1KX3B

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3B00
3LJAD 3MGPC 1P3OA 5CPKC 3W98C 3MGQC 3C1CB 1H3OB 4XUJD 5GT3D 1P3MD 1M19A 3C1BD 4J8VD 4H9PB 1P3FB 1M1AC 4XUJA 5GT3A 4WU8B 1HQ3A 3X1SA 3A6NC 4KGCB 3NQJB 1A7WA 5B32A 5B1MC 5E5AC 1P3KC 3KWQA 3V9RB 2NQBB 5AV5B 4Z2MG 5B2IA 1M18A 1ID3A 2F8NA 1P3PB 3AZMB 4H9QB 2HUEB 3AV1D 1ID3D 4KUDD 3AZJD 1P3GD 5AVBC 4YS3B 5AV8D 3R45B 3WKJB 4KUDA 3AZJA 3REHB 1P3MC 5C3IB 3AYWA 1P3BA 1TAFA 3AZGB 3NQUA 3B6FC 4J8UB 3O62B 5DNND 4ZUXB 3MGSD 1KX3C 1AOIC 3MVDD 4CAYB 5AV9D 2HIOD 3X1TB 3KUYB 4X23D 3LZ0B 3AZNC 3B6FA 5B33A 1P3LB 1P3MA 1M19D 5AVBD 1BH9A 3X1UB 5AVBA 4WU9A 4R8PA 4WU9D 3LZ1D 4Z5TC 2BYKA 1M1AD 3VH6T 3KWQC 3AYWC 5F99B 5G49A 1P3BC 5B40B 4NE6A 3W99B 4J8UC 5BS7C 1U35A 1HQ3C 3A6NA 1KX4C 5GSUB 4J8XA 1BH8A 1ULYA 1M19C 3MGQA 4AWLB 1P3FD 1BFMA 4YM6B 5AV6C 2CV5B 3W98B 1HQ3B 5JRGB 2PYOC 4X23A 5GT0B 1ZLAB 5B1LD 5B0YC 3W96D 3WTPE 2CWEA 5B33D 3B0BA 3KWQB 5B2IB 1M18B 5GXQB 4LD9B 3REIB 5CPKB 3AZEA 1S32B 5CP6A 4YS3A 4R8PD 5CPJB 3LZ1A 5DNMB 1P3AD 3UTBD 1TAFB 4J8UA 2RVQC 4WZSB 4Z66D 3TU4B 1U35D 1F66B 3A6ND 3AV2A 3W96C 3X1UC 1S32C 3AFAB 3X1TA 3KUYA 4H9SA 4H9OB 1KX5B 3UTAC 4Z5TB 3C1CD 1P3MB 5B40C 3AZNA 4WU9B 1P3IA 4ZUXC 5BO0B 3W97D 1TZYA 1P3ID 3LELB 4UUZA 5B1LC 5B0YD 1KX4D 5AV9C 5B33C 4J8XB 1BH8B 5JA4A 3WTPD 3AZGD 2F8NK 3LZ0C 1WWIA 4YM6A 3RELD 4XZQC 3AZHA 4JJNB 3C1BC 3REHC 1P3IC 4QLCC 5AV9B 3KUYD 3WA9B 5B0ZA 3AZIA 4X23B 5GT0A 1ZLAA 4H9NB 1KX5C 3UT9A 2HUEC 1P34B 1P3KD 3AZLC 3UTAA 4HGAC 5AY8A 4EO5B 3TU4C 3X1TC 5CPKA 5B2JD 5B24A 3MGPA 5B31G 3UTAD 1S32A 2FJ7B 1ID3C 1P3AB 5B2IC 1M18C 5B1MA 5E5AA 5DNMA 3AFAC 1P3PC 1M1AB 2NZDB 3KXBB 5AVCB 5GT3C 4XUJC 4J8WA 1F66A 1P3OD 1B67A 5GXQC 4LD9C 3AZKB 3AZEC 2AROB 3B0DB 3WTPA 5JRGC 3C1CC 3WAAD 3X1SD 4YM6D 5GSUC 5KDMA 3LJAB 2NZDC 4NFTA 5B32D 1P3IB 5F99C 5GT0D 1N1JB 3AN2C 1ZLAD 4NE3A 2YFWB 1TZYB 4KGCD 3B6GD 3LELA 5DNMC 2CV5C 4H9RA 4KGCA 5B0YB 1KX4B 2PYOB 4KHAB 1S32D 4JJNC 2NQBA 5AV5A 3AZKC 1P3LC 5CPJD 1ID3B 5B31D 3AZLA 2F8NB 5CPIC 3WKJA 4Z66B 3LJAC 3MGRB 3REHA 3B0CW 3B6FD 5BNVB 3AYWB 1P3BB 3NQUB 3O62A 4WNNA 4Z5TD 2HIOB 4J8VA 3UT9B 4CAYA 1P34A 3B0CT 3UTAB 5AY8B 1AOIB 3MGRC 2FJ7A 4DRAA 3REJB 4DRBA 3C1BB 5C3IC 5E5AB 5B1MB 1BH9B 1P3GC 4WU8D 2FJ7C 1B6WA 1TZYC 5AVCD 4G91C 3RELC 5BT1C 4G92B 3KXBA 5F99D 4CSRB 3REKB 5BNXB 2BYKB 1EQZA 5AV5D 3AZKA 5B40A 3W99A 1EQZD 1JFIA 3WTPB 1P3GB 2HIOC 2YFVA 3MGSA 5AV8B 3WKJD 5CPJC 5B32C 5KDMB 3LJAA 3W96A 3X1VC 3AN2A 3MNNA 4ZBJB 5DNNB 3AN2D 3B6GB 1P3PD 3AZMD 4ZUXD 2JSSA 3MNND 4E45A 1P34D 4AWLC 5CP6D 5CPIB 1P3KB 2AROC 3W98A 5B1LB 1F1EA 1KU5A 3LZ1C 3REIC 2RVQD 3KWQD 3UTBA 5B31B 2F8ND 1P3LD 4EO5C 5GXQA 4LD9A 3AZLB 3REIA 3WAAC 4J8WC 3AZEB 3MVDB 1P3AC 3LZ1B 1P3OB 3UTBC 3MNNC 5BNVA 3C1CA 3W99D 3MGQD 1M19B 4H9PA 3VH6A 5B24C 1P3FA 3B6GC 5GT3B 4XUJB 2HIOA 3X1SB 3MGSC 4J8VB 1KX5D 3NQJA 1F66C 4J8XC 2BYMA 1KX5A 4G92C 3V9RA 3AZIC 5BS7A 1P3PA 3AZMA 3C1BA 3AZHC 3W98D 3AZNB 3R45A 4KUDB 3AZJB 5AV8C 3W97C 3W99C 4YS3D 4WU9C 5BNXA 3AZGA 5GXQD 4LD9D 4HGAB 3REID 3RELA 5B0ZC 4J8UD 1P3GA 2YFVB 3MGSB 2F8NH 3AV2D 5AV8A 3O62C 4YM6C 3LZ0A 3W96B 3X1TD 3AN2B 3MNNB 3LZ0D 3AZMC 5DNNA 5CPKD 1P34C 3AZHB 5CPIA 5AV9A 5B1LA 3AZFB 3WA9A 4QLCB 5AV5C 3KSYA 4Z2MH 4H9SC 3W97A 3UTBB 1R4VA 3AZED 3TU4D 3AV2C 5FUGB 4J8WD 1KX3B 5B24B 3VH6W 1P3AA 3AFAD 2L5AA 2NQBC 3MGQB 1M1AA 3WAAA 4WV4B 4XZQD 2NZDA 2CV5A 1P3OC 5JRGA 2CV5D 4J8XD 2AROA 3MVDC 2BYMB 5JRGD 5B0ZD 3AZID 3LELD 1HTAA 3B0DC 4NE5A 5B31C 3AZND 5AV6A 5CP6B 5CPID 3MGPD 5CPJA 5AVCC 1TZYD 3WA9D 4ZBJC 1Q9CA 4M6BA 5AV6D 1N1JA 2YFWA 3AV1B 5DNMD 2PYOD 4H9RB 3TU4A 5B0YA 1KX4A 5AY8C 3RELB 5B2JB 1U35C 4KHAA 3AV2B 1EQZC 4JJND 2PYOA 1F66D 3KXBC 3AFAA 3O62D 4H9OA 3X1VA 4Z5TA 4R8PC 3X1VD 4XZQA 4G91B 2NZDD 3AZHD 4Z66A 3WA9C 3MGRA 3REKC 3UT9C 2FJ7D 1H3OA 5GT0C 1ZLAC 4QLCD 2AROD 5BT1D 5BO0A 3AZFA 5DNNC 4QLCA 4WNNB 4WU8A 3X1UD 4UUZB 3W97B 1AOID 3REJC 2IO5B 3KXBD 5B32B 1AOIA 5FUGA 1KX3A 5B40D 3WKJC 4H9QA 3REJA 2NQBD 5JA4B 4WU8C 3AZJC 3WAAB 3AZFC 3AZGC 4J8VC 4E44A 4JJNA 4CSRA 3REKA 1EQZB 3REHD 4Z66C 5B0ZB 3AZIB 3KUYC 4ZUXA 4H9NA 1JFIB 3LELC 2LY8A 1HQ3D 3X1SC 3MGRD 4KUDC 3MGPB 3B6FB 5AV6B 5CHLB 5B33B 1P3LA 5B2ID 1M18D 3AZFD 1P3FC 3B6GA 3VH5W 5AVBB 3X1UA 4YS3C 5CP6C 3AV1A 3UT9D 4KGCC 1P3KA 4R8PB 5AVCA 5AY8D 3VH5A 4J8WB 1KX3D 2IO5C 5B24D 5B2JA 5F99A 5G49B 3AYWD 5B31A 3AZLD 1P3BD 3REJD 3VH5T 2F8NG 4X23C 3AZKD 5B1MD 5E5AD 5B2JC 1WWSA 3X1VB 1U35B 3A6NB 5GSUA 3MVDA 5B32G 4XZQB 3AV1C 5GSUD 3WTPC 3REKD
