3RELB

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relB00
5AV5B 5BT1D 3AZHC 3AZMB 4WU8D 1ULYA 3B0CT 3AZIA 4HGAB 1P3BB 1M1AB 1ID3C 3AZJC 3UT9A 3X1TA 1P3AA 1P3KA 3LZ1B 5AV9B 3AZHD 5FUGA 5AVBC 5B2IB 1TZYB 4Z5TC 3MVDC 3AZEA 3MGQB 1B6WA 2RVQC 4XUJB 5AV6A 5F99B 3B0DB 1M18A 4Z5TD 3AZGD 1R4VA 3TU4C 2FJ7B 4ZUXB 2JSSA 1HQ3D 4XZQA 3MGSA 2RVQD 5GT3C 5B33A 4Z66A 3W98C 4YS3A 3X1SA 3TU4D 5CP6C 4G91B 5GT0B 5GT3D 3O62A 3AZFA 2CV5C 5CPKC 5GSUA 1H3OB 5DNMB 4J8UB 1KX4B 2YFWA 3REHA 5B31B 3RELB 2NQBB 3REKC 3UTAB 2CV5D 3KUYC 5JRGB 3LZ0A 3REJA 5B1LB 3C1BC 5CPJD 1ZLAA 3NQJA 3KUYD 4DRBA 5AV5A 3MGRC 2HIOB 3AZMA 5GXQD 1M1AA 3KXBB 3C1BD 5B32B 4H9SC 3C1CB 3WAAB 4NE5A 5BNVB 3MGRD 5AV9A 3X1UC 5B2IA 4H9RB 1TZYA 5B40B 2AROB 1P3IB 4JJNB 3MGQA 3X1VC 1U35D 3LELC 3UTBC 4J8VC 3X1UD 5F99A 2F8ND 2FJ7A 3X1VD 1N1JB 3W99D 2PYOD 4KUDB 5B0ZB 5B0YD 3WKJB 4J8WC 5E5AB 1P3BD 4WU9C 1WWSA 1BH9A 5GT0A 3AN2A 2NZDC 4J8WD 2LY8A 3LZ1D 4G92C 3AZKC 4LD9C 1P3MC 1H3OA 5DNMA 3WA9B 4WU9D 3W97B 4J8UA 4ZBJB 1P3KB 1KX4A 3REIC 1F66B 4KGCA 5B31A 1ID3B 3RELA 3AZJB 2NQBA 2NZDD 4XUJD 3AZKD 4LD9D 1M19B 5AVBB 1P3GB 5JRGA 5AV6B 3REID 1KX3B 4ZUXD 5DNNC 5B1LA 4Z2MG 1P3FC 4QLCB 5AVCB 4YM6D 2HIOA 5CPIA 3KXBA 5B32A 3AZLA 3C1CA 5BNVA 3VH6T 3NQUB 4J8XC 1BH8B 5CP6B 4H9RA 3B6FA 5B40A 1F1EA 2AROA 3UTAD 1P3IA 4JJNA 1S32C 5CPKB 4J8XD 1JFIB 1AOIA 5B1MB 5B24D 3MNNC 1EQZD 1S32D 1A7WA 1N1JA 4KUDA 4CAYB 2HUEC 5B0ZA 3WKJA 5C3IC 1P3LB 5E5AA 3AFAB 4X23C 3MNND 1WWIA 5B2JC 3VH6W 4WU8A 3MGPC 1HTAA 3WAAD 3AZNB 3AYWD 4X23D 5AV8B 5B2JD 3WA9A 3W97A 3MGPD 1F66A 1ID3A 3AZJA 3AZGC 3KWQC 3AV1C 1M19A 3B6GC 1HQ3C 5AVBA 1P3GA 3MVDA 1KX3A 3VH6A 3LELB 3KWQD 3WTPE 4CSRB 4J8VB 3AV1D 1P3PD 3B6GD 3UT9C 3X1TC 1P3OD 2F8NK 1KU5A 5BNXB 4QLCA 5AVCA 1P3AC 3LJAB 4DRAA 3AZID 3AZEC 3UT9D 3X1TD 1BH9B 3W98A 3AN2B 3NQUA 1P3KD 1P3AD 1BH8A 5CP6A 1M18C 3AZED 4KGCB 1KX5B 2YFVA 5CPKA 4XZQC 3MGSC 1JFIA 1P3MB 4H9OB 5B33C 4Z66C 1M18D 5B1MA 4M6BA 4YS3C 5CPJC 3REKA 4CAYA 4XZQD 3MGSD 3WTPB 3A6NC 3O62C 5GXQC 4Z66D 5B33D 3AZFC 1P3LA 4YS3D 3AFAA 3X1SD 5DNNB 5GSUC 5BO0A 3A6ND 3REHC 3O62D 3AZNA 1TAFB 5CPIB 5AY8B 3AZFD 3AV2B 3AZLB 5AV8A 5GSUD 1U35C 3REHD 2IO5C 3REJC 2F8NG 3B6FB 3R45B 4R8PB 3W99C 2PYOC 1ZLAC 1AOIB 5B0YC 3LZ0D 3REJD 5AV5C 3LELA 3UTBA 4HGAC 1P3BC 4CSRA 4J8VA 1M1AC 4AWLB 5CHLB 1ZLAD 5BNXA 3W96B 4EO5B 3LZ1C 5AV5D 3AZMD 5AV9C 3LJAA 4UUZB 5B2IC 1TZYC 2HUEB 1P34B 1M1AD 4WU8B 3MGQC 5BS7C 4XUJC 5AV9D 5B2ID 1TZYD 3AZHB 1KX5A 3MGQD 2FJ7C 4ZUXC 1P3MA 2F8NH 4H9OA 5F99D 4KHAB 3MVDB 4Z5TB 2FJ7D 4YM6C 4G91C 3WTPA 1HQ3B 4E44A 5DNNA 4J8UC 3TU4B 5GT0D 5B31C 1TAFA 2L5AA 5AY8A 5B31G 3RELC 1P3FA 3UTAC 5GT3B 3AV2A 2NQBC 3W98B 5DNMD 4KGCD 4J8UD 1KX4D 5JRGC 5B31D 3RELD 2NQBD 5B24C 3R45A 5B1LC 1EQZC 4R8PA 2YFVB 4H9QA 2CV5B 5JRGD 5B1LD 4WNNB 3KXBC 3REKB 3C1CC 4H9PB 3WAAC 3W96A 3MNNA 3AYWC 3KUYB 2HIOD 4UUZA 1P34A 5CPID 4Z2MH 3KXBD 5B40C 2AROC 5B32D 3AZLD 4JJNC 2BYMA 5GXQB 3C1CD 1P3IC 5BO0B 3C1BB 3MGRB 5B40D 3AZHA 3B6FD 2AROD 1P3ID 4JJND 1B67A 5B0ZC 1AOID 4H9NA 1U35B 3WKJC 1P3PC 5E5AC 3X1UB 4KHAA 2F8NB 2BYKB 4Z5TA 1P3OC 3AZGA 4KUDD 5B0ZD 3X1VB 1HQ3A 3W99B 2PYOB 3WKJD 3UTBB 3AZIC 5E5AD 5B0YB 3WA9C 3W97C 1P3KC 4ZBJC 3TU4A 1F66C 5GT3A 3VH5T 4J8WB 3WA9D 1M19C 3W97D 1P3GC 1F66D 5AV6C 1KX3C 4WU9B 1ID3D 3AZJD 2NZDB 3AZKB 2CV5A 4G92B 4LD9B 1M19D 5AVBD 1P3GD 5AV6D 3MVDD 1KX3D 4QLCC 5AVCC 3REIB 3X1SC 4WNNA 3B0CW 4H9PA 4QLCD 5AVCD 5CPJA 3KUYA 3VH5W 4YM6B 3A6NA 3B0BA 5GXQA 3W98D 3C1BA 1P3FB 5JA4B 5CP6D 4WZSB 4NFTA 3MGRA 5B1MC 3LZ0C 1Q9CA 5CPKD 4H9SA 1U35A 4NE3A 4J8XB 1P3LC 4H9QB 5B1MD 3X1UA 3AFAC 2F8NA 2BYKA 5B24B 3VH5A 5KDMB 3REKD 1EQZB 1S32B 3AZMC 3V9RB 3X1VA 3W99A 3AZNC 2PYOA 1P3LD 5B0YA 3AFAD 5AV8C 4NE6A 3MNNB 1P3BA 3AZND 2BYMB 5C3IB 5AV8D 3LZ1A 4J8WA 3AYWB 4X23B 5B2JB 4WU9A 5F99C 3B0DC 3MGPB 2NZDA 5BS7A 4XUJA 3AZKA 4LD9A 3KSYA 4H9NB 3REIA 3LJAC 4ZUXA 3LELD 3UTBD 3AZGB 4J8VD 5G49B 5GT0C 3KWQB 1P3PB 3AV1B 3B6GB 3AN2C 1P3OB 3LJAD 4YM6A 5DNMC 4KGCC 1KX5C 1KX4C 3AZIB 3AN2D 3UT9B 3X1TB 5JA4A 1P3AB 5FUGB 1KX5D 3UTAA 3AZEB 3WTPC 1P3MD 4J8XA 1M18B 5B24A 5KDMA 1EQZA 1S32A 2HIOC 3V9RA 3WTPD 2CWEA 4XZQB 5CPIC 5AY8C 3MGSB 3AV2C 5B32C 5B32G 3AZLC 5B33B 4Z66B 5DNND 4YS3B 5CPJB 3X1SB 3B6FC 5AY8D 4WV4B 1P3FD 3A6NB 3AV2D 3WAAA 3O62B 4R8PC 3AYWA 3AZFB 4X23A 1AOIC 5GSUB 5B2JA 3MGPA 2YFWB 4E45A 3REHB 4R8PD 4AWLC 4KUDC 3W96C 4EO5C 3LZ0B 2IO5B 3REJB 1P34C 5BT1C 4WU8C 5G49A 3KWQA 1P3PA 3AV1A 3B6GA 3W96D 1BFMA 1ZLAB 3NQJB 1P3OA 1P34D
