1KX3B

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3B00
5B31G 3AZJA 5CPJC 2CV5A 2NZDC 2CWEA 3WTPD 3REJC 3AZEB 3B0DB 4NFTA 4YS3D 3KXBB 4WZSB 3UT9B 4X23D 1TAFB 4QLCA 3AZNB 2YFVA 5DNNC 3X1SC 4J8VB 2NQBA 3AZGA 5KDMB 5GT0D 5B1MD 5GSUD 4NE3A 3AZIC 4KGCB 4WU8C 5AV8D 5B0YD 1P3FC 4Z2MG 1P3PC 4M6BA 3NQUA 5FUGB 4YM6C 3MGSA 4ZBJB 1WWIA 5B33A 2HIOD 3W97A 1P34B 3O62B 2AROA 3AV1A 3R45B 5CPKD 4EO5C 5B2IA 4LD9C 1N1JB 3AZED 3AZMB 3X1TC 4XZQB 3KXBD 1HQ3D 3MGQC 1ZLAA 1P3AB 4J8WA 3X1VC 5AV6C 5DNMD 4HGAC 5B2JB 3REIA 4J8UB 5AV9C 5B40B 3KUYC 4H9OB 1ID3D 4J8VD 5B32B 5BS7C 4R8PB 3LZ1C 4CSRA 1TZYB 3MGRA 3MNNA 4JJNB 3RELC 3AYWB 1P3MA 3A6NB 1KX4A 4Z5TB 3UTAC 1P3LA 5JRGD 3O62D 1P3OB 1P3BB 1ULYA 1KU5A 5AV5B 3AZMD 1KX3C 4J8XB 5GXQB 3AZKC 4KHAB 4CAYA 2F8NB 1P3AD 4KUDC 5BT1D 3AV2B 3B6FD 1BH8A 2YFWB 4WU9C 5B2JD 5B0ZD 5B40D 3REKA 5CPJB 1AOID 5B31B 3B6GC 4XUJA 5BNXA 4ZUXA 4R8PD 1P3IA 1EQZC 1F66C 1TZYD 4H9RB 5CP6C 3VH6A 5GT3C 3UTBB 3TU4C 3AN2B 3AYWD 3A6ND 3VH5A 4Z5TD 3C1BA 3X1SB 5AVCA 4AWLB 3AZHB 5CPIB 1P3BD 4H9SA 3MVDA 4G91C 4H9NB 2IO5B 4E44A 3REHD 3AZIB 4J8XD 5GXQD 4WU8B 1P3FB 1P3GA 5AY8D 3AZFD 3AV2D 4YM6B 1WWSA 3LELB 5AVBB 4Z66B 5E5AA 5B24D 1M19B 1S32B 5CPJD 5F99A 3NQJA 4EO5B 5GSUA 2PYOC 3W98C 3REJD 4LD9B 2NZDD 3WA9C 3C1CA 4WNNB 1M1AC 1M18A 5AV6B 3WTPB 1U35C 3B0BA 4YS3B 5DNND 3X1SD 2CV5C 3AZEA 5BO0B 5B1LA 3LZ1B 4X23B 4G92B 3AZID 4WU8D 1P3FD 3UT9A 1P3PD 3AFAC 3RELB 3WKJC 1TAFA 3AZNA 4YM6D 4QLCC 5GT0B 5B1MB 3MGPC 4J8VA 5AV8B 5B0YB 3AZGC 2NQBC 5KDMA 4LD9D 4KGCA 3X1TD 1KX5C 3MGQD 3X1UC 2HIOB 4KUDB 5FUGA 5CPKB 3X1VD 3MGSC 5AV6D 1P34A 5AV9D 3O62A 3KUYD 3R45A 3W97C 2AROC 1HQ3B 2HUEC 5B2IC 1N1JA 4XZQA 1EQZB 3LZ1D 1P3KC 5DNMB 1P3AA 3W99C 5G49A 5CP6B 4H9QB 5GT3B 1ID3B 5B2JA 3TU4B 3RELD 4J8UA 5C3IC 4H9OA 1B6WA 3UTAD 5B32A 4R8PA 3AZLA 3KWQA 1TZYA 3WAAC 1KX3D 3MGRC 3AZKD 3MNNC 4JJNA 4KUDD 5JRGB 3AYWA 3A6NA 1P3MC 4Z5TA 4WU9D 1P3LC 1P3OA 1P3BA 5BNVB 5AV5A 3B6GD 4DRBA 1EQZD 5GXQA 1F66D 4KHAA 2F8NA 3B6FB 5B0ZB 3WA9B 2FJ7C 5CP6D 3AV2A 1M1AB 2YFWA 5GT3D 1AOIB 1BFMA 1B67A 3TU4D 2L5AA 5CPJA 5B31A 3VH6W 3LZ0C 4XUJC 4ZUXC 5CHLB 4H9RA 3VH5W 5JA4B 3UTBA 3AN2A 1HTAA 3AFAB 3WKJB 3X1SA 3MGPB 3AZHA 3C1BC 5CPIA 5AVCC 3REHB 3LJAC 4NE6A 3MVDC 4H9NA 3W98D 2PYOD 3AZIA 3W96C 5AY8B 4WU8A 3AZFB 1P3FA 1KX5B 1P3GC 2JSSA 3WA9D 5B24B 3V9RB 3X1UB 1M1AD 4YM6A 3LELA 5AVBA 4Z66A 1M19A 3REJB 1U35D 2NZDB 5E5AC 1S32A 5F99C 2AROB 2HUEB 2CV5D 4LD9A 1P3KB 4WNNA 3C1CC 3W99B 5DNNB 5AV6A 1M18C 3WTPA 3AFAD 4YS3A 3WKJD 4QLCD 4E45A 3MGPD 2NQBD 3AZGD 5BO0A 1P3PB 3LZ1A 5B1LC 4X23A 4WV4B 2F8NH 3WAAB 1KX5D 4NE5A 3UT9C 1BH9B 3RELA 3X1UD 4H9PB 3AZNC 5GT0A 5B1MA 1H3OB 3MGSD 5AV8A 5B0YA 4UUZB 3X1TB 3W97D 2AROD 5B2ID 3MGQB 1Q9CA 4KGCC 3X1VB 1P3KD 4HGAB 2HIOA 4KUDA 5AV9B 3W99D 3KUYB 5CPKA 3AZJC 2FJ7B 1JFIB 1P34C 3KXBA 2BYMB 1HQ3A 1R4VA 3LZ0B 1EQZA 4XZQC 4ZUXB 4DRAA 5DNMA 3WAAD 5CP6A 3MGRD 4H9QA 5GT3A 1ID3A 4Z2MH 3MNND 3TU4A 3UTAB 4J8UC 3B0CW 1P3MD 1KX3B 2LY8A 1P3LD 5B32C 3AZLC 3AZKB 3LJAB 3KWQC 3W96B 4WU9B 5B33C 4JJNC 5JRGA 2FJ7D 3AV1C 3B6GB 3AZMA 2RVQC 5BNVA 1P3OC 1F66B 5AV5C 1ZLAC 3LZ0D 4XUJD 4ZUXD 4J8WC 3B6FA 5B0ZA 5B40A 3REIC 1M1AA 1AOIA 3VH6T 1F1EA 2BYKB 5B31C 4G91B 3C1BD 5AVCD 3VH5T 3LJAD 1A7WA 3MVDD 5B1LB 5JA4A 3W96D 1P3GD 1KX4C 3UTBC 3AN2C 3AFAA 3WKJA 3MGPA 3W98B 3AZHC 2PYOB 5CPIC 4AWLC 3REHA 5E5AD 4J8XA 5F99D 2IO5C 5AY8A 3AZFA 1KX5A 5B24A 1U35B 3V9RA 3X1UA 3C1CD 3REKC 3AZJB 3LELC 1M18D 2CV5B 3REJA 5AVBC 4Z66C 1M19C 2NZDA 1P3IC 1S32C 5B1LD 1P3KA 3W99A 4QLCB 5DNNA 2YFVB 5G49B 3UT9D 3WTPC 2NQBB 3AZGB 4YS3C 4H9SC 3AZND 3AZLB 1P3PA 2F8NK 4X23C 3KWQB 4G92C 3WAAA 4KGCD 3NQUB 1BH9A 3MGSB 5B33B 4H9PA 3W97B 3AZJD 3AV1B 1H3OA 5B1MC 5GT0C 5GSUC 5B2IB 4UUZA 3X1TA 5AV8C 5B0YC 1P34D 3MGQA 1ZLAB 3X1VA 4XZQD 4J8WB 5AV9A 2HIOC 5C3IB 3KUYA 3REIB 5CPKC 2FJ7A 1JFIA 3WTPE 3AZEC 3B0DC 5BS7A 4J8UD 3KXBC 2BYMA 1HQ3C 4CSRB 3LZ0A 5B32D 3AZLD 3MGRB 3MNNB 3KWQD 5DNMC 3B0CT 1P3MB 1ID3C 1KX4B 4J8VC 3UTAA 5B33D 4JJND 1P3LB 3AV1D 1KX3A 2RVQD 3AZKA 1P3OD 3LJAA 4CAYB 5AV5D 3KSYA 1ZLAD 3W96A 4J8WD 4ZBJC 4WU9A 1BH8B 2F8ND 3REID 5JRGC 3O62C 3REKB 3B6GA 3AZMC 4XUJB 5BNXB 1P3IB 1F66A 5B31D 1P3AC 5BT1C 3B6FC 5B2JC 5B0ZC 5B40C 1AOIC 1KX4D 3UTBD 5B32G 3AN2D 3C1BB 5AVCB 4R8PC 2BYKA 3MVDB 1TZYC 3AZHD 5CPID 1P3GB 3AYWC 3A6NC 4Z5TC 5E5AB 1P3BC 3REKD 5F99B 3W98A 3LELD 2PYOA 3NQJB 5GSUB 5AVBD 4Z66D 1M19D 3REHC 1P3ID 2F8NG 4J8XC 5GXQC 1S32D 3WA9A 3C1CB 5AY8C 3AZFC 3AV2C 1M18B 1U35A 5B24C
