MG 3MGQA 3WAAC 4KGCD 3C1BC 5B2JA 3MNNA 1AOIA 3UTBC 2CV5B 3RELB 3AV2D 5GT0B 5B2IA 5B40D 1M19A 5B32C 2PYOC 1TZYA 4G92C 3F6TA 4H9NA 3AZGA 3A6NB 4LD9C 1P3FC 4Z5TD 4XZQA 5DNND 5F99C 5B1MB 3MNNC 1AOIC 1HQ3D 5DNMB 3AZGB 1F66B 3X1VD 5BNXB 4WV4B 4J8VD 4WU9B 2YFWB 1EQZD 5AY8A 1M1AA 1P3KA 3LZ1B 2HUEB 1KX4B 3LZ0A 2VQRA 4XUJB 1TZYC 3WTPE 1P3BA 1Q9CA 1KX3B 3AZGC 1BH8B 2HIOB 1ZLAD 3KWQA 3AZLD 3WAAB 1ID3B 1P3PC 4JJNA 4QLCA 3C1BB 2YFVB 3B0DC 3X1UA 4ZUXA 2L5AA 3REKC 3AYWC 3AV1C 5AVCD 5AY8C 5CPJC 3KXBA 4Z66A 5GXQA 5B1LD 3AFAA 4G91B 3P5JB 4ZBJB 3W97A 1P3BC 5CPIA 5BNVA 2PYOB 4H9QA 2FJ7D 1A7WA 4CAYB 3AZMC 2Y2NA 3REJA 1P3GA 2ZY2A 3MGQB 2F2AC 1KX5D 2ZY3A 3AN2A 5B24D 5B2JB 3X1UC 5F99B 3MNNB 3TU4A 3AZKA 1P3MA 1AOIB 2ZY5A 3AZFC 4YS3A 3W96A 3KXBC 5B31D 4Z66C 5B2IB 3AFAC 1M19B 2BYMA 4J8XA 5CPIC 1TZYB 1N1JA 1BFMA 1T3UA 4H9NB
chains in the Genus database with same CATH topology
5GT3A 5CPKC 4WU8D 4XZQB 2F8NH 2NZDC 3TU4C 3AZKC 3NQJA 3AZIC 4R8PC 3REKB 3W96C 3MGSA 5AY8B 3AZJA 1M1AB 5CPJB 1P3KB 4Z2MH 3LJAA 4J8XC 1S32C 2Y2IA 3X1TD 1P3BB 5AV6A 5DNMA 5JRGD 1P3AA 3VH5W 5AVBA 3KWQB 1P3OD 3W98D 1BH9A 4JJNB 2XD1A 3B6GD 4QLCB 4X23D 3X1UB 4ZUXB 1U35C 3KUYC 1JFIA 2AROD 2JE5A 3VH5T 2CV5D 3X1SA 3W99C 3RELD 4KHAA 1P34A 5GT0D 3KXBB 4Z66B 5GXQB 5AV5D 3AFAB 2CWEA 3W97B 1H3OA 5CPIB 5BNVB 3C1BA 1M18A 1P3AC 5B33D 3REIC 3WTPC 1P3GB 5E5AC 5JA4A 3UTBA 3A6ND 3AN2B 4UUZA 3UT9C 5B1MD 3TU4B 4AWLB 5B32A 5AV9D 3AZKB 1P3IC 1P3MB 1F66D 2PYOA 1ULYA 3X1SC 1B67A 4WU9D 4H9OA 3W96B 3AZNC 3LZ1D 1KX4D 5B0ZC 2BYMB 4J8XB 4XUJD 3AV2A 5B0YD 1P3FA 1M18C 1KX3D 4LD9A 1N1JB 4NFTA 5F99A 3LELD 5FUGA 5BO0A 2HIOD 1W2EA 5GT3B 5BS7A 5B31G 3O62C 4KUDC 3WAAD 1ID3D 3NQJB 4NE3A 4Z5TA 5DNNA 2G5HC 1P3LD 3MGSB 3AZJB 3X1VA 3LJAB 4J8VA 3AV2C 3WKJD 3VH6W 4WNNA 1P3PA 5AV6B 5B40C 3H0RC 3AYWA 3REKA 3REIB 1P3AB 5BS7C 5AVBB 3AV1A 3MGQD 5E5AB 5CPJA 1BH9B 1ZLAA 3VH6T 3AZEA 3UT9B 4NE5A 5B2JD 2Y2KA 4Z5TC 1JFIB 1AOID 5DNNC 2F8NK 5AV8D 1HQ3C 3X1SB 3AZMA 3NQUA 5GSUD 4KHAB 3X1VC 2Y2HA 4J8VC 1P34B 1EQZC 5B2ID 5AVCA 1M19D 1H3OB 1M18B 5CHLB 2G5IC 3AZHD 2F8NA 4M6BA 3MGRD 3AZFA 5JA4B 3UTBB 1ZLAC 3AZEC 4UUZB 4XZQD 3AZLC 3B0CW 5B32B 5B24A 4G92B 4H9OB 2RVQD 5AY8D 5CP6D 3MVDD 1M1AD 1P3KD 5AVCC 3LZ0D 5CPKA 3MGPD 3B0CT 3AV2B 1P3FB 4LD9B 4H9PA 1P3BD 2NZDA 3AL0C 5FUGB 3AZIA 4R8PA 5BO0B 2FJ7C 5BT1C 3KWQD 3B6FD 4JJND 4QLCD 1KX5C 4ZUXD 5B24C 4WZSB 4Z5TB 1S32A 5DNNB 1HQ3B 2DQNC 3X1VB 4J8VB 5GXQD 5B31C 3W97D 4EO5C 4WNNB 3REHD 1P3PB 3KSYA 4DRBA 3EG5B 3B0DB 1U35A 3KUYA 3AYWB 3REJD 3X1TA 1P3GD 3AV1B 2JCHA 2NQBD 3W99A 3UTAD 4J8UD 1ZLAB 3AN2D 3AZEB 2IO5C 1P3OA 3W98A 4WU8C 1P3MD 3C1CD 3B6GA 4YS3D 3WA9D 3AZMB 4X23A 4YM6D 3NQUB 4J8WD 3REIA 3WTPA 2AROA 5AVCB 5E5AA 2Y2LA 3UT9A 3X1TC 2F8NB 1P3IA 2Y2GA 3AZFB 2Y2PA 5GT3D 5JRGC 5KDMA 5B33A 1F1EA 3AZNA 1P3OC 3W98C 5B0ZA 3B6GC 5B24B 4X23C 3EPLA 3MGSD 3AZJD 2AROC 3LJAD 2CV5C 5CPKB 4E44A 3RELC 3O62A 4KUDA 3VH6A 4HGAC 5GT0C 4H9PB 2NZDB 5AV6D 5AV5C 5DNMD 3AZIB 4R8PB 5B0YA 2FFFB 4KGCA 1P3AD 4E45A 5AVBD 5C3IC 5B33C 3LELA 2XD5A 2DF4C 4H9SA 1S32B 5B1MC 5B40A 5AV9C 1F66C 1WWIA 1P34D 4WU9C 1P3LA 3LZ1C 2HUEC 1KX4C 3C1BD 1M18D 4XUJC 4KGCC 5B0YC 1U35B 1KX3C 3KUYB 3X1TB 1HQ3A 3V9RA 3LELC 2ZM5A 3UTBD 3W99B 4H9SC 2HIOC 1EQZA 1R4VA 1P3OB 1KU5A 1B6WA 3W98B 1ID3C 5B32D 3H0MC 2PYOD 3B6GB 4X23B 1WWSA 1HTAA 2Y2MA 3WTPB 2AROB 1P3LC 5AV8A 2ZY4A 5GSUA 4LD9D 4HGAB 1P3FD 3AZLA 3WKJC 5F99D 4G91C 4ZBJC 5AV5B 3MNND 1P3IB 5C3IB 5KDMB 3AZHA 5B33B 3AZNB 3MGRA 3MGQC 5G49B 5B0ZB 1TAFA 2Y2OA 1TZYD 3EPKA 5B2JC 5B1LA 5AV9B 3AZGD 5AV8C 2FJ7A 4UPKA 5GSUC 3O62B 4KUDB 5CP6A 3MVDA 2JSSA 5B2IC 1P3PD 1M19C 2Y2JA 1KX5A 3MGPA 4KGCB 5B0YB 3AYWD 3REKD 3AV1D 3AZHC 3LELB 5CPJD 3MGRC 4NE6A 4H9RB 3AZED 3B6FA 3R45A 5B31A 4XZQC 5B1LC 5B40B 4CSRA 3AZMD 3VH5A 2RVQC 3EPHA 1P3LB 5CP6C 3MVDC 2BYKA 1P3KC 1M1AC 3LZ0C 3MGPC 3X1UD 3WKJB 4WU8A 2F8ND 3REHA 3FDDA 3H0LC 3V9RB 3AZFD 5BT1D 3KXBD 1EQZB 4Z66D 3KWQC 3B6FC 4DQYB 3AFAD 2NQBA 3A1IA 4JJNC 3UTAA 4J8UA 5CPID 4QLCC 4ZUXC 3C1CA 1Z2CB 5AV8B 3WA9A 5CPKD 4YM6A 4J8WA 2W8SA 5GSUB 5JRGA 3A1KA 5GXQC 5B32G 3AZLB 2NZDD 3TU4D 3W97C 3AZKD 3REHC 3AZID 4R8PD 2BG1A 3W96D 3AZHB 3REJC 1P3GC 3MGRB 2CV5A 2NQBC 1TAFB 3RELA 4J8XD 4DRAA 3UTAC 4J8UC 5GT0A 3AN2C 1S32D 2LY8A 2Y2QA 5B1LB 5AV5A 4AWLC 1P3MC 3C1CC 1PZRA 4YS3C 2FJ7B 3WA9C 4YM6C 4J8WC 5CP6B 3MVDB 5G49A 3LZ0B 3A6NA 1KX5B 3MGPB 1U35D 3KUYD 5B1MA 5AV9A 1F66A 3KFUG 3W99D 5BNXA 4WU9A 5GT3C 2YFWA 3B6FB 3R45B 5B31B 3LZ1A 4EO5B 3EPJA 1KX4A 3IP4C 4CSRB 4XUJA 1KX3A 3REID 3WTPD 2RIQA 5E5AD 3MGSC 3AZJC 4WJ3C 2BYKB 1BH8A 4H9RA 2HIOA 3LJAC 3A6NC 3UT9D 2IO5B 4WU8B 3WAAA 1ID3A 1P3ID 3REHB 5AV6C 5DNMC 4H9QB 3X1SD 2YFVA 3REJB 3AZND 5AVBC 5B0ZD 2NQBB 3B0BA 3UTAB 4J8UB 2F8NG 3WKJA 3C1CB 2J8PA 4YS3B 3WA9B 4CAYA 2UWXA 4YM6B 5JRGB 3O62D 4J8WB 1P34C 4KUDD 4Z2MG 3MGQA 3WAAC 4KGCD 3C1BC 5B2JA 3MNNA 1AOIA 3UTBC 2CV5B 3RELB 3AV2D 5GT0B 5B2IA 5B40D 1M19A 5B32C 2PYOC 1TZYA 4G92C 3F6TA 4H9NA 3AZGA 3A6NB 4LD9C 1P3FC 4Z5TD 4XZQA 5DNND 5F99C 5B1MB 3MNNC 1AOIC 1HQ3D 5DNMB 3AZGB 1F66B 3X1VD 5BNXB 4WV4B 4J8VD 4WU9B 2YFWB 1EQZD 5AY8A 1M1AA 1P3KA 3LZ1B 2HUEB 1KX4B 3LZ0A 2VQRA 4XUJB 1TZYC 3WTPE 1P3BA 1Q9CA 1KX3B 3AZGC 1BH8B 2HIOB 1ZLAD 3KWQA 3AZLD 3WAAB 1ID3B 1P3PC 4JJNA 4QLCA 3C1BB 2YFVB 3B0DC 3X1UA 4ZUXA 2L5AA 3REKC 3AYWC 3AV1C 5AVCD 5AY8C 5CPJC 3KXBA 4Z66A 5GXQA 5B1LD 3AFAA 4G91B 3P5JB 4ZBJB 3W97A 1P3BC 5CPIA 5BNVA 2PYOB 4H9QA 2FJ7D 1A7WA 4CAYB 3AZMC 2Y2NA 3REJA 1P3GA 2ZY2A 3MGQB 2F2AC 1KX5D 2ZY3A 3AN2A 5B24D 5B2JB 3X1UC 5F99B 3MNNB 3TU4A 3AZKA 1P3MA 1AOIB 2ZY5A 3AZFC 4YS3A 3W96A 3KXBC 5B31D 4Z66C 5B2IB 3AFAC 1M19B 2BYMA 4J8XA 5CPIC 1TZYB 1N1JA 1BFMA 1T3UA 4H9NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 A;  5CPK C;  4WU8 D;  4XZQ B;  2F8N H;  2NZD C;  3TU4 C;  3AZK C;  3NQJ A;  3AZI C;  4R8P C;  3REK B;  3W96 C;  3MGS A;  5AY8 B;  3AZJ A;  1M1A B;  5CPJ B;  1P3K B;  4Z2M H;  3LJA A;  4J8X C;  1S32 C;  3X1T D;  1P3B B;  5AV6 A;  5DNM A;  5JRG D;  1P3A A;  3VH5 W;  5AVB A;  3KWQ B;  1P3O D;  3W98 D;  1BH9 A;  4JJN B;  3B6G D;  4QLC B;  4X23 D;  3X1U B;  4ZUX B;  1U35 C;  3KUY C;  1JFI A;  2ARO D;  3VH5 T;  2CV5 D;  3X1S A;  3W99 C;  3REL D;  4KHA A;  1P34 A;  5GT0 D;  3KXB B;  4Z66 B;  5GXQ B;  5AV5 D;  3AFA B;  2CWE A;  3W97 B;  1H3O A;  5CPI B;  5BNV B;  3C1B A;  1M18 A;  1P3A C;  5B33 D;  3REI C;  3WTP C;  1P3G B;  5E5A C;  5JA4 A;  3UTB A;  3A6N D;  3AN2 B;  4UUZ A;  3UT9 C;  5B1M D;  3TU4 B;  4AWL B;  5B32 A;  5AV9 D;  3AZK B;  1P3I C;  1P3M B;  1F66 D;  2PYO A;  1ULY A;  3X1S C;  1B67 A;  4WU9 D;  4H9O A;  3W96 B;  3AZN C;  3LZ1 D;  1KX4 D;  5B0Z C;  2BYM B;  4J8X B;  4XUJ D;  3AV2 A;  5B0Y D;  1P3F