3RELB

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relB00
3WKJD 5B24C 1M18D 3WA9D 3X1SA 3AV1D 5F99A 3AZLC 3MVDA 2AROB 1AOID 3NQJB 3W96A 3W98D 4J8XA 3REKD 1M19B 5B0YB 1KX3A 3WTPB 5JA4A 1KX5B 4CSRA 3AZKD 3AZLA 3WKJB 2YFVB 1M18B 3WA9B 5B24A 1AOIB 4WU9C 4Z2MH 5B32D 4WNNA 4ZUXC 5GXQD 1S32C 5AV8C 3AFAD 5E5AB 3AYWD 3RELD 2FJ7C 1P3KB 3VH6A 3C1CC 1HQ3D 4X23C 5FUGB 5B1MD 1P3BD 3REIC 5GXQB 5B33B 4WU9A 3B6FD 4ZUXA 3AFAB 1S32A 5AV8A 4KHAA 1P3LD 2F8ND 3R45A 4ZBJB 4HGAB 2NQBD 4UUZA 4LD9B 2HIOD 1ZLAB 2FJ7A 5B0ZB 3AV2C 1P3BB 3C1CA 4X23A 4NE5A 3MGRC 3B6FB 1WWIA 4G92C 3REIA 3B6GB 3X1TC 1JFIA 2PYOD 3AZMC 2F8NB 3MGPD 3AZIC 5B31D 1P3MC 3AZED 3KUYC 4KUDD 5BNVB 4DRBA 5KDMB 3AZHD 1P34D 4NE6A 3AV2A 2YFWB 1P3PD 3UTAC 3VH5T 3MGRA 4EO5C 5C3IB 3AN2B 3NQUB 5GSUD 5CPJC 5B31B 3X1TA 3AZEB 3AZMA 4CAYB 3AZIA 4KUDB 3AZHB 1P3MA 3AZJC 3LJAC 3TU4C 3KUYA 1P3PB 3LZ0C 1EQZB 1TZYC 2HUEC 3UTAA 3W97D 3X1VD 5GSUB 4XUJC 3V9RB 5AVCD 4J8WD 4H9OA 5CPJA 2CV5C 3O62B 2AROC 4WV4B 3AZJA 3LJAA 3REHC 3TU4A 1U35B 3LZ0A 1M19C 3WTPC 4J8VD 1KX5C 5BNXB 5AV5B 5B2IC 1TZYA 4JJND 4XUJA 5AVCB 4J8WB 2CWEA 3B0BA 3X1UC 1AOIC 2CV5A 1M1AB 5CP6D 2AROA 3AZGC 4Z5TC 5CPID 3NQJA 4J8VB 3REHA 1P3GD 1M19A 3WTPA 4JJNB 3REJD 1KX5A 5E5AC 5B2IA 4R8PD 1P3KC 2YFVA 4M6BA 3AZND 3X1UA 5AV9D 1AOIA 1F66D 5B40D 5B33C 4H9NB 3AZGA 4Z5TA 3KWQD 1P3GB 5B1LD 4QLCD 1P3OC 5G49B 4XZQD 3KXBC 3REJB 4R8PB 1KU5A 3W99C 3MNND 4ZBJC 5E5AA 3AZNB 3AZFD 5GT3B 4LD9C 1ZLAC 1P3KA 5B0ZC 1F66B 5B40B 1BH9A 4QLCB 5B33A 4WU8C 3B6GC 1P3IC 5GT0D 1P3OA 3VH5A 3MNNB 3KXBA 3AZFB 4KGCD 3W99A 1KX4D 4LD9A 1ZLAA 5B0ZA 3AV1B 5JRGD 2IO5C 3UTBD 1KX5D 5C3IC 3AN2C 3LELD 4WU8A 3W98B 3REKB 3B6GA 1P3IA 3LZ1D 4KGCB 1KX4B 3AZKB 5CPKD 3C1BC 4YS3C 1P3AD 5BNVA 5KDMA 5JRGB 4Z66C 1EQZC 2YFWA 3LELB 5B32B 3MGQD 1P3FC 5DNMC 4DRAA 3B0DB 5BO0A 1ID3D 5AV6D 3LZ1B 3AN2A 3UT9D 3WAAD 5AY8D 4H9QB 3O62C 5BT1D 1P3AB 3AYWB 3RELB 5F99D 3C1BA 3MVDD 1HQ3B 4YS3A 1U35C 4Z66A 1EQZA 3W96D 5B1MB 5AV5C 4H9RB 4J8XD 1ID3B 5AV6B 1KX3D 3UT9B 3WAAB 1P3FA 5DNMA 3V9RA 3AZLD 1P3LB 3O62A 2RVQC 1M1AC 5DNND 5B24D 2NQBB 5BS7C 4AWLB 2HIOB 3W96B 5AVBC 2F8NG 1U35A 5B2JD 5BNXA 5AV5A 3A6NC 4YM6C 4CSRB 3AZLB 5AVCA 2PYOB 3MGPB 2LY8A 5DNNB 1M1AA 1R4VA 1P34B 4J8UD 5B31G 5BS7A 4H9SC 5B2JB 5AVBA 4WU9D 2L5AA 5CHLB 4ZUXD 1BH8B 3A6NA 3B0CW 3AZNC 1N1JA 4YM6A 1S32D 5GT3C 5AV8D 2FJ7D 3C1CD 4J8UB 4H9NA 4X23D 1F1EA 4H9SA 3REID 5G49A 3MNNC 5B0YC 3MGSD 4Z2MG 3X1VB 5AV8B 4KHAB 1S32B 2F8NK 3W97B 3AZNA 3WKJC 1B6WA 5GT3A 4UUZB 1M18C 2FJ7B 3WA9C 3AV1C 3C1CB 4X23B 3AV2D 3W98C 3REIB 4G91B 3MGRD 3REKC 3MGSB 4KGCC 1JFIB 3MNNA 5B0YA 3AZKC 3X1TD 3WKJA 3AZID 1P3MD 1M18A 3WA9A 1H3OB 3VH6W 3AV1A 3KUYD 5CP6B 5B32C 3LELC 5CPIB 3B0DC 5GXQC 3UTAD 3W98A 3REKA 3AFAC 4KGCA 3KSYA 3AYWC 3AZKA 3RELC 5CPJD 1P3MB 4HGAC 1HQ3C 5B1MC 1P3BC 5AV9B 3AZJD 3LJAD 3TU4D 5FUGA 3LZ0D 1A7WA 5B32A 3LELA 3UTAB 3B6FC 3KWQB 1TZYD 5B1LB 5GXQA 4EO5B 4XZQB 5BT1C 4XUJD 1P3LC 3AFAA 5CPJB 4H9PB 2NQBC 3AYWA 4AWLC 1TAFB 2HIOC 3RELA 2CV5D 2NZDD 2AROD 1HQ3A 3AZJB 5B1MA 1P3BA 1B67A 3REHD 3B6FA 3WAAA 2BYMB 5GT0B 5B2ID 4XUJB 2PYOC 3MGPC 5B31C 5DNNC 3AZEC 1P3LA 4WZSB 2CV5B 2F8NA 2NZDB 4KUDC 3X1UD 3AZHC 1P34C 2NQBA 2HIOA 5B2JC 1P3PC 3AZGD 4Z5TD 3REHB 3UTBB 2JSSA 5B2IB 5GSUC 2BYKB 5E5AD 2PYOA 3NQUA 5B32G 3MGPA 1P3KD 5B31A 5DNNA 3X1UB 4J8UC 3AZEA 5CPKB 4CAYA 4KUDA 3X1SD 3AZGB 4Z5TB 3AZHA 1P34A 5B2JA 5B33D 1P3PA 3W97C 3X1VC 3MGQB 1BH8A 1P3OD 3KXBD 5GSUA 5AVCC 5AY8B 3W99D 4J8WC 4LD9D 1ZLAD 5B0ZD 1BH9B 3X1SB 5F99B 4J8UA 3MVDB 4G91C 4J8VC 3MGSC 1BFMA 4WU8D 4J8XB 1P3OB 3KXBB 4JJNC 3B6GD 3W97A 3X1VA 5JA4B 1P3ID 1KX3B 3W99B 4J8WA 5CP6C 5CPIC 5B24B 3B0CT 4WNNB 4WU8B 1P3GC 4J8VA 3MGSA 1P3IB 3REJC 3AN2D 4R8PC 4JJNA 4NE3A 1ULYA 3C1BD 5AV9C 1H3OA 1F66C 4YS3D 5B40C 4Z66D 5CP6A 1EQZD 5CPIA 2IO5B 3KWQC 5B1LC 4QLCC 5BO0B 4XZQC 4WU9B 4NFTA 1P3FD 5DNMD 1P3GA 4ZUXB 3REJA 3VH5W 4R8PA 3AZFC 1HTAA 3O62D 3R45B 3C1BB 4YS3B 4Z66B 5AV9A 1F66A 5B40A 1U35D 5AV5D 5GT0C 3KWQA 1P3FB 5B1LA 4QLCA 5DNMB 4XZQA 4H9PA 2NZDC 1KX4C 3VH6T 3WTPE 3AZFA 1TAFA 3AZMD 2RVQD 1M1AD 5JRGC 3UTBC 5AVBD 3AV2B 3MGRB 2BYMA 3A6ND 5GT0A 3LZ1C 4YM6D 4G92B 5CPKC 3X1TB 3AZMB 2NZDA 1KX4A 1P3AC 3AZIB 5AVBB 5JRGA 3KUYB 3MGQC 1WWSA 3UTBA 1ID3C 3A6NB 5AV6C 1N1JB 3WAAC 4YM6B 3UT9C 2BYKA 5AY8C 3LZ1A 5GT3D 1Q9CA 4H9QA 4H9OB 3X1SC 2F8NH 5F99C 5CPKA 3MVDC 1P3AA 3W96C 4J8XC 3LJAB 3TU4B 3LZ0B 1KX3C 4H9RA 4E45A 3MGQA 1TZYB 1ID3A 1M19D 5AV6A 2HUEB 3WTPD 5B0YD 3UT9A 5AY8A 4E44A