chains in the Genus database with same CATH superfamily
5B31G 3AZJA 5CPJC 2CV5A 2NZDC 2CWEA 3WTPD 3REJC 3AZEB 3B0DB 4NFTA 4YS3D 3KXBB 4WZSB 3P5JB 3UT9B 4X23D 1TAFB 4QLCA 3AZNB 2YFVA 5DNNC 3X1SC 4J8VB 2NQBA 3AZGA 5KDMB 5GT0D 5B1MD 2Y2NA 4NE3A 5GSUD 3AZIC 4KGCB 4WU8C 5AV8D 5B0YD 1P3FC 4Z2MG 1P3PC 4M6BA 3NQUA 5FUGB 4YM6C 3MGSA 4ZBJB 1WWIA 5B33A 2HIOD 3W97A 1P34B 3O62B 2AROA 3AV1A 3R45B 5CPKD 4EO5C 5B2IA 4LD9C 1N1JB 3AZED 2G5IC 3AZMB 4XZQB 3X1TC 3KXBD 1HQ3D 3MGQC 1ZLAA 1P3AB 3H0LC 4J8WA 3X1VC 5AV6C 5DNMD 4HGAC 5B2JB 3REIA 4J8UB 5AV9C 5B40B 3KUYC 4H9OB 1ID3D 4J8VD 5B32B 5BS7C 4R8PB 3LZ1C 4CSRA 1TZYB 3MGRA 3MNNA 2FFFB 4JJNB 3RELC 3AYWB 1P3MA 3A6NB 1KX4A 4Z5TB 3UTAC 1P3LA 5JRGD 3O62D 1P3OB 1P3BB 1ULYA 1KU5A 5AV5B 3AZMD 1KX3C 4J8XB 5GXQB 3AZKC 4KHAB 4CAYA 2F8NB 3EPHA 3AL0C 1P3AD 4KUDC 5BT1D 3AV2B 3B6FD 1BH8A 2YFWB 4WU9C 5B2JD 5B0ZD 5B40D 3REKA 5CPJB 1AOID 5B31B 3B6GC 4XUJA 5BNXA 4ZUXA 2Y2JA 4R8PD 1P3IA 1EQZC 1F66C 1TZYD 2Y2KA 4H9RB 5CP6C 3VH6A 5GT3C 3H0RC 3UTBB 3TU4C 3AN2B 3AYWD 3A6ND 3VH5A 4Z5TD 3C1BA 3X1SB 5AVCA 4AWLB 3AZHB 5CPIB 3A1KA 1P3BD 4H9SA 3MVDA 4G91C 4H9NB 2IO5B 4E44A 3REHD 3AZIB 4J8XD 5GXQD 4WU8B 1P3FB 1P3GA 5AY8D 3AZFD 3AV2D 4YM6B 1WWSA 3LELB 5AVBB 4Z66B 5E5AA 5B24D 1M19B 1S32B 5CPJD 5F99A 3NQJA 4EO5B 5GSUA 2PYOC 3W98C 2Y2IA 3REJD 4LD9B 2NZDD 3WA9C 3C1CA 4WNNB 3EPLA 1M1AC 1M18A 5AV6B 3WTPB 1U35C 3B0BA 4YS3B 5DNND 3X1SD 1W2EA 2CV5C 2UWXA 3AZEA 5BO0B 5B1LA 3LZ1B 4X23B 4G92B 3AZID 2G5HC 4WU8D 1P3FD 3UT9A 1P3PD 3AFAC 3RELB 3WKJC 1TAFA 3AZNA 4YM6D 4QLCC 5GT0B 5B1MB 3MGPC 4J8VA 3F6TA 2XD5A 5AV8B 5B0YB 3AZGC 2NQBC 5KDMA 4LD9D 4KGCA 3X1TD 1KX5C 3EG5B 3MGQD 3X1UC 2HIOB 4KUDB 5FUGA 5CPKB 3X1VD 3MGSC 5AV6D 1P34A 2BG1A 5AV9D 3O62A 3R45A 3KUYD 2AROC 3W97C 2ZY5A 1HQ3B 2HUEC 5B2IC 1N1JA 4XZQA 1EQZB 3LZ1D 1P3KC 5DNMB 1P3AA 2Y2OA 3EPKA 3W99C 5G49A 5CP6B 4H9QB 5GT3B 1ID3B 5B2JA 3TU4B 3RELD 4J8UA 5C3IC 4H9OA 1B6WA 3UTAD 5B32A 4R8PA 3AZLA 3KWQA 1TZYA 3WAAC 1KX3D 3MGRC 3AZKD 3MNNC 4JJNA 4KUDD 5JRGB 3AYWA 3A6NA 1P3MC 4Z5TA 4WU9D 2JE5A 1P3LC 1P3OA 1P3BA 5BNVB 5AV5A 2DQNC 3B6GD 4DRBA 1EQZD 5GXQA 1F66D 4KHAA 2F8NA 3B6FB 5B0ZB 3WA9B 3KFUG 2FJ7C 5CP6D 3AV2A 1M1AB 2YFWA 5GT3D 1AOIB 1BFMA 1B67A 3TU4D 2L5AA 5CPJA 5B31A 3VH6W 3LZ0C 4XUJC 4ZUXC 5CHLB 4H9RA 3VH5W 5JA4B 3UTBA 3AN2A 1HTAA 3AFAB 3WKJB 3X1SA 3MGPB 3AZHA 3C1BC 5CPIA 5AVCC 3REHB 2ZY2A 3LJAC 4NE6A 3MVDC 4H9NA 3W98D 2PYOD 3AZIA 2ZY3A 3W96C 5AY8B 4WU8A 3AZFB 1P3FA 1KX5B 1P3GC 2JSSA 3WA9D 5B24B 3V9RB 3X1UB 1M1AD 4YM6A 3LELA 5AVBA 4Z66A 1M19A 3REJB 1U35D 2NZDB 5E5AC 1S32A 2AROB 5F99C 2HUEB 2CV5D 4LD9A 1T3UA 1P3KB 4WNNA 3C1CC 3W99B 5DNNB 5AV6A 1M18C 3WTPA 3AFAD 4YS3A 3WKJD 3IP4C 4QLCD 4E45A 3MGPD 2NQBD 3AZGD 5BO0A 1P3PB 3LZ1A 5B1LC 4X23A 4WV4B 2F8NH 3WAAB 1KX5D 4NE5A 3UT9C 1BH9B 3FDDA 3RELA 3X1UD 4H9PB 3AZNC 5GT0A 5B1MA 1H3OB 2F2AC 3MGSD 2RIQA 5AV8A 5B0YA 4UUZB 3X1TB 3W97D 2AROD 5B2ID 3MGQB 1Q9CA 4KGCC 3X1VB 1PZRA 1P3KD 4HGAB 2HIOA 4KUDA 5AV9B 3W99D 3KUYB 5CPKA 3AZJC 2FJ7B 1JFIB 1P34C 3KXBA 2BYMB 1HQ3A 1R4VA 3LZ0B 2ZY4A 1EQZA 4XZQC 4ZUXB 4DRAA 5DNMA 3WAAD 5CP6A 3MGRD 4H9QA 5GT3A 1ID3A 4Z2MH 3MNND 3TU4A 3UTAB 4J8UC 3B0CW 1P3MD 1KX3B 2LY8A 1P3LD 5B32C 3AZLC 3AZKB 3LJAB 3KWQC 3W96B 4WU9B 5B33C 4JJNC 5JRGA 2FJ7D 3AV1C 2XD1A 3B6GB 3AZMA 2Y2QA 2RVQC 5BNVA 2Y2LA 1P3OC 1F66B 5AV5C 1ZLAC 3LZ0D 4XUJD 4ZUXD 4J8WC 3B6FA 5B0ZA 5B40A 3REIC 1M1AA 1AOIA 3VH6T 1F1EA 2BYKB 5B31C 4G91B 3C1BD 5AVCD 3VH5T 3LJAD 2Y2MA 1A7WA 3MVDD 5B1LB 5JA4A 3W96D 1P3GD 1KX4C 3UTBC 3AN2C 3AFAA 3WKJA 3MGPA 3W98B 3AZHC 2PYOB 5CPIC 4AWLC 3REHA 5E5AD 4J8XA 5F99D 3EPJA 2IO5C 5AY8A 3AZFA 1KX5A 5B24A 1U35B 3V9RA 3X1UA 3C1CD 3REKC 3AZJB 3LELC 1M18D 2CV5B 3REJA 5AVBC 4Z66C 1M19C 2NZDA 1P3IC 1S32C 2VQRA 5B1LD 1P3KA 2Y2HA 3W99A 4QLCB 5DNNA 2YFVB 5G49B 3UT9D 3WTPC 2NQBB 3AZGB 4YS3C 4H9SC 3AZND 3AZLB 1P3PA 2F8NK 4X23C 3KWQB 4G92C 3WAAA 4KGCD 2Y2GA 3NQUB 3H0MC 1BH9A 3MGSB 5B33B 4H9PA 3W97B 3AZJD 3AV1B 1H3OA 5B1MC 5GT0C 5B2IB 5GSUC 2Y2PA 4UUZA 3X1TA 5AV8C 5B0YC 1P34D 3MGQA 1ZLAB 2JCHA 3X1VA 4XZQD 4J8WB 5AV9A 2HIOC 5C3IB 3KUYA 2ZM5A 3REIB 5CPKC 2FJ7A 1JFIA 3WTPE 3AZEC 3B0DC 5BS7A 4J8UD 3KXBC 2BYMA 1HQ3C 4CSRB 3LZ0A 5B32D 3AZLD 3MGRB 3MNNB 3KWQD 5DNMC 3B0CT 1P3MB 1ID3C 4DQYB 4WJ3C 1KX4B 4J8VC 3UTAA 5B33D 4JJND 1Z2CB 1P3LB 3AV1D 2DF4C 1KX3A 2RVQD 3AZKA 1P3OD 3LJAA 4CAYB 5AV5D 3KSYA 1ZLAD 3W96A 4J8WD 4ZBJC 4WU9A 1BH8B 2F8ND 3REID 5JRGC 3O62C 3REKB 3B6GA 3AZMC 4XUJB 5BNXB 1P3IB 1F66A 5B31D 1P3AC 5BT1C 3B6FC 5B2JC 5B0ZC 5B40C 1AOIC 4UPKA 3UTBD 5B32G 1KX4D 3AN2D 3C1BB 5AVCB 4R8PC 2BYKA 3MVDB 1TZYC 3AZHD 5CPID 1P3GB 3AYWC 3A6NC 4Z5TC 2W8SA 5E5AB 1P3BC 3REKD 5F99B 3W98A 3LELD 2PYOA 3NQJB 5GSUB 5AVBD 4Z66D 1M19D 3REHC 1P3ID 2F8NG 4J8XC 2J8PA 3A1IA 5GXQC 1S32D 3WA9A 3C1CB 5AY8C 3AZFC 3AV2C 1M18B 1U35A 5B24C
