1KX3B

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3B00
5DNNC 3X1SA 3W97C 3O62C 4YS3A 3KUYC 5E5AD 1TZYD 3WKJD 4NE6A 3AZEA 5BNXA 5BT1D 4J8WA 3NQJA 5GSUC 3AYWD 1P34C 1P3MB 1ZLAD 1S32B 1AOID 4Z5TA 4G92B 1H3OB 4HGAC 5B33C 1M1AB 5AY8B 4UUZA 4Z2MH 4WU8A 1P3FB 3REJD 3WA9C 5CPJA 3AZGA 3TU4D 3MGPC 1P3OB 3B6FA 3AN2C 5B31D 3VH6T 5DNMB 2AROA 2NQBB 5FUGA 5B2ID 3W98B 4XUJA 3AZJB 3WTPD 3C1CB 3AV2D 4KGCA 5KDMA 1ID3A 5DNMC 1TZYB 4KUDB 4DRAA 3WKJB 5B0YD 1P3LD 3AZID 3W96A 2BYKB 1KX5C 3X1SC 4YS3C 2PYOD 3AZFD 3AZHD 3AZJC 3MGSD 3REKA 1AOIB 3AZEC 3WAAB 4J8WC 4WZSB 4AWLB 3RELD 4JJND 3REJB 1HQ3A 4H9NA 4Z5TC 5B31B 4WU8C 3UT9A 3AZKB 5F99D 3KWQA 4Z66C 2CV5A 5B2IB 1M18B 3C1BA 3UTBA 3B6FC 1KX4C 3AFAA 1P3PB 2AROC 3WTPB 1P3BA 5GT0B 4ZBJC 3X1TD 3KXBD 3W99D 4XUJC 4DRBA 1P3LB 3AZIB 5CPKD 3MNNC 3B6GA 3VH5T 3REHD 1JFIA 5B32A 1ID3C 3AZFB 3AV1B 3AZHB 3AZNA 2BYMB 3W96C 1B67A 3LJAD 5B40D 4J8UA 1P3KB 5B24D 1U35A 5B1MD 4H9RA 3MGRC 4YM6B 1M19D 4J8XA 1BH8A 5DNND 3W97D 3O62D 1HQ3C 3KUYD 5AV5A 4KHAA 5F99B 1P3KC 4J8VB 3REIB 4G91B 3UT9C 3UTAA 5GSUD 2CV5C 3KWQC 5AV6A 3A6ND 3X1TB 5B2JB 5AV8A 3C1BC 3W99B 2YFVB 3AFAC 1KX3A 1BH9A 1P3BC 4H9QB 3REIC 1P3IA 3MGPD 4G91C 4WNNA 3B6GC 5B24B 5B2JC 5GXQB 5B32C 1M1AD 2F8NA 1P3FD 5GT3B 1F66B 5AVCC 2HIOA 5AVBA 4J8UC 5DNNB 3W97B 3O62B 3X1VA 4LD9C 3R45B 3KUYB 5JRGA 4QLCA 1BFMA 5DNMD 5BO0A 4J8XC 3LZ0B 2NQBD 1KX5D 3W98D 4H9PB 3AZMA 1P34B 5AV5C 1EQZA 3AZJD 3C1CD 5BS7A 4HGAB 5B33B 1P3MA 3B0BA 3UTAC 2LY8A 4KUDD 4E44A 5CP6A 3WA9B 3LZ0C 1S32A 4X23A 3MGPB 3MGQB 5AV8C 3LZ1A 3AN2B 4R8PC 1KX3C 4WU8D 4H9OB 1P3OA 2NZDA 1P3IC 5B0ZB 4Z66D 3WAAD 5AV9A 5CPIA 1P3GA 3B6FD 3AZLC 1KX4D 4ZUXA 3MGQC 2AROD 3X1UA 3LELB 5B32G 5B1LC 3AZKD 5B0ZC 2HIOC 5AVBC 3MNND 1KX5B 2RVQC 3X1SB 1TAFA 1M18D 5E5AA 4YS3B 2F8NK 1TZYA 5JRGC 4QLCC 5G49A 3WKJA 1P3PD 1HTAA 3B0CW 3LELC 3AZEB 5BNXB 3V9RA 5GT0D 3AYWA 4J8WB 1ZLAA 3NQJB 3AZMC 3MGRD 1EQZC 4Z5TB 5BS7C 4UUZB 3REJA 4WU8B 3AV1D 4CAYA 3TU4A 3AZGB 4Z66B 4X23C 1P3KD 5B31A 3B6FB 2YFWA 1KX4B 3UT9D 2AROB 4YM6D 2NZDC 2CV5D 5B2IA 4ZBJB 2FJ7A 5FUGB 2IO5C 5AV9C 5CPIC 3C1BD 1P3GC 4XUJB 5CPJC 3AZGC 3MNNB 4ZUXC 4J8VD 3AV2A 3X1UC 3REID 1ID3B 2F8NG 5B0YA 1F1EA 4CSRA 3W96B 2PYOA 5B2JD 5E5AC 3AZFA 3MGRB 3MGSA 2BYMA 5AVCD 4KGCC 3RELA 4JJNA 3AYWC 1ZLAC 4LD9D 1HQ3B 4H9NB 5GXQD 2JSSA 3UT9B 5GT3D 1F66D 5F99A 3REKC 3TU4C 2CV5B 3KWQB 3C1BB 3UTBB 3AFAB 2F8NH 3UTAD 1P3BB 5JA4B 3LZ0D 3KXBA 2FJ7C 4XZQA 5AV8D 4WU9A 3NQUA 5CPKA 1P34D 4R8PD 3B6GB 3REHA 1WWIA 3AV2C 3UTBC 1JFIB 5B32B 5B33D 3KSYA 5B0YC 3LJAA 5B40A 3AZNB 5BNVA 5B24A 3WA9D 5AVCB 4J8UB 3AZLD 3MGQD 5B1MA 1U35B 4WV4B 4LD9B 3AN2D 4H9RB 4EO5B 3MGSC 1M19A 1R4VA 4NFTA 4J8XB 1BH8B 5B1LD 5B0ZD 2HIOD 3W97A 4JJNC 3RELC 3KUYA 1N1JA 2HUEC 3AZNC 5AV5B 4KHAB 1U35C 3LELD 3MVDA 4EO5C 4H9PA 5GSUA 1B6WA 1P3AA 3UTAB 3A6NA 3AZMD 1EQZD 5AV8B 3X1SD 3B0DC 4YS3D 4R8PB 1KX3B 1BH9B 3MGPA 3AZED 1P3IB 3KXBC 4NE3A 4XZQC 4J8WD 4WU9C 5CPKC 4WNNB 5AV6C 3AZLB 3REHC 1H3OA 1M1AA 4Z5TD 5AY8A 2F8NB 1P3FA 5AV9D 3LJAC 1P3GD 5B1LB 5CPJD 3AZGD 2HIOB 5AVBB 5B1MC 3X1VB 3X1UD 5DNMA 5JRGB 4QLCB 1M19C 5BO0B 2NQBA 1KX5A 3B0CT 3W98A 3AZMB 4XUJD 3AZJA 3C1CA 1EQZB 3X1VC 3MVDC 3VH5W 4KGCD 1ID3D 4KUDA 1P3AC 1Q9CA 5C3IC 3A6NC 5CP6B 2BYKA 1A7WA 3W96D 4X23B 5CHLB 3LZ1B 1AOIA 3REKD 4Z66A 3WAAA 2NZDB 2IO5B 1P3MC 5AV9B 5CPIB 1P3GB 5CP6C 1KX4A 5CPJB 1HQ3D 1S32C 4G92C 4ZUXB 1M1AC 3LZ1C 1ULYA 5AY8C 3X1UB 1P3FC 2FJ7D 3AZKA 3MNNA 1P3OC 3VH6W 3KWQD 1WWSA 4E45A 1M18A 1TAFB 3UTBD 5E5AB 1P3PA 5G49B 3WTPA 3AFAD 5GT0A 2NQBC 1P3BD 4KGCB 3V9RB 5KDMB 3AYWB 3W98C 1ZLAB 1P3LA 3MGRA 3AZIA 3C1CC 3B6GD 1TZYC 5B32D 3AV1A 3AZHA 4KUDC 3WKJC 4M6BA 4CAYB 3REKB 5BT1C 3TU4B 3AZND 1P3KA 4J8UD 1U35D 2YFWB 4YM6A 1AOIC 3WAAC 4J8XD 4AWLC 2FJ7B 3REJC 4H9SA 4J8VA 5AV5D 5JA4A 5B31C 3REIA 3AV2B 4XZQD 5B0YB 3AZKC 4WU9D 4NE5A 4CSRB 5B2IC 3X1TA 5B2JA 5AV6D 1M18C 3W99A 2PYOB 2YFVA 1P3PC 3VH5A 3MGSB 3WTPC 1KX3D 4H9QA 5AVCA 5GT0C 1P3ID 3RELB 4JJNB 4LD9A 1P3LC 3AZIC 2HUEB 5GXQA 2PYOC 3AZFC 2F8ND 3AV1C 5GT3A 3AZHC 1F66A 5DNNA 2CWEA 5AVBD 3O62A 3R45A 2RVQD 3X1VD 3B0DB 3MVDD 5JRGD 1KU5A 4QLCD 4YM6C 1P3AD 3LZ0A 3VH6A 3KXBB 4XZQB 1P34A 5F99C 3NQUB 4H9SC 4R8PA 4WU9B 5CPKB 3WTPE 4J8VC 5AV6B 3REHB 5B33A 5B31G 3WA9A 1P3MD 3LJAB 5B40B 5CP6D 5BNVB 3MGQA 3AZLA 3X1TC 1S32D 4X23D 3W99C 3AN2A 5B1MB 3LZ1D 5AY8D 4H9OA 1M19B 5B1LA 5B0ZA 1P3OD 4Z2MG 2NZDD 5CPID 1N1JB 2L5AA 5B40C 5B24C 5GXQC 4ZUXD 3LELA 3MVDB 5GT3C 1F66C 5GSUB 1P3AB 5C3IB 3A6NB