chains in the Genus database with same CATH superfamily
5AV5B 5BT1D 3AZHC 3AZMB 4WU8D 1ULYA 3B0CT 3AZIA 4HGAB 1P3BB 1M1AB 1ID3C 3AZJC 3UT9A 3X1TA 1P3AA 1P3KA 3LZ1B 1PZRA 5AV9B 3AZHD 5FUGA 5AVBC 5B2IB 1TZYB 4Z5TC 3MVDC 3AZEA 3MGQB 1B6WA 2RVQC 4XUJB 5AV6A 5F99B 3B0DB 1M18A 4Z5TD 3AZGD 1R4VA 3TU4C 2FJ7B 4ZUXB 2JSSA 1HQ3D 4XZQA 3MGSA 2RVQD 5GT3C 5B33A 4Z66A 3W98C 4YS3A 3X1SA 3TU4D 5CP6C 4G91B 5GT0B 5GT3D 3O62A 3AZFA 2CV5C 5CPKC 2VQRA 5GSUA 1H3OB 5DNMB 4J8UB 1KX4B 2YFWA 3REHA 5B31B 3RELB 2NQBB 3REKC 3UTAB 2CV5D 3KUYC 5JRGB 2BG1A 2ZY3A 3LZ0A 3REJA 2JCHA 5B1LB 3C1BC 5CPJD 1ZLAA 3NQJA 3KUYD 4DRBA 5AV5A 3MGRC 2HIOB 3AZMA 5GXQD 1M1AA 3KXBB 3C1BD 5B32B 4H9SC 3C1CB 3WAAB 4NE5A 5BNVB 3EG5B 3MGRD 5AV9A 3X1UC 5B2IA 1TZYA 4H9RB 5B40B 2AROB 1P3IB 4JJNB 3MGQA 3X1VC 1U35D 3LELC 3UTBC 4J8VC 3X1UD 5F99A 2F8ND 2FJ7A 3X1VD 1N1JB 3W99D 2PYOD 4KUDB 5B0ZB 5B0YD 3WKJB 4J8WC 5E5AB 2XD1A 1P3BD 4WU9C 1WWSA 1BH9A 3P5JB 5GT0A 3AN2A 2NZDC 4J8WD 2LY8A 3LZ1D 4G92C 3AZKC 4LD9C 1P3MC 1H3OA 5DNMA 3WA9B 4WU9D 3W97B 4J8UA 4ZBJB 1P3KB 1KX4A 3REIC 1F66B 4KGCA 5B31A 1ID3B 3RELA 3AZJB 2NQBA 2NZDD 4XUJD 3AZKD 4LD9D 1M19B 4WJ3C 5AVBB 1P3GB 5JRGA 5AV6B 3REID 1KX3B 4ZUXD 5DNNC 5B1LA 4Z2MG 1P3FC 5AVCB 4QLCB 4YM6D 2HIOA 5CPIA 3KXBA 5B32A 3AZLA 3C1CA 5BNVA 3VH6T 3NQUB 4J8XC 1BH8B 5CP6B 4H9RA 3B6FA 5B40A 1F1EA 2AROA 3UTAD 1P3IA 4JJNA 1S32C 5CPKB 4J8XD 1JFIB 1AOIA 2DF4C 5B1MB 5B24D 3MNNC 1EQZD 1S32D 1A7WA 1N1JA 4KUDA 4CAYB 3EPHA 2HUEC 5B0ZA 2F2AC 3WKJA 5C3IC 1P3LB 5E5AA 3AFAB 4X23C 3MNND 1WWIA 5B2JC 3VH6W 4WU8A 3MGPC 1HTAA 3WAAD 3AZNB 3AYWD 4X23D 5AV8B 2W8SA 5B2JD 3WA9A 3W97A 3MGPD 1F66A 1ID3A 3AZJA 3AZGC 3A1IA 3KWQC 3AV1C 1M19A 3B6GC 1HQ3C 5AVBA 1P3GA 3MVDA 1KX3A 3VH6A 3LELB 3KWQD 4UPKA 4CSRB 3WTPE 4J8VB 3AV1D 1P3PD 3B6GD 3UT9C 3X1TC 1P3OD 2F8NK 1KU5A 5BNXB 4QLCA 5AVCA 1P3AC 3A1KA 3LJAB 4DRAA 2Y2IA 3AZID 3AZEC 3AL0C 3UT9D 3X1TD 1BH9B 3W98A 3AN2B 3NQUA 1P3KD 1P3AD 1BH8A 3KFUG 5CP6A 3H0MC 1M18C 3AZED 2FFFB 4KGCB 1KX5B 2YFVA 5CPKA 4XZQC 3MGSC 1JFIA 1P3MB 4H9OB 2Y2QA 5B33C 4Z66C 1M18D 5B1MA 4M6BA 4YS3C 5CPJC 3REKA 4CAYA 4XZQD 3MGSD 3WTPB 3A6NC 3O62C 5GXQC 5B33D 4Z66D 3AZFC 1P3LA 2UWXA 4YS3D 3AFAA 3X1SD 5DNNB 5GSUC 5BO0A 3A6ND 3REHC 3O62D 3AZNA 1TAFB 5CPIB 5AY8B 3AZFD 3AV2B 3AZLB 5AV8A 5GSUD 1U35C 3REHD 2IO5C 3REJC 2F8NG 3B6FB 3R45B 4R8PB 3W99C 2PYOC 1ZLAC 1AOIB 5B0YC 3LZ0D 3REJD 5AV5C 3LELA 3UTBA 4HGAC 1P3BC 4CSRA 4J8VA 1M1AC 4AWLB 5CHLB 1ZLAD 5BNXA 3W96B 4EO5B 3LZ1C 5AV5D 3AZMD 5AV9C 3LJAA 4UUZB 5B2IC 1TZYC 2HUEB 1P34B 1M1AD 4WU8B 3MGQC 5BS7C 4XUJC 5AV9D 5B2ID 1TZYD 3AZHB 1KX5A 3MGQD 2FJ7C 4ZUXC 1P3MA 2F8NH 4H9OA 5F99D 2RIQA 4KHAB 3MVDB 4Z5TB 2FJ7D 4YM6C 4G91C 3WTPA 2JE5A 1HQ3B 4E44A 5DNNA 2Y2OA 4J8UC 3TU4B 5GT0D 5B31C 1TAFA 2L5AA 5AY8A 5B31G 3RELC 1P3FA 3UTAC 5GT3B 3AV2A 2NQBC 3W98B 5DNMD 4KGCD 4J8UD 3H0RC 1KX4D 5JRGC 5B31D 3RELD 2NQBD 5B24C 3R45A 5B1LC 1EQZC 4R8PA 2YFVB 4H9QA 2CV5B 5JRGD 3EPLA 5B1LD 2G5IC 4WNNB 3KXBC 3REKB 2Y2HA 3C1CC 4H9PB 3WAAC 3W96A 3MNNA 3AYWC 3F6TA 2HIOD 3KUYB 4UUZA 1P34A 5CPID 4Z2MH 3KXBD 5B40C 2AROC 5B32D 3AZLD 4JJNC 2BYMA 5GXQB 3C1CD 1P3IC 5BO0B 3C1BB 2Y2PA 2Y2GA 3MGRB 5B40D 3AZHA 3B6FD 2AROD 1P3ID 4JJND 2XD5A 1B67A 2Y2LA 5B0ZC 1AOID 4H9NA 1U35B 3WKJC 1P3PC 5E5AC 3X1UB 4KHAA 2F8NB 2BYKB 4Z5TA 1P3OC 3AZGA 4KUDD 5B0ZD 3X1VB 1HQ3A 2G5HC 2PYOB 3W99B 3WKJD 3UTBB 3AZIC 5E5AD 5B0YB 3WA9C 3W97C 1P3KC 4ZBJC 3TU4A 1F66C 5GT3A 3VH5T 4J8WB 3IP4C 3WA9D 1M19C 3W97D 1P3GC 1F66D 5AV6C 1KX3C 4WU9B 1ID3D 3AZJD 2NZDB 3AZKB 2CV5A 4G92B 4LD9B 1M19D 5AVBD 1P3GD 5AV6D 3MVDD 1KX3D 4QLCC 5AVCC 3REIB 3X1SC 4WNNA 3B0CW 4H9PA 4QLCD 5AVCD 5CPJA 3KUYA 2Y2NA 3VH5W 4YM6B 3A6NA 3B0BA 5GXQA 3W98D 3C1BA 1P3FB 2Y2JA 5JA4B 5CP6D 4WZSB 4NFTA 3MGRA 3EPJA 5B1MC 3LZ0C 1Q9CA 5CPKD 4H9SA 1U35A 4NE3A 4J8XB 1P3LC 4H9QB 5B1MD 3X1UA 3AFAC 2F8NA 2BYKA 2Y2MA 5B24B 3VH5A 5KDMB 3REKD 1EQZB 1S32B 3AZMC 3V9RB 3X1VA 3W99A 3AZNC 2PYOA 1P3LD 5B0YA 3AFAD 5AV8C 4NE6A 3MNNB 1P3BA 2DQNC 3AZND 2BYMB 5C3IB 5AV8D 3LZ1A 4J8WA 3AYWB 4X23B 5B2JB 4WU9A 5F99C 3B0DC 3MGPB 2NZDA 5BS7A 4XUJA 3AZKA 4LD9A 2ZM5A 3KSYA 3H0LC 4H9NB 3REIA 1W2EA 3LJAC 4ZUXA 3FDDA 2ZY5A 3LELD 3UTBD 3AZGB 4J8VD 5G49B 5GT0C 3KWQB 1P3PB 3AV1B 3EPKA 3B6GB 3AN2C 1P3OB 3LJAD 4YM6A 5DNMC 4KGCC 1KX5C 1KX4C 3AZIB 3AN2D 3UT9B 2Y2KA 3X1TB 5JA4A 1P3AB 5FUGB 4DQYB 1KX5D 3UTAA 3AZEB 1Z2CB 3WTPC 1P3MD 4J8XA 1M18B 5B24A 5KDMA 1EQZA 1S32A 2HIOC 3V9RA 3WTPD 2CWEA 4XZQB 5CPIC 5AY8C 3MGSB 2ZY4A 3AV2C 5B32C 5B32G 3AZLC 5B33B 4Z66B 5DNND 4YS3B 1T3UA 5CPJB 3X1SB 3B6FC 5AY8D 4WV4B 1P3FD 3A6NB 3AV2D 3WAAA 3O62B 4R8PC 3AYWA 3AZFB 4X23A 2J8PA 5GSUB 5B2JA 1AOIC 3MGPA 2YFWB 4E45A 3REHB 4R8PD 4AWLC 4KUDC 3W96C 4EO5C 3LZ0B 2IO5B 3REJB 1P34C 5BT1C 4WU8C 5G49A 3KWQA 1P3PA 3AV1A 3B6GA 2ZY2A 3W96D 1BFMA 1ZLAB 3NQJB 1P3OA 1P34D