chains in the Genus database with same CATH superfamily
2JE5A 3LJAD 3MGPC 1P3OA 5CPKC 3W98C 3MGQC 3C1CB 1H3OB 4XUJD 5GT3D 1P3MD 1M19A 3C1BD 4J8VD 4H9PB 1P3FB 1M1AC 4XUJA 5GT3A 4WU8B 1HQ3A 3X1SA 3A6NC 4KGCB 3NQJB 1A7WA 5B32A 5B1MC 5E5AC 1P3KC 3KWQA 3V9RB 2NQBB 5AV5B 4Z2MG 5B2IA 1M18A 1ID3A 2F8NA 1P3PB 3AZMB 4H9QB 2HUEB 3AV1D 1ID3D 4KUDD 3AZJD 1P3GD 5AVBC 4YS3B 5AV8D 3R45B 3WKJB 4KUDA 3AZJA 3REHB 1P3MC 5C3IB 3AYWA 1P3BA 1TAFA 3AZGB 3NQUA 3B6FC 4J8UB 3O62B 5DNND 3IP4C 2Y2HA 4ZUXB 3MGSD 1KX3C 2FFFB 1AOIC 3MVDD 4CAYB 5AV9D 2HIOD 3X1TB 3KUYB 4X23D 3LZ0B 3AZNC 3B6FA 2Y2PA 5B33A 1P3LB 1P3MA 1M19D 5AVBD 1BH9A 3X1UB 5AVBA 4WU9A 3KFUG 4R8PA 4WU9D 2UWXA 3LZ1D 4Z5TC 2BYKA 1M1AD 3VH6T 3KWQC 3AYWC 5F99B 5G49A 1P3BC 5B40B 4NE6A 3W99B 4J8UC 5BS7C 1U35A 1HQ3C 3A6NA 1KX4C 5GSUB 2ZY5A 4J8XA 1BH8A 1ULYA 1M19C 3MGQA 4AWLB 1P3FD 1BFMA 4YM6B 5AV6C 2CV5B 3W98B 1HQ3B 5JRGB 2PYOC 2VQRA 4X23A 5GT0B 1ZLAB 5B1LD 5B0YC 3W96D 3WTPE 2CWEA 5B33D 3B0BA 3KWQB 5B2IB 1M18B 5GXQB 4LD9B 3REIB 5CPKB 3AZEA 1S32B 5CP6A 4YS3A 4R8PD 5CPJB 3LZ1A 5DNMB 1P3AD 3UTBD 1TAFB 4J8UA 2RVQC 4WZSB 4Z66D 3TU4B 1U35D 1F66B 3A6ND 3AV2A 3W96C 3X1UC 1S32C 3AFAB 3X1TA 3KUYA 4H9SA 4H9OB 3F6TA 1KX5B 2Y2NA 3UTAC 4Z5TB 3C1CD 1P3MB 5B40C 3AZNA 4WU9B 1P3IA 4ZUXC 3EPHA 5BO0B 3W97D 1TZYA 1P3ID 3LELB 3P5JB 4UUZA 5B1LC 5B0YD 1KX4D 5AV9C 5B33C 4J8XB 1BH8B 5JA4A 2DQNC 3WTPD 3AZGD 2F8NK 3LZ0C 1WWIA 4YM6A 3RELD 4XZQC 3AZHA 4JJNB 3C1BC 3REHC 1P3IC 4QLCC 3H0RC 5AV9B 3KUYD 3WA9B 5B0ZA 3AZIA 4X23B 5GT0A 1ZLAA 4H9NB 1KX5C 3UT9A 2HUEC 1P34B 1P3KD 3AZLC 3UTAA 4HGAC 5AY8A 4EO5B 3TU4C 3X1TC 5CPKA 5B2JD 5B24A 3MGPA 5B31G 3UTAD 1S32A 2FJ7B 1ID3C 1P3AB 5B2IC 1M18C 5B1MA 5E5AA 5DNMA 3AFAC 1P3PC 1M1AB 2NZDB 3KXBB 5AVCB 5GT3C 4XUJC 4J8WA 1F66A 1P3OD 1B67A 5GXQC 4LD9C 3AZKB 3EPKA 3AZEC 2AROB 3B0DB 3WTPA 5JRGC 3C1CC 3WAAD 3X1SD 4YM6D 3AL0C 5GSUC 5KDMA 3LJAB 2ZM5A 2NZDC 4NFTA 5B32D 3EG5B 1P3IB 5F99C 5GT0D 1N1JB 3AN2C 1ZLAD 4NE3A 2YFWB 1TZYB 4KGCD 3B6GD 3LELA 5DNMC 2CV5C 4H9RA 4KGCA 5B0YB 1KX4B 2PYOB 4KHAB 1S32D 4JJNC 2JCHA 2NQBA 5AV5A 3AZKC 1P3LC 5CPJD 1ID3B 5B31D 3AZLA 2F8NB 5CPIC 2Y2JA 3WKJA 4Z66B 3LJAC 1T3UA 3MGRB 3REHA 3B0CW 3B6FD 5BNVB 3AYWB 1P3BB 3NQUB 3O62A 3A1IA 4WNNA 4Z5TD 2HIOB 4J8VA 3UT9B 4CAYA 1P34A 3B0CT 3UTAB 5AY8B 1AOIB 3MGRC 2DF4C 2FJ7A 4DRAA 3REJB 4DRBA 1W2EA 3C1BB 5C3IC 5E5AB 5B1MB 1BH9B 1P3GC 4WU8D 2FJ7C 1B6WA 1TZYC 5AVCD 4G91C 3RELC 5BT1C 4G92B 3KXBA 5F99D 4CSRB 3REKB 5BNXB 2BYKB 1EQZA 5AV5D 3AZKA 5B40A 2Y2MA 3W99A 1EQZD 4DQYB 1JFIA 3WTPB 1P3GB 2HIOC 2YFVA 3MGSA 5AV8B 3WKJD 5CPJC 5B32C 5KDMB 3LJAA 3W96A 3X1VC 3AN2A 3A1KA 3MNNA 4ZBJB 5DNNB 3AN2D 3B6GB 1P3PD 3AZMD 4ZUXD 2JSSA 3MNND 4E45A 1P34D 4AWLC 5CP6D 5CPIB 1P3KB 2AROC 3W98A 5B1LB 1F1EA 1KU5A 3FDDA 3LZ1C 3REIC 2RVQD 3KWQD 3UTBA 5B31B 2F8ND 2W8SA 1P3LD 4EO5C 5GXQA 4LD9A 3AZLB 3REIA 3WAAC 4J8WC 3AZEB 2Y2OA 2ZY2A 3MVDB 1P3AC 3LZ1B 1P3OB 3UTBC 3MNNC 2XD1A 5BNVA 3C1CA 2G5HC 3W99D 3MGQD 1M19B 4H9PA 3VH6A 5B24C 1P3FA 3B6GC 5GT3B 4XUJB 2HIOA 3X1SB 3MGSC 4J8VB 1KX5D 1PZRA 3NQJA 1F66C 4J8XC 2BYMA 1KX5A 4G92C 3V9RA 3AZIC 5BS7A 1P3PA 3AZMA 3C1BA 3AZHC 2Y2QA 3W98D 3AZNB 3R45A 4KUDB 3AZJB 5AV8C 3W97C 3W99C 4YS3D 4WU9C 5BNXA 3AZGA 5GXQD 4LD9D 4HGAB 3REID 3RELA 5B0ZC 4J8UD 1P3GA 2YFVB 3MGSB 2F8NH 3AV2D 5AV8A 3O62C 4YM6C 3LZ0A 3W96B 3X1TD 3AN2B 3MNNB 3LZ0D 3AZMC 5DNNA 5CPKD 2ZY4A 1P34C 3AZHB 5CPIA 5AV9A 5B1LA 3AZFB 3WA9A 3KSYA 5AV5C 4Z2MH 4QLCB 4H9SC 3W97A 3UTBB 1R4VA 2Y2KA 3AZED 3TU4D 3AV2C 5FUGB 4J8WD 1KX3B 5B24B 3VH6W 1P3AA 3AFAD 2L5AA 2NQBC 3MGQB 1M1AA 3WAAA 4WV4B 4XZQD 2NZDA 2CV5A 1P3OC 5JRGA 3H0LC 2CV5D 4J8XD 3H0MC 2AROA 3MVDC 2BYMB 5JRGD 5B0ZD 3AZID 3LELD 1HTAA 3B0DC 4NE5A 5B31C 3AZND 2Y2IA 5AV6A 5CP6B 5CPID 4WJ3C 3MGPD 5CPJA 5AVCC 1TZYD 3WA9D 4ZBJC 1Q9CA 4M6BA 5AV6D 2ZY3A 1N1JA 2XD5A 2YFWA 3AV1B 5DNMD 2PYOD 4H9RB 3TU4A 5B0YA 1KX4A 5AY8C 3RELB 5B2JB 1U35C 4KHAA 3AV2B 1EQZC 4JJND 2PYOA 1F66D 3KXBC 3AFAA 3O62D 4H9OA 3X1VA 4UPKA 4Z5TA 4R8PC 3X1VD 4XZQA 4G91B 2NZDD 3AZHD 4Z66A 3WA9C 2G5IC 3MGRA 3EPJA 3REKC 3UT9C 2F2AC 2FJ7D 1H3OA 5GT0C 1ZLAC 4QLCD 2AROD 2J8PA 5BT1D 5BO0A 3AZFA 2RIQA 5DNNC 4QLCA 4WNNB 4WU8A 3X1UD 4UUZB 3W97B 1AOID 3REJC 2IO5B 1Z2CB 3KXBD 5B32B 1AOIA 5FUGA 1KX3A 2Y2GA 5B40D 3WKJC 4H9QA 3REJA 2NQBD 5JA4B 4WU8C 3AZJC 3WAAB 3AZFC 3AZGC 4J8VC 4E44A 4JJNA 4CSRA 3REKA 1EQZB 3REHD 4Z66C 5B0ZB 3AZIB 3KUYC 4ZUXA 4H9NA 1JFIB 3LELC 2LY8A 1HQ3D 2BG1A 3X1SC 3MGRD 4KUDC 3MGPB 3EPLA 3B6FB 5AV6B 5CHLB 5B33B 1P3LA 5B2ID 1M18D 3AZFD 1P3FC 3B6GA 3VH5W 5AVBB 3X1UA 4YS3C 5CP6C 3AV1A 3UT9D 4KGCC 1P3KA 4R8PB 5AVCA 5AY8D 3VH5A 4J8WB 1KX3D 2IO5C 5B24D 5B2JA 2Y2LA 5F99A 5G49B 3AYWD 5B31A 3AZLD 1P3BD 3REJD 3VH5T 2F8NG 4X23C 3AZKD 5B1MD 5E5AD 5B2JC 1WWSA 3X1VB 1U35B 3A6NB 5GSUA 3MVDA 5B32G 4XZQB 3AV1C 5GSUD 3WTPC 3REKD