chains in the Genus database with same CATH superfamily
5DNNC 3X1SA 3W97C 3O62C 4YS3A 2UWXA 3KUYC 5E5AD 2ZM5A 1TZYD 3WKJD 4NE6A 3AZEA 5BNXA 5BT1D 4J8WA 3NQJA 5GSUC 3EPLA 3AYWD 1P34C 1P3MB 1ZLAD 3EPJA 1S32B 1AOID 4Z5TA 4G92B 1H3OB 4HGAC 5B33C 1M1AB 5AY8B 4UUZA 4Z2MH 4WU8A 1P3FB 3REJD 3WA9C 5CPJA 3AZGA 3TU4D 3MGPC 1P3OB 3B6FA 3AN2C 5B31D 3VH6T 5DNMB 2AROA 3P5JB 2NQBB 5FUGA 5B2ID 3W98B 4XUJA 3AZJB 3WTPD 3C1CB 3AV2D 4KGCA 5KDMA 1ID3A 5DNMC 1TZYB 4KUDB 4DRAA 3WKJB 5B0YD 1P3LD 3AZID 3W96A 2BG1A 2BYKB 1KX5C 3X1SC 4YS3C 2PYOD 2G5HC 3AZFD 3AZHD 3AZJC 3MGSD 3REKA 1AOIB 3AZEC 3WAAB 4J8WC 4WZSB 4AWLB 3RELD 4JJND 3REJB 1HQ3A 2XD5A 4H9NA 4Z5TC 5B31B 4WU8C 3UT9A 3AZKB 5F99D 3KWQA 4Z66C 2CV5A 5B2IB 1M18B 3C1BA 3UTBA 3B6FC 2Y2JA 1KX4C 3AFAA 1P3PB 2JE5A 2AROC 3WTPB 1P3BA 3EPHA 5GT0B 4ZBJC 3X1TD 3KXBD 3W99D 4XUJC 4DRBA 1P3LB 3AZIB 5CPKD 3MNNC 3B6GA 3VH5T 3REHD 1JFIA 5B32A 1ID3C 3AZFB 3AV1B 2XD1A 3AZHB 3AZNA 2BYMB 3W96C 1B67A 3LJAD 5B40D 4J8UA 1P3KB 5B24D 1U35A 5B1MD 4H9RA 3MGRC 4YM6B 1M19D 4J8XA 1BH8A 5DNND 3W97D 3O62D 1HQ3C 3KUYD 5AV5A 4KHAA 5F99B 1P3KC 4J8VB 3REIB 4G91B 3UT9C 3UTAA 5GSUD 2CV5C 3KWQC 5AV6A 3A6ND 3X1TB 5B2JB 5AV8A 3C1BC 3W99B 2YFVB 3AFAC 1KX3A 1BH9A 1P3BC 4H9QB 3REIC 1P3IA 3MGPD 4G91C 4WNNA 3B6GC 5B24B 5B2JC 5GXQB 5B32C 1M1AD 2F8NA 1P3FD 5GT3B 1F66B 5AVCC 2HIOA 5AVBA 4J8UC 5DNNB 3W97B 3O62B 3X1VA 4LD9C 3R45B 3KUYB 5JRGA 4QLCA 1BFMA 5DNMD 5BO0A 4J8XC 3LZ0B 4WJ3C 2NQBD 1KX5D 3W98D 4H9PB 3AZMA 1P34B 5AV5C 2Y2GA 1EQZA 3AZJD 3C1CD 5BS7A 4HGAB 5B33B 1P3MA 3B0BA 3UTAC 2LY8A 4KUDD 4E44A 5CP6A 3WA9B 3LZ0C 1S32A 4X23A 3MGPB 3MGQB 5AV8C 3LZ1A 3AN2B 2Y2OA 4R8PC 1KX3C 4WU8D 4H9OB 2ZY4A 1P3OA 2NZDA 1P3IC 5B0ZB 4Z66D 3WAAD 5AV9A 5CPIA 1P3GA 3B6FD 3AZLC 1KX4D 4ZUXA 3MGQC 2AROD 3X1UA 3LELB 5B32G 2DF4C 5B1LC 3AZKD 5B0ZC 2HIOC 1T3UA 5AVBC 3MNND 1KX5B 2RVQC 3X1SB 1TAFA 1M18D 5E5AA 4YS3B 2F8NK 1TZYA 5JRGC 4QLCC 5G49A 3WKJA 1P3PD 1HTAA 3B0CW 3LELC 3AZEB 5BNXB 3V9RA 5GT0D 3AYWA 4J8WB 1ZLAA 3NQJB 3AZMC 3MGRD 1EQZC 4Z5TB 5BS7C 4UUZB 3REJA 4WU8B 3AV1D 4CAYA 3TU4A 3AZGB 4Z66B 4X23C 1P3KD 5B31A 3B6FB 2YFWA 1KX4B 3UT9D 2AROB 4YM6D 2NZDC 2CV5D 5B2IA 4ZBJB 2FJ7A 5FUGB 2IO5C 4UPKA 5AV9C 5CPIC 3C1BD 1P3GC 4XUJB 5CPJC 3AZGC 3MNNB 4ZUXC 4J8VD 3AV2A 3X1UC 3REID 1ID3B 2F8NG 5B0YA 1F1EA 4CSRA 3W96B 1Z2CB 3F6TA 2PYOA 5B2JD 5E5AC 3AZFA 1PZRA 3MGRB 3MGSA 2BYMA 5AVCD 4KGCC 3RELA 4JJNA 3AYWC 1ZLAC 4LD9D 1HQ3B 4H9NB 5GXQD 2JSSA 3UT9B 5GT3D 1F66D 5F99A 3REKC 3TU4C 2CV5B 3KWQB 3C1BB 3UTBB 2JCHA 3AFAB 2F8NH 3A1KA 3UTAD 1P3BB 5JA4B 3LZ0D 3KXBA 2FJ7C 4XZQA 5AV8D 4WU9A 3NQUA 5CPKA 1P34D 2ZY5A 4R8PD 3B6GB 3REHA 1WWIA 3AV2C 3UTBC 1JFIB 5B32B 5B33D 3KSYA 5B0YC 3LJAA 5B40A 3AZNB 5BNVA 5B24A 3WA9D 5AVCB 4J8UB 3AZLD 3MGQD 5B1MA 1U35B 4WV4B 4LD9B 3AN2D 4H9RB 4EO5B 3MGSC 1M19A 1R4VA 3H0MC 4NFTA 1BH8B 5B1LD 4J8XB 5B0ZD 2HIOD 3W97A 4JJNC 3RELC 3KUYA 1N1JA 2HUEC 3AZNC 5AV5B 4KHAB 1W2EA 1U35C 3LELD 3MVDA 4EO5C 4H9PA 5GSUA 1B6WA 1P3AA 3UTAB 3A6NA 3AZMD 2G5IC 5AV8B 3X1SD 1EQZD 3B0DC 4YS3D 4R8PB 1KX3B 2Y2HA 1BH9B 2Y2IA 3MGPA 3AZED 1P3IB 3KXBC 4NE3A 4XZQC 4J8WD 4WU9C 5CPKC 4WNNB 3FDDA 5AV6C 3AZLB 3REHC 1H3OA 1M1AA 4Z5TD 5AY8A 2F8NB 1P3FA 5AV9D 3LJAC 1P3GD 5B1LB 5CPJD 3AZGD 2HIOB 5AVBB 5B1MC 3KFUG 3X1VB 3X1UD 5DNMA 5JRGB 4QLCB 1M19C 5BO0B 2NQBA 1KX5A 3B0CT 2Y2QA 3H0LC 3W98A 3AZMB 4XUJD 3AZJA 3A1IA 3C1CA 1EQZB 3X1VC 3MVDC 3VH5W 4KGCD 2F2AC 1ID3D 4KUDA 1P3AC 1Q9CA 2Y2LA 5C3IC 3A6NC 5CP6B 3EPKA 2BYKA 1A7WA 3W96D 4X23B 5CHLB 3LZ1B 1AOIA 3REKD 2Y2PA 4Z66A 3WAAA 2NZDB 2IO5B 1P3MC 5AV9B 5CPIB 1P3GB 5CP6C 1KX4A 5CPJB 1HQ3D 2FFFB 1S32C 3IP4C 4G92C 4ZUXB 1M1AC 3LZ1C 1ULYA 5AY8C 3X1UB 4DQYB 1P3FC 2FJ7D 3AZKA 3MNNA 1P3OC 3VH6W 3KWQD 1WWSA 4E45A 1M18A 1TAFB 3UTBD 5E5AB 1P3PA 5G49B 3WTPA 3AFAD 5GT0A 2NQBC 1P3BD 4KGCB 3V9RB 5KDMB 3AYWB 3W98C 1ZLAB 1P3LA 3MGRA 3AZIA 3C1CC 3B6GD 1TZYC 5B32D 3AV1A 3AZHA 4KUDC 3WKJC 4M6BA 4CAYB 3REKB 5BT1C 3TU4B 3AZND 1P3KA 4J8UD 1U35D 2YFWB 4YM6A 1AOIC 2J8PA 3WAAC 4J8XD 4AWLC 2FJ7B 3REJC 4H9SA 4J8VA 5AV5D 3EG5B 2Y2NA 5JA4A 5B31C 3REIA 3AV2B 3AL0C 4XZQD 5B0YB 3AZKC 4WU9D 4NE5A 4CSRB 5B2IC 3X1TA 5B2JA 5AV6D 1M18C 3W99A 2PYOB 2YFVA 1P3PC 3H0RC 3VH5A 3MGSB 3WTPC 1KX3D 4H9QA 5AVCA 5GT0C 1P3ID 3RELB 4JJNB 4LD9A 1P3LC 3AZIC 2HUEB 5GXQA 2PYOC 3AZFC 2F8ND 3AV1C 5GT3A 3AZHC 1F66A 5DNNA 2CWEA 5AVBD 3O62A 3R45A 2RVQD 3X1VD 3B0DB 3MVDD 5JRGD 1KU5A 4QLCD 4YM6C 1P3AD 3LZ0A 3VH6A 3KXBB 4XZQB 1P34A 5F99C 3NQUB 4H9SC 4R8PA 4WU9B 5CPKB 3WTPE 4J8VC 5AV6B 3REHB 5B33A 2RIQA 5B31G 3WA9A 1P3MD 3LJAB 5B40B 5CP6D 5BNVB 3MGQA 3AZLA 3X1TC 1S32D 4X23D 3W99C 3AN2A 5B1MB 3LZ1D 2Y2MA 5AY8D 4H9OA 1M19B 5B1LA 5B0ZA 1P3OD 4Z2MG 2NZDD 2ZY2A 5CPID 1N1JB 2L5AA 2Y2KA 5B40C 5B24C 5GXQC 4ZUXD 3LELA 2ZY3A 2DQNC 3MVDB 5GT3C 1F66C 5GSUB 1P3AB 2VQRA 2W8SA 5C3IB 3A6NB