chains in the Genus database with same CATH topology
5AV5B 5BT1D 3AZHC 3AZMB 4WU8D 1ULYA 3B0CT 3AZIA 4HGAB 1P3BB 1M1AB 1ID3C 3AZJC 3UT9A 3X1TA 1P3AA 1P3KA 3LZ1B 1PZRA 5AV9B 3AZHD 5FUGA 5AVBC 5B2IB 1TZYB 4Z5TC 3MVDC 3AZEA 3MGQB 1B6WA 2RVQC 4XUJB 5AV6A 5F99B 3B0DB 1M18A 4Z5TD 3AZGD 1R4VA 3TU4C 2FJ7B 4ZUXB 2JSSA 1HQ3D 4XZQA 3MGSA 2RVQD 5GT3C 5B33A 4Z66A 3W98C 4YS3A 3X1SA 3TU4D 5CP6C 4G91B 5GT0B 5GT3D 3O62A 3AZFA 2CV5C 5CPKC 2VQRA 5GSUA 1H3OB 5DNMB 4J8UB 1KX4B 2YFWA 3REHA 5B31B 3RELB 2NQBB 3REKC 3UTAB 2CV5D 3KUYC 5JRGB 2BG1A 2ZY3A 3LZ0A 3REJA 2JCHA 5B1LB 3C1BC 5CPJD 1ZLAA 3NQJA 3KUYD 4DRBA 5AV5A 3MGRC 2HIOB 3AZMA 5GXQD 1M1AA 3KXBB 3C1BD 5B32B 4H9SC 3C1CB 3WAAB 4NE5A 5BNVB 3EG5B 3MGRD 5AV9A 3X1UC 5B2IA 1TZYA 4H9RB 5B40B 2AROB 1P3IB 4JJNB 3MGQA 3X1VC 1U35D 3LELC 3UTBC 4J8VC 3X1UD 5F99A 2F8ND 2FJ7A 3X1VD 1N1JB 3W99D 2PYOD 4KUDB 5B0ZB 5B0YD 3WKJB 4J8WC 5E5AB 2XD1A 1P3BD 4WU9C 1WWSA 1BH9A 3P5JB 5GT0A 3AN2A 2NZDC 4J8WD 2LY8A 3LZ1D 4G92C 3AZKC 4LD9C 1P3MC 1H3OA 5DNMA 3WA9B 4WU9D 3W97B 4J8UA 4ZBJB 1P3KB 1KX4A 3REIC 1F66B 4KGCA 5B31A 1ID3B 3RELA 3AZJB 2NQBA 2NZDD 4XUJD 3AZKD 4LD9D 1M19B 4WJ3C 5AVBB 1P3GB 5JRGA 5AV6B 3REID 1KX3B 4ZUXD 5DNNC 5B1LA 4Z2MG 1P3FC 5AVCB 4QLCB 4YM6D 2HIOA 5CPIA 3KXBA 5B32A 3AZLA 3C1CA 5BNVA 3VH6T 3NQUB 4J8XC 1BH8B 5CP6B 4H9RA 3B6FA 5B40A 1F1EA 2AROA 3UTAD 1P3IA 4JJNA 1S32C 5CPKB 4J8XD 1JFIB 1AOIA 2DF4C 5B1MB 5B24D 3MNNC 1EQZD 1S32D 1A7WA 1N1JA 4KUDA 4CAYB 3EPHA 2HUEC 5B0ZA 2F2AC 3WKJA 5C3IC 1P3LB 5E5AA 3AFAB 4X23C 3MNND 1WWIA 5B2JC 3VH6W 4WU8A 3MGPC 1HTAA 3WAAD 3AZNB 3AYWD 4X23D 5AV8B 2W8SA 5B2JD 3WA9A 3W97A 3MGPD 1F66A 1ID3A 3AZJA 3AZGC 3A1IA 3KWQC 3AV1C 1M19A 3B6GC 1HQ3C 5AVBA 1P3GA 3MVDA 1KX3A 3VH6A 3LELB 3KWQD 4UPKA 4CSRB 3WTPE 4J8VB 3AV1D 1P3PD 3B6GD 3UT9C 3X1TC 1P3OD 2F8NK 1KU5A 5BNXB 4QLCA 5AVCA 1P3AC 3A1KA 3LJAB 4DRAA 2Y2IA 3AZID 3AZEC 3AL0C 3UT9D 3X1TD 1BH9B 3W98A 3AN2B 3NQUA 1P3KD 1P3AD 1BH8A 3KFUG 5CP6A 3H0MC 1M18C 3AZED 2FFFB 4KGCB 1KX5B 2YFVA 5CPKA 4XZQC 3MGSC 1JFIA 1P3MB 4H9OB 2Y2QA 5B33C 4Z66C 1M18D 5B1MA 4M6BA 4YS3C 5CPJC 3REKA 4CAYA 4XZQD 3MGSD 3WTPB 3A6NC 3O62C 5GXQC 5B33D 4Z66D 3AZFC 1P3LA 2UWXA 4YS3D 3AFAA 3X1SD 5DNNB 5GSUC 5BO0A 3A6ND 3REHC 3O62D 3AZNA 1TAFB 5CPIB 5AY8B 3AZFD 3AV2B 3AZLB 5AV8A 5GSUD 1U35C 3REHD 2IO5C 3REJC 2F8NG 3B6FB 3R45B 4R8PB 3W99C 2PYOC 1ZLAC 1AOIB 5B0YC 3LZ0D 3REJD 5AV5C 3LELA 3UTBA 4HGAC 1P3BC 4CSRA 4J8VA 1M1AC 4AWLB 5CHLB 1ZLAD 5BNXA 3W96B 4EO5B 3LZ1C 5AV5D 3AZMD 5AV9C 3LJAA 4UUZB 5B2IC 1TZYC 2HUEB 1P34B 1M1AD 4WU8B 3MGQC 5BS7C 4XUJC 5AV9D 5B2ID 1TZYD 3AZHB 1KX5A 3MGQD 2FJ7C 4ZUXC 1P3MA 2F8NH 4H9OA 5F99D 2RIQA 4KHAB 3MVDB 4Z5TB 2FJ7D 4YM6C 4G91C 3WTPA 2JE5A 1HQ3B 4E44A 5DNNA 2Y2OA 4J8UC 3TU4B 5GT0D 5B31C 1TAFA 2L5AA 5AY8A 5B31G 3RELC 1P3FA 3UTAC 5GT3B 3AV2A 2NQBC 3W98B 5DNMD 4KGCD 4J8UD 3H0RC 1KX4D 5JRGC 5B31D 3RELD 2NQBD 5B24C 3R45A 5B1LC 1EQZC 4R8PA 2YFVB 4H9QA 2CV5B 5JRGD 3EPLA 5B1LD 2G5IC 4WNNB 3KXBC 3REKB 2Y2HA 3C1CC 4H9PB 3WAAC 3W96A 3MNNA 3AYWC 3F6TA 2HIOD 3KUYB 4UUZA 1P34A 5CPID 4Z2MH 3KXBD 5B40C 2AROC 5B32D 3AZLD 4JJNC 2BYMA 5GXQB 3C1CD 1P3IC 5BO0B 3C1BB 2Y2PA 2Y2GA 3MGRB 5B40D 3AZHA 3B6FD 2AROD 1P3ID 4JJND 2XD5A 1B67A 2Y2LA 5B0ZC 1AOID 4H9NA 1U35B 3WKJC 1P3PC 5E5AC 3X1UB 4KHAA 2F8NB 2BYKB 4Z5TA 1P3OC 3AZGA 4KUDD 5B0ZD 3X1VB 1HQ3A 2G5HC 2PYOB 3W99B 3WKJD 3UTBB 3AZIC 5E5AD 5B0YB 3WA9C 3W97C 1P3KC 4ZBJC 3TU4A 1F66C 5GT3A 3VH5T 4J8WB 3IP4C 3WA9D 1M19C 3W97D 1P3GC 1F66D 5AV6C 1KX3C 4WU9B 1ID3D 3AZJD 2NZDB 3AZKB 2CV5A 4G92B 4LD9B 1M19D 5AVBD 1P3GD 5AV6D 3MVDD 1KX3D 4QLCC 5AVCC 3REIB 3X1SC 4WNNA 3B0CW 4H9PA 4QLCD 5AVCD 5CPJA 3KUYA 2Y2NA 3VH5W 4YM6B 3A6NA 3B0BA 5GXQA 3W98D 3C1BA 1P3FB 2Y2JA 5JA4B 5CP6D 4WZSB 4NFTA 3MGRA 3EPJA 5B1MC 3LZ0C 1Q9CA 5CPKD 4H9SA 1U35A 4NE3A 4J8XB 1P3LC 4H9QB 5B1MD 3X1UA 3AFAC 2F8NA 2BYKA 2Y2MA 5B24B 3VH5A 5KDMB 3REKD 1EQZB 1S32B 3AZMC 3V9RB 3X1VA 