chains in the Genus database with same CATH topology
2JE5A 3LJAD 3MGPC 1P3OA 5CPKC 3W98C 3MGQC 3C1CB 1H3OB 4XUJD 5GT3D 1P3MD 1M19A 3C1BD 4J8VD 4H9PB 1P3FB 1M1AC 4XUJA 5GT3A 4WU8B 1HQ3A 3X1SA 3A6NC 4KGCB 3NQJB 1A7WA 5B32A 5B1MC 5E5AC 1P3KC 3KWQA 3V9RB 2NQBB 5AV5B 4Z2MG 5B2IA 1M18A 1ID3A 2F8NA 1P3PB 3AZMB 4H9QB 2HUEB 3AV1D 1ID3D 4KUDD 3AZJD 1P3GD 5AVBC 4YS3B 5AV8D 3R45B 3WKJB 4KUDA 3AZJA 3REHB 1P3MC 5C3IB 3AYWA 1P3BA 1TAFA 3AZGB 3NQUA 3B6FC 4J8UB 3O62B 5DNND 3IP4C 2Y2HA 4ZUXB 3MGSD 1KX3C 2FFFB 1AOIC 3MVDD 4CAYB 5AV9D 2HIOD 3X1TB 3KUYB 4X23D 3LZ0B 3AZNC 3B6FA 2Y2PA 5B33A 1P3LB 1P3MA 1M19D 5AVBD 1BH9A 3X1UB 5AVBA 4WU9A 3KFUG 4R8PA 4WU9D 2UWXA 3LZ1D 4Z5TC 2BYKA 1M1AD 3VH6T 3KWQC 3AYWC 5F99B 5G49A 1P3BC 5B40B 4NE6A 3W99B 4J8UC 5BS7C 1U35A 1HQ3C 3A6NA 1KX4C 5GSUB 2ZY5A 4J8XA 1BH8A 1ULYA 1M19C 3MGQA 4AWLB 1P3FD 1BFMA 4YM6B 5AV6C 2CV5B 3W98B 1HQ3B 5JRGB 2PYOC 2VQRA 4X23A 5GT0B 1ZLAB 5B1LD 5B0YC 3W96D 3WTPE 2CWEA 5B33D 3B0BA 3KWQB 5B2IB 1M18B 5GXQB 4LD9B 3REIB 5CPKB 3AZEA 1S32B 5CP6A 4YS3A 4R8PD 5CPJB 3LZ1A 5DNMB 1P3AD 3UTBD 1TAFB 4J8UA 2RVQC 4WZSB 4Z66D 3TU4B 1U35D 1F66B 3A6ND 3AV2A 3W96C 3X1UC 1S32C 3AFAB 3X1TA 3KUYA 4H9SA 4H9OB 3F6TA 1KX5B 2Y2NA 3UTAC 4Z5TB 3C1CD 1P3MB 5B40C 3AZNA 4WU9B 1P3IA 4ZUXC 3EPHA 5BO0B 3W97D 1TZYA 1P3ID 3LELB 3P5JB 4UUZA 5B1LC 5B0YD 1KX4D 5AV9C 5B33C 4J8XB 1BH8B 5JA4A 2DQNC 3WTPD 3AZGD 2F8NK 3LZ0C 1WWIA 4YM6A 3RELD 4XZQC 3AZHA 4JJNB 3C1BC 3REHC 1P3IC 4QLCC 3H0RC 5AV9B 3KUYD 3WA9B 5B0ZA 3AZIA 4X23B 5GT0A 1ZLAA 4H9NB 1KX5C 3UT9A 2HUEC 1P34B 1P3KD 3AZLC 3UTAA 4HGAC 5AY8A 4EO5B 3TU4C 3X1TC 5CPKA 5B2JD 5B24A 3MGPA 5B31G 3UTAD 1S32A 2FJ7B 1ID3C 1P3AB 5B2IC 1M18C 5B1MA 5E5AA 5DNMA 3AFAC 1P3PC 1M1AB 2NZDB 3KXBB 5AVCB 5GT3C 4XUJC 4J8WA 1F66A 1P3OD 1B67A 5GXQC 4LD9C 3AZKB 3EPKA 3AZEC 2AROB 3B0DB 3WTPA 5JRGC 3C1CC 3WAAD 3X1SD 4YM6D 3AL0C 5GSUC 5KDMA 3LJAB 2ZM5A 2NZDC 4NFTA 5B32D 3EG5B 1P3IB 5F99C 5GT0D 1N1JB 3AN2C 1ZLAD 4NE3A 2YFWB 1TZYB 4KGCD 3B6GD 3LELA 5DNMC 2CV5C 4H9RA 4KGCA 5B0YB 1KX4B 2PYOB 4KHAB 1S32D 4JJNC 2JCHA 2NQBA 5AV5A 3AZKC 1P3LC 5CPJD 1ID3B 5B31D 3AZLA 2F8NB 5CPIC 2Y2JA 3WKJA 4Z66B 3LJAC 1T3UA 3MGRB 3REHA 3B0CW 3B6FD 5BNVB 3AYWB 1P3BB 3NQUB 3O62A 3A1IA 4WNNA 4Z5TD 2HIOB 4J8VA 3UT9B 4CAYA 1P34A 3B0CT 3UTAB 5AY8B 1AOIB 3MGRC 2DF4C 2FJ7A 4DRAA 3REJB 4DRBA 1W2EA 3C1BB 5C3IC 5E5AB 5B1MB 1BH9B 1P3GC 4WU8D 2FJ7C 1B6WA 1TZYC 5AVCD 4G91C 3RELC 5BT1C 4G92B 3KXBA 5F99D 4CSRB 3REKB 5BNXB 2BYKB 1EQZA 5AV5D 3AZKA 5B40A 2Y2MA 3W99A 1EQZD 4DQYB 1JFIA 3WTPB 1P3GB 2HIOC 2YFVA 3MGSA 5AV8B 3WKJD 5CPJC 5B32C 5KDMB 3LJAA 3W96A 3X1VC 3AN2A 3A1KA 3MNNA 4ZBJB 5DNNB 3AN2D 3B6GB 1P3PD 3AZMD 4ZUXD 2JSSA 3MNND 4E45A 1P34D 4AWLC 5CP6D 5CPIB 1P3KB 2AROC 3W98A 5B1LB 1F1EA 1KU5A 3FDDA 3LZ1C 3REIC 2RVQD 3KWQD 3UTBA 5B31B 2F8ND 2W8SA 1P3LD 4EO5C 5GXQA 4LD9A 3AZLB 3REIA 3WAAC 4J8WC 3AZEB 2Y2OA 2ZY2A 3MVDB 1P3AC 3LZ1B 1P3OB 3UTBC 3MNNC 2XD1A 5BNVA 3C1CA 2G5HC 3W99D 3MGQD 1M19B 4H9PA 3VH6A 5B24C 1P3FA 3B6GC 5GT3B 4XUJB 2HIOA 3X1SB 3MGSC 4J8VB 1KX5D 1PZRA 3NQJA 1F66C 4J8XC 2BYMA 1KX5A 4G92C 3V9RA 3AZIC 5BS7A 1P3PA 3AZMA 3C1BA 3AZHC 2Y2QA 3W98D 3AZNB 3R45A 4KUDB 3AZJB 5AV8C 3W97C 3W99C 4YS3D 4WU9C 5BNXA 3AZGA 5GXQD 4LD9D 4HGAB 3REID 3RELA 5B0ZC 4J8UD 1P3GA 2YFVB 3MGSB 2F8NH 3AV2D 5AV8A 3O62C 4YM6C 3LZ0A 3W96B 3X1TD 3AN2B 3MNNB 3LZ0D 3AZMC 5DNNA 5CPKD 2ZY4A 1P34C 3AZHB 5CPIA 5AV9A 5B1LA 3AZFB 3WA9A 3KSYA 5AV5C 4Z2MH 4QLCB 4H9SC 3W97A 3UTBB 1R4VA 2Y2KA 3AZED 3TU4D 3AV2C 5FUGB 4J8WD 1KX3B 5B24B 3VH6W 1P3AA 3AFAD 2L5AA 2NQBC 3MGQB 1M1AA 3WAAA 4WV4B 4XZQD 2NZDA 2CV5A 1P3OC 5JRGA 3H0LC 2CV5D 4J8XD 3H0MC 2AROA 3MVDC 2BYMB 5JRGD 5B0ZD 3AZID 3LELD 1HTAA 3B0DC 4NE5A 5B31C 3AZND 2Y2IA 5AV6A 5CP6B 5CPID 4WJ3C 3MGPD 5CPJA 5AVCC 1TZYD 3WA9D 4ZBJC 1Q9CA 4M6BA 5AV6D 2ZY3A 1N1JA 2XD5A 2YFWA 3AV1B 5DNMD 2PYOD 4H9RB 3TU4A 5B0YA 1KX4A 5AY8C 3RELB 5B2JB 1U35C 4KHAA 3AV2B 