chains in the Genus database with same CATH topology
5DNNC 3X1SA 3W97C 3O62C 4YS3A 2UWXA 3KUYC 5E5AD 2ZM5A 1TZYD 3WKJD 4NE6A 3AZEA 5BNXA 5BT1D 4J8WA 3NQJA 5GSUC 3EPLA 3AYWD 1P34C 1P3MB 1ZLAD 3EPJA 1S32B 1AOID 4Z5TA 4G92B 1H3OB 4HGAC 5B33C 1M1AB 5AY8B 4UUZA 4Z2MH 4WU8A 1P3FB 3REJD 3WA9C 5CPJA 3AZGA 3TU4D 3MGPC 1P3OB 3B6FA 3AN2C 5B31D 3VH6T 5DNMB 2AROA 3P5JB 2NQBB 5FUGA 5B2ID 3W98B 4XUJA 3AZJB 3WTPD 3C1CB 3AV2D 4KGCA 5KDMA 1ID3A 5DNMC 1TZYB 4KUDB 4DRAA 3WKJB 5B0YD 1P3LD 3AZID 3W96A 2BG1A 2BYKB 1KX5C 3X1SC 4YS3C 2PYOD 2G5HC 3AZFD 3AZHD 3AZJC 3MGSD 3REKA 1AOIB 3AZEC 3WAAB 4J8WC 4WZSB 4AWLB 3RELD 4JJND 3REJB 1HQ3A 2XD5A 4H9NA 4Z5TC 5B31B 4WU8C 3UT9A 3AZKB 5F99D 3KWQA 4Z66C 2CV5A 5B2IB 1M18B 3C1BA 3UTBA 3B6FC 2Y2JA 1KX4C 3AFAA 1P3PB 2JE5A 2AROC 3WTPB 1P3BA 3EPHA 5GT0B 4ZBJC 3X1TD 3KXBD 3W99D 4XUJC 4DRBA 1P3LB 3AZIB 5CPKD 3MNNC 3B6GA 3VH5T 3REHD 1JFIA 5B32A 1ID3C 3AZFB 3AV1B 2XD1A 3AZHB 3AZNA 2BYMB 3W96C 1B67A 3LJAD 5B40D 4J8UA 1P3KB 5B24D 1U35A 5B1MD 4H9RA 3MGRC 4YM6B 1M19D 4J8XA 1BH8A 5DNND 3W97D 3O62D 1HQ3C 3KUYD 5AV5A 4KHAA 5F99B 1P3KC 4J8VB 3REIB 4G91B 3UT9C 3UTAA 5GSUD 2CV5C 3KWQC 5AV6A 3A6ND 3X1TB 5B2JB 5AV8A 3C1BC 3W99B 2YFVB 3AFAC 1KX3A 1BH9A 1P3BC 4H9QB 3REIC 1P3IA 3MGPD 4G91C 4WNNA 3B6GC 5B24B 5B2JC 5GXQB 5B32C 1M1AD 2F8NA 1P3FD 5GT3B 1F66B 5AVCC 2HIOA 5AVBA 4J8UC 5DNNB 3W97B 3O62B 3X1VA 4LD9C 3R45B 3KUYB 5JRGA 4QLCA 1BFMA 5DNMD 5BO0A 4J8XC 3LZ0B 4WJ3C 2NQBD 1KX5D 3W98D 4H9PB 3AZMA 1P34B 5AV5C 2Y2GA 1EQZA 3AZJD 3C1CD 5BS7A 4HGAB 5B33B 1P3MA 3B0BA 3UTAC 2LY8A 4KUDD 4E44A 5CP6A 3WA9B 3LZ0C 1S32A 4X23A 3MGPB 3MGQB 5AV8C 3LZ1A 3AN2B 2Y2OA 4R8PC 1KX3C 4WU8D 4H9OB 2ZY4A 1P3OA 2NZDA 1P3IC 5B0ZB 4Z66D 3WAAD 5AV9A 5CPIA 1P3GA 3B6FD 3AZLC 1KX4D 4ZUXA 3MGQC 2AROD 3X1UA 3LELB 5B32G 2DF4C 5B1LC 3AZKD 5B0ZC 2HIOC 1T3UA 5AVBC 3MNND 1KX5B 2RVQC 3X1SB 1TAFA 1M18D 5E5AA 4YS3B 2F8NK 1TZYA 5JRGC 4QLCC 5G49A 3WKJA 1P3PD 1HTAA 3B0CW 3LELC 3AZEB 5BNXB 3V9RA 5GT0D 3AYWA 4J8WB 1ZLAA 3NQJB 3AZMC 3MGRD 1EQZC 4Z5TB 5BS7C 4UUZB 3REJA 4WU8B 3AV1D 4CAYA 3TU4A 3AZGB 4Z66B 4X23C 1P3KD 5B31A 3B6FB 2YFWA 1KX4B 3UT9D 2AROB 4YM6D 2NZDC 2CV5D 5B2IA 4ZBJB 2FJ7A 5FUGB 2IO5C 4UPKA 5AV9C 5CPIC 3C1BD 1P3GC 4XUJB 5CPJC 3AZGC 3MNNB 4ZUXC 4J8VD 3AV2A 3X1UC 3REID 1ID3B 2F8NG 5B0YA 1F1EA 4CSRA 3W96B 1Z2CB 3F6TA 2PYOA 5B2JD 5E5AC 3AZFA 1PZRA 3MGRB 3MGSA 2BYMA 5AVCD 4KGCC 3RELA 4JJNA 3AYWC 1ZLAC 4LD9D 1HQ3B 4H9NB 5GXQD 2JSSA 3UT9B 5GT3D 1F66D 5F99A 3REKC 3TU4C 2CV5B 3KWQB 3C1BB 3UTBB 2JCHA 3AFAB 2F8NH 3A1KA 3UTAD 1P3BB 5JA4B 3LZ0D 3KXBA 2FJ7C 4XZQA 5AV8D 4WU9A 3NQUA 5CPKA 1P34D 2ZY5A 4R8PD 3B6GB 3REHA 1WWIA 3AV2C 3UTBC 1JFIB 5B32B 5B33D 3KSYA 5B0YC 3LJAA 5B40A 3AZNB 5BNVA 5B24A 3WA9D 5AVCB 4J8UB 3AZLD 3MGQD 5B1MA 1U35B 4WV4B 4LD9B 3AN2D 4H9RB 4EO5B 3MGSC 1M19A 1R4VA 3H0MC 4NFTA 1BH8B 5B1LD 4J8XB 5B0ZD 2HIOD 3W97A 4JJNC 3RELC 3KUYA 1N1JA 2HUEC 3AZNC 5AV5B 4KHAB 1W2EA 1U35C 3LELD 3MVDA 4EO5C 4H9PA 5GSUA 1B6WA 1P3AA 3UTAB 3A6NA 3AZMD 2G5IC 5AV8B 3X1SD 1EQZD 3B0DC 4YS3D 4R8PB 1KX3B 2Y2HA 1BH9B 2Y2IA 3MGPA 3AZED 1P3IB 3KXBC 4NE3A 4XZQC 4J8WD 4WU9C 5CPKC 4WNNB 3FDDA 5AV6C 3AZLB 3REHC 1H3OA 1M1AA 4Z5TD 5AY8A 2F8NB 1P3FA 5AV9D 3LJAC 1P3GD 5B1LB 5CPJD 3AZGD 2HIOB 5AVBB 5B1MC 3KFUG 3X1VB 3X1UD 5DNMA 5JRGB 4QLCB 1M19C 5BO0B 2NQBA 1KX5A 3B0CT 2Y2QA 3H0LC 3W98A 3AZMB 4XUJD 3AZJA 3A1IA 3C1CA 1EQZB 3X1VC 3MVDC 3VH5W 4KGCD 2F2AC 1ID3D 4KUDA 1P3AC 1Q9CA 2Y2LA 5C3IC 3A6NC 5CP6B 3EPKA 2BYKA 1A7WA 3W96D 4X23B 5CHLB 3LZ1B 1AOIA 3REKD 2Y2PA 4Z66A 3WAAA 2NZDB 2IO5B 1P3MC 5AV9B 5CPIB 1P3GB 5CP6C 1KX4A 5CPJB 1HQ3D 2FFFB 1S32C 3IP4C 4G92C 4ZUXB 1M1AC 3LZ1C 1ULYA 5AY8C 3X1UB 4DQYB 1P3FC 2FJ7D 3AZKA 3MNNA 1P3OC 3VH6W 3KWQD 1WWSA 4E45A 1M18A 1TAFB 3UTBD 5E5AB 1P3PA 5G49B 3WTPA 3AFAD 5GT0A 2NQBC 1P3BD 4KGCB 3V9RB 5KDMB 3AYWB 3W98C 1ZLAB 1P3LA 3MGRA 3AZIA 3C1CC 3B6GD 1TZYC 5B32D 3AV1A 3AZHA 4KUDC 3WKJC 4M6BA 