A;  1M18 C;  1KX3 D;  4LD9 A;  1N1J B;  4NFT A;  5F99 A;  3LEL D;  5FUG A;  5BO0 A;  2HIO D;  5GT3 B;  5BS7 A;  5B31 G;  3O62 C;  4KUD C;  3WAA D;  1ID3 D;  3NQJ B;  4NE3 A;  4Z5T A;  5DNN A;  1P3L D;  3MGS B;  3AZJ B;  3X1V A;  3LJA B;  4J8V A;  3AV2 C;  3WKJ D;  3VH6 W;  4WNN A;  1P3P A;  5AV6 B;  5B40 C;  3AYW A;  3REK A;  3REI B;  1P3A B;  5BS7 C;  5AVB B;  3AV1 A;  3MGQ D;  5E5A B;  5CPJ A;  1BH9 B;  1ZLA A;  3VH6 T;  3AZE A;  3UT9 B;  4NE5 A;  5B2J D;  1JFI B;  4Z5T C;  1AOI D;  5DNN C;  2F8N K;  5AV8 D;  1HQ3 C;  3X1S B;  3AZM A;  3NQU A;  5GSU D;  4KHA B;  3X1V C;  1P34 B;  4J8V C;  1EQZ C;  5B2I D;  5AVC A;  1M19 D;  1H3O B;  1M18 B;  5CHL B;  3AZH D;  2F8N A;  4M6B A;  3MGR D;  3AZF A;  5JA4 B;  3UTB B;  1ZLA C;  3AZE C;  4UUZ B;  4XZQ D;  3AZL C;  3B0C W;  5B32 B;  5B24 A;  4G92 B;  4H9O B;  2RVQ D;  5AY8 D;  5CP6 D;  3MVD D;  1M1A D;  1P3K D;  5AVC C;  3LZ0 D;  5CPK A;  3MGP D;  3B0C T;  3AV2 B;  1P3F B;  4LD9 B;  4H9P A;  1P3B D;  2NZD A;  5FUG B;  3AZI A;  4R8P A;  5BO0 B;  2FJ7 C;  5BT1 C;  3KWQ D;  3B6F D;  4JJN D;  4QLC D;  1KX5 C;  4ZUX D;  5B24 C;  4WZS B;  4Z5T B;  1S32 A;  5DNN B;  1HQ3 B;  3X1V B;  4J8V B;  5GXQ D;  5B31 C;  3W97 D;  4EO5 C;  4WNN B;  3REH D;  1P3P B;  3KSY A;  4DRB A;  3B0D B;  1U35 A;  3KUY A;  3AYW B;  3REJ D;  3X1T A;  1P3G D;  3AV1 B;  2NQB D;  3W99 A;  3UTA D;  4J8U D;  1ZLA B;  3AN2 D;  3AZE B;  2IO5 C;  1P3O A;  3W98 A;  4WU8 C;  1P3M D;  3C1C D;  3B6G A;  4YS3 D;  3WA9 D;  3AZM B;  4X23 A;  4YM6 D;  3NQU B;  4J8W D;  3REI A;  3WTP A;  2ARO A;  5AVC B;  5E5A A;  3UT9 A;  3X1T C;  2F8N B;  1P3I A;  3AZF B;  5GT3 D;  5JRG C;  5KDM A;  5B33 A;  1F1E A;  3AZN A;  1P3O C;  3W98 C;  5B0Z A;  3B6G C;  5B24 B;  4X23 C;  3MGS D;  3AZJ D;  2ARO C;  3LJA D;  2CV5 C;  5CPK B;  4E44 A;  3REL C;  3O62 A;  4KUD A;  3VH6 A;  4HGA C;  5GT0 C;  4H9P B;  2NZD B;  5AV6 D;  5AV5 C;  5DNM D;  3AZI B;  4R8P B;  5B0Y A;  4KGC A;  1P3A D;  4E45 A;  5AVB D;  5C3I C;  5B33 C;  3LEL A;  4H9S A;  1S32 B;  5B1M C;  5B40 A;  5AV9 C;  1F66 C;  1WWI A;  1P34 D;  4WU9 C;  1P3L A;  3LZ1 C;  2HUE C;  1KX4 C;  3C1B D;  1M18 D;  4XUJ C;  4KGC C;  5B0Y C;  1U35 B;  1KX3 C;  3KUY B;  3X1T B;  1HQ3 A;  3V9R A;  3LEL C;  3UTB D;  3W99 B;  4H9S C;  2HIO C;  1EQZ A;  1R4V A;  1P3O B;  1KU5 A;  1B6W A;  3W98 B;  1ID3 C;  5B32 D;  3B6G B;  2PYO D;  4X23 B;  1WWS A;  1HTA A;  3WTP B;  2ARO B;  1P3L C;  5AV8 A;  5GSU A;  4LD9 D;  4HGA B;  1P3F D;  3AZL A;  3WKJ C;  5F99 D;  4G91 C;  4ZBJ C;  5AV5 B;  3MNN D;  1P3I B;  5C3I B;  5KDM B;  3AZH A;  5B33 B;  3AZN B;  3MGR A;  3MGQ C;  5G49 B;  5B0Z B;  1TAF A;  1TZY D;  5B2J C;  5B1L A;  5AV9 B;  3AZG D;  5AV8 C;  2FJ7 A;  5GSU C;  3O62 B;  4KUD B;  5CP6 A;  3MVD A;  2JSS A;  5B2I C;  1P3P D;  1M19 C;  1KX5 A;  3MGP A;  4KGC B;  5B0Y B;  3AYW D;  3REK D;  3AV1 D;  3AZH C;  3LEL B;  5CPJ D;  3MGR C;  4NE6 A;  4H9R B;  3AZE D;  3B6F A;  3R45 A;  5B31 A;  4XZQ C;  5B1L C;  5B40 B;  4CSR A;  3AZM D;  3VH5 A;  2RVQ C;  1P3L B;  5CP6 C;  3MVD C;  2BYK A;  1P3K C;  1M1A C;  3LZ0 C;  3MGP C;  3X1U D;  3WKJ B;  4WU8 A;  2F8N D;  3REH A;  3V9R B;  3AZF D;  5BT1 D;  3KXB D;  1EQZ B;  4Z66 D;  3KWQ C;  3B6F C;  3AFA D;  2NQB A;  4JJN C;  3UTA A;  4J8U A;  5CPI D;  4QLC C;  4ZUX