chains in the Genus database with same CATH superfamily
3WKJD 5B24C 1M18D 3WA9D 3X1SA 3AV1D 5F99A 3MVDA 2AROB 1AOID 3NQJB 3W96A 3W98D 4J8XA 3REKD 2FFFB 1M19B 5B0YB 1KX3A 3WTPB 5JA4A 1KX5B 4CSRA 3AZKD 3AZLA 3FDDA 3WKJB 2YFVB 4WJ3C 1M18B 3WA9B 5B24A 1AOIB 4WU9C 4Z2MH 5B32D 4WNNA 4ZUXC 5GXQD 1S32C 5AV8C 3AFAD 5E5AB 2VQRA 3H0LC 3AYWD 3RELD 2FJ7C 1P3KB 3VH6A 3C1CC 1HQ3D 4X23C 5FUGB 5B1MD 1P3BD 3REIC 5GXQB 5B33B 4WU9A 3B6FD 4ZUXA 3AFAB 1S32A 5AV8A 4KHAA 1P3LD 2F8ND 3R45A 4ZBJB 4HGAB 2NQBD 4UUZA 4LD9B 2HIOD 1ZLAB 2FJ7A 5B0ZB 3AV2C 1P3BB 3C1CA 2BG1A 4X23A 4NE5A 3MGRC 3B6FB 2Y2HA 1WWIA 4G92C 3REIA 3B6GB 3X1TC 1JFIA 3EPKA 2PYOD 3AZMC 2F8NB 3MGPD 3AZIC 5B31D 2ZY4A 1P3MC 3AZED 3KUYC 4KUDD 5BNVB 4DRBA 5KDMB 3AZHD 1P34D 4NE6A 3AV2A 2YFWB 1P3PD 3UTAC 3VH5T 3MGRA 4EO5C 5C3IB 3AN2B 3NQUB 5GSUD 5CPJC 5B31B 3X1TA 3AZEB 3AZMA 4CAYB 3AZIA 4KUDB 3AZHB 1P3MA 3AZJC 3LJAC 3TU4C 3KUYA 1P3PB 3LZ0C 1EQZB 1TZYC 2ZM5A 2HUEC 3UTAA 3W97D 3X1VD 5GSUB 2Y2NA 4XUJC 3V9RB 5AVCD 2JCHA 4H9OA 4J8WD 5CPJA 2CV5C 3O62B 2AROC 4WV4B 3AZJA 3LJAA 3REHC 3TU4A 1U35B 3LZ0A 1M19C 3WTPC 4J8VD 1KX5C 5BNXB 5AV5B 5B2IC 1TZYA 4JJND 4XUJA 5AVCB 4J8WB 2CWEA 3B0BA 2JE5A 3X1UC 1AOIC 3AL0C 2CV5A 1M1AB 5CP6D 2AROA 3AZGC 4Z5TC 5CPID 3NQJA 4J8VB 3REHA 1P3GD 1M19A 3WTPA 4JJNB 3REJD 1KX5A 5E5AC 5B2IA 4R8PD 2W8SA 2YFVA 1P3KC 4M6BA 3AZND 3X1UA 5AV9D 1AOIA 2DQNC 1F66D 5B40D 5B33C 4H9NB 2Y2LA 2Y2IA 3AZGA 4Z5TA 3KWQD 1P3GB 5B1LD 4QLCD 1P3OC 5G49B 4XZQD 3KXBC 3REJB 4R8PB 1KU5A 3W99C 3MNND 4ZBJC 5E5AA 3AZNB 3AZFD 5GT3B 4LD9C 1ZLAC 1P3KA 5B0ZC 2Y2OA 1F66B 5B40B 1BH9A 4QLCB 5B33A 4WU8C 3B6GC 1P3IC 5GT0D 1P3OA 3VH5A 3MNNB 3KXBA 3AZFB 4KGCD 3W99A 1KX4D 1Z2CB 4LD9A 2Y2KA 1ZLAA 5B0ZA 3AV1B 5JRGD 2G5IC 3EG5B 2IO5C 3UTBD 1KX5D 3KFUG 5C3IC 3AN2C 3LELD 4WU8A 3W98B 3REKB 3B6GA 1P3IA 3LZ1D 4KGCB 1KX4B 3AZKB 5CPKD 3C1BC 4YS3C 1P3AD 5BNVA 5KDMA 5JRGB 4Z66C 1EQZC 4UPKA 3H0RC 1PZRA 2YFWA 3LELB 5B32B 3MGQD 1P3FC 5DNMC 4DRAA 3B0DB 5BO0A 1ID3D 5AV6D 3LZ1B 3AN2A 3UT9D 3WAAD 5AY8D 4H9QB 3O62C 5BT1D 2DF4C 3AYWB 1P3AB 3RELB 5F99D 3C1BA 3MVDD 1HQ3B 4YS3A 1U35C 4Z66A 1EQZA 3W96D 5B1MB 5AV5C 4H9RB 4J8XD 1ID3B 5AV6B 1KX3D 3UT9B 3WAAB 1P3FA 5DNMA 3V9RA 1T3UA 3AZLD 1P3LB 3O62A 2RVQC 1M1AC 5DNND 5B24D 2NQBB 5BS7C 4AWLB 2HIOB 3W96B 5AVBC 2F8NG 1U35A 5B2JD 5BNXA 5AV5A 3A6NC 3F6TA 4YM6C 4CSRB 3AZLB 5AVCA 2PYOB 3MGPB 3P5JB 2LY8A 5DNNB 1M1AA 1R4VA 1P34B 4J8UD 5B31G 5BS7A 4H9SC 2Y2PA 5B2JB 5AVBA 4WU9D 2L5AA 5CHLB 4ZUXD 1BH8B 3A6NA 3B0CW 3AZNC 1N1JA 4YM6A 1S32D 5GT3C 5AV8D 2Y2GA 2FJ7D 3C1CD 4J8UB 4H9NA 4X23D 1F1EA 4H9SA 3REID 5G49A 3MNNC 5B0YC 3MGSD 2J8PA 4Z2MG 5AV8B 4KHAB 3X1VB 1S32B 2F8NK 3W97B 3AZNA 3WKJC 1B6WA 5GT3A 2ZY2A 4UUZB 1M18C 2FJ7B 3WA9C 3AV1C 3C1CB 4X23B 3AV2D 3W98C 3REIB 4G91B 3MGRD 3REKC 3MGSB 4KGCC 1JFIB 3MNNA 2XD5A 5B0YA 3AZKC 3X1TD 3WKJA 3AZID 1P3MD 1M18A 2Y2QA 3WA9A 1H3OB 3VH6W 3AV1A 3KUYD 5CP6B 5B32C 3LELC 5CPIB 3B0DC 5GXQC 3UTAD 3W98A 3IP4C 3REKA 3AFAC 4KGCA 3KSYA 3AYWC 3AZKA 3RELC 5CPJD 1P3MB 4HGAC 1HQ3C 5B1MC 1P3BC 5AV9B 3AZJD 3LJAD 3TU4D 5FUGA 3LZ0D 1A7WA 5B32A 3LELA 3UTAB 3B6FC 3KWQB 1TZYD 5B1LB 5GXQA 4EO5B 4XZQB 5BT1C 4XUJD 1P3LC 3AFAA 5CPJB 4H9PB 2NQBC 3AYWA 4AWLC 1TAFB 2HIOC 3RELA 2CV5D 2NZDD 2AROD 1HQ3A 3AZJB 5B1MA 1P3BA 1B67A 3REHD 3B6FA 3WAAA 2BYMB 5GT0B 5B2ID 4XUJB 2PYOC 3MGPC 5B31C 3A1IA 5DNNC 3AZEC 1P3LA 4WZSB 2CV5B 2F8NA 2NZDB 4KUDC 3A1KA 3X1UD 3AZHC 1P34C 2NQBA 2HIOA 5B2JC 1P3PC 3AZGD 4Z5TD 3REHB 3UTBB 2JSSA 5B2IB 3EPJA 5GSUC 2BYKB 5E5AD 2PYOA 3NQUA 2XD1A 5B32G 3MGPA 1P3KD 5B31A 5DNNA 3X1UB 4J8UC 3AZEA 5CPKB 4CAYA 4KUDA 3H0MC 3X1SD 4Z5TB 3AZGB 3AZHA 1P34A 1W2EA 5B2JA 5B33D 1P3PA 3W97C 3X1VC 3MGQB 1BH8A 1P3OD 3KXBD 5GSUA 5AVCC 5AY8B 3W99D 4J8WC 2Y2JA 4LD9D 1ZLAD 5B0ZD 1BH9B 3X1SB 5F99B 4J8UA 3MVDB 4G91C 4J8VC 3MGSC 1BFMA 4WU8D 4J8XB 1P3OB 3KXBB 4JJNC 3B6GD 3W97A 3X1VA 5JA4B 1P3ID 1KX3B 3W99B 4J8WA 5CP6C 5CPIC 5B24B 3B0CT 4WNNB 4WU8B 1P3GC 2F2AC 4J8VA 3MGSA 1P3IB 3REJC 3AN2D 4R8PC 4JJNA 4NE3A 1ULYA 3EPHA 3C1BD 5AV9C 1H3OA 1F66C 4YS3D 5B40C 4Z66D 5CP6A 1EQZD 5CPIA 2IO5B 3KWQC 5B1LC 4QLCC 5BO0B 4XZQC 4WU9B 4NFTA 1P3FD 5DNMD 1P3GA 4ZUXB 3REJA 3VH5W 4R8PA 3AZFC 1HTAA 3O62D 3R45B 3C1BB 4YS3B 4Z66B 2UWXA 5AV9A 1F66A 5B40A 1U35D 5AV5D 5GT0C 3KWQA 1P3FB 5B1LA 4QLCA 5DNMB 4XZQA 2Y2MA 4H9PA 2NZDC 1KX4C 3VH6T 3WTPE 3AZFA 1TAFA 3AZMD 2RVQD 1M1AD 5JRGC 4DQYB 3UTBC 5AVBD 3AV2B 2ZY3A 3MGRB 2BYMA 3A6ND 5GT0A 3LZ1C 4YM6D 4G92B 5CPKC 3X1TB 3AZMB 2NZDA 1KX4A 1P3AC 3EPLA 3AZIB 5AVBB 5JRGA 3KUYB 3MGQC 1WWSA 3UTBA 1ID3C 3A6NB 5AV6C 2ZY5A 1N1JB 3WAAC 4YM6B 3UT9C 2BYKA 5AY8C 2G5HC 3LZ1A 5GT3D 1Q9CA 4H9QA 4H9OB 3X1SC 2F8NH 5F99C 5CPKA 3MVDC 2RIQA 1P3AA 3WTPD 3W96C 4J8XC 3LJAB 3TU4B 3LZ0B 1KX3C 4H9RA 4E45A 3MGQA 1TZYB 1ID3A 1M19D 5AV6A 2HUEB 5B0YD 3AZLC 3UT9A 5AY8A 4E44A