1EQZC 4JJND 2PYOA 1F66D 3KXBC 3AFAA 3O62D 4H9OA 3X1VA 4UPKA 4Z5TA 4R8PC 3X1VD 4XZQA 4G91B 2NZDD 3AZHD 4Z66A 3WA9C 2G5IC 3MGRA 3EPJA 3REKC 3UT9C 2F2AC 2FJ7D 1H3OA 5GT0C 1ZLAC 4QLCD 2AROD 2J8PA 5BT1D 5BO0A 3AZFA 2RIQA 5DNNC 4QLCA 4WNNB 4WU8A 3X1UD 4UUZB 3W97B 1AOID 3REJC 2IO5B 1Z2CB 3KXBD 5B32B 1AOIA 5FUGA 1KX3A 2Y2GA 5B40D 3WKJC 4H9QA 3REJA 2NQBD 5JA4B 4WU8C 3AZJC 3WAAB 3AZFC 3AZGC 4J8VC 4E44A 4JJNA 4CSRA 3REKA 1EQZB 3REHD 4Z66C 5B0ZB 3AZIB 3KUYC 4ZUXA 4H9NA 1JFIB 3LELC 2LY8A 1HQ3D 2BG1A 3X1SC 3MGRD 4KUDC 3MGPB 3EPLA 3B6FB 5AV6B 5CHLB 5B33B 1P3LA 5B2ID 1M18D 3AZFD 1P3FC 3B6GA 3VH5W 5AVBB 3X1UA 4YS3C 5CP6C 3AV1A 3UT9D 4KGCC 1P3KA 4R8PB 5AVCA 5AY8D 3VH5A 4J8WB 1KX3D 2IO5C 5B24D 5B2JA 2Y2LA 5F99A 5G49B 3AYWD 5B31A 3AZLD 1P3BD 3REJD 3VH5T 2F8NG 4X23C 3AZKD 5B1MD 5E5AD 5B2JC 1WWSA 3X1VB 1U35B 3A6NB 5GSUA 3MVDA 5B32G 4XZQB 3AV1C 5GSUD 3WTPC 3REKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA D;  3MGP C;  1P3O A;  5CPK C;  3W98 C;  3MGQ C;  3C1C B;  1H3O B;  4XUJ D;  5GT3 D;  1P3M D;  1M19 A;  3C1B D;  4J8V D;  4H9P B;  1P3F B;  1M1A C;  4XUJ A;  5GT3 A;  4WU8 B;  1HQ3 A;  3X1S A;  3A6N C;  4KGC B;  3NQJ B;  1A7W A;  5B32 A;  5B1M C;  5E5A C;  1P3K C;  3KWQ A;  3V9R B;  2NQB B;  5AV5 B;  4Z2M G;  5B2I A;  1M18 A;  1ID3 A;  2F8N A;  1P3P B;  3AZM B;  4H9Q B;  2HUE B;  3AV1 D;  1ID3 D;  4KUD D;  3AZJ D;  1P3G D;  5AVB C;  4YS3 B;  5AV8 D;  3R45 B;  3WKJ B;  4KUD A;  3AZJ A;  3REH B;  1P3M C;  5C3I B;  3AYW A;  1P3B A;  1TAF A;  3AZG B;  3NQU A;  3B6F C;  4J8U B;  3O62 B;  5DNN D;  4ZUX B;  3MGS D;  1KX3 C;  1AOI C;  3MVD D;  4CAY B;  5AV9 D;  2HIO D;  3X1T B;  3KUY B;  4X23 D;  3LZ0 B;  3AZN C;  3B6F A;  5B33 A;  1P3L B;  1P3M A;  1M19 D;  5AVB D;  1BH9 A;  3X1U B;  5AVB A;  4WU9 A;  4R8P A;  4WU9 D;  3LZ1 D;  4Z5T C;  2BYK A;  1M1A D;  3VH6 T;  3KWQ C;  3AYW C;  5F99 B;  5G49 A;  1P3B C;  5B40 B;  4NE6 A;  3W99 B;  4J8U C;  5BS7 C;  1U35 A;  1HQ3 C;  3A6N A;  1KX4 C;  5GSU B;  4J8X A;  1BH8 A;  1ULY A;  1M19 C;  3MGQ A;  4AWL B;  1P3F D;  1BFM A;  4YM6 B;  5AV6 C;  2CV5 B;  3W98 B;  1HQ3 B;  5JRG B;  2PYO C;  4X23 A;  5GT0 B;  1ZLA B;  5B1L D;  5B0Y C;  3W96 D;  3WTP E;  2CWE A;  5B33 D;  3B0B A;  3KWQ B;  5B2I B;  1M18 B;  5GXQ B;  4LD9 B;  3REI B;  5CPK B;  3AZE A;  1S32 B;  5CP6 A;  4YS3 A;  4R8P D;  5CPJ B;  3LZ1 A;  5DNM B;  1P3A D;  3UTB D;  1TAF B;  4J8U A;  2RVQ C;  4WZS B;  4Z66 D;  3TU4 B;  1U35 D;  1F66 B;  3A6N D;  3AV2 A;  3W96 C;  3X1U C;  1S32 C;  3AFA B;  3X1T A;  3KUY A;  4H9S A;  4H9O B;  1KX5 B;  3UTA C;  4Z5T B;  3C1C D;  1P3M B;  5B40 C;  3AZN A;  4WU9 B;  1P3I A;  4ZUX C;  5BO0 B;  3W97 D;  1TZY A;  1P3I D;  3LEL B;  4UUZ A;  5B1L C;  5B0Y D;  1KX4 D;  5AV9 C;  5B33 C;  4J8X B;  1BH8 B;  5JA4 A;  3WTP D;  3AZG D;  2F8N K;  3LZ0 C;  1WWI A;  4YM6 A;  3REL D;  4XZQ C;  3AZH A;  4JJN B;  3C1B C;  3REH C;  1P3I C;  4QLC C;  5AV9 B;  3KUY D;  3WA9 B;  5B0Z A;  3AZI A;  4X23 B;  5GT0 A;  1ZLA A;  4H9N B;  1KX5 C;  3UT9 A;  2HUE C;  1P34 B;  1P3K D;  3AZL C;  3UTA A;  4HGA C;  5AY8 A;  4EO5 B;  3TU4 C;  3X1T C;  5CPK A;  5B2J D;  5B24 A;  3MGP A;  5B31 G;  3UTA D;  1S32 A;  2FJ7 B;  1ID3 C;  1P3A B;  5B2I C;  1M18 C;  5B1M A;  5E5A A;  5DNM A;  3AFA C;  1P3P C;  1M1A B;  2NZD B;  3KXB B;  5AVC B;  5GT3 C;  4XUJ C;  4J8W A;  1F66 A;  1P3O D;  1B67 A;  5GXQ C;  4LD9 C;  3AZK B;  3AZE C;  2ARO B;  3B0D B;  3WTP A;  5JRG C;  3C1C C;  3WAA D;  3X1S D;  4YM6 D;  5GSU C;  5KDM A;  3LJA B;  2NZD C;  4NFT A;  5B32 D;  1P3I B;  5F99 C;  5GT0 D;  1N1J B;  3AN2 C;  1ZLA D;  4NE3 A;  2YFW B;  1TZY B;  4KGC D;  3B6G D;  3LEL A;  5DNM C;  2CV5 C;  4H9R A;  4KGC A;  5B0Y B;  1KX4 B;  2PYO B;  4KHA B;  1S32 D;  4JJN C;  2NQB A;  5AV5 A;  3AZK C;  1P3L C;  5CPJ D;  1ID3 B;  5B31 D;  3AZL A;  2F8N B;  5CPI C;  3WKJ A;  4Z66 B;  3LJA C;  3MGR B;  3REH A;  3B0C W;  3B6F D;  5BNV B;  3AYW B;  1P3B B;  3NQU B;  3O62 A;  4WNN A;  4Z5T D;  2HIO B;  4J8V A;  3UT9 B;  4CAY A;  1P34 A;  3B0C T;  3UTA B;  5AY8 B;  1AOI B;  3MGR C;  2FJ7 A;  4DRA A;  3REJ B;  4DRB A;  3C1B B;  5C3I C;  5E5A B;  5B1M B;  1BH9 B;  1P3G C;  4WU8 D;  2FJ7 C;  1B6W A;  1TZY C;  5AVC D;  4G91 C;  3REL C;  5BT1 C;  4G92 B;  3KXB A;  5F99 D;  4CSR B;  3REK B;  5BNX B;  2BYK B;  1EQZ A;  5AV5 D;  3AZK A;  5B40 A;  3W99 A;  1EQZ D;  1JFI A;  3WTP B;  1P3G B;  2HIO C;  2YFV A;  3MGS A;  5AV8 B;  3WKJ D;  5CPJ C;  5B32 C;  5KDM B;  3LJA A;  3W96 A;  3X1V C;  3AN2 A;  3MNN A;  4ZBJ B;  5DNN B;  3AN2 D;  3B6G B;  1P3P D;  3AZM D;  4ZUX D;  2JSS A;  3MNN D;  4E45 A;  1P34 D;  4AWL C;  5CP6 D;  5CPI B;  1P3K B;  2ARO C;  3W98 A;  5B1L B;  1F1E A;  1KU5 A;  3LZ1 C;  3REI C;  2RVQ D;  3KWQ D;  3UTB A;  5B31 B;  2F8N D;  1P3L D;  4EO5 C;  5GXQ A;  4LD9 A;  3AZL B;  3REI A;  3WAA C;  4J8W C;  3AZE B;  3MVD B;  1P3A C;  3LZ1 B;  1P3O B;  3UTB C;  3MNN C;  5BNV A;  3C1C A;  3W99 D;  3MGQ D;  1M19 B;  4H9P A;  3VH6 A;  5B24 C;  1P3F A;  3B6G C;  5GT3 B;  4XUJ B;  2HIO A;  3X1S B;  3MGS C;  4J8V B;  1KX5 D;  3NQJ A;  1F66 C;  4J8X C;  2BYM A;  1KX5 A;  4G92 C;  3V9R A;  3AZI C;  5BS7 A;  1P3P A;  3AZM A;  3C1B A;  3AZH C;  3W98 D;  3AZN B;  3R45 A;  4KUD B;  3AZJ B;  5AV8 C;  3W97 C;  3W99 C;  4YS3 D;  4WU9 C;  5BNX A;  3AZG A;  5GXQ D;  4LD9 D;  4HGA B;  3REI D;  3REL A;  5B0Z C;  4J8U D;  1P3G A;  2YFV B;  3MGS B;  2F8N H;  3AV2 D;  5AV8 A;  3O62 C;  4YM6 C;  3LZ0 A;  3W96 B;  3X1T D;  3AN2 B;  3MNN B;  3LZ0 D;  3AZM C;  5DNN A;  5CPK D;  1P34 C;  3AZH B;  5CPI A;  5AV9 A;  5B1L A;  3AZF B;  3WA9 A;  4QLC B;  5AV5 C;  3KSY A;  4Z2M H;  4H9S C;  3W97 A;  3UTB B;  1R4V A;  3AZE D;  3TU4 D;  3AV2 C;  5FUG B;  4J8W D;  1KX3 B;  5B24 B;  3VH6 W;  1P3A A;  3AFA D;  2L5A A;  2NQB C;  3MGQ B;  1M1A A;  3WAA A;  4WV4 B;  4XZQ D;  2NZD A;  2CV5 A;  1P3O C;  5JRG A;  2CV5 D;  4J8X D;  2ARO A;  3MVD C;  2BYM B;  5JRG D;  5B0Z D;  3AZI D;  3LEL D;  1HTA A;  3B0D C;  4NE5 A;  5B31 C;  3AZN D;  5AV6 A;  5CP6 B;  5CPI D;  3MGP D;  5CPJ A;  5AVC C;  1TZY D;  3WA9 D;  4ZBJ C;  1Q9C A;  4M6B A;  5AV6 D;  1N1J A;  2YFW A;  3AV1 B;  5DNM D;  2PYO D;  4H9R B;  3TU4 A;  5B0Y A;  1KX4 A;  5AY8 C;  3REL B;  5B2J B;  1U35 C;  4KHA A;  3AV2 B;  1EQZ C;  4JJN D;  2PYO A;  1F66 D;  3KXB C;  3AFA A;  3O62 D;  4H9O A;  3X1V A;  4Z5T A;  4R8P C;  3X1V D;  4XZQ A;  4G91 B;  2NZD D;  3AZH D;  4Z66 A;  3WA9 C;  3MGR A;  3REK C;  3UT9 C;  2FJ7 D;  1H3O A;  5GT0 C;  1ZLA C;  4QLC D;  2ARO D;  5BT1 D;  5BO0 A;  3AZF A;  5DNN C;  4QLC A;  4WNN B;  4WU8 A;  3X1U D;  4UUZ B;  3W97 B;  1AOI D;  3REJ C;  2IO5 B;  3KXB D;  5B32 B;  1AOI A;  5FUG A;  1KX3 A;  5B40 D;  3WKJ C;  4H9Q A;  3REJ A;  2NQB D;  5JA4 B;  4WU8 C;  3AZJ C;  3WAA B;  3AZF C;  3AZG C;  4J8V C;  4E44 A;  4JJN A;  4CSR A;  3REK A;  1EQZ B;  3REH D;  4Z66 C;  5B0Z B;  3AZI B;  3KUY C;  4ZUX A;  4H9N A;  1JFI B;  3LEL C;  2LY8 A;  1HQ3 D;  3X1S C;  3MGR D;  4KUD C;  3MGP B;  3B6F B;  5AV6 B;  5CHL B;  5B33 B;  1P3L A;  5B2I D;  1M18 D;  3AZF D;  1P3F C;  3B6G A;  3VH5 W;  5AVB B;  3X1U A;  4YS3 C;  5CP6 C;  3AV1 A;  3UT9 D;  4KGC C;  1P3K A;  4R8P B;  5AVC A;  5AY8 D;  3VH5 A;  4J8W B;  1KX3 D;  2IO5 C;  5B24 D;  5B2J A;  5F99 A;  5G49 B;  3AYW D;  5B31 A;  3AZL D;  1P3B D;  3REJ D;  3VH5 T;  2F8N G;  4X23 C;  3AZK D;  5B1M D;  5E5A D;  5B2J C;  1WWS A;  3X1V B;  1U35 B;  3A6N B;  5GSU A;  3MVD A;  5B32 G;  4XZQ B;  3AV1 C;  5GSU D;  3WTP C;  3REK D; 
#chains in the Genus database with same CATH topology
 2JE5 A;  3LJA D;  3MGP C;  1P3O A;  5CPK C;  3W98 C;  3MGQ C;  3C1C B;  1H3O B;  4XUJ D;  5GT3 D;  1P3M D;  1M19 A;  3C1B D;  4J8V D;  4H9P B;  1P3F B;  1M1A C;  4XUJ A;  5GT3 A;  4WU8 B;  1HQ3 A;  3X1S A;  3A6N C;  4KGC B;  3NQJ B;  1A7W A;  5B32 A;  5B1M C;  5E5A C;  1P3K C;  3KWQ A;  3V9R B;  2NQB B;  5AV5 B;  4Z2M G;  5B2I A;  1M18 A;  1ID3 A;  2F8N A;  1P3P B;  3AZM B;  4H9Q B;  2HUE B;  3AV1 D;  1ID3 D;  4KUD D;  3AZJ D;  1P3G D;  5AVB C;  4YS3 B;  5AV8 D;  3R45 B;  3WKJ B;  4KUD A;  3AZJ A;  3REH B;  1P3M C;  5C3I B;  3AYW A;  1P3B A;  1TAF A;  3AZG B;  3NQU A;  3B6F C;  4J8U B;  3O62 B;  5DNN D;  3IP4 C;  2Y2H A;  4ZUX B;  3MGS D;  1KX3 C;  2FFF B;  1AOI C;  3MVD D;  4CAY B;  5AV9 D;  2HIO D;  3X1T B;  3KUY B;  4X23 D;  3LZ0 B;  3AZN C;  3B6F A;  2Y2P A;  5B33 A;  1P3L B;  1P3M A;  1M19 D;  5AVB D;  1BH9 A;  3X1U B;  5AVB A;  4WU9 A;  3KFU G;  4R8P A;  4WU9 D;  2UWX A;  3LZ1 D;  4Z5T C;  2BYK A;  1M1A D;  3VH6 T;  3KWQ C;  3AYW C;  5F99 B;  5G49 A;  1P3B C;  5B40 B;  4NE6 A;  3W99 B;  4J8U C;  5BS7 C;  1U35 A;  1HQ3 C;  3A6N A;  1KX4 C;  5GSU B;  2ZY5 A;  4J8X A;  1BH8 A;  1ULY A;  1M19 C;  