C;  3C1C A;  5AV8 B;  3WA9 A;  5CPK D;  4YM6 A;  4J8W A;  5JRG A;  5GSU B;  5B32 G;  5GXQ C;  3AZL B;  2NZD D;  3TU4 D;  3W97 C;  3AZK D;  3REH C;  3AZI D;  4R8P D;  3W96 D;  3AZH B;  3REJ C;  1P3G C;  3MGR B;  2CV5 A;  2NQB C;  1TAF B;  3REL A;  4J8X D;  4DRA A;  3UTA C;  4J8U C;  5GT0 A;  3AN2 C;  1S32 D;  2LY8 A;  5B1L B;  5AV5 A;  4AWL C;  1P3M C;  3C1C C;  4YS3 C;  2FJ7 B;  3WA9 C;  4YM6 C;  4J8W C;  5CP6 B;  3MVD B;  5G49 A;  3LZ0 B;  3A6N A;  1KX5 B;  3MGP B;  1U35 D;  3KUY D;  5B1M A;  5AV9 A;  1F66 A;  3W99 D;  5BNX A;  4WU9 A;  5GT3 C;  2YFW A;  3B6F B;  3R45 B;  5B31 B;  3LZ1 A;  4EO5 B;  1KX4 A;  4CSR B;  4XUJ A;  1KX3 A;  3REI D;  3WTP D;  5E5A D;  3MGS C;  3AZJ C;  2BYK B;  1BH8 A;  4H9R A;  2HIO A;  3LJA C;  3A6N C;  3UT9 D;  2IO5 B;  4WU8 B;  3WAA A;  1ID3 A;  1P3I D;  3REH B;  5AV6 C;  5DNM C;  4H9Q B;  3X1S D;  2YFV A;  3REJ B;  3AZN D;  5AVB C;  5B0Z D;  2NQB B;  3B0B A;  3UTA B;  4J8U B;  2F8N G;  3WKJ A;  3C1C B;  4YS3 B;  3WA9 B;  4CAY A;  4YM6 B;  4J8W B;  5JRG B;  3O62 D;  1P34 C;  4KUD D;  4Z2M G;  3MGQ A;  3WAA C;  4KGC D;  3C1B C;  5B2J A;  3MNN A;  1AOI A;  3UTB C;  2CV5 B;  3REL B;  3AV2 D;  5GT0 B;  5B2I A;  5B40 D;  1M19 A;  5B32 C;  2PYO C;  1TZY A;  4G92 C;  4H9N A;  3AZG A;  3A6N B;  4LD9 C;  1P3F C;  4Z5T D;  4XZQ A;  5DNN D;  5F99 C;  5B1M B;  3MNN C;  1AOI C;  1HQ3 D;  5DNM B;  3AZG B;  1F66 B;  3X1V D;  5BNX B;  4WV4 B;  4J8V D;  4WU9 B;  2YFW B;  1EQZ D;  5AY8 A;  1M1A A;  1P3K A;  3LZ1 B;  2HUE B;  1KX4 B;  3LZ0 A;  4XUJ B;  1TZY C;  3WTP E;  1P3B A;  1Q9C A;  1KX3 B;  3AZG C;  1BH8 B;  2HIO B;  1ZLA D;  3KWQ A;  3AZL D;  3WAA B;  1ID3 B;  1P3P C;  4JJN A;  4QLC A;  3C1B B;  2YFV B;  3B0D C;  3X1U A;  4ZUX A;  2L5A A;  3REK C;  3AYW C;  3AV1 C;  5AVC D;  5AY8 C;  5CPJ C;  3KXB A;  4Z66 A;  5GXQ A;  5B1L D;  3AFA A;  4G91 B;  4ZBJ B;  3W97 A;  1P3B C;  5CPI A;  5BNV A;  2PYO B;  4H9Q A;  2FJ7 D;  1A7W A;  4CAY B;  3AZM C;  3REJ A;  1P3G A;  3MGQ B;  1KX5 D;  3AN2 A;  5B24 D;  5B2J B;  3X1U C;  5F99 B;  3MNN B;  3TU4 A;  3AZK A;  1P3M A;  1AOI B;  4YS3 A;  3AZF C;  3W96 A;  3KXB C;  5B31 D;  4Z66 C;  5B2I B;  3AFA C;  1M19 B;  2BYM A;  4J8X A;  5CPI C;  1TZY B;  1N1J A;  1BFM A;  4H9N B; 
#chains in the Genus database with same CATH topology
 5GT3 A;  5CPK C;  4WU8 D;  4XZQ B;  2F8N H;  2NZD C;  3TU4 C;  3AZK C;  3NQJ A;  3AZI C;  4R8P C;  3REK B;  3W96 C;  3MGS A;  5AY8 B;  3AZJ A;  1M1A B;  5CPJ B;  1P3K B;  4Z2M H;  3LJA A;  4J8X C;  1S32 C;  2Y2I A;  3X1T D;  1P3B B;  5AV6 A;  5DNM A;  5JRG D;  1P3A A;  3VH5 W;  5AVB A;  3KWQ B;  1P3O D;  3W98 D;  1BH9 A;  4JJN B;  2XD1 A;  3B6G D;  4QLC B;  4X23 D;  3X1U B;  4ZUX B;  1U35 C;  3KUY C;  1JFI A;  2ARO D;  2JE5 A;  3VH5 T;  2CV5 D;  3X1S A;  3W99 C;  3REL D;  4KHA A;  1P34 A;  5GT0 D;  3KXB B;  4Z66 B;  5GXQ B;  5AV5 D;  3AFA B;  2CWE A;  3W97 B;  1H3O A;  5CPI B;  5BNV B;  3C1B A;  1M18 A;  1P3A C;  5B33 D;  3REI C;  3WTP C;  1P3G B;  5E5A C;  5JA4 A;  3UTB A;  3A6N D;  3AN2 B;  4UUZ A;  3UT9 C;  5B1M D;  3TU4 B;  4AWL B;  5B32 A;  5AV9 D;  3AZK B;  1P3I C;  1P3M B;  1F66 D;  2PYO A;  1ULY A;  3X1S C;  1B67 A;  4WU9 D;  4H9O A;  3W96 B;  3AZN C;  3LZ1 D;  1KX4 D;  5B0Z C;  2BYM B;  4J8X B;  4XUJ D;  3AV2 A;  5B0Y D;  