chains in the Genus database with same CATH topology
5B31G 3AZJA 5CPJC 2CV5A 2NZDC 2CWEA 3WTPD 3REJC 3AZEB 3B0DB 4NFTA 4YS3D 3KXBB 4WZSB 3P5JB 3UT9B 4X23D 1TAFB 4QLCA 3AZNB 2YFVA 5DNNC 3X1SC 4J8VB 2NQBA 3AZGA 5KDMB 5GT0D 5B1MD 2Y2NA 4NE3A 5GSUD 3AZIC 4KGCB 4WU8C 5AV8D 5B0YD 1P3FC 4Z2MG 1P3PC 4M6BA 3NQUA 5FUGB 4YM6C 3MGSA 4ZBJB 1WWIA 5B33A 2HIOD 3W97A 1P34B 3O62B 2AROA 3AV1A 3R45B 5CPKD 4EO5C 5B2IA 4LD9C 1N1JB 3AZED 2G5IC 3AZMB 4XZQB 3X1TC 3KXBD 1HQ3D 3MGQC 1ZLAA 1P3AB 3H0LC 4J8WA 3X1VC 5AV6C 5DNMD 4HGAC 5B2JB 3REIA 4J8UB 5AV9C 5B40B 3KUYC 4H9OB 1ID3D 4J8VD 5B32B 5BS7C 4R8PB 3LZ1C 4CSRA 1TZYB 3MGRA 3MNNA 2FFFB 4JJNB 3RELC 3AYWB 1P3MA 3A6NB 1KX4A 4Z5TB 3UTAC 1P3LA 5JRGD 3O62D 1P3OB 1P3BB 1ULYA 1KU5A 5AV5B 3AZMD 1KX3C 4J8XB 5GXQB 3AZKC 4KHAB 4CAYA 2F8NB 3EPHA 3AL0C 1P3AD 4KUDC 5BT1D 3AV2B 3B6FD 1BH8A 2YFWB 4WU9C 5B2JD 5B0ZD 5B40D 3REKA 5CPJB 1AOID 5B31B 3B6GC 4XUJA 5BNXA 4ZUXA 2Y2JA 4R8PD 1P3IA 1EQZC 1F66C 1TZYD 2Y2KA 4H9RB 5CP6C 3VH6A 5GT3C 3H0RC 3UTBB 3TU4C 3AN2B 3AYWD 3A6ND 3VH5A 4Z5TD 3C1BA 3X1SB 5AVCA 4AWLB 3AZHB 5CPIB 3A1KA 1P3BD 4H9SA 3MVDA 4G91C 4H9NB 2IO5B 4E44A 3REHD 3AZIB 4J8XD 5GXQD 4WU8B 1P3FB 1P3GA 5AY8D 3AZFD 3AV2D 4YM6B 1WWSA 3LELB 5AVBB 4Z66B 5E5AA 5B24D 1M19B 1S32B 5CPJD 5F99A 3NQJA 4EO5B 5GSUA 2PYOC 3W98C 2Y2IA 3REJD 4LD9B 2NZDD 3WA9C 3C1CA 4WNNB 3EPLA 1M1AC 1M18A 5AV6B 3WTPB 1U35C 3B0BA 4YS3B 5DNND 3X1SD 1W2EA 2CV5C 2UWXA 3AZEA 5BO0B 5B1LA 3LZ1B 4X23B 4G92B 3AZID 2G5HC 4WU8D 1P3FD 3UT9A 1P3PD 3AFAC 3RELB 3WKJC 1TAFA 3AZNA 4YM6D 4QLCC 5GT0B 5B1MB 3MGPC 4J8VA 3F6TA 2XD5A 5AV8B 5B0YB 3AZGC 2NQBC 5KDMA 4LD9D 4KGCA 3X1TD 1KX5C 3EG5B 3MGQD 3X1UC 2HIOB 4KUDB 5FUGA 5CPKB 3X1VD 3MGSC 5AV6D 1P34A 2BG1A 5AV9D 3O62A 3R45A 3KUYD 2AROC 3W97C 2ZY5A 1HQ3B 2HUEC 5B2IC 1N1JA 4XZQA 1EQZB 3LZ1D 1P3KC 5DNMB 1P3AA 2Y2OA 3EPKA 3W99C 5G49A 5CP6B 4H9QB 5GT3B 1ID3B 5B2JA 3TU4B 3RELD 4J8UA 5C3IC 4H9OA 1B6WA 3UTAD 5B32A 4R8PA 3AZLA 3KWQA 1TZYA 3WAAC 1KX3D 3MGRC 3AZKD 3MNNC 4JJNA 4KUDD 5JRGB 3AYWA 3A6NA 1P3MC 4Z5TA 4WU9D 2JE5A 1P3LC 1P3OA 1P3BA 5BNVB 5AV5A 2DQNC 3B6GD 4DRBA 1EQZD 5GXQA 1F66D 4KHAA 2F8NA 3B6FB 5B0ZB 3WA9B 3KFUG 2FJ7C 5CP6D 3AV2A 1M1AB 2YFWA 5GT3D 1AOIB 1BFMA 1B67A 3TU4D 2L5AA 5CPJA 5B31A 3VH6W 3LZ0C 4XUJC 4ZUXC 5CHLB 4H9RA 3VH5W 5JA4B 3UTBA 3AN2A 1HTAA 3AFAB 3WKJB 3X1SA 3MGPB 3AZHA 3C1BC 5CPIA 5AVCC 3REHB 2ZY2A 3LJAC 4NE6A 3MVDC 4H9NA 3W98D 2PYOD 3AZIA 2ZY3A 3W96C 5AY8B 4WU8A 3AZFB 1P3FA 1KX5B 1P3GC 2JSSA 3WA9D 5B24B 3V9RB 3X1UB 1M1AD 4YM6A 3LELA 5AVBA 4Z66A 1M19A 3REJB 1U35D 2NZDB 5E5AC 1S32A 2AROB 5F99C 2HUEB 2CV5D 4LD9A 1T3UA 1P3KB 4WNNA 3C1CC 3W99B 5DNNB 5AV6A 1M18C 3WTPA 3AFAD 4YS3A 3WKJD 3IP4C 4QLCD 4E45A 3MGPD 2NQBD 3AZGD 5BO0A 1P3PB 3LZ1A 5B1LC 4X23A 4WV4B 2F8NH 3WAAB 1KX5D 4NE5A 3UT9C 1BH9B 3FDDA 3RELA 3X1UD 4H9PB 3AZNC 5GT0A 5B1MA 1H3OB 2F2AC 3MGSD 2RIQA 5AV8A 5B0YA 4UUZB 3X1TB 3W97D 2AROD 5B2ID 3MGQB 1Q9CA 4KGCC 3X1VB 1PZRA 1P3KD 4HGAB 2HIOA 4KUDA 5AV9B 3W99D 3KUYB 5CPKA 3AZJC 2FJ7B 1JFIB 1P34C 3KXBA 2BYMB 1HQ3A 1R4VA 3LZ0B 2ZY4A 1EQZA 4XZQC 4ZUXB 4DRAA 5DNMA 3WAAD 5CP6A 3MGRD 4H9QA 5GT3A 1ID3A 4Z2MH 3MNND 3TU4A 3UTAB 4J8UC 3B0CW 1P3MD 1KX3B 2LY8A 1P3LD 5B32C 3AZLC 3AZKB 3LJAB 3KWQC 3W96B 4WU9B 5B33C 4JJNC 5JRGA 2FJ7D 3AV1C 2XD1A 3B6GB 3AZMA 2Y2QA 2RVQC 5BNVA 2Y2LA 1P3OC 1F66B 5AV5C 1ZLAC 3LZ0D 4XUJD 4ZUXD 4J8WC 3B6FA 5B0ZA 5B40A 3REIC 1M1AA 1AOIA 3VH6T 1F1EA 2BYKB 5B31C 4G91B 3C1BD 5AVCD 3VH5T 3LJAD 2Y2MA 1A7WA 3MVDD 5B1LB 5JA4A 3W96D 1P3GD 1KX4C 3UTBC 3AN2C 3AFAA 3WKJA 3MGPA 3W98B 3AZHC 2PYOB 5CPIC 4AWLC 3REHA 5E5AD 4J8XA 5F99D 3EPJA 2IO5C 5AY8A 3AZFA 1KX5A 5B24A 1U35B 3V9RA 3X1UA 3C1CD 3REKC 3AZJB 3LELC 1M18D 2CV5B 3REJA 5AVBC 4Z66C 1M19C 2NZDA 1P3IC 1S32C 2VQRA 5B1LD 1P3KA 2Y2HA 3W99A 4QLCB 5DNNA 2YFVB 5G49B 3UT9D 3WTPC 2NQBB 3AZGB 4YS3C 4H9SC 3AZND 3AZLB 1P3PA 2F8NK 4X23C 3KWQB 4G92C 3WAAA 4KGCD 2Y2GA 3NQUB 3H0MC 