4CAYB 3REKB 5BT1C 3TU4B 3AZND 1P3KA 4J8UD 1U35D 2YFWB 4YM6A 1AOIC 2J8PA 3WAAC 4J8XD 4AWLC 2FJ7B 3REJC 4H9SA 4J8VA 5AV5D 3EG5B 2Y2NA 5JA4A 5B31C 3REIA 3AV2B 3AL0C 4XZQD 5B0YB 3AZKC 4WU9D 4NE5A 4CSRB 5B2IC 3X1TA 5B2JA 5AV6D 1M18C 3W99A 2PYOB 2YFVA 1P3PC 3H0RC 3VH5A 3MGSB 3WTPC 1KX3D 4H9QA 5AVCA 5GT0C 1P3ID 3RELB 4JJNB 4LD9A 1P3LC 3AZIC 2HUEB 5GXQA 2PYOC 3AZFC 2F8ND 3AV1C 5GT3A 3AZHC 1F66A 5DNNA 2CWEA 5AVBD 3O62A 3R45A 2RVQD 3X1VD 3B0DB 3MVDD 5JRGD 1KU5A 4QLCD 4YM6C 1P3AD 3LZ0A 3VH6A 3KXBB 4XZQB 1P34A 5F99C 3NQUB 4H9SC 4R8PA 4WU9B 5CPKB 3WTPE 4J8VC 5AV6B 3REHB 5B33A 2RIQA 5B31G 3WA9A 1P3MD 3LJAB 5B40B 5CP6D 5BNVB 3MGQA 3AZLA 3X1TC 1S32D 4X23D 3W99C 3AN2A 5B1MB 3LZ1D 2Y2MA 5AY8D 4H9OA 1M19B 5B1LA 5B0ZA 1P3OD 4Z2MG 2NZDD 2ZY2A 5CPID 1N1JB 2L5AA 2Y2KA 5B40C 5B24C 5GXQC 4ZUXD 3LELA 2ZY3A 2DQNC 3MVDB 5GT3C 1F66C 5GSUB 1P3AB 2VQRA 2W8SA 5C3IB 3A6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNN C;  3X1S A;  3W97 C;  3O62 C;  4YS3 A;  3KUY C;  5E5A D;  1TZY D;  3WKJ D;  4NE6 A;  3AZE A;  5BNX A;  5BT1 D;  4J8W A;  3NQJ A;  5GSU C;  3AYW D;  1P34 C;  1P3M B;  1ZLA D;  1S32 B;  1AOI D;  4Z5T A;  4G92 B;  1H3O B;  4HGA C;  5B33 C;  1M1A B;  5AY8 B;  4UUZ A;  4Z2M H;  4WU8 A;  1P3F B;  3REJ D;  3WA9 C;  5CPJ A;  3AZG A;  3TU4 D;  3MGP C;  1P3O B;  3B6F A;  3AN2 C;  5B31 D;  3VH6 T;  5DNM B;  2ARO A;  2NQB B;  5FUG A;  5B2I D;  3W98 B;  4XUJ A;  3AZJ B;  3WTP D;  3C1C B;  3AV2 D;  4KGC A;  5KDM A;  1ID3 A;  5DNM C;  1TZY B;  4KUD B;  4DRA A;  3WKJ B;  5B0Y D;  1P3L D;  3AZI D;  3W96 A;  2BYK B;  1KX5 C;  3X1S C;  4YS3 C;  2PYO D;  3AZF D;  3AZH D;  3AZJ C;  3MGS D;  3REK A;  1AOI B;  3AZE C;  3WAA B;  4J8W C;  4WZS B;  4AWL B;  3REL D;  4JJN D;  3REJ B;  1HQ3 A;  4H9N A;  4Z5T C;  5B31 B;  4WU8 C;  3UT9 A;  3AZK B;  5F99 D;  3KWQ A;  4Z66 C;  2CV5 A;  5B2I B;  1M18 B;  3C1B A;  3UTB A;  3B6F C;  1KX4 C;  3AFA A;  1P3P B;  2ARO C;  3WTP B;  1P3B A;  5GT0 B;  4ZBJ C;  3X1T D;  3KXB D;  3W99 D;  4XUJ C;  4DRB A;  1P3L B;  3AZI B;  5CPK D;  3MNN C;  3B6G A;  3VH5 T;  3REH D;  1JFI A;  5B32 A;  1ID3 C;  3AZF B;  3AV1 B;  3AZH B;  3AZN A;  2BYM B;  3W96 C;  1B67 A;  3LJA D;  5B40 D;  4J8U A;  1P3K B;  5B24 D;  1U35 A;  5B1M D;  4H9R A;  3MGR C;  4YM6 B;  1M19 D;  4J8X A;  1BH8 A;  5DNN D;  3W97 D;  3O62 D;  1HQ3 C;  3KUY D;  5AV5 A;  4KHA A;  5F99 B;  1P3K C;  4J8V B;  3REI B;  4G91 B;  3UT9 C;  3UTA A;  5GSU D;  2CV5 C;  3KWQ C;  5AV6 A;  3A6N D;  3X1T B;  5B2J B;  5AV8 A;  3C1B C;  3W99 B;  2YFV B;  3AFA C;  1KX3 A;  1BH9 A;  1P3B C;  4H9Q B;  3REI C;  1P3I A;  3MGP D;  4G91 C;  4WNN A;  3B6G C;  5B24 B;  5B2J C;  5GXQ B;  5B32 C;  1M1A D;  2F8N A;  1P3F D;  5GT3 B;  1F66 B;  5AVC C;  2HIO A;  5AVB A;  4J8U C;  5DNN B;  3W97 B;  3O62 B;  3X1V A;  4LD9 C;  3R45 B;  3KUY B;  5JRG A;  4QLC A;  1BFM A;  5DNM D;  5BO0 A;  4J8X C;  3LZ0 B;  2NQB D;  1KX5 D;  3W98 D;  4H9P B;  3AZM A;  1P34 B;  5AV5 C;  1EQZ A;  3AZJ D;  3C1C D;  5BS7 A;  4HGA B;  5B33 B;  1P3M A;  3B0B A;  3UTA C;  2LY8 A;  4KUD D;  4E44 A;  5CP6 A;  3WA9 B;  3LZ0 C;  1S32 A;  4X23 A;  3MGP B;  3MGQ B;  5AV8 C;  3LZ1 A;  3AN2 B;  4R8P C;  1KX3 C;  4WU8 D;  4H9O B;  1P3O A;  2NZD A;  1P3I C;  5B0Z B;  4Z66 D;  3WAA D;  5AV9 A;  5CPI A;  1P3G A;  3B6F D;  3AZL C;  1KX4 D;  4ZUX A;  3MGQ C;  2ARO D;  3X1U A;  3LEL B;  5B32 G;  5B1L C;  3AZK D;  5B0Z C;  2HIO C;  5AVB C;  3MNN D;  1KX5 B;  2RVQ C;  3X1S B;  1TAF A;  1M18 D;  5E5A A;  4YS3 B;  2F8N K;  1TZY A;  5JRG C;  4QLC C;  5G49 A;  3WKJ A;  1P3P D;  1HTA A;  3B0C W;  3LEL C;  3AZE B;  5BNX B;  3V9R A;  5GT0 D;  3AYW A;  4J8W B;  1ZLA A;  3NQJ B;  3AZM C;  3MGR D;  1EQZ C;  4Z5T B;  5BS7 C;  4UUZ B;  3REJ A;  4WU8 B;  3AV1 D;  4CAY A;  3TU4 A;  3AZG B;  4Z66 B;  4X23 C;  1P3K D;  5B31 A;  3B6F B;  2YFW A;  1KX4 B;  3UT9 D;  2ARO B;  4YM6 D;  2NZD C;  2CV5 D;  5B2I A;  4ZBJ B;  2FJ7 A;  5FUG B;  2IO5 C;  5AV9 C;  5CPI C;  3C1B D;  1P3G C;  4XUJ B;  5CPJ C;  3AZG C;  3MNN B;  4ZUX C;  4J8V D;  3AV2 A;  3X1U C;  3REI D;  1ID3 B;  2F8N G;  5B0Y A;  1F1E A;  4CSR A;  3W96 B;  2PYO A;  5B2J D;  5E5A C;  3AZF A;  3MGR B;  3MGS A;  2BYM A;  5AVC D;  4KGC C;  3REL A;  4JJN A;  3AYW C;  1ZLA C;  4LD9 D;  1HQ3 B;  4H9N B;  5GXQ D;  2JSS A;  3UT9 B;  5GT3 D;  1F66 D;  5F99 A;  3REK C;  3TU4 C;  2CV5 