chains in the Genus database with same CATH topology
3WKJD 5B24C 1M18D 3WA9D 3X1SA 3AV1D 5F99A 3MVDA 2AROB 1AOID 3NQJB 3W96A 3W98D 4J8XA 3REKD 2FFFB 1M19B 5B0YB 1KX3A 3WTPB 5JA4A 1KX5B 4CSRA 3AZKD 3AZLA 3FDDA 3WKJB 2YFVB 4WJ3C 1M18B 3WA9B 5B24A 1AOIB 4WU9C 4Z2MH 5B32D 4WNNA 4ZUXC 5GXQD 1S32C 5AV8C 3AFAD 5E5AB 2VQRA 3H0LC 3AYWD 3RELD 2FJ7C 1P3KB 3VH6A 3C1CC 1HQ3D 4X23C 5FUGB 5B1MD 1P3BD 3REIC 5GXQB 5B33B 4WU9A 3B6FD 4ZUXA 3AFAB 1S32A 5AV8A 4KHAA 1P3LD 2F8ND 3R45A 4ZBJB 4HGAB 2NQBD 4UUZA 4LD9B 2HIOD 1ZLAB 2FJ7A 5B0ZB 3AV2C 1P3BB 3C1CA 2BG1A 4X23A 4NE5A 3MGRC 3B6FB 2Y2HA 1WWIA 4G92C 3REIA 3B6GB 3X1TC 1JFIA 3EPKA 2PYOD 3AZMC 2F8NB 3MGPD 3AZIC 5B31D 2ZY4A 1P3MC 3AZED 3KUYC 4KUDD 5BNVB 4DRBA 5KDMB 3AZHD 1P34D 4NE6A 3AV2A 2YFWB 1P3PD 3UTAC 3VH5T 3MGRA 4EO5C 5C3IB 3AN2B 3NQUB 5GSUD 5CPJC 5B31B 3X1TA 3AZEB 3AZMA 4CAYB 3AZIA 4KUDB 3AZHB 1P3MA 3AZJC 3LJAC 3TU4C 3KUYA 1P3PB 3LZ0C 1EQZB 1TZYC 2ZM5A 2HUEC 3UTAA 3W97D 3X1VD 5GSUB 2Y2NA 4XUJC 3V9RB 5AVCD 2JCHA 4H9OA 4J8WD 5CPJA 2CV5C 3O62B 2AROC 4WV4B 3AZJA 3LJAA 3REHC 3TU4A 1U35B 3LZ0A 1M19C 3WTPC 4J8VD 1KX5C 5BNXB 5AV5B 5B2IC 1TZYA 4JJND 4XUJA 5AVCB 4J8WB 2CWEA 3B0BA 2JE5A 3X1UC 1AOIC 3AL0C 2CV5A 1M1AB 5CP6D 2AROA 3AZGC 4Z5TC 5CPID 3NQJA 4J8VB 3REHA 1P3GD 1M19A 3WTPA 4JJNB 3REJD 1KX5A 5E5AC 5B2IA 4R8PD 2W8SA 2YFVA 1P3KC 4M6BA 3AZND 3X1UA 5AV9D 1AOIA 2DQNC 1F66D 5B40D 5B33C 4H9NB 2Y2LA 2Y2IA 3AZGA 4Z5TA 3KWQD 1P3GB 5B1LD 4QLCD 1P3OC 5G49B 4XZQD 3KXBC 3REJB 4R8PB 1KU5A 3W99C 3MNND 4ZBJC 5E5AA 3AZNB 3AZFD 5GT3B 4LD9C 1ZLAC 1P3KA 5B0ZC 2Y2OA 1F66B 5B40B 1BH9A 4QLCB 5B33A 4WU8C 3B6GC 1P3IC 5GT0D 1P3OA 3VH5A 3MNNB 3KXBA 3AZFB 4KGCD 3W99A 1KX4D 1Z2CB 4LD9A 2Y2KA 1ZLAA 5B0ZA 3AV1B 5JRGD 2G5IC 3EG5B 2IO5C 3UTBD 1KX5D 3KFUG 5C3IC 3AN2C 3LELD 4WU8A 3W98B 3REKB 3B6GA 1P3IA 3LZ1D 4KGCB 1KX4B 3AZKB 5CPKD 3C1BC 4YS3C 1P3AD 5BNVA 5KDMA 5JRGB 4Z66C 1EQZC 4UPKA 3H0RC 1PZRA 2YFWA 3LELB 5B32B 3MGQD 1P3FC 5DNMC 4DRAA 3B0DB 5BO0A 1ID3D 5AV6D 3LZ1B 3AN2A 3UT9D 3WAAD 5AY8D 4H9QB 3O62C 5BT1D 2DF4C 3AYWB 1P3AB 3RELB 5F99D 3C1BA 3MVDD 1HQ3B 4YS3A 1U35C 4Z66A 1EQZA 3W96D 5B1MB 5AV5C 4H9RB 4J8XD 1ID3B 5AV6B 1KX3D 3UT9B 3WAAB 1P3FA 5DNMA 3V9RA 1T3UA 3AZLD 1P3LB 3O62A 2RVQC 1M1AC 5DNND 5B24D 2NQBB 5BS7C 4AWLB 2HIOB 3W96B 5AVBC 2F8NG 1U35A 5B2JD 5BNXA 5AV5A 3A6NC 3F6TA 4YM6C 4CSRB 3AZLB 5AVCA 2PYOB 3MGPB 3P5JB 2LY8A 5DNNB 1M1AA 1R4VA 1P34B 4J8UD 5B31G 5BS7A 4H9SC 2Y2PA 5B2JB 5AVBA 4WU9D 2L5AA 5CHLB 4ZUXD 1BH8B 3A6NA 3B0CW 3AZNC 1N1JA 4YM6A 1S32D 5GT3C 5AV8D 2Y2GA 2FJ7D 3C1CD 4J8UB 4H9NA 4X23D 1F1EA 4H9SA 3REID 5G49A 3MNNC 5B0YC 3MGSD 2J8PA 4Z2MG 5AV8B 4KHAB 3X1VB 1S32B 2F8NK 3W97B 3AZNA 3WKJC 1B6WA 5GT3A 2ZY2A 4UUZB 1M18C 2FJ7B 3WA9C 3AV1C 3C1CB 4X23B 3AV2D 3W98C 3REIB 4G91B 3MGRD 3REKC 3MGSB 4KGCC 1JFIB 3MNNA 2XD5A 5B0YA 3AZKC 3X1TD 3WKJA 3AZID 1P3MD 1M18A 2Y2QA 3WA9A 1H3OB 3VH6W 3AV1A 3KUYD 5CP6B 5B32C 3LELC 5CPIB 3B0DC 5GXQC 3UTAD 3W98A 3IP4C 3REKA 3AFAC 4KGCA 3KSYA 3AYWC 3AZKA 3RELC 5CPJD 1P3MB 4HGAC 1HQ3C 5B1MC 1P3BC 5AV9B 3AZJD 3LJAD 3TU4D 5FUGA 3LZ0D 1A7WA 5B32A 3LELA 3UTAB 3B6FC 3KWQB 1TZYD 5B1LB 5GXQA 4EO5B 4XZQB 5BT1C 4XUJD 1P3LC 3AFAA 5CPJB 4H9PB 2NQBC 3AYWA 4AWLC 1TAFB 2HIOC 3RELA 2CV5D 2NZDD 2AROD 1HQ3A 3AZJB 5B1MA 1P3BA 1B67A 3REHD 3B6FA 3WAAA 2BYMB 5GT0B 5B2ID 4XUJB 2PYOC 3MGPC 5B31C 3A1IA 5DNNC 3AZEC 1P3LA 4WZSB 2CV5B 2F8NA 2NZDB 4KUDC 3A1KA 3X1UD 3AZHC 1P34C 2NQBA 2HIOA 5B2JC 1P3PC 3AZGD 4Z5TD 3REHB 3UTBB 2JSSA 5B2IB 3EPJA 5GSUC 2BYKB 5E5AD 2PYOA 3NQUA 2XD1A 5B32G 3MGPA 1P3KD 5B31A 5DNNA 3X1UB 4J8UC 3AZEA 5CPKB 4CAYA 4KUDA 3H0MC 3X1SD 4Z5TB 3AZGB 3AZHA 1P34A 1W2EA 5B2JA 5B33D 1P3PA 3W97C 3X1VC 3MGQB 1BH8A 1P3OD 3KXBD 5GSUA 5AVCC 5AY8B 3W99D 4J8WC 2Y2JA 4LD9D 1ZLAD 5B0ZD 1BH9B 3X1SB 5F99B 4J8UA 3MVDB 4G91C 4J8VC 3MGSC 1BFMA 4WU8D 4J8XB 1P3OB 3KXBB 4JJNC 3B6GD 3W97A 3X1VA 5JA4B 1P3ID 1KX3B 3W99B 4J8WA 5CP6C 