1BH9A 3MGSB 5B33B 4H9PA 3W97B 3AZJD 3AV1B 1H3OA 5B1MC 5GT0C 5B2IB 5GSUC 2Y2PA 4UUZA 3X1TA 5AV8C 5B0YC 1P34D 3MGQA 1ZLAB 2JCHA 3X1VA 4XZQD 4J8WB 5AV9A 2HIOC 5C3IB 3KUYA 2ZM5A 3REIB 5CPKC 2FJ7A 1JFIA 3WTPE 3AZEC 3B0DC 5BS7A 4J8UD 3KXBC 2BYMA 1HQ3C 4CSRB 3LZ0A 5B32D 3AZLD 3MGRB 3MNNB 3KWQD 5DNMC 3B0CT 1P3MB 1ID3C 4DQYB 4WJ3C 1KX4B 4J8VC 3UTAA 5B33D 4JJND 1Z2CB 1P3LB 3AV1D 2DF4C 1KX3A 2RVQD 3AZKA 1P3OD 3LJAA 4CAYB 5AV5D 3KSYA 1ZLAD 3W96A 4J8WD 4ZBJC 4WU9A 1BH8B 2F8ND 3REID 5JRGC 3O62C 3REKB 3B6GA 3AZMC 4XUJB 5BNXB 1P3IB 1F66A 5B31D 1P3AC 5BT1C 3B6FC 5B2JC 5B0ZC 5B40C 1AOIC 4UPKA 3UTBD 5B32G 1KX4D 3AN2D 3C1BB 5AVCB 4R8PC 2BYKA 3MVDB 1TZYC 3AZHD 5CPID 1P3GB 3AYWC 3A6NC 4Z5TC 2W8SA 5E5AB 1P3BC 3REKD 5F99B 3W98A 3LELD 2PYOA 3NQJB 5GSUB 5AVBD 4Z66D 1M19D 3REHC 1P3ID 2F8NG 4J8XC 2J8PA 3A1IA 5GXQC 1S32D 3WA9A 3C1CB 5AY8C 3AZFC 3AV2C 1M18B 1U35A 5B24C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 G;  3AZJ A;  5CPJ C;  2CV5 A;  2NZD C;  2CWE A;  3WTP D;  3REJ C;  3AZE B;  3B0D B;  4NFT A;  4YS3 D;  3KXB B;  4WZS B;  3UT9 B;  4X23 D;  1TAF B;  4QLC A;  3AZN B;  2YFV A;  5DNN C;  3X1S C;  4J8V B;  2NQB A;  3AZG A;  5KDM B;  5GT0 D;  5B1M D;  5GSU D;  4NE3 A;  3AZI C;  4KGC B;  4WU8 C;  5AV8 D;  5B0Y D;  1P3F C;  4Z2M G;  1P3P C;  4M6B A;  3NQU A;  5FUG B;  4YM6 C;  3MGS A;  4ZBJ B;  1WWI A;  5B33 A;  2HIO D;  3W97 A;  1P34 B;  3O62 B;  2ARO A;  3AV1 A;  3R45 B;  5CPK D;  4EO5 C;  5B2I A;  4LD9 C;  1N1J B;  3AZE D;  3AZM B;  3X1T C;  4XZQ B;  3KXB D;  1HQ3 D;  3MGQ C;  1ZLA A;  1P3A B;  4J8W A;  3X1V C;  5AV6 C;  5DNM D;  4HGA C;  5B2J B;  3REI A;  4J8U B;  5AV9 C;  5B40 B;  3KUY C;  4H9O B;  1ID3 D;  4J8V D;  5B32 B;  5BS7 C;  4R8P B;  3LZ1 C;  4CSR A;  1TZY B;  3MGR A;  3MNN A;  4JJN B;  3REL C;  3AYW B;  1P3M A;  3A6N B;  1KX4 A;  4Z5T B;  3UTA C;  1P3L A;  5JRG D;  3O62 D;  1P3O B;  1P3B B;  1ULY A;  1KU5 A;  5AV5 B;  3AZM D;  1KX3 C;  4J8X B;  5GXQ B;  3AZK C;  4KHA B;  4CAY A;  2F8N B;  1P3A D;  4KUD C;  5BT1 D;  3AV2 B;  3B6F D;  1BH8 A;  2YFW B;  4WU9 C;  5B2J D;  5B0Z D;  5B40 D;  3REK A;  5CPJ B;  1AOI D;  5B31 B;  3B6G C;  4XUJ A;  5BNX A;  4ZUX A;  4R8P D;  1P3I A;  1EQZ C;  1F66 C;  1TZY D;  4H9R B;  5CP6 C;  3VH6 A;  5GT3 C;  3UTB B;  3TU4 C;  3AN2 B;  3AYW D;  3A6N D;  3VH5 A;  4Z5T D;  3C1B A;  3X1S B;  5AVC A;  4AWL B;  3AZH B;  5CPI B;  1P3B D;  4H9S A;  3MVD A;  4G91 C;  4H9N B;  2IO5 B;  4E44 A;  3REH D;  3AZI B;  4J8X D;  5GXQ D;  4WU8 B;  1P3F B;  1P3G A;  5AY8 D;  3AZF D;  3AV2 D;  4YM6 B;  1WWS A;  3LEL B;  5AVB B;  4Z66 B;  5E5A A;  5B24 D;  1M19 B;  1S32 B;  5CPJ D;  5F99 A;  3NQJ A;  4EO5 B;  5GSU A;  2PYO C;  3W98 C;  3REJ D;  4LD9 B;  2NZD D;  3WA9 C;  3C1C A;  4WNN B;  1M1A C;  1M18 A;  5AV6 B;  3WTP B;  1U35 C;  3B0B A;  4YS3 B;  5DNN D;  3X1S D;  2CV5 C;  3AZE A;  5BO0 B;  5B1L A;  3LZ1 B;  4X23 B;  4G92 B;  3AZI D;  4WU8 D;  1P3F D;  3UT9 A;  1P3P D;  3AFA C;  3REL B;  3WKJ C;  1TAF A;  3AZN A;  4YM6 D;  4QLC C;  5GT0 B;  5B1M B;  3MGP C;  4J8V A;  5AV8 B;  5B0Y B;  3AZG C;  2NQB C;  5KDM A;  4LD9 D;  4KGC A;  3X1T D;  1KX5 C;  3MGQ D;  3X1U C;  2HIO B;  4KUD B;  5FUG A;  5CPK B;  3X1V D;  3MGS C;  5AV6 D;  1P34 A;  5AV9 D;  3O62 A;  3KUY D;  3R45 A;  3W97 C;  2ARO C;  1HQ3 B;  2HUE C;  5B2I C;  1N1J A;  4XZQ A;  1EQZ B;  3LZ1 D;  1P3K C;  5DNM B;  1P3A A;  3W99 C;  5G49 A;  5CP6 B;  4H9Q B;  5GT3 B;  1ID3 B;  5B2J A;  3TU4 B;  3REL D;  4J8U A;  5C3I C;  4H9O A;  1B6W A;  3UTA D;  5B32 A;  4R8P A;  3AZL A;  3KWQ A;  1TZY A;  3WAA C;  1KX3 D;  3MGR C;  3AZK D;  3MNN C;  4JJN A;  4KUD D;  5JRG B;  3AYW A;  3A6N A;  1P3M C;  4Z5T A;  4WU9 D;  1P3L C;  1P3O A;  1P3B A;  5BNV B;  5AV5 A;  3B6G D;  4DRB A;  1EQZ D;  5GXQ A;  1F66 D;  4KHA A;  2F8N A;  3B6F B;  5B0Z B;  3WA9 B;  2FJ7 C;  5CP6 D;  3AV2 A;  1M1A B;  2YFW A;  5GT3 D;  1AOI B;  1BFM A;  1B67 A;  3TU4 D;  2L5A A;  5CPJ A;  5B31 A;  3VH6 W;  3LZ0 C;  4XUJ C;  4ZUX C;  5CHL B;  4H9R A;  3VH5 W;  5JA4 B;  3UTB A;  3AN2 A;  1HTA A;  3AFA B;  3WKJ B;  3X1S A;  3MGP B;  3AZH A;  3C1B C;  5CPI A;  5AVC C;  3REH B;  3LJA C;  4NE6 A;  3MVD C;  4H9N A;  3W98 D;  2PYO D;  3AZI A;  3W96 C;  5AY8 B;  4WU8 A;  3AZF B;  1P3F A;  1KX5 B;  1P3G C;  2JSS A;  3WA9 D;  5B24 B;  3V9R B;  3X1U B;  1M1A D;  4YM6 A;  3LEL A;  5AVB