3W99A 3AZNC 2PYOA 1P3LD 5B0YA 3AFAD 5AV8C 4NE6A 3MNNB 1P3BA 2DQNC 3AZND 2BYMB 5C3IB 5AV8D 3LZ1A 4J8WA 3AYWB 4X23B 5B2JB 4WU9A 5F99C 3B0DC 3MGPB 2NZDA 5BS7A 4XUJA 3AZKA 4LD9A 2ZM5A 3KSYA 3H0LC 4H9NB 3REIA 1W2EA 3LJAC 4ZUXA 3FDDA 2ZY5A 3LELD 3UTBD 3AZGB 4J8VD 5G49B 5GT0C 3KWQB 1P3PB 3AV1B 3EPKA 3B6GB 3AN2C 1P3OB 3LJAD 4YM6A 5DNMC 4KGCC 1KX5C 1KX4C 3AZIB 3AN2D 3UT9B 2Y2KA 3X1TB 5JA4A 1P3AB 5FUGB 4DQYB 1KX5D 3UTAA 3AZEB 1Z2CB 3WTPC 1P3MD 4J8XA 1M18B 5B24A 5KDMA 1EQZA 1S32A 2HIOC 3V9RA 3WTPD 2CWEA 4XZQB 5CPIC 5AY8C 3MGSB 2ZY4A 3AV2C 5B32C 5B32G 3AZLC 5B33B 4Z66B 5DNND 4YS3B 1T3UA 5CPJB 3X1SB 3B6FC 5AY8D 4WV4B 1P3FD 3A6NB 3AV2D 3WAAA 3O62B 4R8PC 3AYWA 3AZFB 4X23A 2J8PA 5GSUB 5B2JA 1AOIC 3MGPA 2YFWB 4E45A 3REHB 4R8PD 4AWLC 4KUDC 3W96C 4EO5C 3LZ0B 2IO5B 3REJB 1P34C 5BT1C 4WU8C 5G49A 3KWQA 1P3PA 3AV1A 3B6GA 2ZY2A 3W96D 1BFMA 1ZLAB 3NQJB 1P3OA 1P34D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 B;  5BT1 D;  3AZH C;  3AZM B;  4WU8 D;  1ULY A;  3B0C T;  3AZI A;  4HGA B;  1P3B B;  1M1A B;  1ID3 C;  3AZJ C;  3UT9 A;  3X1T A;  1P3A A;  1P3K A;  3LZ1 B;  5AV9 B;  3AZH D;  5FUG A;  5AVB C;  5B2I B;  1TZY B;  4Z5T C;  3MVD C;  3AZE A;  3MGQ B;  1B6W A;  2RVQ C;  4XUJ B;  5AV6 A;  5F99 B;  3B0D B;  1M18 A;  4Z5T D;  3AZG D;  1R4V A;  3TU4 C;  2FJ7 B;  4ZUX B;  2JSS A;  1HQ3 D;  4XZQ A;  3MGS A;  2RVQ D;  5GT3 C;  5B33 A;  4Z66 A;  3W98 C;  4YS3 A;  3X1S A;  3TU4 D;  5CP6 C;  4G91 B;  5GT0 B;  5GT3 D;  3O62 A;  3AZF A;  2CV5 C;  5CPK C;  5GSU A;  1H3O B;  5DNM B;  4J8U B;  1KX4 B;  2YFW A;  3REH A;  5B31 B;  3REL B;  2NQB B;  3REK C;  3UTA B;  2CV5 D;  3KUY C;  5JRG B;  3LZ0 A;  3REJ A;  5B1L B;  3C1B C;  5CPJ D;  1ZLA A;  3NQJ A;  3KUY D;  4DRB A;  5AV5 A;  3MGR C;  2HIO B;  3AZM A;  5GXQ D;  1M1A A;  3KXB B;  3C1B D;  5B32 B;  4H9S C;  3C1C B;  3WAA B;  4NE5 A;  5BNV B;  3MGR D;  5AV9 A;  3X1U C;  5B2I A;  4H9R B;  1TZY A;  5B40 B;  2ARO B;  1P3I B;  4JJN B;  3MGQ A;  3X1V C;  1U35 D;  3LEL C;  3UTB C;  4J8V C;  3X1U D;  5F99 A;  2F8N D;  2FJ7 A;  3X1V D;  1N1J B;  3W99 D;  2PYO D;  4KUD B;  5B0Z B;  5B0Y D;  3WKJ B;  4J8W C;  5E5A B;  1P3B D;  4WU9 C;  1WWS A;  1BH9 A;  5GT0 A;  3AN2 A;  2NZD C;  4J8W D;  2LY8 A;  3LZ1 D;  4G92 C;  3AZK C;  4LD9 C;  1P3M C;  1H3O A;  5DNM A;  3WA9 B;  4WU9 D;  3W97 B;  4J8U A;  4ZBJ B;  1P3K B;  1KX4 A;  3REI C;  1F66 B;  4KGC A;  5B31 A;  1ID3 B;  3REL A;  3AZJ B;  2NQB A;  2NZD D;  4XUJ D;  3AZK D;  4LD9 D;  1M19 B;  5AVB B;  1P3G B;  5JRG A;  5AV6 B;  3REI D;  1KX3 B;  4ZUX D;  5DNN C;  5B1L A;  4Z2M G;  1P3F C;  4QLC B;  5AVC B;  4YM6 D;  2HIO A;  5CPI A;  3KXB A;  5B32 A;  3AZL A;  3C1C A;  5BNV A;  3VH6 T;  3NQU B;  4J8X C;  1BH8 B;  5CP6 B;  4H9R A;  3B6F A;  5B40 A;  1F1E A;  2ARO A;  3UTA D;  1P3I A;  4JJN A;  1S32 C;  5CPK B;  4J8X D;  1JFI B;  1AOI A;  5B1M B;  5B24 D;  3MNN C;  1EQZ D;  1S32 D;  1A7W A;  1N1J A;  4KUD A;  4CAY B;  2HUE C;  5B0Z A;  3WKJ A;  5C3I C;  1P3L B;  5E5A A;  3AFA B;  4X23 C;  3MNN D;  1WWI A;  5B2J C;  3VH6 W;  4WU8 A;  3MGP C;  1HTA A;  3WAA D;  3AZN B;  3AYW D;  4X23 D;  5AV8 B;  5B2J D;  3WA9 A;  3W97 A;  3MGP D;  1F66 A;  1ID3 A;  3AZJ A;  3AZG C;  3KWQ C;  3AV1 C;  1M19 A;  3B6G C;  1HQ3 C;  5AVB A;  1P3G A;  3MVD A;  1KX3 A;  3VH6 A;  3LEL B;  3KWQ D;  3WTP E;  4CSR B;  4J8V B;  3AV1 D;  1P3P D;  3B6G D;  3UT9 C;  3X1T C;  1P3O D;  2F8N K;  1KU5 A;  5BNX B;  4QLC A;  5AVC A;  1P3A C;  3LJA B;  4DRA A;  3AZI D;  3AZE C;  3UT9 D;  3X1T D;  1BH9 B;  3W98 A;  3AN2 B;  3NQU A;  1P3K D;  1P3A D;  1BH8 A;  5CP6 A;  1M18 C;  3AZE D;  4KGC B;  1KX5 B;  2YFV A;  5CPK A;  4XZQ C;  3MGS C;  1JFI A;  1P3M B;  4H9O B;  5B33 C;  4Z66 C;  1M18 D;  5B1M A;  4M6B A;  4YS3 C;  5CPJ C;  3REK A;  4CAY A;  4XZQ D;  3MGS D;  3WTP B;  3A6N C;  3O62 C;  5GXQ C;  4Z66 D;  5B33 D;  3AZF C;  1P3L A;  4YS3 D;  3AFA A;  3X1S D;  5DNN B;  5GSU C;  5BO0 A;  3A6N D;  3REH C;  3O62 D;  3AZN A;  1TAF B;  5CPI B;  5AY8 B;  3AZF D;  3AV2 B;  3AZL B;  5AV8 A;  5GSU D;  1U35 C;  3REH D;  2IO5 C;  3REJ C;  2F8N G;  3B6F B;  3R45 B;  4R8P B;  3W99 C;  2PYO C;  1ZLA C;  1AOI B;  5B0Y C;  3LZ0 D;  3REJ D;  5AV5 C;  3LEL A;  3UTB A;  4HGA C;  1P3B C;  4CSR A;  4J8V A;  1M1A C;  4AWL B;  5CHL B;  1ZLA D;  5BNX A;  3W96 B;  4EO5 B;  3LZ1 C;  5AV5 D;  3AZM D;  5AV9 