5CPIC 5B24B 3B0CT 4WNNB 4WU8B 1P3GC 2F2AC 4J8VA 3MGSA 1P3IB 3REJC 3AN2D 4R8PC 4JJNA 4NE3A 1ULYA 3EPHA 3C1BD 5AV9C 1H3OA 1F66C 4YS3D 5B40C 4Z66D 5CP6A 1EQZD 5CPIA 2IO5B 3KWQC 5B1LC 4QLCC 5BO0B 4XZQC 4WU9B 4NFTA 1P3FD 5DNMD 1P3GA 4ZUXB 3REJA 3VH5W 4R8PA 3AZFC 1HTAA 3O62D 3R45B 3C1BB 4YS3B 4Z66B 2UWXA 5AV9A 1F66A 5B40A 1U35D 5AV5D 5GT0C 3KWQA 1P3FB 5B1LA 4QLCA 5DNMB 4XZQA 2Y2MA 4H9PA 2NZDC 1KX4C 3VH6T 3WTPE 3AZFA 1TAFA 3AZMD 2RVQD 1M1AD 5JRGC 4DQYB 3UTBC 5AVBD 3AV2B 2ZY3A 3MGRB 2BYMA 3A6ND 5GT0A 3LZ1C 4YM6D 4G92B 5CPKC 3X1TB 3AZMB 2NZDA 1KX4A 1P3AC 3EPLA 3AZIB 5AVBB 5JRGA 3KUYB 3MGQC 1WWSA 3UTBA 1ID3C 3A6NB 5AV6C 2ZY5A 1N1JB 3WAAC 4YM6B 3UT9C 2BYKA 5AY8C 2G5HC 3LZ1A 5GT3D 1Q9CA 4H9QA 4H9OB 3X1SC 2F8NH 5F99C 5CPKA 3MVDC 2RIQA 1P3AA 3WTPD 3W96C 4J8XC 3LJAB 3TU4B 3LZ0B 1KX3C 4H9RA 4E45A 3MGQA 1TZYB 1ID3A 1M19D 5AV6A 2HUEB 5B0YD 3AZLC 3UT9A 5AY8A 4E44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ D;  5B24 C;  1M18 D;  3WA9 D;  3X1S A;  3AV1 D;  5F99 A;  3AZL C;  3MVD A;  2ARO B;  1AOI D;  3NQJ B;  3W96 A;  3W98 D;  4J8X A;  3REK D;  1M19 B;  5B0Y B;  1KX3 A;  3WTP B;  5JA4 A;  1KX5 B;  4CSR A;  3AZK D;  3AZL A;  3WKJ B;  2YFV B;  1M18 B;  3WA9 B;  5B24 A;  1AOI B;  4WU9 C;  4Z2M H;  5B32 D;  4WNN A;  4ZUX C;  5GXQ D;  1S32 C;  5AV8 C;  3AFA D;  5E5A B;  3AYW D;  3REL D;  2FJ7 C;  1P3K B;  3VH6 A;  3C1C C;  1HQ3 D;  4X23 C;  5FUG B;  5B1M D;  1P3B D;  3REI C;  5GXQ B;  5B33 B;  4WU9 A;  3B6F D;  4ZUX A;  3AFA B;  1S32 A;  5AV8 A;  4KHA A;  1P3L D;  2F8N D;  3R45 A;  4ZBJ B;  4HGA B;  2NQB D;  4UUZ A;  4LD9 B;  2HIO D;  1ZLA B;  2FJ7 A;  5B0Z B;  3AV2 C;  1P3B B;  3C1C A;  4X23 A;  4NE5 A;  3MGR C;  3B6F B;  1WWI A;  4G92 C;  3REI A;  3B6G B;  3X1T C;  1JFI A;  2PYO D;  3AZM C;  2F8N B;  3MGP D;  3AZI C;  5B31 D;  1P3M C;  3AZE D;  3KUY C;  4KUD D;  5BNV B;  4DRB A;  5KDM B;  3AZH D;  1P34 D;  4NE6 A;  3AV2 A;  2YFW B;  1P3P D;  3UTA C;  3VH5 T;  3MGR A;  4EO5 C;  5C3I B;  3AN2 B;  3NQU B;  5GSU D;  5CPJ C;  5B31 B;  3X1T A;  3AZE B;  3AZM A;  4CAY B;  3AZI A;  4KUD B;  3AZH B;  1P3M A;  3AZJ C;  3LJA C;  3TU4 C;  3KUY A;  1P3P B;  3LZ0 C;  1EQZ B;  1TZY C;  2HUE C;  3UTA A;  3W97 D;  3X1V D;  5GSU B;  4XUJ C;  3V9R B;  5AVC D;  4J8W D;  4H9O A;  5CPJ A;  2CV5 C;  3O62 B;  2ARO C;  4WV4 B;  3AZJ A;  3LJA A;  3REH C;  3TU4 A;  1U35 B;  3LZ0 A;  1M19 C;  3WTP C;  4J8V D;  1KX5 C;  5BNX B;  5AV5 B;  5B2I C;  1TZY A;  4JJN D;  4XUJ A;  5AVC B;  4J8W B;  2CWE A;  3B0B A;  3X1U C;  1AOI C;  2CV5 A;  1M1A B;  5CP6 D;  2ARO A;  3AZG C;  4Z5T C;  5CPI D;  3NQJ A;  4J8V B;  3REH A;  1P3G D;  1M19 A;  3WTP A;  4JJN B;  3REJ D;  1KX5 A;  5E5A C;  5B2I A;  4R8P D;  1P3K C;  2YFV A;  4M6B A;  3AZN D;  3X1U A;  5AV9 D;  1AOI A;  1F66 D;  5B40 D;  5B33 C;  4H9N B;  3AZG A;  4Z5T A;  3KWQ D;  1P3G B;  5B1L D;  4QLC D;  1P3O C;  5G49 B;  4XZQ D;  3KXB C;  3REJ B;  4R8P B;  1KU5 A;  3W99 C;  3MNN D;  4ZBJ C;  5E5A A;  3AZN B;  3AZF D;  5GT3 B;  4LD9 C;  1ZLA C;  1P3K A;  5B0Z C;  1F66 B;  5B40 B;  1BH9 A;  4QLC B;  5B33 A;  4WU8 C;  3B6G C;  1P3I C;  5GT0 D;  1P3O A;  3VH5 A;  3MNN B;  3KXB A;  3AZF B;  4KGC D;  3W99 A;  1KX4 D;  4LD9 A;  1ZLA A;  5B0Z A;  3AV1 B;  5JRG D;  2IO5 C;  3UTB D;  1KX5 D;  5C3I C;  3AN2 C;  3LEL D;  4WU8 A;  3W98 B;  3REK B;  3B6G A;  1P3I A;  3LZ1 D;  4KGC B;  1KX4 B;  3AZK B;  5CPK D;  3C1B C;  4YS3 C;  1P3A D;  5BNV A;  5KDM A;  5JRG B;  4Z66 C;  1EQZ C;  2YFW A;  3LEL B;  5B32 B;  3MGQ D;  1P3F C;  5DNM C;  4DRA A;  3B0D B;  5BO0 A;  1ID3 D;  5AV6 D;  3LZ1 B;  3AN2 A;  3UT9 D;  3WAA D;  5AY8 D;  4H9Q B;  3O62 C;  5BT1 D;  1P3A B;  3AYW B;  3REL B;  5F99 D;  3C1B A;  3MVD D;  1HQ3 B;  4YS3 A;  1U35 C;  4Z66 A;  1EQZ A;  3W96 D;  5B1M B;  5AV5 C;  4H9R B;  4J8X D;  1ID3 B;  5AV6 B;  1KX3 D;  3UT9 B;  3WAA B;  1P3F A;  5DNM A;  3V9R A;  3AZL D;  1P3L B;  3O62 A;  2RVQ C;  1M1A C;  5DNN D;  5B24 D;  2NQB B;  5BS7 C;  4AWL B;  2HIO B;  3W96 B;  5AVB C;  2F8N G;  1U35 A;  5B2J D;  5BNX A;  5AV5 A;  3A6N C;  4YM6 C;  4CSR B;  3AZL B;  5AVC A;  2PYO B;  3MGP B;  2LY8 A;  5DNN B;  1M1A A;  1R4V A;  1P34 B;  4J8U D;  5B31 G;  5BS7 A;  4H9S C;  5B2J B;  5AVB A;  4WU9 D;  2L5A A;  5CHL B;  4ZUX D;  1BH8 B;  3A6N A;  3B0C W;  3AZN C;  1N1J A;  4YM6 A;  1S32 D;  5GT3 C;  5AV8 D;  2FJ7 D;  3C1C