B;  3KWQ B;  3C1B B;  3UTB B;  3AFA B;  2F8N H;  3UTA D;  1P3B B;  5JA4 B;  3LZ0 D;  3KXB A;  2FJ7 C;  4XZQ A;  5AV8 D;  4WU9 A;  3NQU A;  5CPK A;  1P34 D;  4R8P D;  3B6G B;  3REH A;  1WWI A;  3AV2 C;  3UTB C;  1JFI B;  5B32 B;  5B33 D;  3KSY A;  5B0Y C;  3LJA A;  5B40 A;  3AZN B;  5BNV A;  5B24 A;  3WA9 D;  5AVC B;  4J8U B;  3AZL D;  3MGQ D;  5B1M A;  1U35 B;  4WV4 B;  4LD9 B;  3AN2 D;  4H9R B;  4EO5 B;  3MGS C;  1M19 A;  1R4V A;  4NFT A;  4J8X B;  1BH8 B;  5B1L D;  5B0Z D;  2HIO D;  3W97 A;  4JJN C;  3REL C;  3KUY A;  1N1J A;  2HUE C;  3AZN C;  5AV5 B;  4KHA B;  1U35 C;  3LEL D;  3MVD A;  4EO5 C;  4H9P A;  5GSU A;  1B6W A;  1P3A A;  3UTA B;  3A6N A;  3AZM D;  1EQZ D;  5AV8 B;  3X1S D;  3B0D C;  4YS3 D;  4R8P B;  1KX3 B;  1BH9 B;  3MGP A;  3AZE D;  1P3I B;  3KXB C;  4NE3 A;  4XZQ C;  4J8W D;  4WU9 C;  5CPK C;  4WNN B;  5AV6 C;  3AZL B;  3REH C;  1H3O A;  1M1A A;  4Z5T D;  5AY8 A;  2F8N B;  1P3F A;  5AV9 D;  3LJA C;  1P3G D;  5B1L B;  5CPJ D;  3AZG D;  2HIO B;  5AVB B;  5B1M C;  3X1V B;  3X1U D;  5DNM A;  5JRG B;  4QLC B;  1M19 C;  5BO0 B;  2NQB A;  1KX5 A;  3B0C T;  3W98 A;  3AZM B;  4XUJ D;  3AZJ A;  3C1C A;  1EQZ B;  3X1V C;  3MVD C;  3VH5 W;  4KGC D;  1ID3 D;  4KUD A;  1P3A C;  1Q9C A;  5C3I C;  3A6N C;  5CP6 B;  2BYK A;  1A7W A;  3W96 D;  4X23 B;  5CHL B;  3LZ1 B;  1AOI A;  3REK D;  4Z66 A;  3WAA A;  2NZD B;  2IO5 B;  1P3M C;  5AV9 B;  5CPI B;  1P3G B;  5CP6 C;  1KX4 A;  5CPJ B;  1HQ3 D;  1S32 C;  4G92 C;  4ZUX B;  1M1A C;  3LZ1 C;  1ULY A;  5AY8 C;  3X1U B;  1P3F C;  2FJ7 D;  3AZK A;  3MNN A;  1P3O C;  3VH6 W;  3KWQ D;  1WWS A;  4E45 A;  1M18 A;  1TAF B;  3UTB D;  5E5A B;  1P3P A;  5G49 B;  3WTP A;  3AFA D;  5GT0 A;  2NQB C;  1P3B D;  4KGC B;  3V9R B;  5KDM B;  3AYW B;  3W98 C;  1ZLA B;  1P3L A;  3MGR A;  3AZI A;  3C1C C;  3B6G D;  1TZY C;  5B32 D;  3AV1 A;  3AZH A;  4KUD C;  3WKJ C;  4M6B A;  4CAY B;  3REK B;  5BT1 C;  3TU4 B;  3AZN D;  1P3K A;  4J8U D;  1U35 D;  2YFW B;  4YM6 A;  1AOI C;  3WAA C;  4J8X D;  4AWL C;  2FJ7 B;  3REJ C;  4H9S A;  4J8V A;  5AV5 D;  5JA4 A;  5B31 C;  3REI A;  3AV2 B;  4XZQ D;  5B0Y B;  3AZK C;  4WU9 D;  4NE5 A;  4CSR B;  5B2I C;  3X1T A;  5B2J A;  5AV6 D;  1M18 C;  3W99 A;  2PYO B;  2YFV A;  1P3P C;  3VH5 A;  3MGS B;  3WTP C;  1KX3 D;  4H9Q A;  5AVC A;  5GT0 C;  1P3I D;  3REL B;  4JJN B;  4LD9 A;  1P3L C;  3AZI C;  2HUE B;  5GXQ A;  2PYO C;  3AZF C;  2F8N D;  3AV1 C;  5GT3 A;  3AZH C;  1F66 A;  5DNN A;  2CWE A;  5AVB D;  3O62 A;  3R45 A;  2RVQ D;  3X1V D;  3B0D B;  3MVD D;  5JRG D;  1KU5 A;  4QLC D;  4YM6 C;  1P3A D;  3LZ0 A;  3VH6 A;  3KXB B;  4XZQ B;  1P34 A;  5F99 C;  3NQU B;  4H9S C;  4R8P A;  4WU9 B;  5CPK B;  3WTP E;  4J8V C;  5AV6 B;  3REH B;  5B33 A;  5B31 G;  3WA9 A;  1P3M D;  3LJA B;  5B40 B;  5CP6 D;  5BNV B;  3MGQ A;  3AZL A;  3X1T C;  1S32 D;  4X23 D;  3W99 C;  3AN2 A;  5B1M B;  3LZ1 D;  5AY8 D;  4H9O A;  1M19 B;  5B1L A;  5B0Z A;  1P3O D;  4Z2M G;  2NZD D;  5CPI D;  1N1J B;  2L5A A;  5B40 C;  5B24 C;  5GXQ C;  4ZUX D;  3LEL A;  3MVD B;  5GT3 C;  1F66 C;  5GSU B;  1P3A B;  5C3I B;  3A6N B; 
#chains in the Genus database with same CATH topology
 5DNN C;  3X1S A;  3W97 C;  3O62 C;  4YS3 A;  2UWX A;  3KUY C;  5E5A D;  2ZM5 A;  1TZY D;  3WKJ D;  4NE6 A;  3AZE A;  5BNX A;  5BT1 D;  4J8W A;  3NQJ A;  5GSU C;  3EPL A;  3AYW D;  1P34 C;  1P3M B;  1ZLA D;  3EPJ A;  1S32 B;  1AOI D;  4Z5T A;  4G92 B;  1H3O B;  4HGA C;  5B33 C;  1M1A B;  5AY8 B;  4UUZ A;  4Z2M H;  4WU8 A;  1P3F B;  3REJ D;  3WA9 C;  5CPJ A;  3AZG A;  3TU4 D;  3MGP C;  1P3O B;  3B6F A;  3AN2 C;  5B31 D;  3VH6 T;  5DNM B;  2ARO A;  3P5J B;  2NQB B;  5FUG A;  5B2I D;  3W98 B;  4XUJ A;  3AZJ B;  3WTP D;  3C1C B;  3AV2 D;  4KGC A;  5KDM A;  1ID3 A;  5DNM C;  1TZY B;  4KUD B;  4DRA A;  3WKJ B;  5B0Y D;  1P3L D;  3AZI D;  3W96 A;  2BG1 A;  2BYK B;  1KX5 C;  3X1S C;  4YS3 C;  2PYO D;  2G5H C;  3AZF D;  3AZH D;  3AZJ C;  3MGS D;  3REK A;  1AOI B;  3AZE C;  3WAA B;  4J8W C;  4WZS B;  4AWL B;  3REL D;  4JJN D;  3REJ B;  1HQ3 A;  2XD5 A;  4H9N A;  4Z5T C;  5B31 B;  4WU8 C;  3UT9 A;  3AZK B;  5F99 D;  3KWQ A;  4Z66 C;  2CV5 A;  5B2I B;  1M18 B;  3C1B A;  3UTB A;  3B6F C;  2Y2J A;  1KX4 C;  3AFA A;  1P3P B;  2JE5 A;  2ARO C;  3WTP B;  1P3B A;  3EPH A;  5GT0 B;  4ZBJ C;  3X1T D;  3KXB D;  3W99 D;  