C;  3LJA A;  4UUZ B;  5B2I C;  1TZY C;  2HUE B;  1P34 B;  1M1A D;  4WU8 B;  3MGQ C;  5BS7 C;  4XUJ C;  5AV9 D;  5B2I D;  1TZY D;  3AZH B;  1KX5 A;  3MGQ D;  2FJ7 C;  4ZUX C;  1P3M A;  2F8N H;  4H9O A;  5F99 D;  4KHA B;  3MVD B;  4Z5T B;  2FJ7 D;  4YM6 C;  4G91 C;  3WTP A;  1HQ3 B;  4E44 A;  5DNN A;  4J8U C;  3TU4 B;  5GT0 D;  5B31 C;  1TAF A;  2L5A A;  5AY8 A;  5B31 G;  3REL C;  1P3F A;  3UTA C;  5GT3 B;  3AV2 A;  2NQB C;  3W98 B;  5DNM D;  4KGC D;  4J8U D;  1KX4 D;  5JRG C;  5B31 D;  3REL D;  2NQB D;  5B24 C;  3R45 A;  5B1L C;  1EQZ C;  4R8P A;  2YFV B;  4H9Q A;  2CV5 B;  5JRG D;  5B1L D;  4WNN B;  3KXB C;  3REK B;  3C1C C;  4H9P B;  3WAA C;  3W96 A;  3MNN A;  3AYW C;  3KUY B;  2HIO D;  4UUZ A;  1P34 A;  5CPI D;  4Z2M H;  3KXB D;  5B40 C;  2ARO C;  5B32 D;  3AZL D;  4JJN C;  2BYM A;  5GXQ B;  3C1C D;  1P3I C;  5BO0 B;  3C1B B;  3MGR B;  5B40 D;  3AZH A;  3B6F D;  2ARO D;  1P3I D;  4JJN D;  1B67 A;  5B0Z C;  1AOI D;  4H9N A;  1U35 B;  3WKJ C;  1P3P C;  5E5A C;  3X1U B;  4KHA A;  2F8N B;  2BYK B;  4Z5T A;  1P3O C;  3AZG A;  4KUD D;  5B0Z D;  3X1V B;  1HQ3 A;  3W99 B;  2PYO B;  3WKJ D;  3UTB B;  3AZI C;  5E5A D;  5B0Y B;  3WA9 C;  3W97 C;  1P3K C;  4ZBJ C;  3TU4 A;  1F66 C;  5GT3 A;  3VH5 T;  4J8W B;  3WA9 D;  1M19 C;  3W97 D;  1P3G C;  1F66 D;  5AV6 C;  1KX3 C;  4WU9 B;  1ID3 D;  3AZJ D;  2NZD B;  3AZK B;  2CV5 A;  4G92 B;  4LD9 B;  1M19 D;  5AVB D;  1P3G D;  5AV6 D;  3MVD D;  1KX3 D;  4QLC C;  5AVC C;  3REI B;  3X1S C;  4WNN A;  3B0C W;  4H9P A;  4QLC D;  5AVC D;  5CPJ A;  3KUY A;  3VH5 W;  4YM6 B;  3A6N A;  3B0B A;  5GXQ A;  3W98 D;  3C1B A;  1P3F B;  5JA4 B;  5CP6 D;  4WZS B;  4NFT A;  3MGR A;  5B1M C;  3LZ0 C;  1Q9C A;  5CPK D;  4H9S A;  1U35 A;  4NE3 A;  4J8X B;  1P3L C;  4H9Q B;  5B1M D;  3X1U A;  3AFA C;  2F8N A;  2BYK A;  5B24 B;  3VH5 A;  5KDM B;  3REK D;  1EQZ B;  1S32 B;  3AZM C;  3V9R B;  3X1V A;  3W99 A;  3AZN C;  2PYO A;  1P3L D;  5B0Y A;  3AFA D;  5AV8 C;  4NE6 A;  3MNN B;  1P3B A;  3AZN D;  2BYM B;  5C3I B;  5AV8 D;  3LZ1 A;  4J8W A;  3AYW B;  4X23 B;  5B2J B;  4WU9 A;  5F99 C;  3B0D C;  3MGP B;  2NZD A;  5BS7 A;  4XUJ A;  3AZK A;  4LD9 A;  3KSY A;  4H9N B;  3REI A;  3LJA C;  4ZUX A;  3LEL D;  3UTB D;  3AZG B;  4J8V D;  5G49 B;  5GT0 C;  3KWQ B;  1P3P B;  3AV1 B;  3B6G B;  3AN2 C;  1P3O B;  3LJA D;  4YM6 A;  5DNM C;  4KGC C;  1KX5 C;  1KX4 C;  3AZI B;  3AN2 D;  3UT9 B;  3X1T B;  5JA4 A;  1P3A B;  5FUG B;  1KX5 D;  3UTA A;  3AZE B;  3WTP C;  1P3M D;  4J8X A;  1M18 B;  5B24 A;  5KDM A;  1EQZ A;  1S32 A;  2HIO C;  3V9R A;  3WTP D;  2CWE A;  4XZQ B;  5CPI C;  5AY8 C;  3MGS B;  3AV2 C;  5B32 C;  5B32 G;  3AZL C;  5B33 B;  4Z66 B;  5DNN D;  4YS3 B;  5CPJ B;  3X1S B;  3B6F C;  5AY8 D;  4WV4 B;  1P3F D;  3A6N B;  3AV2 D;  3WAA A;  3O62 B;  4R8P C;  3AYW A;  3AZF B;  4X23 A;  1AOI C;  5GSU B;  5B2J A;  3MGP A;  2YFW B;  4E45 A;  3REH B;  4R8P D;  4AWL C;  4KUD C;  3W96 C;  4EO5 C;  3LZ0 B;  2IO5 B;  3REJ B;  1P34 C;  5BT1 C;  4WU8 C;  5G49 A;  3KWQ A;  1P3P A;  3AV1 A;  3B6G A;  3W96 D;  1BFM A;  1ZLA B;  3NQJ B;  1P3O A;  1P34 D; 
#chains in the Genus database with same CATH topology
 5AV5 B;  5BT1 D;  3AZH C;  3AZM B;  4WU8 D;  1ULY A;  3B0C T;  3AZI A;  4HGA B;  1P3B B;  1M1A B;  1ID3 C;  3AZJ C;  3UT9 A;  3X1T A;  1P3A A;  1P3K A;  3LZ1 B;  1PZR A;  5AV9 B;  3AZH D;  5FUG A;  5AVB C;  5B2I B;  1TZY B;  4Z5T C;  3MVD C;  3AZE A;  3MGQ B;  1B6W A;  2RVQ C;  4XUJ B;  5AV6 A;  5F99 B;  3B0D B;  1M18 A;  4Z5T D;  3AZG D;  1R4V A;  3TU4 C;  2FJ7 B;  4ZUX B;  2JSS A;  1HQ3 D;  4XZQ A;  3MGS A;  2RVQ D;  5GT3 C;  5B33 A;  4Z66 A;  3W98 C;  4YS3 A;  3X1S A;  3TU4 D;  5CP6 C;  4G91 B;  5GT0 B;  5GT3 D;  3O62 A;  3AZF A;  2CV5 C;  5CPK C;  2VQR A;  5GSU A;  1H3O B;  5DNM B;  4J8U B;  1KX4 B;  2YFW A;  3REH A;  5B31 B;  3REL B;  2NQB B;  3REK C;  3UTA B;  2CV5 D;  3KUY C;  5JRG B;  2BG1 A;  2ZY3 A;  3LZ0 A;  3REJ A;  2JCH A;  5B1L B;  3C1B C;  5CPJ D;  1ZLA A;  3NQJ A;  3KUY D;  4DRB A;  5AV5 A;  3MGR C;  2HIO B;  3AZM A;  5GXQ D;  1M1A A;  3KXB B;  3C1B D;  5B32 B;  4H9S C;  3C1C B;  3WAA B;  4NE5 A;  5BNV B;  3EG5 B;  3MGR D;  5AV9 A;  3X1U C;  5B2I A;  1TZY A;  4H9R B;  5B40 B;  2ARO B;  1P3I B;  4JJN B;  3MGQ A;  3X1V C;  1U35 D;  3LEL C;  3UTB C;  4J8V C;  3X1U D;  5F99 A;  2F8N D;  