D;  4J8U B;  4H9N A;  4X23 D;  1F1E A;  4H9S A;  3REI D;  5G49 A;  3MNN C;  5B0Y C;  3MGS D;  4Z2M G;  3X1V B;  5AV8 B;  4KHA B;  1S32 B;  2F8N K;  3W97 B;  3AZN A;  3WKJ C;  1B6W A;  5GT3 A;  4UUZ B;  1M18 C;  2FJ7 B;  3WA9 C;  3AV1 C;  3C1C B;  4X23 B;  3AV2 D;  3W98 C;  3REI B;  4G91 B;  3MGR D;  3REK C;  3MGS B;  4KGC C;  1JFI B;  3MNN A;  5B0Y A;  3AZK C;  3X1T D;  3WKJ A;  3AZI D;  1P3M D;  1M18 A;  3WA9 A;  1H3O B;  3VH6 W;  3AV1 A;  3KUY D;  5CP6 B;  5B32 C;  3LEL C;  5CPI B;  3B0D C;  5GXQ C;  3UTA D;  3W98 A;  3REK A;  3AFA C;  4KGC A;  3KSY A;  3AYW C;  3AZK A;  3REL C;  5CPJ D;  1P3M B;  4HGA C;  1HQ3 C;  5B1M C;  1P3B C;  5AV9 B;  3AZJ D;  3LJA D;  3TU4 D;  5FUG A;  3LZ0 D;  1A7W A;  5B32 A;  3LEL A;  3UTA B;  3B6F C;  3KWQ B;  1TZY D;  5B1L B;  5GXQ A;  4EO5 B;  4XZQ B;  5BT1 C;  4XUJ D;  1P3L C;  3AFA A;  5CPJ B;  4H9P B;  2NQB C;  3AYW A;  4AWL C;  1TAF B;  2HIO C;  3REL A;  2CV5 D;  2NZD D;  2ARO D;  1HQ3 A;  3AZJ B;  5B1M A;  1P3B A;  1B67 A;  3REH D;  3B6F A;  3WAA A;  2BYM B;  5GT0 B;  5B2I D;  4XUJ B;  2PYO C;  3MGP C;  5B31 C;  5DNN C;  3AZE C;  1P3L A;  4WZS B;  2CV5 B;  2F8N A;  2NZD B;  4KUD C;  3X1U D;  3AZH C;  1P34 C;  2NQB A;  2HIO A;  5B2J C;  1P3P C;  3AZG D;  4Z5T D;  3REH B;  3UTB B;  2JSS A;  5B2I B;  5GSU C;  2BYK B;  5E5A D;  2PYO A;  3NQU A;  5B32 G;  3MGP A;  1P3K D;  5B31 A;  5DNN A;  3X1U B;  4J8U C;  3AZE A;  5CPK B;  4CAY A;  4KUD A;  3X1S D;  3AZG B;  4Z5T B;  3AZH A;  1P34 A;  5B2J A;  5B33 D;  1P3P A;  3W97 C;  3X1V C;  3MGQ B;  1BH8 A;  1P3O D;  3KXB D;  5GSU A;  5AVC C;  5AY8 B;  3W99 D;  4J8W C;  4LD9 D;  1ZLA D;  5B0Z D;  1BH9 B;  3X1S B;  5F99 B;  4J8U A;  3MVD B;  4G91 C;  4J8V C;  3MGS C;  1BFM A;  4WU8 D;  4J8X B;  1P3O B;  3KXB B;  4JJN C;  3B6G D;  3W97 A;  3X1V A;  5JA4 B;  1P3I D;  1KX3 B;  3W99 B;  4J8W A;  5CP6 C;  5CPI C;  5B24 B;  3B0C T;  4WNN B;  4WU8 B;  1P3G C;  4J8V A;  3MGS A;  1P3I B;  3REJ C;  3AN2 D;  4R8P C;  4JJN A;  4NE3 A;  1ULY A;  3C1B D;  5AV9 C;  1H3O A;  1F66 C;  4YS3 D;  5B40 C;  4Z66 D;  5CP6 A;  1EQZ D;  5CPI A;  2IO5 B;  3KWQ C;  5B1L C;  4QLC C;  5BO0 B;  4XZQ C;  4WU9 B;  4NFT A;  1P3F D;  5DNM D;  1P3G A;  4ZUX B;  3REJ A;  3VH5 W;  4R8P A;  3AZF C;  1HTA A;  3O62 D;  3R45 B;  3C1B B;  4YS3 B;  4Z66 B;  5AV9 A;  1F66 A;  5B40 A;  1U35 D;  5AV5 D;  5GT0 C;  3KWQ A;  1P3F B;  5B1L A;  4QLC A;  5DNM B;  4XZQ A;  4H9P A;  2NZD C;  1KX4 C;  3VH6 T;  3WTP E;  3AZF A;  1TAF A;  3AZM D;  2RVQ D;  1M1A D;  5JRG C;  3UTB C;  5AVB D;  3AV2 B;  3MGR B;  2BYM A;  3A6N D;  5GT0 A;  3LZ1 C;  4YM6 D;  4G92 B;  5CPK C;  3X1T B;  3AZM B;  2NZD A;  1KX4 A;  1P3A C;  3AZI B;  5AVB B;  5JRG A;  3KUY B;  3MGQ C;  1WWS A;  3UTB A;  1ID3 C;  3A6N B;  5AV6 C;  1N1J B;  3WAA C;  4YM6 B;  3UT9 C;  2BYK A;  5AY8 C;  3LZ1 A;  5GT3 D;  1Q9C A;  4H9Q A;  4H9O B;  3X1S C;  2F8N H;  5F99 C;  5CPK A;  3MVD C;  1P3A A;  3W96 C;  4J8X C;  3LJA B;  3TU4 B;  3LZ0 B;  1KX3 C;  4H9R A;  4E45 A;  3MGQ A;  1TZY B;  1ID3 A;  1M19 D;  5AV6 A;  2HUE B;  3WTP D;  5B0Y D;  3UT9 A;  5AY8 A;  4E44 A; 
#chains in the Genus database with same CATH topology
 3WKJ D;  5B24 C;  1M18 D;  3WA9 D;  3X1S A;  3AV1 D;  5F99 A;  3MVD A;  2ARO B;  1AOI D;  3NQJ B;  3W96 A;  3W98 D;  4J8X A;  3REK D;  2FFF B;  1M19 B;  5B0Y B;  1KX3 A;  3WTP B;  5JA4 A;  1KX5 B;  4CSR A;  3AZK D;  3AZL A;  3FDD A;  3WKJ B;  2YFV B;  4WJ3 C;  1M18 B;  3WA9 B;  5B24 A;  1AOI B;  4WU9 C;  4Z2M H;  5B32 D;  4WNN A;  4ZUX C;  5GXQ D;  1S32 C;  5AV8 C;  3AFA D;  5E5A B;  2VQR A;  3H0L C;  3AYW D;  3REL D;  2FJ7 C;  1P3K B;  3VH6 A;  3C1C C;  1HQ3 D;  4X23 C;  5FUG B;  5B1M D;  1P3B D;  3REI C;  5GXQ B;  5B33 B;  4WU9 A;  3B6F D;  4ZUX A;  3AFA B;  1S32 A;  5AV8 A;  4KHA A;  1P3L D;  2F8N D;  3R45 A;  4ZBJ B;  4HGA B;  2NQB D;  4UUZ A;  4LD9 B;  2HIO D;  1ZLA B;  2FJ7 A;  5B0Z B;  3AV2 C;  1P3B B;  3C1C A;  2BG1 A;  4X23 A;  4NE5 A;  3MGR C;  3B6F B;  2Y2H A;  1WWI A;  4G92 C;  3REI A;  3B6G B;  3X1T C;  1JFI A;  3EPK A;  2PYO D;  3AZM C;  2F8N B;  3MGP D;  3AZI C;  5B31 D;  2ZY4 A;  1P3M C;  3AZE D;  3KUY C;  4KUD D;  5BNV B;  4DRB A;  5KDM B;  3AZH D;  1P34 D;  4NE6 A;  3AV2 A;  2YFW B;  1P3P D;  3UTA C;  3VH5 T;  3MGR A;  4EO5 C;  5C3I B;  3AN2 B;  3NQU B;  5GSU D;  5CPJ C;  5B31 B;  