4XUJ C;  4DRB A;  1P3L B;  3AZI B;  5CPK D;  3MNN C;  3B6G A;  3VH5 T;  3REH D;  1JFI A;  5B32 A;  1ID3 C;  3AZF B;  3AV1 B;  2XD1 A;  3AZH B;  3AZN A;  2BYM B;  3W96 C;  1B67 A;  3LJA D;  5B40 D;  4J8U A;  1P3K B;  5B24 D;  1U35 A;  5B1M D;  4H9R A;  3MGR C;  4YM6 B;  1M19 D;  4J8X A;  1BH8 A;  5DNN D;  3W97 D;  3O62 D;  1HQ3 C;  3KUY D;  5AV5 A;  4KHA A;  5F99 B;  1P3K C;  4J8V B;  3REI B;  4G91 B;  3UT9 C;  3UTA A;  5GSU D;  2CV5 C;  3KWQ C;  5AV6 A;  3A6N D;  3X1T B;  5B2J B;  5AV8 A;  3C1B C;  3W99 B;  2YFV B;  3AFA C;  1KX3 A;  1BH9 A;  1P3B C;  4H9Q B;  3REI C;  1P3I A;  3MGP D;  4G91 C;  4WNN A;  3B6G C;  5B24 B;  5B2J C;  5GXQ B;  5B32 C;  1M1A D;  2F8N A;  1P3F D;  5GT3 B;  1F66 B;  5AVC C;  2HIO A;  5AVB A;  4J8U C;  5DNN B;  3W97 B;  3O62 B;  3X1V A;  4LD9 C;  3R45 B;  3KUY B;  5JRG A;  4QLC A;  1BFM A;  5DNM D;  5BO0 A;  4J8X C;  3LZ0 B;  4WJ3 C;  2NQB D;  1KX5 D;  3W98 D;  4H9P B;  3AZM A;  1P34 B;  5AV5 C;  2Y2G A;  1EQZ A;  3AZJ D;  3C1C D;  5BS7 A;  4HGA B;  5B33 B;  1P3M A;  3B0B A;  3UTA C;  2LY8 A;  4KUD D;  4E44 A;  5CP6 A;  3WA9 B;  3LZ0 C;  1S32 A;  4X23 A;  3MGP B;  3MGQ B;  5AV8 C;  3LZ1 A;  3AN2 B;  2Y2O A;  4R8P C;  1KX3 C;  4WU8 D;  4H9O B;  2ZY4 A;  1P3O A;  2NZD A;  1P3I C;  5B0Z B;  4Z66 D;  3WAA D;  5AV9 A;  5CPI A;  1P3G A;  3B6F D;  3AZL C;  1KX4 D;  4ZUX A;  3MGQ C;  2ARO D;  3X1U A;  3LEL B;  5B32 G;  2DF4 C;  5B1L C;  3AZK D;  5B0Z C;  2HIO C;  1T3U A;  5AVB C;  3MNN D;  1KX5 B;  2RVQ C;  3X1S B;  1TAF A;  1M18 D;  5E5A A;  4YS3 B;  2F8N K;  1TZY A;  5JRG C;  4QLC C;  5G49 A;  3WKJ A;  1P3P D;  1HTA A;  3B0C W;  3LEL C;  3AZE B;  5BNX B;  3V9R A;  5GT0 D;  3AYW A;  4J8W B;  1ZLA A;  3NQJ B;  3AZM C;  3MGR D;  1EQZ C;  4Z5T B;  5BS7 C;  4UUZ B;  3REJ A;  4WU8 B;  3AV1 D;  4CAY A;  3TU4 A;  3AZG B;  4Z66 B;  4X23 C;  1P3K D;  5B31 A;  3B6F B;  2YFW A;  1KX4 B;  3UT9 D;  2ARO B;  4YM6 D;  2NZD C;  2CV5 D;  5B2I A;  4ZBJ B;  2FJ7 A;  5FUG B;  2IO5 C;  4UPK A;  5AV9 C;  5CPI C;  3C1B D;  1P3G C;  4XUJ B;  5CPJ C;  3AZG C;  3MNN B;  4ZUX C;  4J8V D;  3AV2 A;  3X1U C;  3REI D;  1ID3 B;  2F8N G;  5B0Y A;  1F1E A;  4CSR A;  3W96 B;  1Z2C B;  3F6T A;  2PYO A;  5B2J D;  5E5A C;  3AZF A;  1PZR A;  3MGR B;  3MGS A;  2BYM A;  5AVC D;  4KGC C;  3REL A;  4JJN A;  3AYW C;  1ZLA C;  4LD9 D;  1HQ3 B;  4H9N B;  5GXQ D;  2JSS A;  3UT9 B;  5GT3 D;  1F66 D;  5F99 A;  3REK C;  3TU4 C;  2CV5 B;  3KWQ B;  3C1B B;  3UTB B;  2JCH A;  3AFA B;  2F8N H;  3A1K A;  3UTA D;  1P3B B;  5JA4 B;  3LZ0 D;  3KXB A;  2FJ7 C;  4XZQ A;  5AV8 D;  4WU9 A;  3NQU A;  5CPK A;  1P34 D;  2ZY5 A;  4R8P D;  3B6G B;  3REH A;  1WWI A;  3AV2 C;  3UTB C;  1JFI B;  5B32 B;  5B33 D;  3KSY A;  5B0Y C;  3LJA A;  5B40 A;  3AZN B;  5BNV A;  5B24 A;  3WA9 D;  5AVC B;  4J8U B;  3AZL D;  3MGQ D;  5B1M A;  1U35 B;  4WV4 B;  4LD9 B;  3AN2 D;  4H9R B;  4EO5 B;  3MGS C;  1M19 A;  1R4V A;  3H0M C;  4NFT A;  1BH8 B;  5B1L D;  4J8X B;  5B0Z D;  2HIO D;  3W97 A;  4JJN C;  3REL C;  3KUY A;  1N1J A;  2HUE C;  3AZN C;  5AV5 B;  4KHA B;  1W2E A;  1U35 C;  3LEL D;  3MVD A;  4EO5 C;  4H9P A;  5GSU A;  1B6W A;  1P3A A;  3UTA B;  3A6N A;  3AZM D;  2G5I C;  5AV8 B;  3X1S D;  1EQZ D;  3B0D C;  4YS3 D;  4R8P B;  1KX3 B;  2Y2H A;  1BH9 B;  2Y2I A;  3MGP A;  3AZE D;  1P3I B;  3KXB C;  4NE3 A;  4XZQ C;  4J8W D;  4WU9 C;  5CPK C;  4WNN B;  3FDD A;  5AV6 C;  3AZL B;  3REH C;  1H3O A;  1M1A A;  4Z5T D;  5AY8 A;  2F8N B;  1P3F A;  5AV9 D;  3LJA C;  1P3G D;  5B1L B;  5CPJ D;  3AZG D;  2HIO B;  5AVB B;  5B1M C;  3KFU G;  3X1V B;  3X1U D;  5DNM A;  5JRG B;  4QLC B;  1M19 C;  5BO0 B;  2NQB A;  1KX5 A;  3B0C T;  2Y2Q A;  3H0L C;  3W98 A;  3AZM B;  4XUJ D;  3AZJ A;  3A1I A;  3C1C A;  1EQZ B;  3X1V C;  3MVD C;  3VH5 W;  4KGC D;  2F2A C;  1ID3 D;  4KUD A;  1P3A C;  1Q9C A;  2Y2L A;  5C3I C;  3A6N C;  5CP6 B;  3EPK A;  2BYK A;  1A7W A;  3W96 D;  4X23 B;  5CHL B;  3LZ1 B;  1AOI A;  3REK D;  2Y2P A;  4Z66 A;  3WAA A;  2NZD B;  2IO5 B;  1P3M C;  5AV9 B;  5CPI B;  1P3G B;  5CP6 C;  1KX4 A;  5CPJ B;  1HQ3 D;  2FFF B;  1S32 C;  3IP4 C;  4G92 C;  4ZUX B;  1M1A C;  3LZ1 C;  1ULY A;  5AY8 C;  3X1U B;  4DQY B;  1P3F C;  2FJ7 D;  3AZK A;  3MNN A;  1P3O C;  3VH6 W;  3KWQ D;  1WWS A;  4E45 A;  1M18 A;  1TAF B;  3UTB D;  5E5A B;  1P3P A;  5G49 B;  3WTP A;  3AFA