2FJ7 A;  3X1V D;  1N1J B;  3W99 D;  2PYO D;  4KUD B;  5B0Z B;  5B0Y D;  3WKJ B;  4J8W C;  5E5A B;  2XD1 A;  1P3B D;  4WU9 C;  1WWS A;  1BH9 A;  3P5J B;  5GT0 A;  3AN2 A;  2NZD C;  4J8W D;  2LY8 A;  3LZ1 D;  4G92 C;  3AZK C;  4LD9 C;  1P3M C;  1H3O A;  5DNM A;  3WA9 B;  4WU9 D;  3W97 B;  4J8U A;  4ZBJ B;  1P3K B;  1KX4 A;  3REI C;  1F66 B;  4KGC A;  5B31 A;  1ID3 B;  3REL A;  3AZJ B;  2NQB A;  2NZD D;  4XUJ D;  3AZK D;  4LD9 D;  1M19 B;  4WJ3 C;  5AVB B;  1P3G B;  5JRG A;  5AV6 B;  3REI D;  1KX3 B;  4ZUX D;  5DNN C;  5B1L A;  4Z2M G;  1P3F C;  5AVC B;  4QLC B;  4YM6 D;  2HIO A;  5CPI A;  3KXB A;  5B32 A;  3AZL A;  3C1C A;  5BNV A;  3VH6 T;  3NQU B;  4J8X C;  1BH8 B;  5CP6 B;  4H9R A;  3B6F A;  5B40 A;  1F1E A;  2ARO A;  3UTA D;  1P3I A;  4JJN A;  1S32 C;  5CPK B;  4J8X D;  1JFI B;  1AOI A;  2DF4 C;  5B1M B;  5B24 D;  3MNN C;  1EQZ D;  1S32 D;  1A7W A;  1N1J A;  4KUD A;  4CAY B;  3EPH A;  2HUE C;  5B0Z A;  2F2A C;  3WKJ A;  5C3I C;  1P3L B;  5E5A A;  3AFA B;  4X23 C;  3MNN D;  1WWI A;  5B2J C;  3VH6 W;  4WU8 A;  3MGP C;  1HTA A;  3WAA D;  3AZN B;  3AYW D;  4X23 D;  5AV8 B;  2W8S A;  5B2J D;  3WA9 A;  3W97 A;  3MGP D;  1F66 A;  1ID3 A;  3AZJ A;  3AZG C;  3A1I A;  3KWQ C;  3AV1 C;  1M19 A;  3B6G C;  1HQ3 C;  5AVB A;  1P3G A;  3MVD A;  1KX3 A;  3VH6 A;  3LEL B;  3KWQ D;  4UPK A;  4CSR B;  3WTP E;  4J8V B;  3AV1 D;  1P3P D;  3B6G D;  3UT9 C;  3X1T C;  1P3O D;  2F8N K;  1KU5 A;  5BNX B;  4QLC A;  5AVC A;  1P3A C;  3A1K A;  3LJA B;  4DRA A;  2Y2I A;  3AZI D;  3AZE C;  3AL0 C;  3UT9 D;  3X1T D;  1BH9 B;  3W98 A;  3AN2 B;  3NQU A;  1P3K D;  1P3A D;  1BH8 A;  3KFU G;  5CP6 A;  3H0M C;  1M18 C;  3AZE D;  2FFF B;  4KGC B;  1KX5 B;  2YFV A;  5CPK A;  4XZQ C;  3MGS C;  1JFI A;  1P3M B;  4H9O B;  2Y2Q A;  5B33 C;  4Z66 C;  1M18 D;  5B1M A;  4M6B A;  4YS3 C;  5CPJ C;  3REK A;  4CAY A;  4XZQ D;  3MGS D;  3WTP B;  3A6N C;  3O62 C;  5GXQ C;  5B33 D;  4Z66 D;  3AZF C;  1P3L A;  2UWX A;  4YS3 D;  3AFA A;  3X1S D;  5DNN B;  5GSU C;  5BO0 A;  3A6N D;  3REH C;  3O62 D;  3AZN A;  1TAF B;  5CPI B;  5AY8 B;  3AZF D;  3AV2 B;  3AZL B;  5AV8 A;  5GSU D;  1U35 C;  3REH D;  2IO5 C;  3REJ C;  2F8N G;  3B6F B;  3R45 B;  4R8P B;  3W99 C;  2PYO C;  1ZLA C;  1AOI B;  5B0Y C;  3LZ0 D;  3REJ D;  5AV5 C;  3LEL A;  3UTB A;  4HGA C;  1P3B C;  4CSR A;  4J8V A;  1M1A C;  4AWL B;  5CHL B;  1ZLA D;  5BNX A;  3W96 B;  4EO5 B;  3LZ1 C;  5AV5 D;  3AZM D;  5AV9 C;  3LJA A;  4UUZ B;  5B2I C;  1TZY C;  2HUE B;  1P34 B;  1M1A D;  4WU8 B;  3MGQ C;  5BS7 C;  4XUJ C;  5AV9 D;  5B2I D;  1TZY D;  3AZH B;  1KX5 A;  3MGQ D;  2FJ7 C;  4ZUX C;  1P3M A;  2F8N H;  4H9O A;  5F99 D;  2RIQ A;  4KHA B;  3MVD B;  4Z5T B;  2FJ7 D;  4YM6 C;  4G91 C;  3WTP A;  2JE5 A;  1HQ3 B;  4E44 A;  5DNN A;  2Y2O A;  4J8U C;  3TU4 B;  5GT0 D;  5B31 C;  1TAF A;  2L5A A;  5AY8 A;  5B31 G;  3REL C;  1P3F A;  3UTA C;  5GT3 B;  3AV2 A;  2NQB C;  3W98 B;  5DNM D;  4KGC D;  4J8U D;  3H0R C;  1KX4 D;  5JRG C;  5B31 D;  3REL D;  2NQB D;  5B24 C;  3R45 A;  5B1L C;  1EQZ C;  4R8P A;  2YFV B;  4H9Q A;  2CV5 B;  5JRG D;  3EPL A;  5B1L D;  2G5I C;  4WNN B;  3KXB C;  3REK B;  2Y2H A;  3C1C C;  4H9P B;  3WAA C;  3W96 A;  3MNN A;  3AYW C;  3F6T A;  2HIO D;  3KUY B;  4UUZ A;  1P34 A;  5CPI D;  4Z2M H;  3KXB D;  5B40 C;  2ARO C;  5B32 D;  3AZL D;  4JJN C;  2BYM A;  5GXQ B;  3C1C D;  1P3I C;  5BO0 B;  3C1B B;  2Y2P A;  2Y2G A;  3MGR B;  5B40 D;  3AZH A;  3B6F D;  2ARO D;  1P3I D;  4JJN D;  2XD5 A;  1B67 A;  2Y2L A;  5B0Z C;  1AOI D;  4H9N A;  1U35 B;  3WKJ C;  1P3P C;  5E5A C;  3X1U B;  4KHA A;  2F8N B;  2BYK B;  4Z5T A;  1P3O C;  3AZG A;  4KUD D;  5B0Z D;  3X1V B;  1HQ3 A;  2G5H C;  2PYO B;  3W99 B;  3WKJ D;  3UTB B;  3AZI C;  5E5A D;  5B0Y B;  3WA9 C;  3W97 C;  1P3K C;  4ZBJ C;  3TU4 A;  1F66 C;  5GT3 A;  3VH5 T;  4J8W B;  3IP4 C;  3WA9 D;  1M19 C;  3W97 D;  1P3G C;  1F66 D;  5AV6 C;  1KX3 C;  4WU9 B;  1ID3 D;  3AZJ D;  2NZD B;  3AZK B;  2CV5 A;  4G92 B;  4LD9 B;  1M19 D;  5AVB D;  1P3G D;  5AV6 D;  3MVD D;  1KX3 D;  4QLC C;  5AVC C;  3REI B;  3X1S C;  4WNN A;  3B0C W;  4H9P A;  4QLC D;  5AVC D;  5CPJ A;  3KUY A;  2Y2N A;  3VH5 W;  4YM6 B;  3A6N A;  3B0B A;  5GXQ A;  3W98 D;  3C1B A;  1P3F B;  2Y2J A;  5JA4 B;  5CP6 D;  4WZS B;  4NFT A;  3MGR A;  3EPJ A;  5B1M C;  3LZ0 C;  1Q9C A;  5CPK