A;  4Z66 A;  1M19 A;  3REJ B;  1U35 D;  2NZD B;  5E5A C;  1S32 A;  5F99 C;  2ARO B;  2HUE B;  2CV5 D;  4LD9 A;  1P3K B;  4WNN A;  3C1C C;  3W99 B;  5DNN B;  5AV6 A;  1M18 C;  3WTP A;  3AFA D;  4YS3 A;  3WKJ D;  4QLC D;  4E45 A;  3MGP D;  2NQB D;  3AZG D;  5BO0 A;  1P3P B;  3LZ1 A;  5B1L C;  4X23 A;  4WV4 B;  2F8N H;  3WAA B;  1KX5 D;  4NE5 A;  3UT9 C;  1BH9 B;  3REL A;  3X1U D;  4H9P B;  3AZN C;  5GT0 A;  5B1M A;  1H3O B;  3MGS D;  5AV8 A;  5B0Y A;  4UUZ B;  3X1T B;  3W97 D;  2ARO D;  5B2I D;  3MGQ B;  1Q9C A;  4KGC C;  3X1V B;  1P3K D;  4HGA B;  2HIO A;  4KUD A;  5AV9 B;  3W99 D;  3KUY B;  5CPK A;  3AZJ C;  2FJ7 B;  1JFI B;  1P34 C;  3KXB A;  2BYM B;  1HQ3 A;  1R4V A;  3LZ0 B;  1EQZ A;  4XZQ C;  4ZUX B;  4DRA A;  5DNM A;  3WAA D;  5CP6 A;  3MGR D;  4H9Q A;  5GT3 A;  1ID3 A;  4Z2M H;  3MNN D;  3TU4 A;  3UTA B;  4J8U C;  3B0C W;  1P3M D;  1KX3 B;  2LY8 A;  1P3L D;  5B32 C;  3AZL C;  3AZK B;  3LJA B;  3KWQ C;  3W96 B;  4WU9 B;  5B33 C;  4JJN C;  5JRG A;  2FJ7 D;  3AV1 C;  3B6G B;  3AZM A;  2RVQ C;  5BNV A;  1P3O C;  1F66 B;  5AV5 C;  1ZLA C;  3LZ0 D;  4XUJ D;  4ZUX D;  4J8W C;  3B6F A;  5B0Z A;  5B40 A;  3REI C;  1M1A A;  1AOI A;  3VH6 T;  1F1E A;  2BYK B;  5B31 C;  4G91 B;  3C1B D;  5AVC D;  3VH5 T;  3LJA D;  1A7W A;  3MVD D;  5B1L B;  5JA4 A;  3W96 D;  1P3G D;  1KX4 C;  3UTB C;  3AN2 C;  3AFA A;  3WKJ A;  3MGP A;  3W98 B;  3AZH C;  2PYO B;  5CPI C;  4AWL C;  3REH A;  5E5A D;  4J8X A;  5F99 D;  2IO5 C;  5AY8 A;  3AZF A;  1KX5 A;  5B24 A;  1U35 B;  3V9R A;  3X1U A;  3C1C D;  3REK C;  3AZJ B;  3LEL C;  1M18 D;  2CV5 B;  3REJ A;  5AVB C;  4Z66 C;  1M19 C;  2NZD A;  1P3I C;  1S32 C;  5B1L D;  1P3K A;  3W99 A;  4QLC B;  5DNN A;  2YFV B;  5G49 B;  3UT9 D;  3WTP C;  2NQB B;  3AZG B;  4YS3 C;  4H9S C;  3AZN D;  3AZL B;  1P3P A;  2F8N K;  4X23 C;  3KWQ B;  4G92 C;  3WAA A;  4KGC D;  3NQU B;  1BH9 A;  3MGS B;  5B33 B;  4H9P A;  3W97 B;  3AZJ D;  3AV1 B;  1H3O A;  5B1M C;  5GT0 C;  5GSU C;  5B2I B;  4UUZ A;  3X1T A;  5AV8 C;  5B0Y C;  1P34 D;  3MGQ A;  1ZLA B;  3X1V A;  4XZQ D;  4J8W B;  5AV9 A;  2HIO C;  5C3I B;  3KUY A;  3REI B;  5CPK C;  2FJ7 A;  1JFI A;  3WTP E;  3AZE C;  3B0D C;  5BS7 A;  4J8U D;  3KXB C;  2BYM A;  1HQ3 C;  4CSR B;  3LZ0 A;  5B32 D;  3AZL D;  3MGR B;  3MNN B;  3KWQ D;  5DNM C;  3B0C T;  1P3M B;  1ID3 C;  1KX4 B;  4J8V C;  3UTA A;  5B33 D;  4JJN D;  1P3L B;  3AV1 D;  1KX3 A;  2RVQ D;  3AZK A;  1P3O D;  3LJA A;  4CAY B;  5AV5 D;  3KSY A;  1ZLA D;  3W96 A;  4J8W D;  4ZBJ C;  4WU9 A;  1BH8 B;  2F8N D;  3REI D;  5JRG C;  3O62 C;  3REK B;  3B6G A;  3AZM C;  4XUJ B;  5BNX B;  1P3I B;  1F66 A;  5B31 D;  1P3A C;  5BT1 C;  3B6F C;  5B2J C;  5B0Z C;  5B40 C;  1AOI C;  1KX4 D;  3UTB D;  5B32 G;  3AN2 D;  3C1B B;  5AVC B;  4R8P C;  2BYK A;  3MVD B;  1TZY C;  3AZH D;  5CPI D;  1P3G B;  3AYW C;  3A6N C;  4Z5T C;  5E5A B;  1P3B C;  3REK D;  5F99 B;  3W98 A;  3LEL D;  2PYO A;  3NQJ B;  5GSU B;  5AVB D;  4Z66 D;  1M19 D;  3REH C;  1P3I D;  2F8N G;  4J8X C;  5GXQ C;  1S32 D;  3WA9 A;  3C1C B;  5AY8 C;  3AZF C;  3AV2 C;  1M18 B;  1U35 A;  5B24 C; 
#chains in the Genus database with same CATH topology
 5B31 G;  3AZJ A;  5CPJ C;  2CV5 A;  2NZD C;  2CWE A;  3WTP D;  3REJ C;  3AZE B;  3B0D B;  4NFT A;  4YS3 D;  3KXB B;  4WZS B;  3P5J B;  3UT9 B;  4X23 D;  1TAF B;  4QLC A;  3AZN B;  2YFV A;  5DNN C;  3X1S C;  4J8V B;  2NQB A;  3AZG A;  5KDM B;  5GT0 D;  5B1M D;  2Y2N A;  4NE3 A;  5GSU D;  3AZI C;  4KGC B;  4WU8 C;  5AV8 D;  5B0Y D;  1P3F C;  4Z2M G;  1P3P C;  4M6B A;  3NQU A;  5FUG B;  4YM6 C;  3MGS A;  4ZBJ B;  1WWI A;  5B33 A;  2HIO D;  3W97 A;  1P34 B;  3O62 B;  2ARO A;  3AV1 A;  3R45 B;  5CPK D;  4EO5 C;  5B2I A;  4LD9 C;  1N1J B;  3AZE D;  2G5I C;  3AZM B;  4XZQ B;  3X1T C;  3KXB D;  1HQ3 D;  3MGQ C;  1ZLA A;  1P3A B;  3H0L C;  4J8W A;  3X1V C;  5AV6 C;  5DNM D;  4HGA C;  5B2J B;  3REI A;  4J8U B;  5AV9 C;  5B40 B;  3KUY C;  4H9O B;  1ID3 D;  4J8V D;  5B32 B;  5BS7 C;  4R8P B;  3LZ1 C;  4CSR A;  1TZY B;  3MGR A;  3MNN A;  2FFF B;  4JJN B;  3REL C;  3AYW B;  1P3M A;  3A6N B;  1KX4 A;  4Z5T B;  3UTA C;  1P3L A;  5JRG D;  3O62 D;  1P3O B;  1P3B B;  1ULY A;  1KU5 A;  5AV5 B;  3AZM D;  1KX3 C;  4J8X B;  5GXQ B;  3AZK C;  4KHA B;  4CAY A;  2F8N B;  3EPH A;  3AL0 C;  1P3A D;  4KUD C;  5BT1 D;  3AV2 B;  