1P3F A;  1M18 C;  1KX3 D;  4LD9 A;  1N1J B;  4NFT A;  5F99 A;  3LEL D;  5FUG A;  5BO0 A;  2HIO D;  1W2E A;  5GT3 B;  5BS7 A;  5B31 G;  3O62 C;  4KUD C;  3WAA D;  1ID3 D;  3NQJ B;  4NE3 A;  4Z5T A;  5DNN A;  2G5H C;  1P3L D;  3MGS B;  3AZJ B;  3X1V A;  3LJA B;  4J8V A;  3AV2 C;  3WKJ D;  3VH6 W;  4WNN A;  1P3P A;  5AV6 B;  5B40 C;  3H0R C;  3AYW A;  3REK A;  3REI B;  1P3A B;  5BS7 C;  5AVB B;  3AV1 A;  3MGQ D;  5E5A B;  5CPJ A;  1BH9 B;  1ZLA A;  3VH6 T;  3AZE A;  3UT9 B;  4NE5 A;  5B2J D;  2Y2K A;  4Z5T C;  1JFI B;  1AOI D;  5DNN C;  2F8N K;  5AV8 D;  1HQ3 C;  3X1S B;  3AZM A;  3NQU A;  5GSU D;  4KHA B;  3X1V C;  2Y2H A;  4J8V C;  1P34 B;  1EQZ C;  5B2I D;  5AVC A;  1M19 D;  1H3O B;  1M18 B;  5CHL B;  2G5I C;  3AZH D;  2F8N A;  4M6B A;  3MGR D;  3AZF A;  5JA4 B;  3UTB B;  1ZLA C;  3AZE C;  4UUZ B;  4XZQ D;  3AZL C;  3B0C W;  5B32 B;  5B24 A;  4G92 B;  4H9O B;  2RVQ D;  5AY8 D;  5CP6 D;  3MVD D;  1M1A D;  1P3K D;  5AVC C;  3LZ0 D;  5CPK A;  3MGP D;  3B0C T;  3AV2 B;  1P3F B;  4LD9 B;  4H9P A;  1P3B D;  2NZD A;  3AL0 C;  5FUG B;  3AZI A;  4R8P A;  5BO0 B;  2FJ7 C;  5BT1 C;  3KWQ D;  3B6F D;  4JJN D;  4QLC D;  1KX5 C;  4ZUX D;  5B24 C;  4WZS B;  4Z5T B;  1S32 A;  5DNN B;  1HQ3 B;  2DQN C;  3X1V B;  4J8V B;  5GXQ D;  5B31 C;  3W97 D;  4EO5 C;  4WNN B;  3REH D;  1P3P B;  3KSY A;  4DRB A;  3EG5 B;  3B0D B;  1U35 A;  3KUY A;  3AYW B;  3REJ D;  3X1T A;  1P3G D;  3AV1 B;  2JCH A;  2NQB D;  3W99 A;  3UTA D;  4J8U D;  1ZLA B;  3AN2 D;  3AZE B;  2IO5 C;  1P3O A;  3W98 A;  4WU8 C;  1P3M D;  3C1C D;  3B6G A;  4YS3 D;  3WA9 D;  3AZM B;  4X23 A;  4YM6 D;  3NQU B;  4J8W D;  3REI A;  3WTP A;  2ARO A;  5AVC B;  5E5A A;  2Y2L A;  3UT9 A;  3X1T C;  2F8N B;  1P3I A;  2Y2G A;  3AZF B;  2Y2P A;  5GT3 D;  5JRG C;  5KDM A;  5B33 A;  1F1E A;  3AZN A;  1P3O C;  3W98 C;  5B0Z A;  3B6G C;  5B24 B;  4X23 C;  3EPL A;  3MGS D;  3AZJ D;  2ARO C;  3LJA D;  2CV5 C;  5CPK B;  4E44 A;  3REL C;  3O62 A;  4KUD A;  3VH6 A;  4HGA C;  5GT0 C;  4H9P B;  2NZD B;  5AV6 D;  5AV5 C;  5DNM D;  3AZI B;  4R8P B;  5B0Y A;  2FFF B;  4KGC A;  1P3A D;  4E45 A;  5AVB D;  5C3I C;  5B33 C;  3LEL A;  2XD5 A;  2DF4 C;  4H9S A;  1S32 B;  5B1M C;  5B40 A;  5AV9 C;  1F66 C;  1WWI A;  1P34 D;  4WU9 C;  1P3L A;  3LZ1 C;  2HUE C;  1KX4 C;  3C1B D;  1M18 D;  4XUJ C;  4KGC C;  5B0Y C;  1U35 B;  1KX3 C;  3KUY B;  3X1T B;  1HQ3 A;  3V9R A;  3LEL C;  2ZM5 A;  3UTB D;  3W99 B;  4H9S C;  2HIO C;  1EQZ A;  1R4V A;  1P3O B;  1KU5 A;  1B6W A;  3W98 B;  1ID3 C;  5B32 D;  3H0M C;  2PYO D;  3B6G B;  4X23 B;  1WWS A;  1HTA A;  2Y2M A;  3WTP B;  2ARO B;  1P3L C;  5AV8 A;  2ZY4 A;  5GSU A;  4LD9 D;  4HGA B;  1P3F D;  3AZL A;  3WKJ C;  5F99 D;  4G91 C;  4ZBJ C;  5AV5 B;  3MNN D;  1P3I B;  5C3I B;  5KDM B;  3AZH A;  5B33 B;  3AZN B;  3MGR A;  3MGQ C;  5G49 B;  5B0Z B;  1TAF A;  2Y2O A;  1TZY D;  3EPK A;  5B2J C;  5B1L A;  5AV9 B;  3AZG D;  5AV8 C;  2FJ7 A;  4UPK A;  5GSU C;  3O62 B;  4KUD B;  5CP6 A;  3MVD A;  2JSS A;  5B2I C;  1P3P D;  1M19 C;  2Y2J A;  1KX5 A;  3MGP A;  4KGC B;  5B0Y B;  3AYW D;  3REK D;  3AV1 D;  3AZH C;  3LEL B;  5CPJ D;  3MGR C;  4NE6 A;  4H9R B;  3AZE D;  3B6F A;  3R45 A;  5B31 A;  4XZQ C;  5B1L C;  5B40 B;  4CSR A;  3AZM D;  3VH5 A;  2RVQ C;  3EPH A;  1P3L B;  5CP6 