3X1T A;  3AZE B;  3AZM A;  4CAY B;  3AZI A;  4KUD B;  3AZH B;  1P3M A;  3AZJ C;  3LJA C;  3TU4 C;  3KUY A;  1P3P B;  3LZ0 C;  1EQZ B;  1TZY C;  2ZM5 A;  2HUE C;  3UTA A;  3W97 D;  3X1V D;  5GSU B;  2Y2N A;  4XUJ C;  3V9R B;  5AVC D;  2JCH A;  4H9O A;  4J8W D;  5CPJ A;  2CV5 C;  3O62 B;  2ARO C;  4WV4 B;  3AZJ A;  3LJA A;  3REH C;  3TU4 A;  1U35 B;  3LZ0 A;  1M19 C;  3WTP C;  4J8V D;  1KX5 C;  5BNX B;  5AV5 B;  5B2I C;  1TZY A;  4JJN D;  4XUJ A;  5AVC B;  4J8W B;  2CWE A;  3B0B A;  2JE5 A;  3X1U C;  1AOI C;  3AL0 C;  2CV5 A;  1M1A B;  5CP6 D;  2ARO A;  3AZG C;  4Z5T C;  5CPI D;  3NQJ A;  4J8V B;  3REH A;  1P3G D;  1M19 A;  3WTP A;  4JJN B;  3REJ D;  1KX5 A;  5E5A C;  5B2I A;  4R8P D;  2W8S A;  2YFV A;  1P3K C;  4M6B A;  3AZN D;  3X1U A;  5AV9 D;  1AOI A;  2DQN C;  1F66 D;  5B40 D;  5B33 C;  4H9N B;  2Y2L A;  2Y2I A;  3AZG A;  4Z5T A;  3KWQ D;  1P3G B;  5B1L D;  4QLC D;  1P3O C;  5G49 B;  4XZQ D;  3KXB C;  3REJ B;  4R8P B;  1KU5 A;  3W99 C;  3MNN D;  4ZBJ C;  5E5A A;  3AZN B;  3AZF D;  5GT3 B;  4LD9 C;  1ZLA C;  1P3K A;  5B0Z C;  2Y2O A;  1F66 B;  5B40 B;  1BH9 A;  4QLC B;  5B33 A;  4WU8 C;  3B6G C;  1P3I C;  5GT0 D;  1P3O A;  3VH5 A;  3MNN B;  3KXB A;  3AZF B;  4KGC D;  3W99 A;  1KX4 D;  1Z2C B;  4LD9 A;  2Y2K A;  1ZLA A;  5B0Z A;  3AV1 B;  5JRG D;  2G5I C;  3EG5 B;  2IO5 C;  3UTB D;  1KX5 D;  3KFU G;  5C3I C;  3AN2 C;  3LEL D;  4WU8 A;  3W98 B;  3REK B;  3B6G A;  1P3I A;  3LZ1 D;  4KGC B;  1KX4 B;  3AZK B;  5CPK D;  3C1B C;  4YS3 C;  1P3A D;  5BNV A;  5KDM A;  5JRG B;  4Z66 C;  1EQZ C;  4UPK A;  3H0R C;  1PZR A;  2YFW A;  3LEL B;  5B32 B;  3MGQ D;  1P3F C;  5DNM C;  4DRA A;  3B0D B;  5BO0 A;  1ID3 D;  5AV6 D;  3LZ1 B;  3AN2 A;  3UT9 D;  3WAA D;  5AY8 D;  4H9Q B;  3O62 C;  5BT1 D;  2DF4 C;  3AYW B;  1P3A B;  3REL B;  5F99 D;  3C1B A;  3MVD D;  1HQ3 B;  4YS3 A;  1U35 C;  4Z66 A;  1EQZ A;  3W96 D;  5B1M B;  5AV5 C;  4H9R B;  4J8X D;  1ID3 B;  5AV6 B;  1KX3 D;  3UT9 B;  3WAA B;  1P3F A;  5DNM A;  3V9R A;  1T3U A;  3AZL D;  1P3L B;  3O62 A;  2RVQ C;  1M1A C;  5DNN D;  5B24 D;  2NQB B;  5BS7 C;  4AWL B;  2HIO B;  3W96 B;  5AVB C;  2F8N G;  1U35 A;  5B2J D;  5BNX A;  5AV5 A;  3A6N C;  3F6T A;  4YM6 C;  4CSR B;  3AZL B;  5AVC A;  2PYO B;  3MGP B;  3P5J B;  2LY8 A;  5DNN B;  1M1A A;  1R4V A;  1P34 B;  4J8U D;  5B31 G;  5BS7 A;  4H9S C;  2Y2P A;  5B2J B;  5AVB A;  4WU9 D;  2L5A A;  5CHL B;  4ZUX D;  1BH8 B;  3A6N A;  3B0C W;  3AZN C;  1N1J A;  4YM6 A;  1S32 D;  5GT3 C;  5AV8 D;  2Y2G A;  2FJ7 D;  3C1C D;  4J8U B;  4H9N A;  4X23 D;  1F1E A;  4H9S A;  3REI D;  5G49 A;  3MNN C;  5B0Y C;  3MGS D;  2J8P A;  4Z2M G;  5AV8 B;  4KHA B;  3X1V B;  1S32 B;  2F8N K;  3W97 B;  3AZN A;  3WKJ C;  1B6W A;  5GT3 A;  2ZY2 A;  4UUZ B;  1M18 C;  2FJ7 B;  3WA9 C;  3AV1 C;  3C1C B;  4X23 B;  3AV2 D;  3W98 C;  3REI B;  4G91 B;  3MGR D;  3REK C;  3MGS B;  4KGC C;  1JFI B;  3MNN A;  2XD5 A;  5B0Y A;  3AZK C;  3X1T D;  3WKJ A;  3AZI D;  1P3M D;  1M18 A;  2Y2Q A;  3WA9 A;  1H3O B;  3VH6 W;  3AV1 A;  3KUY D;  5CP6 B;  5B32 C;  3LEL C;  5CPI B;  3B0D C;  5GXQ C;  3UTA D;  3W98 A;  3IP4 C;  3REK A;  3AFA C;  4KGC A;  3KSY A;  3AYW C;  3AZK A;  3REL C;  5CPJ D;  1P3M B;  4HGA C;  1HQ3 C;  5B1M C;  1P3B C;  5AV9 B;  3AZJ D;  3LJA D;  3TU4 D;  5FUG A;  3LZ0 D;  1A7W A;  5B32 A;  3LEL A;  3UTA B;  3B6F C;  3KWQ B;  1TZY D;  5B1L B;  5GXQ A;  4EO5 B;  4XZQ B;  5BT1 C;  4XUJ D;  1P3L C;  3AFA A;  5CPJ B;  4H9P B;  2NQB C;  3AYW A;  4AWL C;  1TAF B;  2HIO C;  3REL A;  2CV5 D;  2NZD D;  2ARO D;  1HQ3 A;  3AZJ B;  5B1M A;  1P3B A;  1B67 A;  3REH D;  3B6F A;  3WAA A;  2BYM B;  5GT0 B;  5B2I D;  4XUJ B;  2PYO C;  3MGP C;  5B31 C;  3A1I A;  5DNN C;  3AZE C;  1P3L A;  4WZS B;  2CV5 B;  2F8N A;  2NZD B;  4KUD C;  3A1K A;  3X1U D;  3AZH C;  1P34 C;  2NQB A;  2HIO A;  5B2J C;  1P3P C;  3AZG D;  4Z5T D;  3REH B;  3UTB B;  2JSS A;  5B2I B;  3EPJ A;  5GSU C;  2BYK B;  5E5A D;  2PYO A;  3NQU A;  2XD1 A;  5B32 G;  3MGP A;  1P3K D;  5B31 A;  5DNN A;  3X1U B;  4J8U C;  3AZE A;  5CPK B;  4CAY A;  4KUD A;  3H0M C;  3X1S D;  4Z5T B;  3AZG B;  3AZH A;  1P34 A;  1W2E A;  5B2J A;  5B33 D;  1P3P A;  3W97 C;  3X1V C;  3MGQ B;  1BH8 A;  1P3O D;  3KXB D;  5GSU A;  5AVC C;  5AY8 B;  3W99 D;  4J8W C;  2Y2J A;  4LD9 D;  1ZLA D;  5B0Z D;  1BH9 B;  3X1S B;  5F99 