3B6F D;  1BH8 A;  2YFW B;  4WU9 C;  5B2J D;  5B0Z D;  5B40 D;  3REK A;  5CPJ B;  1AOI D;  5B31 B;  3B6G C;  4XUJ A;  5BNX A;  4ZUX A;  2Y2J A;  4R8P D;  1P3I A;  1EQZ C;  1F66 C;  1TZY D;  2Y2K A;  4H9R B;  5CP6 C;  3VH6 A;  5GT3 C;  3H0R C;  3UTB B;  3TU4 C;  3AN2 B;  3AYW D;  3A6N D;  3VH5 A;  4Z5T D;  3C1B A;  3X1S B;  5AVC A;  4AWL B;  3AZH B;  5CPI B;  3A1K A;  1P3B D;  4H9S A;  3MVD A;  4G91 C;  4H9N B;  2IO5 B;  4E44 A;  3REH D;  3AZI B;  4J8X D;  5GXQ D;  4WU8 B;  1P3F B;  1P3G A;  5AY8 D;  3AZF D;  3AV2 D;  4YM6 B;  1WWS A;  3LEL B;  5AVB B;  4Z66 B;  5E5A A;  5B24 D;  1M19 B;  1S32 B;  5CPJ D;  5F99 A;  3NQJ A;  4EO5 B;  5GSU A;  2PYO C;  3W98 C;  2Y2I A;  3REJ D;  4LD9 B;  2NZD D;  3WA9 C;  3C1C A;  4WNN B;  3EPL A;  1M1A C;  1M18 A;  5AV6 B;  3WTP B;  1U35 C;  3B0B A;  4YS3 B;  5DNN D;  3X1S D;  1W2E A;  2CV5 C;  2UWX A;  3AZE A;  5BO0 B;  5B1L A;  3LZ1 B;  4X23 B;  4G92 B;  3AZI D;  2G5H C;  4WU8 D;  1P3F D;  3UT9 A;  1P3P D;  3AFA C;  3REL B;  3WKJ C;  1TAF A;  3AZN A;  4YM6 D;  4QLC C;  5GT0 B;  5B1M B;  3MGP C;  4J8V A;  3F6T A;  2XD5 A;  5AV8 B;  5B0Y B;  3AZG C;  2NQB C;  5KDM A;  4LD9 D;  4KGC A;  3X1T D;  1KX5 C;  3EG5 B;  3MGQ D;  3X1U C;  2HIO B;  4KUD B;  5FUG A;  5CPK B;  3X1V D;  3MGS C;  5AV6 D;  1P34 A;  2BG1 A;  5AV9 D;  3O62 A;  3R45 A;  3KUY D;  2ARO C;  3W97 C;  2ZY5 A;  1HQ3 B;  2HUE C;  5B2I C;  1N1J A;  4XZQ A;  1EQZ B;  3LZ1 D;  1P3K C;  5DNM B;  1P3A A;  2Y2O A;  3EPK A;  3W99 C;  5G49 A;  5CP6 B;  4H9Q B;  5GT3 B;  1ID3 B;  5B2J A;  3TU4 B;  3REL D;  4J8U A;  5C3I C;  4H9O A;  1B6W A;  3UTA D;  5B32 A;  4R8P A;  3AZL A;  3KWQ A;  1TZY A;  3WAA C;  1KX3 D;  3MGR C;  3AZK D;  3MNN C;  4JJN A;  4KUD D;  5JRG B;  3AYW A;  3A6N A;  1P3M C;  4Z5T A;  4WU9 D;  2JE5 A;  1P3L C;  1P3O A;  1P3B A;  5BNV B;  5AV5 A;  2DQN C;  3B6G D;  4DRB A;  1EQZ D;  5GXQ A;  1F66 D;  4KHA A;  2F8N A;  3B6F B;  5B0Z B;  3WA9 B;  3KFU G;  2FJ7 C;  5CP6 D;  3AV2 A;  1M1A B;  2YFW A;  5GT3 D;  1AOI B;  1BFM A;  1B67 A;  3TU4 D;  2L5A A;  5CPJ A;  5B31 A;  3VH6 W;  3LZ0 C;  4XUJ C;  4ZUX C;  5CHL B;  4H9R A;  3VH5 W;  5JA4 B;  3UTB A;  3AN2 A;  1HTA A;  3AFA B;  3WKJ B;  3X1S A;  3MGP B;  3AZH A;  3C1B C;  5CPI A;  5AVC C;  3REH B;  2ZY2 A;  3LJA C;  4NE6 A;  3MVD C;  4H9N A;  3W98 D;  2PYO D;  3AZI A;  2ZY3 A;  3W96 C;  5AY8 B;  4WU8 A;  3AZF B;  1P3F A;  1KX5 B;  1P3G C;  2JSS A;  3WA9 D;  5B24 B;  3V9R B;  3X1U B;  1M1A D;  4YM6 A;  3LEL A;  5AVB A;  4Z66 A;  1M19 A;  3REJ B;  1U35 D;  2NZD B;  5E5A C;  1S32 A;  2ARO B;  5F99 C;  2HUE B;  2CV5 D;  4LD9 A;  1T3U A;  1P3K B;  4WNN A;  3C1C C;  3W99 B;  5DNN B;  5AV6 A;  1M18 C;  3WTP A;  3AFA D;  4YS3 A;  3WKJ D;  3IP4 C;  4QLC D;  4E45 A;  3MGP D;  2NQB D;  3AZG D;  5BO0 A;  1P3P B;  3LZ1 A;  5B1L C;  4X23 A;  4WV4 B;  2F8N H;  3WAA B;  1KX5 D;  4NE5 A;  3UT9 C;  1BH9 B;  3FDD A;  3REL A;  3X1U D;  4H9P B;  3AZN C;  5GT0 A;  5B1M A;  1H3O B;  2F2A C;  3MGS D;  2RIQ A;  5AV8 A;  5B0Y A;  4UUZ B;  3X1T B;  3W97 D;  2ARO D;  5B2I D;  3MGQ B;  1Q9C A;  4KGC C;  3X1V B;  1PZR A;  1P3K D;  4HGA B;  2HIO A;  4KUD A;  5AV9 B;  3W99 D;  3KUY B;  5CPK A;  3AZJ C;  2FJ7 B;  1JFI B;  1P34 C;  3KXB A;  2BYM B;  1HQ3 A;  1R4V A;  3LZ0 B;  2ZY4 A;  1EQZ A;  4XZQ C;  4ZUX B;  4DRA A;  5DNM A;  3WAA D;  5CP6 A;  3MGR D;  4H9Q A;  5GT3 A;  1ID3 A;  4Z2M H;  3MNN D;  3TU4 A;  3UTA B;  4J8U C;  3B0C W;  1P3M D;  1KX3 B;  2LY8 A;  1P3L D;  5B32 C;  3AZL C;  3AZK B;  3LJA B;  3KWQ C;  3W96 B;  4WU9 B;  5B33 C;  4JJN C;  5JRG A;  2FJ7 D;  3AV1 C;  2XD1 A;  3B6G B;  3AZM A;  2Y2Q A;  2RVQ C;  5BNV A;  2Y2L A;  1P3O C;  1F66 B;  5AV5 C;  1ZLA C;  3LZ0 D;  4XUJ D;  4ZUX D;  4J8W C;  3B6F A;  5B0Z A;  5B40 A;  3REI C;  1M1A A;  1AOI A;  3VH6 T;  1F1E A;  2BYK B;  5B31 C;  4G91 B;  3C1B D;  5AVC D;  3VH5 T;  3LJA D;  2Y2M A;  1A7W A;  3MVD D;  5B1L B;  5JA4 A;  3W96 D;  1P3G D;  1KX4 C;  3UTB C;  3AN2 C;  3AFA A;  3WKJ A;  3MGP A;  3W98 B;  3AZH C;  2PYO B;  5CPI C;  4AWL C;  3REH A;  5E5A D;  4J8X A;  5F99 D;  3EPJ A;  2IO5 C;  5AY8 A;  3AZF A;  1KX5 A;  5B24 A;  1U35 B;  3V9R A;  3X1U A;  3C1C D;  3REK C;  3AZJ B;  3LEL C;  1M18 D;  2CV5 B;  3REJ A;  5AVB C;  4Z66 C;  1M19 C;  2NZD A;  1P3I C;  1S32 C;  2VQR A;  5B1L D;  1P3K A;  2Y2H A;  3W99 A;  4QLC