C;  3MVD C;  2BYK A;  1P3K C;  1M1A C;  3LZ0 C;  3MGP C;  3X1U D;  3WKJ B;  4WU8 A;  2F8N D;  3REH A;  3FDD A;  3H0L C;  3V9R B;  3AZF D;  5BT1 D;  3KXB D;  1EQZ B;  4Z66 D;  3KWQ C;  3B6F C;  4DQY B;  3AFA D;  2NQB A;  3A1I A;  4JJN C;  3UTA A;  4J8U A;  5CPI D;  4QLC C;  4ZUX C;  3C1C A;  1Z2C B;  5AV8 B;  3WA9 A;  5CPK D;  4YM6 A;  4J8W A;  2W8S A;  5GSU B;  5JRG A;  3A1K A;  5GXQ C;  5B32 G;  3AZL B;  2NZD D;  3TU4 D;  3W97 C;  3AZK D;  3REH C;  3AZI D;  4R8P D;  2BG1 A;  3W96 D;  3AZH B;  3REJ C;  1P3G C;  3MGR B;  2CV5 A;  2NQB C;  1TAF B;  3REL A;  4J8X D;  4DRA A;  3UTA C;  4J8U C;  5GT0 A;  3AN2 C;  1S32 D;  2LY8 A;  2Y2Q A;  5B1L B;  5AV5 A;  4AWL C;  1P3M C;  3C1C C;  1PZR A;  4YS3 C;  2FJ7 B;  3WA9 C;  4YM6 C;  4J8W C;  5CP6 B;  3MVD B;  5G49 A;  3LZ0 B;  3A6N A;  1KX5 B;  3MGP B;  1U35 D;  3KUY D;  5B1M A;  5AV9 A;  1F66 A;  3KFU G;  3W99 D;  5BNX A;  4WU9 A;  5GT3 C;  2YFW A;  3B6F B;  3R45 B;  5B31 B;  3LZ1 A;  4EO5 B;  3EPJ A;  1KX4 A;  3IP4 C;  4CSR B;  4XUJ A;  1KX3 A;  3REI D;  3WTP D;  2RIQ A;  5E5A D;  3MGS C;  3AZJ C;  4WJ3 C;  2BYK B;  1BH8 A;  4H9R A;  2HIO A;  3LJA C;  3A6N C;  3UT9 D;  2IO5 B;  4WU8 B;  3WAA A;  1ID3 A;  1P3I D;  3REH B;  5AV6 C;  5DNM C;  4H9Q B;  3X1S D;  2YFV A;  3REJ B;  3AZN D;  5AVB C;  5B0Z D;  2NQB B;  3B0B A;  3UTA B;  4J8U B;  2F8N G;  3WKJ A;  3C1C B;  2J8P A;  4YS3 B;  3WA9 B;  4CAY A;  2UWX A;  4YM6 B;  5JRG B;  3O62 D;  4J8W B;  1P34 C;  4KUD D;  4Z2M G;  3MGQ A;  3WAA C;  4KGC D;  3C1B C;  5B2J A;  3MNN A;  1AOI A;  3UTB C;  2CV5 B;  3REL B;  3AV2 D;  5GT0 B;  5B2I A;  5B40 D;  1M19 A;  5B32 C;  2PYO C;  1TZY A;  4G92 C;  3F6T A;  4H9N A;  3AZG A;  3A6N B;  4LD9 C;  1P3F C;  4Z5T D;  4XZQ A;  5DNN D;  5F99 C;  5B1M B;  3MNN C;  1AOI C;  1HQ3 D;  5DNM B;  3AZG B;  1F66 B;  3X1V D;  5BNX B;  4WV4 B;  4J8V D;  4WU9 B;  2YFW B;  1EQZ D;  5AY8 A;  1M1A A;  1P3K A;  3LZ1 B;  2HUE B;  1KX4 B;  3LZ0 A;  2VQR A;  4XUJ B;  1TZY C;  3WTP E;  1P3B A;  1Q9C A;  1KX3 B;  3AZG C;  1BH8 B;  2HIO B;  1ZLA D;  3KWQ A;  3AZL D;  3WAA B;  1ID3 B;  1P3P C;  4JJN A;  4QLC A;  3C1B B;  2YFV B;  3B0D C;  3X1U A;  4ZUX A;  2L5A A;  3REK C;  3AYW C;  3AV1 C;  5AVC D;  5AY8 C;  5CPJ C;  3KXB A;  4Z66 A;  5GXQ A;  5B1L D;  3AFA A;  4G91 B;  3P5J B;  4ZBJ B;  3W97 A;  1P3B C;  5CPI A;  5BNV A;  2PYO B;  4H9Q A;  2FJ7 D;  1A7W A;  4CAY B;  3AZM C;  2Y2N A;  3REJ A;  1P3G A;  2ZY2 A;  3MGQ B;  2F2A C;  1KX5 D;  2ZY3 A;  3AN2 A;  5B24 D;  5B2J B;  3X1U C;  5F99 B;  3MNN B;  3TU4 A;  3AZK A;  1P3M A;  1AOI B;  2ZY5 A;  3AZF C;  4YS3 A;  3W96 A;  3KXB C;  5B31 D;  4Z66 C;  5B2I B;  3AFA C;  1M19 B;  2BYM A;  4J8X A;  5CPI C;  1TZY B;  1N1J A;  1BFM A;  1T3U A;  4H9N B; 
#chains in the Genus database with same CATH homology