B;  4J8U A;  3MVD B;  4G91 C;  4J8V C;  3MGS C;  1BFM A;  4WU8 D;  4J8X B;  1P3O B;  3KXB B;  4JJN C;  3B6G D;  3W97 A;  3X1V A;  5JA4 B;  1P3I D;  1KX3 B;  3W99 B;  4J8W A;  5CP6 C;  5CPI C;  5B24 B;  3B0C T;  4WNN B;  4WU8 B;  1P3G C;  2F2A C;  4J8V A;  3MGS A;  1P3I B;  3REJ C;  3AN2 D;  4R8P C;  4JJN A;  4NE3 A;  1ULY A;  3EPH A;  3C1B D;  5AV9 C;  1H3O A;  1F66 C;  4YS3 D;  5B40 C;  4Z66 D;  5CP6 A;  1EQZ D;  5CPI A;  2IO5 B;  3KWQ C;  5B1L C;  4QLC C;  5BO0 B;  4XZQ C;  4WU9 B;  4NFT A;  1P3F D;  5DNM D;  1P3G A;  4ZUX B;  3REJ A;  3VH5 W;  4R8P A;  3AZF C;  1HTA A;  3O62 D;  3R45 B;  3C1B B;  4YS3 B;  4Z66 B;  2UWX A;  5AV9 A;  1F66 A;  5B40 A;  1U35 D;  5AV5 D;  5GT0 C;  3KWQ A;  1P3F B;  5B1L A;  4QLC A;  5DNM B;  4XZQ A;  2Y2M A;  4H9P A;  2NZD C;  1KX4 C;  3VH6 T;  3WTP E;  3AZF A;  1TAF A;  3AZM D;  2RVQ D;  1M1A D;  5JRG C;  4DQY B;  3UTB C;  5AVB D;  3AV2 B;  2ZY3 A;  3MGR B;  2BYM A;  3A6N D;  5GT0 A;  3LZ1 C;  4YM6 D;  4G92 B;  5CPK C;  3X1T B;  3AZM B;  2NZD A;  1KX4 A;  1P3A C;  3EPL A;  3AZI B;  5AVB B;  5JRG A;  3KUY B;  3MGQ C;  1WWS A;  3UTB A;  1ID3 C;  3A6N B;  5AV6 C;  2ZY5 A;  1N1J B;  3WAA C;  4YM6 B;  3UT9 C;  2BYK A;  5AY8 C;  2G5H C;  3LZ1 A;  5GT3 D;  1Q9C A;  4H9Q A;  4H9O B;  3X1S C;  2F8N H;  5F99 C;  5CPK A;  3MVD C;  2RIQ A;  1P3A A;  3WTP D;  3W96 C;  4J8X C;  3LJA B;  3TU4 B;  3LZ0 B;  1KX3 C;  4H9R A;  4E45 A;  3MGQ A;  1TZY B;  1ID3 A;  1M19 D;  5AV6 A;  2HUE B;  5B0Y D;  3AZL C;  3UT9 A;  5AY8 A;  4E44 A; 
#chains in the Genus database with same CATH homology
 3WKJ D;  5B24 C;  1M18 D;  3WA9 D;  3X1S A;  3AV1 D;  5F99 A;  3MVD A;  2ARO B;  1AOI D;  3NQJ B;  3W96 A;  3W98 D;  4J8X A;  3REK D;  2FFF B;  1M19 B;  5B0Y B;  1KX3 A;  3WTP B;  5JA4 A;  1KX5 B;  4CSR A;  3AZK D;  3AZL A;  3FDD A;  3WKJ B;  2YFV B;  4WJ3 C;  1M18 B;  3WA9 B;  5B24 A;  1AOI B;  4WU9 C;  4Z2M H;  5B32 D;  4WNN A;  4ZUX C;  5GXQ D;  1S32 C;  5AV8 C;  3AFA D;  5E5A B;  2VQR A;  3H0L C;  3AYW D;  3REL D;  2FJ7 C;  1P3K B;  3VH6 A;  3C1C C;  1HQ3 D;  4X23 C;  5FUG B;  5B1M D;  1P3B D;  3REI C;  5GXQ B;  5B33 B;  4WU9 A;  3B6F D;  4ZUX A;  3AFA B;  1S32 A;  5AV8 A;  4KHA A;  1P3L D;  2F8N D;  3R45 A;  4ZBJ B;  4HGA B;  2NQB D;  4UUZ A;  4LD9 B;  2HIO D;  1ZLA B;  2FJ7 A;  5B0Z B;  3AV2 C;  1P3B B;  3C1C A;  2BG1 A;  4X23 A;  4NE5 A;  3MGR C;  3B6F B;  2Y2H A;  1WWI A;  4G92 C;  3REI A;  3B6G B;  3X1T C;  1JFI A;  3EPK A;  2PYO D;  3AZM C;  2F8N B;  3MGP D;  3AZI C;  5B31 D;  2ZY4 A;  1P3M C;  3AZE D;  3KUY C;  4KUD D;  5BNV B;  4DRB A;  5KDM B;  3AZH D;  1P34 D;  4NE6 A;  3AV2 A;  2YFW B;  1P3P D;  3UTA C;  3VH5 T;  3MGR A;  4EO5 C;  5C3I B;  3AN2 B;  3NQU B;  5GSU D;  5CPJ C;  5B31 B;  3X1T A;  3AZE B;  3AZM A;  4CAY B;  3AZI A;  4KUD B;  3AZH B;  1P3M A;  3AZJ C;  3LJA C;  3TU4 C;  3KUY A;  1P3P B;  3LZ0 C;  1EQZ B;  1TZY C;  2ZM5 A;  2HUE C;  3UTA A;  3W97 D;  3X1V D;  5GSU B;  2Y2N A;  4XUJ C;  3V9R B;  5AVC D;  2JCH A;  4H9O A;  4J8W D;  5CPJ A;  2CV5 C;  3O62 B;  2ARO C;  4WV4 B;  3AZJ A;  3LJA A;  3REH C;  3TU4 A;  1U35 B;  3LZ0 A;  1M19 C;  3WTP C;  4J8V D;  1KX5 C;  5BNX B;  5AV5 B;  5B2I C;  1TZY A;  4JJN D;  4XUJ A;  5AVC B;  4J8W B;  2CWE A;  3B0B A;  2JE5 A;  3X1U C;  1AOI C;  3AL0 C;  2CV5 A;  1M1A B;  5CP6 D;  2ARO A;  3AZG C;  4Z5T C;  5CPI D;  3NQJ A;  4J8V B;  3REH A;  1P3G D;  1M19 A;  3WTP A;  4JJN B;  3REJ D;  1KX5 A;  5E5A C;  5B2I A;  4R8P D;  2W8S A;  2YFV A;  1P3K C;  4M6B A;  3AZN D;  3X1U A;  5AV9 D;  1AOI A;  2DQN C;  1F66 D;  5B40 D;  5B33 C;  4H9N B;  2Y2L A;  2Y2I A;  3AZG A;  4Z5T A;  3KWQ D;  1P3G B;  5B1L D;  4QLC D;  1P3O C;  5G49 B;  4XZQ D;  3KXB C;  3REJ B;  4R8P B;  1KU5 A;  3W99 C;  3MNN D;  4ZBJ C;  5E5A A;  3AZN B;  3AZF D;  5GT3 B;  4LD9 C;  1ZLA C;  1P3K A;  5B0Z C;  2Y2O A;  1F66 B;  5B40 B;  1BH9 A;  4QLC B;  5B33 A;  4WU8 C;  3B6G C;  1P3I C;  5GT0 D;  1P3O A;  3VH5 A;  3MNN B;  3KXB A;  3AZF B;  4KGC D;  3W99 A;  1KX4 D;  1Z2C B;  4LD9 A;  2Y2K A;  1ZLA A;  5B0Z A;  3AV1 B;  5JRG D;  2G5I C;  3EG5 B;  2IO5 C;  3UTB D;  1KX5 D;  3KFU G;  5C3I C;  3AN2 C;  3LEL D;  4WU8 A;  3W98 B;  3REK B;  3B6G A;  1P3I A;  3LZ1 D;  4KGC B;  1KX4 B;  3AZK B;  5CPK D;  3C1B C;  4YS3 C;  1P3A D;  5BNV A;  5KDM A;  5JRG B;  4Z66 C;  1EQZ C;  4UPK A;  