3MGQ A;  4AWL B;  1P3F D;  1BFM A;  4YM6 B;  5AV6 C;  2CV5 B;  3W98 B;  1HQ3 B;  5JRG B;  2PYO C;  2VQR A;  4X23 A;  5GT0 B;  1ZLA B;  5B1L D;  5B0Y C;  3W96 D;  3WTP E;  2CWE A;  5B33 D;  3B0B A;  3KWQ B;  5B2I B;  1M18 B;  5GXQ B;  4LD9 B;  3REI B;  5CPK B;  3AZE A;  1S32 B;  5CP6 A;  4YS3 A;  4R8P D;  5CPJ B;  3LZ1 A;  5DNM B;  1P3A D;  3UTB D;  1TAF B;  4J8U A;  2RVQ C;  4WZS B;  4Z66 D;  3TU4 B;  1U35 D;  1F66 B;  3A6N D;  3AV2 A;  3W96 C;  3X1U C;  1S32 C;  3AFA B;  3X1T A;  3KUY A;  4H9S A;  4H9O B;  3F6T A;  1KX5 B;  2Y2N A;  3UTA C;  4Z5T B;  3C1C D;  1P3M B;  5B40 C;  3AZN A;  4WU9 B;  1P3I A;  4ZUX C;  3EPH A;  5BO0 B;  3W97 D;  1TZY A;  1P3I D;  3LEL B;  3P5J B;  4UUZ A;  5B1L C;  5B0Y D;  1KX4 D;  5AV9 C;  5B33 C;  4J8X B;  1BH8 B;  5JA4 A;  2DQN C;  3WTP D;  3AZG D;  2F8N K;  3LZ0 C;  1WWI A;  4YM6 A;  3REL D;  4XZQ C;  3AZH A;  4JJN B;  3C1B C;  3REH C;  1P3I C;  4QLC C;  3H0R C;  5AV9 B;  3KUY D;  3WA9 B;  5B0Z A;  3AZI A;  4X23 B;  5GT0 A;  1ZLA A;  4H9N B;  1KX5 C;  3UT9 A;  2HUE C;  1P34 B;  1P3K D;  3AZL C;  3UTA A;  4HGA C;  5AY8 A;  4EO5 B;  3TU4 C;  3X1T C;  5CPK A;  5B2J D;  5B24 A;  3MGP A;  5B31 G;  3UTA D;  1S32 A;  2FJ7 B;  1ID3 C;  1P3A B;  5B2I C;  1M18 C;  5B1M A;  5E5A A;  5DNM A;  3AFA C;  1P3P C;  1M1A B;  2NZD B;  3KXB B;  5AVC B;  5GT3 C;  4XUJ C;  4J8W A;  1F66 A;  1P3O D;  1B67 A;  5GXQ C;  4LD9 C;  3AZK B;  3EPK A;  3AZE C;  2ARO B;  3B0D B;  3WTP A;  5JRG C;  3C1C C;  3WAA D;  3X1S D;  4YM6 D;  3AL0 C;  5GSU C;  5KDM A;  3LJA B;  2ZM5 A;  2NZD C;  4NFT A;  5B32 D;  3EG5 B;  1P3I B;  5F99 C;  5GT0 D;  1N1J B;  3AN2 C;  1ZLA D;  4NE3 A;  2YFW B;  1TZY B;  4KGC D;  3B6G D;  3LEL A;  5DNM C;  2CV5 C;  4H9R A;  4KGC A;  5B0Y B;  1KX4 B;  2PYO B;  4KHA B;  1S32 D;  4JJN C;  2JCH A;  2NQB A;  5AV5 A;  3AZK C;  1P3L C;  5CPJ D;  1ID3 B;  5B31 D;  3AZL A;  2F8N B;  5CPI C;  2Y2J A;  3WKJ A;  4Z66 B;  3LJA C;  1T3U A;  3MGR B;  3REH A;  3B0C W;  3B6F D;  5BNV B;  3AYW B;  1P3B B;  3NQU B;  3O62 A;  3A1I A;  4WNN A;  4Z5T D;  2HIO B;  4J8V A;  3UT9 B;  4CAY A;  1P34 A;  3B0C T;  3UTA B;  5AY8 B;  1AOI B;  3MGR C;  2DF4 C;  2FJ7 A;  4DRA A;  3REJ B;  4DRB A;  1W2E A;  3C1B B;  5C3I C;  5E5A B;  5B1M B;  1BH9 B;  1P3G C;  4WU8 D;  2FJ7 C;  1B6W A;  1TZY C;  5AVC D;  4G91 C;  3REL C;  5BT1 C;  4G92 B;  3KXB A;  5F99 D;  4CSR B;  3REK B;  5BNX B;  2BYK B;  1EQZ A;  5AV5 D;  3AZK A;  5B40 A;  2Y2M A;  3W99 A;  1EQZ D;  4DQY B;  1JFI A;  3WTP B;  1P3G B;  2HIO C;  2YFV A;  3MGS A;  5AV8 B;  3WKJ D;  5CPJ C;  5B32 C;  5KDM B;  3LJA A;  3W96 A;  3X1V C;  3AN2 A;  3A1K A;  3MNN A;  4ZBJ B;  5DNN B;  3AN2 D;  3B6G B;  1P3P D;  3AZM D;  4ZUX D;  2JSS A;  3MNN D;  4E45 A;  1P34 D;  4AWL C;  5CP6 D;  5CPI B;  1P3K B;  2ARO C;  3W98 A;  5B1L B;  1F1E A;  1KU5 A;  3FDD A;  3LZ1 C;  3REI C;  2RVQ D;  3KWQ D;  3UTB A;  5B31 B;  2F8N D;  2W8S A;  1P3L D;  4EO5 C;  5GXQ A;  4LD9 A;  3AZL B;  3REI A;  3WAA C;  4J8W C;  3AZE B;  2Y2O A;  2ZY2 A;  3MVD B;  1P3A C;  3LZ1 B;  1P3O B;  3UTB C;  3MNN C;  2XD1 A;  5BNV A;  3C1C A;  2G5H C;  3W99 D;  3MGQ D;  1M19 B;  4H9P A;  3VH6 A;  5B24 C;  1P3F A;  3B6G C;  5GT3 B;  4XUJ B;  2HIO A;  3X1S B;  3MGS C;  4J8V B;  1KX5 D;  1PZR A;  3NQJ A;  1F66 C;  4J8X C;  2BYM A;  1KX5 A;  4G92 C;  3V9R A;  3AZI C;  5BS7 A;  1P3P A;  3AZM A;  3C1B A;  3AZH C;  2Y2Q A;  3W98 D;  3AZN B;  3R45 A;  4KUD B;  3AZJ B;  5AV8 C;  3W97 C;  3W99 C;  4YS3 D;  4WU9 C;  5BNX A;  3AZG A;  5GXQ D;  4LD9 D;  4HGA B;  3REI D;  3REL A;  5B0Z C;  4J8U D;  1P3G A;  2YFV B;  3MGS B;  2F8N H;  3AV2 D;  5AV8 A;  3O62 C;  4YM6 C;  3LZ0 A;  3W96 B;  3X1T D;  3AN2 B;  3MNN B;  3LZ0 D;  3AZM C;  5DNN A;  5CPK D;  2ZY4 A;  1P34 C;  3AZH B;  5CPI A;  5AV9 A;  5B1L A;  3AZF B;  3WA9 A;  3KSY A;  5AV5 C;  4Z2M H;  4QLC B;  4H9S C;  3W97 A;  3UTB B;  1R4V A;  2Y2K A;  3AZE D;  3TU4 D;  3AV2 C;  5FUG B;  4J8W D;  1KX3 B;  5B24 B;  3VH6 W;  1P3A A;  3AFA D;  2L5A A;  2NQB C;  3MGQ B;  1M1A A;  3WAA A;  4WV4 B;  4XZQ D;  2NZD A;  2CV5 A;  1P3O C;  5JRG A;  3H0L C;  2CV5 D;  4J8X D;  3H0M C;  2ARO A;  3MVD C;  2BYM B;  5JRG D;  5B0Z D;  3AZI D;  3LEL D;  1HTA A;  3B0D C;  4NE5 A;  5B31 C;  3AZN D;  2Y2I A;  5AV6 A;  5CP6 B;  5CPI D;  4WJ3 C;  3MGP D;  5CPJ A;  5AVC C;  1TZY D;  3WA9 