 5GT3 A;  5CPK C;  4WU8 D;  4XZQ B;  2F8N H;  2NZD C;  3TU4 C;  3AZK C;  3NQJ A;  3AZI C;  4R8P C;  3REK B;  3W96 C;  3MGS A;  5AY8 B;  3AZJ A;  1M1A B;  5CPJ B;  1P3K B;  4Z2M H;  3LJA A;  4J8X C;  1S32 C;  2Y2I A;  3X1T D;  1P3B B;  5AV6 A;  5DNM A;  5JRG D;  1P3A A;  3VH5 W;  5AVB A;  3KWQ B;  1P3O D;  3W98 D;  1BH9 A;  4JJN B;  2XD1 A;  3B6G D;  4QLC B;  4X23 D;  3X1U B;  4ZUX B;  1U35 C;  3KUY C;  1JFI A;  2ARO D;  2JE5 A;  3VH5 T;  2CV5 D;  3X1S A;  3W99 C;  3REL D;  4KHA A;  1P34 A;  5GT0 D;  3KXB B;  4Z66 B;  5GXQ B;  5AV5 D;  3AFA B;  2CWE A;  3W97 B;  1H3O A;  5CPI B;  5BNV B;  3C1B A;  1M18 A;  1P3A C;  5B33 D;  3REI C;  3WTP C;  1P3G B;  5E5A C;  5JA4 A;  3UTB A;  3A6N D;  3AN2 B;  4UUZ A;  3UT9 C;  5B1M D;  3TU4 B;  4AWL B;  5B32 A;  5AV9 D;  3AZK B;  1P3I C;  1P3M B;  1F66 D;  2PYO A;  1ULY A;  3X1S C;  1B67 A;  4WU9 D;  4H9O A;  3W96 B;  3AZN C;  3LZ1 D;  1KX4 D;  5B0Z C;  2BYM B;  4J8X B;  4XUJ D;  3AV2 A;  5B0Y D;  1P3F A;  1M18 C;  1KX3 D;  4LD9 A;  1N1J B;  4NFT A;  5F99 A;  3LEL D;  5FUG A;  5BO0 A;  2HIO D;  1W2E A;  5GT3 B;  5BS7 A;  5B31 G;  3O62 C;  4KUD C;  3WAA D;  1ID3 D;  3NQJ B;  4NE3 A;  4Z5T A;  5DNN A;  2G5H C;  1P3L D;  3MGS B;  3AZJ B;  3X1V A;  3LJA B;  4J8V A;  3AV2 C;  3WKJ D;  3VH6 W;  4WNN A;  1P3P A;  5AV6 B;  5B40 C;  3H0R C;  3AYW A;  3REK A;  3REI B;  1P3A B;  5BS7 C;  5AVB B;  3AV1 A;  3MGQ D;  5E5A B;  5CPJ A;  1BH9 B;  1ZLA A;  3VH6 T;  3AZE A;  3UT9 B;  4NE5 A;  5B2J D;  2Y2K A;  4Z5T C;  1JFI B;  1AOI D;  5DNN C;  2F8N K;  5AV8 D;  1HQ3 C;  3X1S B;  3AZM A;  3NQU A;  5GSU D;  4KHA B;  3X1V C;  2Y2H A;  4J8V C;  1P34 B;  1EQZ C;  5B2I D;  5AVC A;  1M19 D;  1H3O B;  1M18 B;  5CHL B;  2G5I C;  3AZH D;  2F8N A;  4M6B A;  3MGR D;  3AZF A;  5JA4 B;  3UTB B;  1ZLA C;  3AZE C;  4UUZ B;  4XZQ D;  3AZL C;  3B0C W;  5B32 B;  5B24 A;  4G92 B;  4H9O B;  2RVQ D;  5AY8 D;  5CP6 D;  3MVD D;  1M1A D;  1P3K D;  5AVC C;  3LZ0 D;  5CPK A;  3MGP D;  3B0C T;  3AV2 B;  1P3F B;  4LD9 B;  4H9P A;  1P3B D;  2NZD A;  3AL0 C;  5FUG B;  3AZI A;  4R8P A;  5BO0 B;  2FJ7 C;  5BT1 C;  3KWQ D;  3B6F D;  4JJN D;  4QLC D;  1KX5 C;  4ZUX D;  5B24 C;  4WZS B;  4Z5T B;  1S32 A;  5DNN B;  1HQ3 B;  2DQN C;  3X1V B;  4J8V B;  5GXQ D;  5B31 C;  3W97 D;  4EO5 C;  4WNN B;  3REH D;  1P3P B;  3KSY A;  4DRB A;  3EG5 B;  3B0D B;  1U35 A;  3KUY A;  3AYW B;  3REJ D;  3X1T A;  1P3G D;  3AV1 B;  2JCH A;  2NQB D;  3W99 A;  3UTA D;  4J8U D;  1ZLA B;  3AN2 D;  3AZE B;  2IO5 C;  1P3O A;  3W98 A;  4WU8 C;  1P3M D;  3C1C D;  3B6G A;  4YS3 D;  3WA9 D;  3AZM B;  4X23 A;  4YM6 D;  3NQU B;  4J8W D;  3REI A;  3WTP A;  2ARO A;  5AVC B;  5E5A A;  2Y2L A;  3UT9 A;  3X1T C;  2F8N B;  1P3I A;  2Y2G A;  3AZF B;  2Y2P A;  5GT3 D;  5JRG C;  5KDM A;  5B33 A;  1F1E A;  3AZN A;  1P3O C;  3W98 C;  5B0Z A;  3B6G C;  5B24 B;  4X23 C;  3EPL A;  3MGS D;  3AZJ D;  2ARO C;  3LJA D;  2CV5 C;  5CPK B;  4E44 A;  3REL C;  3O62 A;  4KUD A;  3VH6 A;  4HGA C;  5GT0 C;  4H9P B;  2NZD B;  5AV6 D;  5AV5 C;  5DNM D;  3AZI B;  4R8P B;  5B0Y A;  2FFF B;  4KGC A;  1P3A D;  4E45 A;  5AVB D;  5C3I C;  5B33 C;  3LEL A;  2XD5 A;  2DF4 C;  4H9S A;  1S32 B;  5B1M C;  5B40 A;  5AV9 C;  1F66 C;  1WWI A;  1P34 D;  4WU9 C;  1P3L A;  3LZ1 C;  2HUE C;  1KX4 C;  3C1B D;  1M18 D;  4XUJ C;  4KGC C;  5B0Y C;  1U35 B;  1KX3 C;  3KUY B;  3X1T B;  1HQ3 A;  3V9R A;  3LEL C;  2ZM5 A;  3UTB D;  3W99 B;  4H9S C;  2HIO C;  1EQZ A;  1R4V A;  1P3O B;  1KU5 A;  1B6W A;  3W98 B;  1ID3 C;  5B32 D;  3H0M C;  2PYO D;  3B6G B;  4X23 B;  1WWS A;  1HTA A;  2Y2M A;  3WTP B;  2ARO B;  1P3L C;  5AV8 A;  2ZY4 A;  5GSU A;  4LD9 D;  4HGA B;  1P3F D;  3AZL A;  3WKJ C;  5F99 D;  4G91 C;  4ZBJ C;  5AV5 B;  3MNN D;  1P3I B;  5C3I B;  5KDM B;  3AZH A;  5B33 B;  