B;  5DNN A;  2YFV B;  5G49 B;  3UT9 D;  3WTP C;  2NQB B;  3AZG B;  4YS3 C;  4H9S C;  3AZN D;  3AZL B;  1P3P A;  2F8N K;  4X23 C;  3KWQ B;  4G92 C;  3WAA A;  4KGC D;  2Y2G A;  3NQU B;  3H0M C;  1BH9 A;  3MGS B;  5B33 B;  4H9P A;  3W97 B;  3AZJ D;  3AV1 B;  1H3O A;  5B1M C;  5GT0 C;  5B2I B;  5GSU C;  2Y2P A;  4UUZ A;  3X1T A;  5AV8 C;  5B0Y C;  1P34 D;  3MGQ A;  1ZLA B;  2JCH A;  3X1V A;  4XZQ D;  4J8W B;  5AV9 A;  2HIO C;  5C3I B;  3KUY A;  2ZM5 A;  3REI B;  5CPK C;  2FJ7 A;  1JFI A;  3WTP E;  3AZE C;  3B0D C;  5BS7 A;  4J8U D;  3KXB C;  2BYM A;  1HQ3 C;  4CSR B;  3LZ0 A;  5B32 D;  3AZL D;  3MGR B;  3MNN B;  3KWQ D;  5DNM C;  3B0C T;  1P3M B;  1ID3 C;  4DQY B;  4WJ3 C;  1KX4 B;  4J8V C;  3UTA A;  5B33 D;  4JJN D;  1Z2C B;  1P3L B;  3AV1 D;  2DF4 C;  1KX3 A;  2RVQ D;  3AZK A;  1P3O D;  3LJA A;  4CAY B;  5AV5 D;  3KSY A;  1ZLA D;  3W96 A;  4J8W D;  4ZBJ C;  4WU9 A;  1BH8 B;  2F8N D;  3REI D;  5JRG C;  3O62 C;  3REK B;  3B6G A;  3AZM C;  4XUJ B;  5BNX B;  1P3I B;  1F66 A;  5B31 D;  1P3A C;  5BT1 C;  3B6F C;  5B2J C;  5B0Z C;  5B40 C;  1AOI C;  4UPK A;  3UTB D;  5B32 G;  1KX4 D;  3AN2 D;  3C1B B;  5AVC B;  4R8P C;  2BYK A;  3MVD B;  1TZY C;  3AZH D;  5CPI D;  1P3G B;  3AYW C;  3A6N C;  4Z5T C;  2W8S A;  5E5A B;  1P3B C;  3REK D;  5F99 B;  3W98 A;  3LEL D;  2PYO A;  3NQJ B;  5GSU B;  5AVB D;  4Z66 D;  1M19 D;  3REH C;  1P3I D;  2F8N G;  4J8X C;  2J8P A;  3A1I A;  5GXQ C;  1S32 D;  3WA9 A;  3C1C B;  5AY8 C;  3AZF C;  3AV2 C;  1M18 B;  1U35 A;  5B24 C; 
#chains in the Genus database with same CATH homology
 5B31 G;  3AZJ A;  5CPJ C;  2CV5 A;  2NZD C;  2CWE A;  3WTP D;  3REJ C;  3AZE B;  3B0D B;  4NFT A;  4YS3 D;  3KXB B;  4WZS B;  3P5J B;  3UT9 B;  4X23 D;  1TAF B;  4QLC A;  3AZN B;  2YFV A;  5DNN C;  3X1S C;  4J8V B;  2NQB A;  3AZG A;  5KDM B;  5GT0 D;  5B1M D;  2Y2N A;  4NE3 A;  5GSU D;  3AZI C;  4KGC B;  4WU8 C;  5AV8 D;  5B0Y D;  1P3F C;  4Z2M G;  1P3P C;  4M6B A;  3NQU A;  5FUG B;  4YM6 C;  3MGS A;  4ZBJ B;  1WWI A;  5B33 A;  2HIO D;  3W97 A;  1P34 B;  3O62 B;  2ARO A;  3AV1 A;  3R45 B;  5CPK D;  4EO5 C;  5B2I A;  4LD9 C;  1N1J B;  3AZE D;  2G5I C;  3AZM B;  4XZQ B;  3X1T C;  3KXB D;  1HQ3 D;  3MGQ C;  1ZLA A;  1P3A B;  3H0L C;  4J8W A;  3X1V C;  5AV6 C;  5DNM D;  4HGA C;  5B2J B;  3REI A;  4J8U B;  5AV9 C;  5B40 B;  3KUY C;  4H9O B;  1ID3 D;  4J8V D;  5B32 B;  5BS7 C;  4R8P B;  3LZ1 C;  4CSR A;  1TZY B;  3MGR A;  3MNN A;  2FFF B;  4JJN B;  3REL C;  3AYW B;  1P3M A;  3A6N B;  1KX4 A;  4Z5T B;  3UTA C;  1P3L A;  5JRG D;  3O62 D;  1P3O B;  1P3B B;  1ULY A;  1KU5 A;  5AV5 B;  3AZM D;  1KX3 C;  4J8X B;  5GXQ B;  3AZK C;  4KHA B;  4CAY A;  2F8N B;  3EPH A;  3AL0 C;  1P3A D;  4KUD C;  5BT1 D;  3AV2 B;  3B6F D;  1BH8 A;  2YFW B;  4WU9 C;  5B2J D;  5B0Z D;  5B40 D;  3REK A;  5CPJ B;  1AOI D;  5B31 B;  3B6G C;  4XUJ A;  5BNX A;  4ZUX A;  2Y2J A;  4R8P D;  1P3I A;  1EQZ C;  1F66 C;  1TZY D;  2Y2K A;  4H9R B;  5CP6 C;  3VH6 A;  5GT3 C;  3H0R C;  3UTB B;  3TU4 C;  3AN2 B;  3AYW D;  3A6N D;  3VH5 A;  4Z5T D;  3C1B A;  3X1S B;  5AVC A;  4AWL B;  3AZH B;  5CPI B;  3A1K A;  1P3B D;  4H9S A;  3MVD A;  4G91 C;  4H9N B;  2IO5 B;  4E44 A;  3REH D;  3AZI B;  4J8X D;  5GXQ D;  4WU8 B;  1P3F B;  1P3G A;  5AY8 D;  3AZF D;  3AV2 D;  4YM6 B;  1WWS A;  3LEL B;  5AVB B;  4Z66 B;  5E5A A;  5B24 D;  1M19 B;  1S32 B;  5CPJ D;  5F99 A;  3NQJ A;  4EO5 B;  5GSU A;  2PYO C;  3W98 C;  2Y2I A;  3REJ D;  4LD9 B;  2NZD D;  3WA9 C;  3C1C A;  4WNN B;  3EPL A;  1M1A C;  1M18 A;  5AV6 B;  3WTP B;  1U35 C;  3B0B A;  4YS3 B;  5DNN D;  3X1S D;  1W2E A;  2CV5 C;  2UWX A;  3AZE A;  5BO0 B;  5B1L A;  3LZ1 B;  4X23 B;  4G92 B;  3AZI D;  2G5H C;  4WU8 D;  1P3F D;  3UT9 A;  1P3P D;  3AFA C;  3REL B;  3WKJ C;  1TAF A;  3AZN A;  4YM6 D;  4QLC C;  5GT0 B;  5B1M B;  3MGP C;  4J8V A;  3F6T A;  2XD5 A;  5AV8 B;  5B0Y B;  3AZG C;  2NQB C;  5KDM A;  4LD9 D;  4KGC A;  3X1T D;  1KX5 C;  3EG5 B;  3MGQ D;  3X1U C;  2HIO B;  4KUD B;  5FUG A;  5CPK B;  3X1V D;  3MGS C;  5AV6 D;  1P34 A;  2BG1 A;  5AV9 D;  3O62 A;  3R45 A;  3KUY D;  2ARO C;  3W97 C;  2ZY5 A;  1HQ3 B;  2HUE C;  5B2I C;  1N1J A;  4XZQ A;  1EQZ B;  3LZ1 D;  1P3K C;  5DNM B;  1P3A A;  2Y2O A;  3EPK A;  3W99 C;  5G49 A;  5CP6 B;  4H9Q B;  5GT3 B;  1ID3 B;  5B2J A;  3TU4 B;  3REL D;  4J8U A;  