D;  4ZBJ C;  1Q9C A;  4M6B A;  5AV6 D;  2ZY3 A;  1N1J A;  2XD5 A;  2YFW A;  3AV1 B;  5DNM D;  2PYO D;  4H9R B;  3TU4 A;  5B0Y A;  1KX4 A;  5AY8 C;  3REL B;  5B2J B;  1U35 C;  4KHA A;  3AV2 B;  1EQZ C;  4JJN D;  2PYO A;  1F66 D;  3KXB C;  3AFA A;  3O62 D;  4H9O A;  3X1V A;  4UPK A;  4Z5T A;  4R8P C;  3X1V D;  4XZQ A;  4G91 B;  2NZD D;  3AZH D;  4Z66 A;  3WA9 C;  2G5I C;  3MGR A;  3EPJ A;  3REK C;  3UT9 C;  2F2A C;  2FJ7 D;  1H3O A;  5GT0 C;  1ZLA C;  4QLC D;  2ARO D;  2J8P A;  5BT1 D;  5BO0 A;  3AZF A;  2RIQ A;  5DNN C;  4QLC A;  4WNN B;  4WU8 A;  3X1U D;  4UUZ B;  3W97 B;  1AOI D;  3REJ C;  2IO5 B;  1Z2C B;  3KXB D;  5B32 B;  1AOI A;  5FUG A;  1KX3 A;  2Y2G A;  5B40 D;  3WKJ C;  4H9Q A;  3REJ A;  2NQB D;  5JA4 B;  4WU8 C;  3AZJ C;  3WAA B;  3AZF C;  3AZG C;  4J8V C;  4E44 A;  4JJN A;  4CSR A;  3REK A;  1EQZ B;  3REH D;  4Z66 C;  5B0Z B;  3AZI B;  3KUY C;  4ZUX A;  4H9N A;  1JFI B;  3LEL C;  2LY8 A;  1HQ3 D;  2BG1 A;  3X1S C;  3MGR D;  4KUD C;  3MGP B;  3EPL A;  3B6F B;  5AV6 B;  5CHL B;  5B33 B;  1P3L A;  5B2I D;  1M18 D;  3AZF D;  1P3F C;  3B6G A;  3VH5 W;  5AVB B;  3X1U A;  4YS3 C;  5CP6 C;  3AV1 A;  3UT9 D;  4KGC C;  1P3K A;  4R8P B;  5AVC A;  5AY8 D;  3VH5 A;  4J8W B;  1KX3 D;  2IO5 C;  5B24 D;  5B2J A;  2Y2L A;  5F99 A;  5G49 B;  3AYW D;  5B31 A;  3AZL D;  1P3B D;  3REJ D;  3VH5 T;  2F8N G;  4X23 C;  3AZK D;  5B1M D;  5E5A D;  5B2J C;  1WWS A;  3X1V B;  1U35 B;  3A6N B;  5GSU A;  3MVD A;  5B32 G;  4XZQ B;  3AV1 C;  5GSU D;  3WTP C;  3REK D; 
#chains in the Genus database with same CATH homology
 2JE5 A;  3LJA D;  3MGP C;  1P3O A;  5CPK C;  3W98 C;  3MGQ C;  3C1C B;  1H3O B;  4XUJ D;  5GT3 D;  1P3M D;  1M19 A;  3C1B D;  4J8V D;  4H9P B;  1P3F B;  1M1A C;  4XUJ A;  5GT3 A;  4WU8 B;  1HQ3 A;  3X1S A;  3A6N C;  4KGC B;  3NQJ B;  1A7W A;  5B32 A;  5B1M C;  5E5A C;  1P3K C;  3KWQ A;  3V9R B;  2NQB B;  5AV5 B;  4Z2M G;  5B2I A;  1M18 A;  1ID3 A;  2F8N A;  1P3P B;  3AZM B;  4H9Q B;  2HUE B;  3AV1 D;  1ID3 D;  4KUD D;  3AZJ D;  1P3G D;  5AVB C;  4YS3 B;  5AV8 D;  3R45 B;  3WKJ B;  4KUD A;  3AZJ A;  3REH B;  1P3M C;  5C3I B;  3AYW A;  1P3B A;  1TAF A;  3AZG B;  3NQU A;  3B6F C;  4J8U B;  3O62 B;  5DNN D;  3IP4 C;  2Y2H A;  4ZUX B;  3MGS D;  1KX3 C;  2FFF B;  1AOI C;  3MVD D;  4CAY B;  5AV9 D;  2HIO D;  3X1T B;  3KUY B;  4X23 D;  3LZ0 B;  3AZN C;  3B6F A;  2Y2P A;  5B33 A;  1P3L B;  1P3M A;  1M19 D;  5AVB D;  1BH9 A;  3X1U B;  5AVB A;  4WU9 A;  3KFU G;  4R8P A;  4WU9 D;  2UWX A;  3LZ1 D;  4Z5T C;  2BYK A;  1M1A D;  3VH6 T;  3KWQ C;  3AYW C;  5F99 B;  5G49 A;  1P3B C;  5B40 B;  4NE6 A;  3W99 B;  4J8U C;  5BS7 C;  1U35 A;  1HQ3 C;  3A6N A;  1KX4 C;  5GSU B;  2ZY5 A;  4J8X A;  1BH8 A;  1ULY A;  1M19 C;  3MGQ A;  4AWL B;  1P3F D;  1BFM A;  4YM6 B;  5AV6 C;  2CV5 B;  3W98 B;  1HQ3 B;  5JRG B;  2PYO C;  2VQR A;  4X23 A;  5GT0 B;  1ZLA B;  5B1L D;  5B0Y C;  3W96 D;  3WTP E;  2CWE A;  5B33 D;  3B0B A;  3KWQ B;  5B2I B;  1M18 B;  5GXQ B;  4LD9 B;  3REI B;  5CPK B;  3AZE A;  1S32 B;  5CP6 A;  4YS3 A;  4R8P D;  5CPJ B;  3LZ1 A;  5DNM B;  1P3A D;  3UTB D;  1TAF B;  4J8U A;  2RVQ C;  4WZS B;  4Z66 D;  3TU4 B;  1U35 D;  1F66 B;  3A6N D;  3AV2 A;  3W96 C;  3X1U C;  1S32 C;  3AFA B;  3X1T A;  3KUY A;  4H9S A;  4H9O B;  3F6T A;  1KX5 B;  2Y2N A;  3UTA C;  4Z5T B;  3C1C D;  1P3M B;  5B40 C;  3AZN A;  4WU9 B;  1P3I A;  4ZUX C;  3EPH A;  5BO0 B;  3W97 D;  1TZY A;  1P3I D;  3LEL B;  3P5J B;  4UUZ A;  5B1L C;  5B0Y D;  1KX4 D;  5AV9 C;  5B33 C;  4J8X B;  1BH8 B;  5JA4 A;  2DQN C;  3WTP D;  3AZG D;  2F8N K;  3LZ0 C;  1WWI A;  4YM6 A;  3REL D;  4XZQ C;  3AZH A;  4JJN B;  3C1B C;  3REH C;  1P3I C;  4QLC C;  3H0R C;  5AV9 B;  3KUY D;  3WA9 B;  5B0Z A;  3AZI A;  4X23 B;  5GT0 A;  1ZLA A;  4H9N B;  1KX5 C;  3UT9 A;  2HUE C;  1P34 B;  1P3K D;  3AZL C;  3UTA A;  4HGA C;  5AY8 A;  4EO5 B;  3TU4 C;  3X1T C;  5CPK A;  5B2J D;  5B24 A;  3MGP A;  5B31 G;  3UTA D;  1S32 A;  2FJ7 B;  1ID3 C;  1P3A B;  5B2I C;  1M18 C;  5B1M A;  5E5A A;  5DNM A;  3AFA C;  1P3P C;  1M1A B;  2NZD B;  3KXB B;  5AVC B;  5GT3 C;  4XUJ C;  4J8W A;  1F66 A;  1P3O D;  1B67 A;  5GXQ C;  4LD9 C;  3AZK B;  3EPK A;  3AZE C;  2ARO B;  3B0D B;  3WTP A;  5JRG C;  3C1C C;  3WAA D;  3X1S D;  4YM6 D;  3AL0 C;  5GSU C;  5KDM A;  3LJA B;  2ZM5 A;  2NZD C;  4NFT A;  