D;  5GT0 A;  2NQB C;  1P3B D;  4KGC B;  3V9R B;  5KDM B;  3AYW B;  3W98 C;  1ZLA B;  1P3L A;  3MGR A;  3AZI A;  3C1C C;  3B6G D;  1TZY C;  5B32 D;  3AV1 A;  3AZH A;  4KUD C;  3WKJ C;  4M6B A;  4CAY B;  3REK B;  5BT1 C;  3TU4 B;  3AZN D;  1P3K A;  4J8U D;  1U35 D;  2YFW B;  4YM6 A;  1AOI C;  2J8P A;  3WAA C;  4J8X D;  4AWL C;  2FJ7 B;  3REJ C;  4H9S A;  4J8V A;  5AV5 D;  3EG5 B;  2Y2N A;  5JA4 A;  5B31 C;  3REI A;  3AV2 B;  3AL0 C;  4XZQ D;  5B0Y B;  3AZK C;  4WU9 D;  4NE5 A;  4CSR B;  5B2I C;  3X1T A;  5B2J A;  5AV6 D;  1M18 C;  3W99 A;  2PYO B;  2YFV A;  1P3P C;  3H0R C;  3VH5 A;  3MGS B;  3WTP C;  1KX3 D;  4H9Q A;  5AVC A;  5GT0 C;  1P3I D;  3REL B;  4JJN B;  4LD9 A;  1P3L C;  3AZI C;  2HUE B;  5GXQ A;  2PYO C;  3AZF C;  2F8N D;  3AV1 C;  5GT3 A;  3AZH C;  1F66 A;  5DNN A;  2CWE A;  5AVB D;  3O62 A;  3R45 A;  2RVQ D;  3X1V D;  3B0D B;  3MVD D;  5JRG D;  1KU5 A;  4QLC D;  4YM6 C;  1P3A D;  3LZ0 A;  3VH6 A;  3KXB B;  4XZQ B;  1P34 A;  5F99 C;  3NQU B;  4H9S C;  4R8P A;  4WU9 B;  5CPK B;  3WTP E;  4J8V C;  5AV6 B;  3REH B;  5B33 A;  2RIQ A;  5B31 G;  3WA9 A;  1P3M D;  3LJA B;  5B40 B;  5CP6 D;  5BNV B;  3MGQ A;  3AZL A;  3X1T C;  1S32 D;  4X23 D;  3W99 C;  3AN2 A;  5B1M B;  3LZ1 D;  2Y2M A;  5AY8 D;  4H9O A;  1M19 B;  5B1L A;  5B0Z A;  1P3O D;  4Z2M G;  2NZD D;  2ZY2 A;  5CPI D;  1N1J B;  2L5A A;  2Y2K A;  5B40 C;  5B24 C;  5GXQ C;  4ZUX D;  3LEL A;  2ZY3 A;  2DQN C;  3MVD B;  5GT3 C;  1F66 C;  5GSU B;  1P3A B;  2VQR A;  2W8S A;  5C3I B;  3A6N B; 
#chains in the Genus database with same CATH homology
 5DNN C;  3X1S A;  3W97 C;  3O62 C;  4YS3 A;  2UWX A;  3KUY C;  5E5A D;  2ZM5 A;  1TZY D;  3WKJ D;  4NE6 A;  3AZE A;  5BNX A;  5BT1 D;  4J8W A;  3NQJ A;  5GSU C;  3EPL A;  3AYW D;  1P34 C;  1P3M B;  1ZLA D;  3EPJ A;  1S32 B;  1AOI D;  4Z5T A;  4G92 B;  1H3O B;  4HGA C;  5B33 C;  1M1A B;  5AY8 B;  4UUZ A;  4Z2M H;  4WU8 A;  1P3F B;  3REJ D;  3WA9 C;  5CPJ A;  3AZG A;  3TU4 D;  3MGP C;  1P3O B;  3B6F A;  3AN2 C;  5B31 D;  3VH6 T;  5DNM B;  2ARO A;  3P5J B;  2NQB B;  5FUG A;  5B2I D;  3W98 B;  4XUJ A;  3AZJ B;  3WTP D;  3C1C B;  3AV2 D;  4KGC A;  5KDM A;  1ID3 A;  5DNM C;  1TZY B;  4KUD B;  4DRA A;  3WKJ B;  5B0Y D;  1P3L D;  3AZI D;  3W96 A;  2BG1 A;  2BYK B;  1KX5 C;  3X1S C;  4YS3 C;  2PYO D;  2G5H C;  3AZF D;  3AZH D;  3AZJ C;  3MGS D;  3REK A;  1AOI B;  3AZE C;  3WAA B;  4J8W C;  4WZS B;  4AWL B;  3REL D;  4JJN D;  3REJ B;  1HQ3 A;  2XD5 A;  4H9N A;  4Z5T C;  5B31 B;  4WU8 C;  3UT9 A;  3AZK B;  5F99 D;  3KWQ A;  4Z66 C;  2CV5 A;  5B2I B;  1M18 B;  3C1B A;  3UTB A;  3B6F C;  2Y2J A;  1KX4 C;  3AFA A;  1P3P B;  2JE5 A;  2ARO C;  3WTP B;  1P3B A;  3EPH A;  5GT0 B;  4ZBJ C;  3X1T D;  3KXB D;  3W99 D;  4XUJ C;  4DRB A;  1P3L B;  3AZI B;  5CPK D;  3MNN C;  3B6G A;  3VH5 T;  3REH D;  1JFI A;  5B32 A;  1ID3 C;  3AZF B;  3AV1 B;  2XD1 A;  3AZH B;  3AZN A;  2BYM B;  3W96 C;  1B67 A;  3LJA D;  5B40 D;  4J8U A;  1P3K B;  5B24 D;  1U35 A;  5B1M D;  4H9R A;  3MGR C;  4YM6 B;  1M19 D;  4J8X A;  1BH8 A;  5DNN D;  3W97 D;  3O62 D;  1HQ3 C;  3KUY D;  5AV5 A;  4KHA A;  5F99 B;  1P3K C;  4J8V B;  3REI B;  4G91 B;  3UT9 C;  3UTA A;  5GSU D;  2CV5 C;  3KWQ C;  5AV6 A;  3A6N D;  3X1T B;  5B2J B;  5AV8 A;  3C1B C;  3W99 B;  2YFV B;  3AFA C;  1KX3 A;  1BH9 A;  1P3B C;  4H9Q B;  3REI C;  1P3I A;  3MGP D;  4G91 C;  4WNN A;  3B6G C;  5B24 B;  5B2J C;  5GXQ B;  5B32 C;  1M1A D;  2F8N A;  1P3F D;  5GT3 B;  1F66 B;  5AVC C;  2HIO A;  5AVB A;  4J8U C;  5DNN B;  3W97 B;  3O62 B;  3X1V A;  4LD9 C;  3R45 B;  3KUY B;  5JRG A;  4QLC A;  1BFM A;  5DNM D;  5BO0 A;  4J8X C;  3LZ0 B;  4WJ3 C;  2NQB D;  1KX5 D;  3W98 D;  4H9P B;  3AZM A;  1P34 B;  5AV5 C;  2Y2G A;  1EQZ A;  3AZJ D;  3C1C D;  5BS7 A;  4HGA B;  5B33 B;  1P3M A;  3B0B A;  3UTA C;  2LY8 A;  4KUD D;  4E44 A;  5CP6 A;  3WA9 B;  3LZ0 C;  1S32 A;  4X23 A;  3MGP B;  3MGQ B;  5AV8 C;  3LZ1 A;  3AN2 B;  2Y2O A;  4R8P C;  1KX3 C;  4WU8 D;  4H9O B;  2ZY4 A;  1P3O A;  2NZD A;  1P3I C;  5B0Z B;  4Z66 D;  3WAA D;  5AV9 A;  5CPI A;  1P3G A;  3B6F D;  3AZL C;  1KX4 D;  4ZUX A;  3MGQ C;  2ARO D;  3X1U A;  3LEL B;  5B32 G;  2DF4 C;  5B1L C;  3AZK D;  5B0Z C;  2HIO C;  1T3U A;  5AVB C;  3MNN D;  1KX5 B;  2RVQ C;  3X1S B;  1TAF A;  1M18 D;  5E5A A;  4YS3 B;  2F8N K;  1TZY A;  5JRG C;  