5C3I C;  4H9O A;  1B6W A;  3UTA D;  5B32 A;  4R8P A;  3AZL A;  3KWQ A;  1TZY A;  3WAA C;  1KX3 D;  3MGR C;  3AZK D;  3MNN C;  4JJN A;  4KUD D;  5JRG B;  3AYW A;  3A6N A;  1P3M C;  4Z5T A;  4WU9 D;  2JE5 A;  1P3L C;  1P3O A;  1P3B A;  5BNV B;  5AV5 A;  2DQN C;  3B6G D;  4DRB A;  1EQZ D;  5GXQ A;  1F66 D;  4KHA A;  2F8N A;  3B6F B;  5B0Z B;  3WA9 B;  3KFU G;  2FJ7 C;  5CP6 D;  3AV2 A;  1M1A B;  2YFW A;  5GT3 D;  1AOI B;  1BFM A;  1B67 A;  3TU4 D;  2L5A A;  5CPJ A;  5B31 A;  3VH6 W;  3LZ0 C;  4XUJ C;  4ZUX C;  5CHL B;  4H9R A;  3VH5 W;  5JA4 B;  3UTB A;  3AN2 A;  1HTA A;  3AFA B;  3WKJ B;  3X1S A;  3MGP B;  3AZH A;  3C1B C;  5CPI A;  5AVC C;  3REH B;  2ZY2 A;  3LJA C;  4NE6 A;  3MVD C;  4H9N A;  3W98 D;  2PYO D;  3AZI A;  2ZY3 A;  3W96 C;  5AY8 B;  4WU8 A;  3AZF B;  1P3F A;  1KX5 B;  1P3G C;  2JSS A;  3WA9 D;  5B24 B;  3V9R B;  3X1U B;  1M1A D;  4YM6 A;  3LEL A;  5AVB A;  4Z66 A;  1M19 A;  3REJ B;  1U35 D;  2NZD B;  5E5A C;  1S32 A;  2ARO B;  5F99 C;  2HUE B;  2CV5 D;  4LD9 A;  1T3U A;  1P3K B;  4WNN A;  3C1C C;  3W99 B;  5DNN B;  5AV6 A;  1M18 C;  3WTP A;  3AFA D;  4YS3 A;  3WKJ D;  3IP4 C;  4QLC D;  4E45 A;  3MGP D;  2NQB D;  3AZG D;  5BO0 A;  1P3P B;  3LZ1 A;  5B1L C;  4X23 A;  4WV4 B;  2F8N H;  3WAA B;  1KX5 D;  4NE5 A;  3UT9 C;  1BH9 B;  3FDD A;  3REL A;  3X1U D;  4H9P B;  3AZN C;  5GT0 A;  5B1M A;  1H3O B;  2F2A C;  3MGS D;  2RIQ A;  5AV8 A;  5B0Y A;  4UUZ B;  3X1T B;  3W97 D;  2ARO D;  5B2I D;  3MGQ B;  1Q9C A;  4KGC C;  3X1V B;  1PZR A;  1P3K D;  4HGA B;  2HIO A;  4KUD A;  5AV9 B;  3W99 D;  3KUY B;  5CPK A;  3AZJ C;  2FJ7 B;  1JFI B;  1P34 C;  3KXB A;  2BYM B;  1HQ3 A;  1R4V A;  3LZ0 B;  2ZY4 A;  1EQZ A;  4XZQ C;  4ZUX B;  4DRA A;  5DNM A;  3WAA D;  5CP6 A;  3MGR D;  4H9Q A;  5GT3 A;  1ID3 A;  4Z2M H;  3MNN D;  3TU4 A;  3UTA B;  4J8U C;  3B0C W;  1P3M D;  1KX3 B;  2LY8 A;  1P3L D;  5B32 C;  3AZL C;  3AZK B;  3LJA B;  3KWQ C;  3W96 B;  4WU9 B;  5B33 C;  4JJN C;  5JRG A;  2FJ7 D;  3AV1 C;  2XD1 A;  3B6G B;  3AZM A;  2Y2Q A;  2RVQ C;  5BNV A;  2Y2L A;  1P3O C;  1F66 B;  5AV5 C;  1ZLA C;  3LZ0 D;  4XUJ D;  4ZUX D;  4J8W C;  3B6F A;  5B0Z A;  5B40 A;  3REI C;  1M1A A;  1AOI A;  3VH6 T;  1F1E A;  2BYK B;  5B31 C;  4G91 B;  3C1B D;  5AVC D;  3VH5 T;  3LJA D;  2Y2M A;  1A7W A;  3MVD D;  5B1L B;  5JA4 A;  3W96 D;  1P3G D;  1KX4 C;  3UTB C;  3AN2 C;  3AFA A;  3WKJ A;  3MGP A;  3W98 B;  3AZH C;  2PYO B;  5CPI C;  4AWL C;  3REH A;  5E5A D;  4J8X A;  5F99 D;  3EPJ A;  2IO5 C;  5AY8 A;  3AZF A;  1KX5 A;  5B24 A;  1U35 B;  3V9R A;  3X1U A;  3C1C D;  3REK C;  3AZJ B;  3LEL C;  1M18 D;  2CV5 B;  3REJ A;  5AVB C;  4Z66 C;  1M19 C;  2NZD A;  1P3I C;  1S32 C;  2VQR A;  5B1L D;  1P3K A;  2Y2H A;  3W99 A;  4QLC B;  5DNN A;  2YFV B;  5G49 B;  3UT9 D;  3WTP C;  2NQB B;  3AZG B;  4YS3 C;  4H9S C;  3AZN D;  3AZL B;  1P3P A;  2F8N K;  4X23 C;  3KWQ B;  4G92 C;  3WAA A;  4KGC D;  2Y2G A;  3NQU B;  3H0M C;  1BH9 A;  3MGS B;  5B33 B;  4H9P A;  3W97 B;  3AZJ D;  3AV1 B;  1H3O A;  5B1M C;  5GT0 C;  5B2I B;  5GSU C;  2Y2P A;  4UUZ A;  3X1T A;  5AV8 C;  5B0Y C;  1P34 D;  3MGQ A;  1ZLA B;  2JCH A;  3X1V A;  4XZQ D;  4J8W B;  5AV9 A;  2HIO C;  5C3I B;  3KUY A;  2ZM5 A;  3REI B;  5CPK C;  2FJ7 A;  1JFI A;  3WTP E;  3AZE C;  3B0D C;  5BS7 A;  4J8U D;  3KXB C;  2BYM A;  1HQ3 C;  4CSR B;  3LZ0 A;  5B32 D;  3AZL D;  3MGR B;  3MNN B;  3KWQ D;  5DNM C;  3B0C T;  1P3M B;  1ID3 C;  4DQY B;  4WJ3 C;  1KX4 B;  4J8V C;  3UTA A;  5B33 D;  4JJN D;  1Z2C B;  1P3L B;  3AV1 D;  2DF4 C;  1KX3 A;  2RVQ D;  3AZK A;  1P3O D;  3LJA A;  4CAY B;  5AV5 D;  3KSY A;  1ZLA D;  3W96 A;  4J8W D;  4ZBJ C;  4WU9 A;  1BH8 B;  2F8N D;  3REI D;  5JRG C;  3O62 C;  3REK B;  3B6G A;  3AZM C;  4XUJ B;  5BNX B;  1P3I B;  1F66 A;  5B31 D;  1P3A C;  5BT1 C;  3B6F C;  5B2J C;  5B0Z C;  5B40 C;  1AOI C;  4UPK A;  3UTB D;  5B32 G;  1KX4 D;  3AN2 D;  3C1B B;  5AVC B;  4R8P C;  2BYK A;  3MVD B;  1TZY C;  3AZH D;  5CPI D;  1P3G B;  3AYW C;  3A6N C;  4Z5T C;  2W8S A;  5E5A B;  1P3B C;  3REK D;  5F99 B;  3W98 A;  3LEL D;  2PYO A;  3NQJ B;  5GSU B;  5AVB D;  4Z66 D;  1M19 D;  3REH C;  1P3I D;  2F8N G;  4J8X C;  2J8P A;  3A1I A;  5GXQ C;  1S32 D;  3WA9 A;  3C1C B;  5AY8 C;  3AZF C;  3AV2 C;  1M18 B;  1U35 A;  5B24 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...