5B32 D;  3EG5 B;  1P3I B;  5F99 C;  5GT0 D;  1N1J B;  3AN2 C;  1ZLA D;  4NE3 A;  2YFW B;  1TZY B;  4KGC D;  3B6G D;  3LEL A;  5DNM C;  2CV5 C;  4H9R A;  4KGC A;  5B0Y B;  1KX4 B;  2PYO B;  4KHA B;  1S32 D;  4JJN C;  2JCH A;  2NQB A;  5AV5 A;  3AZK C;  1P3L C;  5CPJ D;  1ID3 B;  5B31 D;  3AZL A;  2F8N B;  5CPI C;  2Y2J A;  3WKJ A;  4Z66 B;  3LJA C;  1T3U A;  3MGR B;  3REH A;  3B0C W;  3B6F D;  5BNV B;  3AYW B;  1P3B B;  3NQU B;  3O62 A;  3A1I A;  4WNN A;  4Z5T D;  2HIO B;  4J8V A;  3UT9 B;  4CAY A;  1P34 A;  3B0C T;  3UTA B;  5AY8 B;  1AOI B;  3MGR C;  2DF4 C;  2FJ7 A;  4DRA A;  3REJ B;  4DRB A;  1W2E A;  3C1B B;  5C3I C;  5E5A B;  5B1M B;  1BH9 B;  1P3G C;  4WU8 D;  2FJ7 C;  1B6W A;  1TZY C;  5AVC D;  4G91 C;  3REL C;  5BT1 C;  4G92 B;  3KXB A;  5F99 D;  4CSR B;  3REK B;  5BNX B;  2BYK B;  1EQZ A;  5AV5 D;  3AZK A;  5B40 A;  2Y2M A;  3W99 A;  1EQZ D;  4DQY B;  1JFI A;  3WTP B;  1P3G B;  2HIO C;  2YFV A;  3MGS A;  5AV8 B;  3WKJ D;  5CPJ C;  5B32 C;  5KDM B;  3LJA A;  3W96 A;  3X1V C;  3AN2 A;  3A1K A;  3MNN A;  4ZBJ B;  5DNN B;  3AN2 D;  3B6G B;  1P3P D;  3AZM D;  4ZUX D;  2JSS A;  3MNN D;  4E45 A;  1P34 D;  4AWL C;  5CP6 D;  5CPI B;  1P3K B;  2ARO C;  3W98 A;  5B1L B;  1F1E A;  1KU5 A;  3FDD A;  3LZ1 C;  3REI C;  2RVQ D;  3KWQ D;  3UTB A;  5B31 B;  2F8N D;  2W8S A;  1P3L D;  4EO5 C;  5GXQ A;  4LD9 A;  3AZL B;  3REI A;  3WAA C;  4J8W C;  3AZE B;  2Y2O A;  2ZY2 A;  3MVD B;  1P3A C;  3LZ1 B;  1P3O B;  3UTB C;  3MNN C;  2XD1 A;  5BNV A;  3C1C A;  2G5H C;  3W99 D;  3MGQ D;  1M19 B;  4H9P A;  3VH6 A;  5B24 C;  1P3F A;  3B6G C;  5GT3 B;  4XUJ B;  2HIO A;  3X1S B;  3MGS C;  4J8V B;  1KX5 D;  1PZR A;  3NQJ A;  1F66 C;  4J8X C;  2BYM A;  1KX5 A;  4G92 C;  3V9R A;  3AZI C;  5BS7 A;  1P3P A;  3AZM A;  3C1B A;  3AZH C;  2Y2Q A;  3W98 D;  3AZN B;  3R45 A;  4KUD B;  3AZJ B;  5AV8 C;  3W97 C;  3W99 C;  4YS3 D;  4WU9 C;  5BNX A;  3AZG A;  5GXQ D;  4LD9 D;  4HGA B;  3REI D;  3REL A;  5B0Z C;  4J8U D;  1P3G A;  2YFV B;  3MGS B;  2F8N H;  3AV2 D;  5AV8 A;  3O62 C;  4YM6 C;  3LZ0 A;  3W96 B;  3X1T D;  3AN2 B;  3MNN B;  3LZ0 D;  3AZM C;  5DNN A;  5CPK D;  2ZY4 A;  1P34 C;  3AZH B;  5CPI A;  5AV9 A;  5B1L A;  3AZF B;  3WA9 A;  3KSY A;  5AV5 C;  4Z2M H;  4QLC B;  4H9S C;  3W97 A;  3UTB B;  1R4V A;  2Y2K A;  3AZE D;  3TU4 D;  3AV2 C;  5FUG B;  4J8W D;  1KX3 B;  5B24 B;  3VH6 W;  1P3A A;  3AFA D;  2L5A A;  2NQB C;  3MGQ B;  1M1A A;  3WAA A;  4WV4 B;  4XZQ D;  2NZD A;  2CV5 A;  1P3O C;  5JRG A;  3H0L C;  2CV5 D;  4J8X D;  3H0M C;  2ARO A;  3MVD C;  2BYM B;  5JRG D;  5B0Z D;  3AZI D;  3LEL D;  1HTA A;  3B0D C;  4NE5 A;  5B31 C;  3AZN D;  2Y2I A;  5AV6 A;  5CP6 B;  5CPI D;  4WJ3 C;  3MGP D;  5CPJ A;  5AVC C;  1TZY D;  3WA9 D;  4ZBJ C;  1Q9C A;  4M6B A;  5AV6 D;  2ZY3 A;  1N1J A;  2XD5 A;  2YFW A;  3AV1 B;  5DNM D;  2PYO D;  4H9R B;  3TU4 A;  5B0Y A;  1KX4 A;  5AY8 C;  3REL B;  5B2J B;  1U35 C;  4KHA A;  3AV2 B;  1EQZ C;  4JJN D;  2PYO A;  1F66 D;  3KXB C;  3AFA A;  3O62 D;  4H9O A;  3X1V A;  4UPK A;  4Z5T A;  4R8P C;  3X1V D;  4XZQ A;  4G91 B;  2NZD D;  3AZH D;  4Z66 A;  3WA9 C;  2G5I C;  3MGR A;  3EPJ A;  3REK C;  3UT9 C;  2F2A C;  2FJ7 D;  1H3O A;  5GT0 C;  1ZLA C;  4QLC D;  2ARO D;  2J8P A;  5BT1 D;  5BO0 A;  3AZF A;  2RIQ A;  5DNN C;  4QLC A;  4WNN B;  4WU8 A;  3X1U D;  4UUZ B;  3W97 B;  1AOI D;  3REJ C;  2IO5 B;  1Z2C B;  3KXB D;  5B32 B;  1AOI A;  5FUG A;  1KX3 A;  2Y2G A;  5B40 D;  3WKJ C;  4H9Q A;  3REJ A;  2NQB D;  5JA4 B;  4WU8 C;  3AZJ C;  3WAA B;  3AZF C;  3AZG C;  4J8V C;  4E44 A;  4JJN A;  4CSR A;  3REK A;  1EQZ B;  3REH D;  4Z66 C;  5B0Z B;  3AZI B;  3KUY C;  4ZUX A;  4H9N A;  1JFI B;  3LEL C;  2LY8 A;  1HQ3 D;  2BG1 A;  3X1S C;  3MGR D;  4KUD C;  3MGP B;  3EPL A;  3B6F B;  5AV6 B;  5CHL B;  5B33 B;  1P3L A;  5B2I D;  1M18 D;  3AZF D;  1P3F C;  3B6G A;  3VH5 W;  5AVB B;  3X1U A;  4YS3 C;  5CP6 C;  3AV1 A;  3UT9 D;  4KGC C;  1P3K A;  4R8P B;  5AVC A;  5AY8 D;  3VH5 A;  4J8W B;  1KX3 D;  2IO5 C;  5B24 D;  5B2J A;  2Y2L A;  5F99 A;  5G49 B;  3AYW D;  5B31 A;  3AZL D;  1P3B D;  3REJ D;  3VH5 T;  2F8N G;  4X23 C;  3AZK D;  5B1M D;  5E5A D;  5B2J C;  1WWS A;  3X1V B;  1U35 B;  3A6N B;  5GSU A;  3MVD A;  5B32 G;  4XZQ B;  3AV1 C;  5GSU D;  3WTP C;  3REK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...