D;  4H9S A;  1U35 A;  4NE3 A;  4J8X B;  1P3L C;  4H9Q B;  5B1M D;  3X1U A;  3AFA C;  2F8N A;  2BYK A;  2Y2M A;  5B24 B;  3VH5 A;  5KDM B;  3REK D;  1EQZ B;  1S32 B;  3AZM C;  3V9R B;  3X1V A;  3W99 A;  3AZN C;  2PYO A;  1P3L D;  5B0Y A;  3AFA D;  5AV8 C;  4NE6 A;  3MNN B;  1P3B A;  2DQN C;  3AZN D;  2BYM B;  5C3I B;  5AV8 D;  3LZ1 A;  4J8W A;  3AYW B;  4X23 B;  5B2J B;  4WU9 A;  5F99 C;  3B0D C;  3MGP B;  2NZD A;  5BS7 A;  4XUJ A;  3AZK A;  4LD9 A;  2ZM5 A;  3KSY A;  3H0L C;  4H9N B;  3REI A;  1W2E A;  3LJA C;  4ZUX A;  3FDD A;  2ZY5 A;  3LEL D;  3UTB D;  3AZG B;  4J8V D;  5G49 B;  5GT0 C;  3KWQ B;  1P3P B;  3AV1 B;  3EPK A;  3B6G B;  3AN2 C;  1P3O B;  3LJA D;  4YM6 A;  5DNM C;  4KGC C;  1KX5 C;  1KX4 C;  3AZI B;  3AN2 D;  3UT9 B;  2Y2K A;  3X1T B;  5JA4 A;  1P3A B;  5FUG B;  4DQY B;  1KX5 D;  3UTA A;  3AZE B;  1Z2C B;  3WTP C;  1P3M D;  4J8X A;  1M18 B;  5B24 A;  5KDM A;  1EQZ A;  1S32 A;  2HIO C;  3V9R A;  3WTP D;  2CWE A;  4XZQ B;  5CPI C;  5AY8 C;  3MGS B;  2ZY4 A;  3AV2 C;  5B32 C;  5B32 G;  3AZL C;  5B33 B;  4Z66 B;  5DNN D;  4YS3 B;  1T3U A;  5CPJ B;  3X1S B;  3B6F C;  5AY8 D;  4WV4 B;  1P3F D;  3A6N B;  3AV2 D;  3WAA A;  3O62 B;  4R8P C;  3AYW A;  3AZF B;  4X23 A;  2J8P A;  5GSU B;  5B2J A;  1AOI C;  3MGP A;  2YFW B;  4E45 A;  3REH B;  4R8P D;  4AWL C;  4KUD C;  3W96 C;  4EO5 C;  3LZ0 B;  2IO5 B;  3REJ B;  1P34 C;  5BT1 C;  4WU8 C;  5G49 A;  3KWQ A;  1P3P A;  3AV1 A;  3B6G A;  2ZY2 A;  3W96 D;  1BFM A;  1ZLA B;  3NQJ B;  1P3O A;  1P34 D; 
#chains in the Genus database with same CATH homology
 5AV5 B;  5BT1 D;  3AZH C;  3AZM B;  4WU8 D;  1ULY A;  3B0C T;  3AZI A;  4HGA B;  1P3B B;  1M1A B;  1ID3 C;  3AZJ C;  3UT9 A;  3X1T A;  1P3A A;  1P3K A;  3LZ1 B;  1PZR A;  5AV9 B;  3AZH D;  5FUG A;  5AVB C;  5B2I B;  1TZY B;  4Z5T C;  3MVD C;  3AZE A;  3MGQ B;  1B6W A;  2RVQ C;  4XUJ B;  5AV6 A;  5F99 B;  3B0D B;  1M18 A;  4Z5T D;  3AZG D;  1R4V A;  3TU4 C;  2FJ7 B;  4ZUX B;  2JSS A;  1HQ3 D;  4XZQ A;  3MGS A;  2RVQ D;  5GT3 C;  5B33 A;  4Z66 A;  3W98 C;  4YS3 A;  3X1S A;  3TU4 D;  5CP6 C;  4G91 B;  5GT0 B;  5GT3 D;  3O62 A;  3AZF A;  2CV5 C;  5CPK C;  2VQR A;  5GSU A;  1H3O B;  5DNM B;  4J8U B;  1KX4 B;  2YFW A;  3REH A;  5B31 B;  3REL B;  2NQB B;  3REK C;  3UTA B;  2CV5 D;  3KUY C;  5JRG B;  2BG1 A;  2ZY3 A;  3LZ0 A;  3REJ A;  2JCH A;  5B1L B;  3C1B C;  5CPJ D;  1ZLA A;  3NQJ A;  3KUY D;  4DRB A;  5AV5 A;  3MGR C;  2HIO B;  3AZM A;  5GXQ D;  1M1A A;  3KXB B;  3C1B D;  5B32 B;  4H9S C;  3C1C B;  3WAA B;  4NE5 A;  5BNV B;  3EG5 B;  3MGR D;  5AV9 A;  3X1U C;  5B2I A;  1TZY A;  4H9R B;  5B40 B;  2ARO B;  1P3I B;  4JJN B;  3MGQ A;  3X1V C;  1U35 D;  3LEL C;  3UTB C;  4J8V C;  3X1U D;  5F99 A;  2F8N D;  2FJ7 A;  3X1V D;  1N1J B;  3W99 D;  2PYO D;  4KUD B;  5B0Z B;  5B0Y D;  3WKJ B;  4J8W C;  5E5A B;  2XD1 A;  1P3B D;  4WU9 C;  1WWS A;  1BH9 A;  3P5J B;  5GT0 A;  3AN2 A;  2NZD C;  4J8W D;  2LY8 A;  3LZ1 D;  4G92 C;  3AZK C;  4LD9 C;  1P3M C;  1H3O A;  5DNM A;  3WA9 B;  4WU9 D;  3W97 B;  4J8U A;  4ZBJ B;  1P3K B;  1KX4 A;  3REI C;  1F66 B;  4KGC A;  5B31 A;  1ID3 B;  3REL A;  3AZJ B;  2NQB A;  2NZD D;  4XUJ D;  3AZK D;  4LD9 D;  1M19 B;  4WJ3 C;  5AVB B;  1P3G B;  5JRG A;  5AV6 B;  3REI D;  1KX3 B;  4ZUX D;  5DNN C;  5B1L A;  4Z2M G;  1P3F C;  5AVC B;  4QLC B;  4YM6 D;  2HIO A;  5CPI A;  3KXB A;  5B32 A;  3AZL A;  3C1C A;  5BNV A;  3VH6 T;  3NQU B;  4J8X C;  1BH8 B;  5CP6 B;  4H9R A;  3B6F A;  5B40 A;  1F1E A;  2ARO A;  3UTA D;  1P3I A;  4JJN A;  1S32 C;  5CPK B;  4J8X D;  1JFI B;  1AOI A;  2DF4 C;  5B1M B;  5B24 D;  3MNN C;  1EQZ D;  1S32 D;  1A7W A;  1N1J A;  4KUD A;  4CAY B;  3EPH A;  2HUE C;  5B0Z A;  2F2A C;  3WKJ A;  5C3I C;  1P3L B;  5E5A A;  3AFA B;  4X23 C;  3MNN D;  1WWI A;  5B2J C;  3VH6 W;  4WU8 A;  3MGP C;  1HTA A;  3WAA D;  3AZN B;  3AYW D;  4X23 D;  5AV8 B;  2W8S A;  5B2J D;  3WA9 A;  3W97 A;  3MGP D;  1F66 A;  1ID3 A;  3AZJ A;  3AZG C;  3A1I A;  3KWQ C;  3AV1 C;  1M19 A;  3B6G C;  1HQ3 C;  5AVB A;  1P3G A;  3MVD A;  1KX3 A;  3VH6 A;  3LEL B;  3KWQ D;  4UPK A;  4CSR B;  3WTP E;  4J8V B;  3AV1 D;  1P3P D;  3B6G D;  3UT9 C;  3X1T C;  1P3O D;  2F8N K;  1KU5 A;  5BNX B;  4QLC A;  5AVC A;  1P3A C;  3A1K A;  3LJA B;  4DRA A;  2Y2I A;  3AZI D;  3AZE C;  3AL0 C;  3UT9 D;  3X1T D;  1BH9 B;  