3H0R C;  1PZR A;  2YFW A;  3LEL B;  5B32 B;  3MGQ D;  1P3F C;  5DNM C;  4DRA A;  3B0D B;  5BO0 A;  1ID3 D;  5AV6 D;  3LZ1 B;  3AN2 A;  3UT9 D;  3WAA D;  5AY8 D;  4H9Q B;  3O62 C;  5BT1 D;  2DF4 C;  3AYW B;  1P3A B;  3REL B;  5F99 D;  3C1B A;  3MVD D;  1HQ3 B;  4YS3 A;  1U35 C;  4Z66 A;  1EQZ A;  3W96 D;  5B1M B;  5AV5 C;  4H9R B;  4J8X D;  1ID3 B;  5AV6 B;  1KX3 D;  3UT9 B;  3WAA B;  1P3F A;  5DNM A;  3V9R A;  1T3U A;  3AZL D;  1P3L B;  3O62 A;  2RVQ C;  1M1A C;  5DNN D;  5B24 D;  2NQB B;  5BS7 C;  4AWL B;  2HIO B;  3W96 B;  5AVB C;  2F8N G;  1U35 A;  5B2J D;  5BNX A;  5AV5 A;  3A6N C;  3F6T A;  4YM6 C;  4CSR B;  3AZL B;  5AVC A;  2PYO B;  3MGP B;  3P5J B;  2LY8 A;  5DNN B;  1M1A A;  1R4V A;  1P34 B;  4J8U D;  5B31 G;  5BS7 A;  4H9S C;  2Y2P A;  5B2J B;  5AVB A;  4WU9 D;  2L5A A;  5CHL B;  4ZUX D;  1BH8 B;  3A6N A;  3B0C W;  3AZN C;  1N1J A;  4YM6 A;  1S32 D;  5GT3 C;  5AV8 D;  2Y2G A;  2FJ7 D;  3C1C D;  4J8U B;  4H9N A;  4X23 D;  1F1E A;  4H9S A;  3REI D;  5G49 A;  3MNN C;  5B0Y C;  3MGS D;  2J8P A;  4Z2M G;  5AV8 B;  4KHA B;  3X1V B;  1S32 B;  2F8N K;  3W97 B;  3AZN A;  3WKJ C;  1B6W A;  5GT3 A;  2ZY2 A;  4UUZ B;  1M18 C;  2FJ7 B;  3WA9 C;  3AV1 C;  3C1C B;  4X23 B;  3AV2 D;  3W98 C;  3REI B;  4G91 B;  3MGR D;  3REK C;  3MGS B;  4KGC C;  1JFI B;  3MNN A;  2XD5 A;  5B0Y A;  3AZK C;  3X1T D;  3WKJ A;  3AZI D;  1P3M D;  1M18 A;  2Y2Q A;  3WA9 A;  1H3O B;  3VH6 W;  3AV1 A;  3KUY D;  5CP6 B;  5B32 C;  3LEL C;  5CPI B;  3B0D C;  5GXQ C;  3UTA D;  3W98 A;  3IP4 C;  3REK A;  3AFA C;  4KGC A;  3KSY A;  3AYW C;  3AZK A;  3REL C;  5CPJ D;  1P3M B;  4HGA C;  1HQ3 C;  5B1M C;  1P3B C;  5AV9 B;  3AZJ D;  3LJA D;  3TU4 D;  5FUG A;  3LZ0 D;  1A7W A;  5B32 A;  3LEL A;  3UTA B;  3B6F C;  3KWQ B;  1TZY D;  5B1L B;  5GXQ A;  4EO5 B;  4XZQ B;  5BT1 C;  4XUJ D;  1P3L C;  3AFA A;  5CPJ B;  4H9P B;  2NQB C;  3AYW A;  4AWL C;  1TAF B;  2HIO C;  3REL A;  2CV5 D;  2NZD D;  2ARO D;  1HQ3 A;  3AZJ B;  5B1M A;  1P3B A;  1B67 A;  3REH D;  3B6F A;  3WAA A;  2BYM B;  5GT0 B;  5B2I D;  4XUJ B;  2PYO C;  3MGP C;  5B31 C;  3A1I A;  5DNN C;  3AZE C;  1P3L A;  4WZS B;  2CV5 B;  2F8N A;  2NZD B;  4KUD C;  3A1K A;  3X1U D;  3AZH C;  1P34 C;  2NQB A;  2HIO A;  5B2J C;  1P3P C;  3AZG D;  4Z5T D;  3REH B;  3UTB B;  2JSS A;  5B2I B;  3EPJ A;  5GSU C;  2BYK B;  5E5A D;  2PYO A;  3NQU A;  2XD1 A;  5B32 G;  3MGP A;  1P3K D;  5B31 A;  5DNN A;  3X1U B;  4J8U C;  3AZE A;  5CPK B;  4CAY A;  4KUD A;  3H0M C;  3X1S D;  4Z5T B;  3AZG B;  3AZH A;  1P34 A;  1W2E A;  5B2J A;  5B33 D;  1P3P A;  3W97 C;  3X1V C;  3MGQ B;  1BH8 A;  1P3O D;  3KXB D;  5GSU A;  5AVC C;  5AY8 B;  3W99 D;  4J8W C;  2Y2J A;  4LD9 D;  1ZLA D;  5B0Z D;  1BH9 B;  3X1S B;  5F99 B;  4J8U A;  3MVD B;  4G91 C;  4J8V C;  3MGS C;  1BFM A;  4WU8 D;  4J8X B;  1P3O B;  3KXB B;  4JJN C;  3B6G D;  3W97 A;  3X1V A;  5JA4 B;  1P3I D;  1KX3 B;  3W99 B;  4J8W A;  5CP6 C;  5CPI C;  5B24 B;  3B0C T;  4WNN B;  4WU8 B;  1P3G C;  2F2A C;  4J8V A;  3MGS A;  1P3I B;  3REJ C;  3AN2 D;  4R8P C;  4JJN A;  4NE3 A;  1ULY A;  3EPH A;  3C1B D;  5AV9 C;  1H3O A;  1F66 C;  4YS3 D;  5B40 C;  4Z66 D;  5CP6 A;  1EQZ D;  5CPI A;  2IO5 B;  3KWQ C;  5B1L C;  4QLC C;  5BO0 B;  4XZQ C;  4WU9 B;  4NFT A;  1P3F D;  5DNM D;  1P3G A;  4ZUX B;  3REJ A;  3VH5 W;  4R8P A;  3AZF C;  1HTA A;  3O62 D;  3R45 B;  3C1B B;  4YS3 B;  4Z66 B;  2UWX A;  5AV9 A;  1F66 A;  5B40 A;  1U35 D;  5AV5 D;  5GT0 C;  3KWQ A;  1P3F B;  5B1L A;  4QLC A;  5DNM B;  4XZQ A;  2Y2M A;  4H9P A;  2NZD C;  1KX4 C;  3VH6 T;  3WTP E;  3AZF A;  1TAF A;  3AZM D;  2RVQ D;  1M1A D;  5JRG C;  4DQY B;  3UTB C;  5AVB D;  3AV2 B;  2ZY3 A;  3MGR B;  2BYM A;  3A6N D;  5GT0 A;  3LZ1 C;  4YM6 D;  4G92 B;  5CPK C;  3X1T B;  3AZM B;  2NZD A;  1KX4 A;  1P3A C;  3EPL A;  3AZI B;  5AVB B;  5JRG A;  3KUY B;  3MGQ C;  1WWS A;  3UTB A;  1ID3 C;  3A6N B;  5AV6 C;  2ZY5 A;  1N1J B;  3WAA C;  4YM6 B;  3UT9 C;  2BYK A;  5AY8 C;  2G5H C;  3LZ1 A;  5GT3 D;  1Q9C A;  4H9Q A;  4H9O B;  3X1S C;  2F8N H;  5F99 C;  5CPK A;  3MVD C;  2RIQ A;  1P3A A;  3WTP D;  3W96 C;  4J8X C;  3LJA B;  3TU4 B;  3LZ0 B;  1KX3 C;  4H9R A;  4E45 A;  3MGQ A;  1TZY B;  1ID3 A;  1M19 D;  5AV6 A;  2HUE B;  5B0Y D;  3AZL C;  3UT9 A;  5AY8 A;  4E44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...