3AZN B;  3MGR A;  3MGQ C;  5G49 B;  5B0Z B;  1TAF A;  2Y2O A;  1TZY D;  3EPK A;  5B2J C;  5B1L A;  5AV9 B;  3AZG D;  5AV8 C;  2FJ7 A;  4UPK A;  5GSU C;  3O62 B;  4KUD B;  5CP6 A;  3MVD A;  2JSS A;  5B2I C;  1P3P D;  1M19 C;  2Y2J A;  1KX5 A;  3MGP A;  4KGC B;  5B0Y B;  3AYW D;  3REK D;  3AV1 D;  3AZH C;  3LEL B;  5CPJ D;  3MGR C;  4NE6 A;  4H9R B;  3AZE D;  3B6F A;  3R45 A;  5B31 A;  4XZQ C;  5B1L C;  5B40 B;  4CSR A;  3AZM D;  3VH5 A;  2RVQ C;  3EPH A;  1P3L B;  5CP6 C;  3MVD C;  2BYK A;  1P3K C;  1M1A C;  3LZ0 C;  3MGP C;  3X1U D;  3WKJ B;  4WU8 A;  2F8N D;  3REH A;  3FDD A;  3H0L C;  3V9R B;  3AZF D;  5BT1 D;  3KXB D;  1EQZ B;  4Z66 D;  3KWQ C;  3B6F C;  4DQY B;  3AFA D;  2NQB A;  3A1I A;  4JJN C;  3UTA A;  4J8U A;  5CPI D;  4QLC C;  4ZUX C;  3C1C A;  1Z2C B;  5AV8 B;  3WA9 A;  5CPK D;  4YM6 A;  4J8W A;  2W8S A;  5GSU B;  5JRG A;  3A1K A;  5GXQ C;  5B32 G;  3AZL B;  2NZD D;  3TU4 D;  3W97 C;  3AZK D;  3REH C;  3AZI D;  4R8P D;  2BG1 A;  3W96 D;  3AZH B;  3REJ C;  1P3G C;  3MGR B;  2CV5 A;  2NQB C;  1TAF B;  3REL A;  4J8X D;  4DRA A;  3UTA C;  4J8U C;  5GT0 A;  3AN2 C;  1S32 D;  2LY8 A;  2Y2Q A;  5B1L B;  5AV5 A;  4AWL C;  1P3M C;  3C1C C;  1PZR A;  4YS3 C;  2FJ7 B;  3WA9 C;  4YM6 C;  4J8W C;  5CP6 B;  3MVD B;  5G49 A;  3LZ0 B;  3A6N A;  1KX5 B;  3MGP B;  1U35 D;  3KUY D;  5B1M A;  5AV9 A;  1F66 A;  3KFU G;  3W99 D;  5BNX A;  4WU9 A;  5GT3 C;  2YFW A;  3B6F B;  3R45 B;  5B31 B;  3LZ1 A;  4EO5 B;  3EPJ A;  1KX4 A;  3IP4 C;  4CSR B;  4XUJ A;  1KX3 A;  3REI D;  3WTP D;  2RIQ A;  5E5A D;  3MGS C;  3AZJ C;  4WJ3 C;  2BYK B;  1BH8 A;  4H9R A;  2HIO A;  3LJA C;  3A6N C;  3UT9 D;  2IO5 B;  4WU8 B;  3WAA A;  1ID3 A;  1P3I D;  3REH B;  5AV6 C;  5DNM C;  4H9Q B;  3X1S D;  2YFV A;  3REJ B;  3AZN D;  5AVB C;  5B0Z D;  2NQB B;  3B0B A;  3UTA B;  4J8U B;  2F8N G;  3WKJ A;  3C1C B;  2J8P A;  4YS3 B;  3WA9 B;  4CAY A;  2UWX A;  4YM6 B;  5JRG B;  3O62 D;  4J8W B;  1P34 C;  4KUD D;  4Z2M G;  3MGQ A;  3WAA C;  4KGC D;  3C1B C;  5B2J A;  3MNN A;  1AOI A;  3UTB C;  2CV5 B;  3REL B;  3AV2 D;  5GT0 B;  5B2I A;  5B40 D;  1M19 A;  5B32 C;  2PYO C;  1TZY A;  4G92 C;  3F6T A;  4H9N A;  3AZG A;  3A6N B;  4LD9 C;  1P3F C;  4Z5T D;  4XZQ A;  5DNN D;  5F99 C;  5B1M B;  3MNN C;  1AOI C;  1HQ3 D;  5DNM B;  3AZG B;  1F66 B;  3X1V D;  5BNX B;  4WV4 B;  4J8V D;  4WU9 B;  2YFW B;  1EQZ D;  5AY8 A;  1M1A A;  1P3K A;  3LZ1 B;  2HUE B;  1KX4 B;  3LZ0 A;  2VQR A;  4XUJ B;  1TZY C;  3WTP E;  1P3B A;  1Q9C A;  1KX3 B;  3AZG C;  1BH8 B;  2HIO B;  1ZLA D;  3KWQ A;  3AZL D;  3WAA B;  1ID3 B;  1P3P C;  4JJN A;  4QLC A;  3C1B B;  2YFV B;  3B0D C;  3X1U A;  4ZUX A;  2L5A A;  3REK C;  3AYW C;  3AV1 C;  5AVC D;  5AY8 C;  5CPJ C;  3KXB A;  4Z66 A;  5GXQ A;  5B1L D;  3AFA A;  4G91 B;  3P5J B;  4ZBJ B;  3W97 A;  1P3B C;  5CPI A;  5BNV A;  2PYO B;  4H9Q A;  2FJ7 D;  1A7W A;  4CAY B;  3AZM C;  2Y2N A;  3REJ A;  1P3G A;  2ZY2 A;  3MGQ B;  2F2A C;  1KX5 D;  2ZY3 A;  3AN2 A;  5B24 D;  5B2J B;  3X1U C;  5F99 B;  3MNN B;  3TU4 A;  3AZK A;  1P3M A;  1AOI B;  2ZY5 A;  3AZF C;  4YS3 A;  3W96 A;  3KXB C;  5B31 D;  4Z66 C;  5B2I B;  3AFA C;  1M19 B;  2BYM A;  4J8X A;  5CPI C;  1TZY B;  1N1J A;  1BFM A;  1T3U A;  4H9N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...