3W98 A;  3AN2 B;  3NQU A;  1P3K D;  1P3A D;  1BH8 A;  3KFU G;  5CP6 A;  3H0M C;  1M18 C;  3AZE D;  2FFF B;  4KGC B;  1KX5 B;  2YFV A;  5CPK A;  4XZQ C;  3MGS C;  1JFI A;  1P3M B;  4H9O B;  2Y2Q A;  5B33 C;  4Z66 C;  1M18 D;  5B1M A;  4M6B A;  4YS3 C;  5CPJ C;  3REK A;  4CAY A;  4XZQ D;  3MGS D;  3WTP B;  3A6N C;  3O62 C;  5GXQ C;  5B33 D;  4Z66 D;  3AZF C;  1P3L A;  2UWX A;  4YS3 D;  3AFA A;  3X1S D;  5DNN B;  5GSU C;  5BO0 A;  3A6N D;  3REH C;  3O62 D;  3AZN A;  1TAF B;  5CPI B;  5AY8 B;  3AZF D;  3AV2 B;  3AZL B;  5AV8 A;  5GSU D;  1U35 C;  3REH D;  2IO5 C;  3REJ C;  2F8N G;  3B6F B;  3R45 B;  4R8P B;  3W99 C;  2PYO C;  1ZLA C;  1AOI B;  5B0Y C;  3LZ0 D;  3REJ D;  5AV5 C;  3LEL A;  3UTB A;  4HGA C;  1P3B C;  4CSR A;  4J8V A;  1M1A C;  4AWL B;  5CHL B;  1ZLA D;  5BNX A;  3W96 B;  4EO5 B;  3LZ1 C;  5AV5 D;  3AZM D;  5AV9 C;  3LJA A;  4UUZ B;  5B2I C;  1TZY C;  2HUE B;  1P34 B;  1M1A D;  4WU8 B;  3MGQ C;  5BS7 C;  4XUJ C;  5AV9 D;  5B2I D;  1TZY D;  3AZH B;  1KX5 A;  3MGQ D;  2FJ7 C;  4ZUX C;  1P3M A;  2F8N H;  4H9O A;  5F99 D;  2RIQ A;  4KHA B;  3MVD B;  4Z5T B;  2FJ7 D;  4YM6 C;  4G91 C;  3WTP A;  2JE5 A;  1HQ3 B;  4E44 A;  5DNN A;  2Y2O A;  4J8U C;  3TU4 B;  5GT0 D;  5B31 C;  1TAF A;  2L5A A;  5AY8 A;  5B31 G;  3REL C;  1P3F A;  3UTA C;  5GT3 B;  3AV2 A;  2NQB C;  3W98 B;  5DNM D;  4KGC D;  4J8U D;  3H0R C;  1KX4 D;  5JRG C;  5B31 D;  3REL D;  2NQB D;  5B24 C;  3R45 A;  5B1L C;  1EQZ C;  4R8P A;  2YFV B;  4H9Q A;  2CV5 B;  5JRG D;  3EPL A;  5B1L D;  2G5I C;  4WNN B;  3KXB C;  3REK B;  2Y2H A;  3C1C C;  4H9P B;  3WAA C;  3W96 A;  3MNN A;  3AYW C;  3F6T A;  2HIO D;  3KUY B;  4UUZ A;  1P34 A;  5CPI D;  4Z2M H;  3KXB D;  5B40 C;  2ARO C;  5B32 D;  3AZL D;  4JJN C;  2BYM A;  5GXQ B;  3C1C D;  1P3I C;  5BO0 B;  3C1B B;  2Y2P A;  2Y2G A;  3MGR B;  5B40 D;  3AZH A;  3B6F D;  2ARO D;  1P3I D;  4JJN D;  2XD5 A;  1B67 A;  2Y2L A;  5B0Z C;  1AOI D;  4H9N A;  1U35 B;  3WKJ C;  1P3P C;  5E5A C;  3X1U B;  4KHA A;  2F8N B;  2BYK B;  4Z5T A;  1P3O C;  3AZG A;  4KUD D;  5B0Z D;  3X1V B;  1HQ3 A;  2G5H C;  2PYO B;  3W99 B;  3WKJ D;  3UTB B;  3AZI C;  5E5A D;  5B0Y B;  3WA9 C;  3W97 C;  1P3K C;  4ZBJ C;  3TU4 A;  1F66 C;  5GT3 A;  3VH5 T;  4J8W B;  3IP4 C;  3WA9 D;  1M19 C;  3W97 D;  1P3G C;  1F66 D;  5AV6 C;  1KX3 C;  4WU9 B;  1ID3 D;  3AZJ D;  2NZD B;  3AZK B;  2CV5 A;  4G92 B;  4LD9 B;  1M19 D;  5AVB D;  1P3G D;  5AV6 D;  3MVD D;  1KX3 D;  4QLC C;  5AVC C;  3REI B;  3X1S C;  4WNN A;  3B0C W;  4H9P A;  4QLC D;  5AVC D;  5CPJ A;  3KUY A;  2Y2N A;  3VH5 W;  4YM6 B;  3A6N A;  3B0B A;  5GXQ A;  3W98 D;  3C1B A;  1P3F B;  2Y2J A;  5JA4 B;  5CP6 D;  4WZS B;  4NFT A;  3MGR A;  3EPJ A;  5B1M C;  3LZ0 C;  1Q9C A;  5CPK D;  4H9S A;  1U35 A;  4NE3 A;  4J8X B;  1P3L C;  4H9Q B;  5B1M D;  3X1U A;  3AFA C;  2F8N A;  2BYK A;  2Y2M A;  5B24 B;  3VH5 A;  5KDM B;  3REK D;  1EQZ B;  1S32 B;  3AZM C;  3V9R B;  3X1V A;  3W99 A;  3AZN C;  2PYO A;  1P3L D;  5B0Y A;  3AFA D;  5AV8 C;  4NE6 A;  3MNN B;  1P3B A;  2DQN C;  3AZN D;  2BYM B;  5C3I B;  5AV8 D;  3LZ1 A;  4J8W A;  3AYW B;  4X23 B;  5B2J B;  4WU9 A;  5F99 C;  3B0D C;  3MGP B;  2NZD A;  5BS7 A;  4XUJ A;  3AZK A;  4LD9 A;  2ZM5 A;  3KSY A;  3H0L C;  4H9N B;  3REI A;  1W2E A;  3LJA C;  4ZUX A;  3FDD A;  2ZY5 A;  3LEL D;  3UTB D;  3AZG B;  4J8V D;  5G49 B;  5GT0 C;  3KWQ B;  1P3P B;  3AV1 B;  3EPK A;  3B6G B;  3AN2 C;  1P3O B;  3LJA D;  4YM6 A;  5DNM C;  4KGC C;  1KX5 C;  1KX4 C;  3AZI B;  3AN2 D;  3UT9 B;  2Y2K A;  3X1T B;  5JA4 A;  1P3A B;  5FUG B;  4DQY B;  1KX5 D;  3UTA A;  3AZE B;  1Z2C B;  3WTP C;  1P3M D;  4J8X A;  1M18 B;  5B24 A;  5KDM A;  1EQZ A;  1S32 A;  2HIO C;  3V9R A;  3WTP D;  2CWE A;  4XZQ B;  5CPI C;  5AY8 C;  3MGS B;  2ZY4 A;  3AV2 C;  5B32 C;  5B32 G;  3AZL C;  5B33 B;  4Z66 B;  5DNN D;  4YS3 B;  1T3U A;  5CPJ B;  3X1S B;  3B6F C;  5AY8 D;  4WV4 B;  1P3F D;  3A6N B;  3AV2 D;  3WAA A;  3O62 B;  4R8P C;  3AYW A;  3AZF B;  4X23 A;  2J8P A;  5GSU B;  5B2J A;  1AOI C;  3MGP A;  2YFW B;  4E45 A;  3REH B;  4R8P D;  4AWL C;  4KUD C;  3W96 C;  4EO5 C;  3LZ0 B;  2IO5 B;  3REJ B;  1P34 C;  5BT1 C;  4WU8 C;  5G49 A;  3KWQ A;  1P3P A;  3AV1 A;  3B6G A;  2ZY2 A;  3W96 D;  1BFM A;  1ZLA B;  3NQJ B;  1P3O A;  1P34 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...