4QLC C;  5G49 A;  3WKJ A;  1P3P D;  1HTA A;  3B0C W;  3LEL C;  3AZE B;  5BNX B;  3V9R A;  5GT0 D;  3AYW A;  4J8W B;  1ZLA A;  3NQJ B;  3AZM C;  3MGR D;  1EQZ C;  4Z5T B;  5BS7 C;  4UUZ B;  3REJ A;  4WU8 B;  3AV1 D;  4CAY A;  3TU4 A;  3AZG B;  4Z66 B;  4X23 C;  1P3K D;  5B31 A;  3B6F B;  2YFW A;  1KX4 B;  3UT9 D;  2ARO B;  4YM6 D;  2NZD C;  2CV5 D;  5B2I A;  4ZBJ B;  2FJ7 A;  5FUG B;  2IO5 C;  4UPK A;  5AV9 C;  5CPI C;  3C1B D;  1P3G C;  4XUJ B;  5CPJ C;  3AZG C;  3MNN B;  4ZUX C;  4J8V D;  3AV2 A;  3X1U C;  3REI D;  1ID3 B;  2F8N G;  5B0Y A;  1F1E A;  4CSR A;  3W96 B;  1Z2C B;  3F6T A;  2PYO A;  5B2J D;  5E5A C;  3AZF A;  1PZR A;  3MGR B;  3MGS A;  2BYM A;  5AVC D;  4KGC C;  3REL A;  4JJN A;  3AYW C;  1ZLA C;  4LD9 D;  1HQ3 B;  4H9N B;  5GXQ D;  2JSS A;  3UT9 B;  5GT3 D;  1F66 D;  5F99 A;  3REK C;  3TU4 C;  2CV5 B;  3KWQ B;  3C1B B;  3UTB B;  2JCH A;  3AFA B;  2F8N H;  3A1K A;  3UTA D;  1P3B B;  5JA4 B;  3LZ0 D;  3KXB A;  2FJ7 C;  4XZQ A;  5AV8 D;  4WU9 A;  3NQU A;  5CPK A;  1P34 D;  2ZY5 A;  4R8P D;  3B6G B;  3REH A;  1WWI A;  3AV2 C;  3UTB C;  1JFI B;  5B32 B;  5B33 D;  3KSY A;  5B0Y C;  3LJA A;  5B40 A;  3AZN B;  5BNV A;  5B24 A;  3WA9 D;  5AVC B;  4J8U B;  3AZL D;  3MGQ D;  5B1M A;  1U35 B;  4WV4 B;  4LD9 B;  3AN2 D;  4H9R B;  4EO5 B;  3MGS C;  1M19 A;  1R4V A;  3H0M C;  4NFT A;  1BH8 B;  5B1L D;  4J8X B;  5B0Z D;  2HIO D;  3W97 A;  4JJN C;  3REL C;  3KUY A;  1N1J A;  2HUE C;  3AZN C;  5AV5 B;  4KHA B;  1W2E A;  1U35 C;  3LEL D;  3MVD A;  4EO5 C;  4H9P A;  5GSU A;  1B6W A;  1P3A A;  3UTA B;  3A6N A;  3AZM D;  2G5I C;  5AV8 B;  3X1S D;  1EQZ D;  3B0D C;  4YS3 D;  4R8P B;  1KX3 B;  2Y2H A;  1BH9 B;  2Y2I A;  3MGP A;  3AZE D;  1P3I B;  3KXB C;  4NE3 A;  4XZQ C;  4J8W D;  4WU9 C;  5CPK C;  4WNN B;  3FDD A;  5AV6 C;  3AZL B;  3REH C;  1H3O A;  1M1A A;  4Z5T D;  5AY8 A;  2F8N B;  1P3F A;  5AV9 D;  3LJA C;  1P3G D;  5B1L B;  5CPJ D;  3AZG D;  2HIO B;  5AVB B;  5B1M C;  3KFU G;  3X1V B;  3X1U D;  5DNM A;  5JRG B;  4QLC B;  1M19 C;  5BO0 B;  2NQB A;  1KX5 A;  3B0C T;  2Y2Q A;  3H0L C;  3W98 A;  3AZM B;  4XUJ D;  3AZJ A;  3A1I A;  3C1C A;  1EQZ B;  3X1V C;  3MVD C;  3VH5 W;  4KGC D;  2F2A C;  1ID3 D;  4KUD A;  1P3A C;  1Q9C A;  2Y2L A;  5C3I C;  3A6N C;  5CP6 B;  3EPK A;  2BYK A;  1A7W A;  3W96 D;  4X23 B;  5CHL B;  3LZ1 B;  1AOI A;  3REK D;  2Y2P A;  4Z66 A;  3WAA A;  2NZD B;  2IO5 B;  1P3M C;  5AV9 B;  5CPI B;  1P3G B;  5CP6 C;  1KX4 A;  5CPJ B;  1HQ3 D;  2FFF B;  1S32 C;  3IP4 C;  4G92 C;  4ZUX B;  1M1A C;  3LZ1 C;  1ULY A;  5AY8 C;  3X1U B;  4DQY B;  1P3F C;  2FJ7 D;  3AZK A;  3MNN A;  1P3O C;  3VH6 W;  3KWQ D;  1WWS A;  4E45 A;  1M18 A;  1TAF B;  3UTB D;  5E5A B;  1P3P A;  5G49 B;  3WTP A;  3AFA D;  5GT0 A;  2NQB C;  1P3B D;  4KGC B;  3V9R B;  5KDM B;  3AYW B;  3W98 C;  1ZLA B;  1P3L A;  3MGR A;  3AZI A;  3C1C C;  3B6G D;  1TZY C;  5B32 D;  3AV1 A;  3AZH A;  4KUD C;  3WKJ C;  4M6B A;  4CAY B;  3REK B;  5BT1 C;  3TU4 B;  3AZN D;  1P3K A;  4J8U D;  1U35 D;  2YFW B;  4YM6 A;  1AOI C;  2J8P A;  3WAA C;  4J8X D;  4AWL C;  2FJ7 B;  3REJ C;  4H9S A;  4J8V A;  5AV5 D;  3EG5 B;  2Y2N A;  5JA4 A;  5B31 C;  3REI A;  3AV2 B;  3AL0 C;  4XZQ D;  5B0Y B;  3AZK C;  4WU9 D;  4NE5 A;  4CSR B;  5B2I C;  3X1T A;  5B2J A;  5AV6 D;  1M18 C;  3W99 A;  2PYO B;  2YFV A;  1P3P C;  3H0R C;  3VH5 A;  3MGS B;  3WTP C;  1KX3 D;  4H9Q A;  5AVC A;  5GT0 C;  1P3I D;  3REL B;  4JJN B;  4LD9 A;  1P3L C;  3AZI C;  2HUE B;  5GXQ A;  2PYO C;  3AZF C;  2F8N D;  3AV1 C;  5GT3 A;  3AZH C;  1F66 A;  5DNN A;  2CWE A;  5AVB D;  3O62 A;  3R45 A;  2RVQ D;  3X1V D;  3B0D B;  3MVD D;  5JRG D;  1KU5 A;  4QLC D;  4YM6 C;  1P3A D;  3LZ0 A;  3VH6 A;  3KXB B;  4XZQ B;  1P34 A;  5F99 C;  3NQU B;  4H9S C;  4R8P A;  4WU9 B;  5CPK B;  3WTP E;  4J8V C;  5AV6 B;  3REH B;  5B33 A;  2RIQ A;  5B31 G;  3WA9 A;  1P3M D;  3LJA B;  5B40 B;  5CP6 D;  5BNV B;  3MGQ A;  3AZL A;  3X1T C;  1S32 D;  4X23 D;  3W99 C;  3AN2 A;  5B1M B;  3LZ1 D;  2Y2M A;  5AY8 D;  4H9O A;  1M19 B;  5B1L A;  5B0Z A;  1P3O D;  4Z2M G;  2NZD D;  2ZY2 A;  5CPI D;  1N1J B;  2L5A A;  2Y2K A;  5B40 C;  5B24 C;  5GXQ C;  4ZUX D;  3LEL A;  2ZY3 A;  2DQN C;  3MVD B;  5GT3 C;  1F66 C;  5GSU B;  1P3A B;  2VQR A;  2W8S A;  5C3I B;  3A6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...