1KX3B

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3B00
3NQUA 3AZJA 3AZHA 3X1VA 3KWQB 1U35C 3MGRB 2NQBB 5AV9D 5B0ZD 3KUYC 3AZGA 1P3KA 4YS3B 5CPID 5AY8C 2HIOC 3O62B 5GXQD 4J8WD 5BS7A 5B2JA 4H9SA 3RELB 1M18B 5DNND 3AZFD 3WAAC 1H3OA 5AV6A 1P3PC 2IO5B 1P3MB 1B67A 3MGQC 4NE6A 3AZMB 3X1SC 5B33B 5B0YB 4J8VA 1P34D 5CPJC 3REKC 2YFWA 3MGPD 5CPKC 3AN2A 5AV9B 1F66D 4YM6A 5B0ZB 3W96C 5CPIB 3WKJD 5B32D 5GXQB 4J8WB 5CHLB 3V9RA 4WV4B 4ZUXD 1HQ3C 4J8UC 4JJND 3A6NA 4WU9A 4EO5B 1KX5A 3UT9D 4KUDD 3B0CW 2RVQD 5DNNB 3REJA 3AZFB 5B1MA 3AV2D 3C1CD 4CAYA 5JA4A 5GT0D 3REHA 5FUGB 5G49A 5AVBA 2CV5B 1Q9CA 1P3LC 5E5AC 4XZQD 1BH9A 1P34B 1BFMA 5B31G 3MGPB 1M1AD 3W99A 1P3OD 1KX3A 1F66B 1P3BA 3LZ1C 5AV5C 5BO0A 3B6FC 5CP6C 1P3AC 3WKJB 5B32B 3AZKC 1U35A 3LZ0D 1BH8B 4ZUXB 4JJNB 4CSRA 4Z2MH 4KUDB 3UT9B 1P3ID 2F8NH 4WNNB 3KUYA 1P3FC 3AV2B 3C1CB 5JRGC 2HIOA 3VH6A 5GT0B 3WTPC 4Z66C 3MVDC 5DNMA 3AV1C 3B6GC 3AZEC 3WAAA 4XZQB 5B31C 1P3PA 1ZLAD 1M1AB 1P3OB 3AZGD 1AOID 1TAFB 3REIC 3MGQA 2F8NA 3X1SA 1EQZC 4G91C 5CPJA 2AROD 3REKA 5F99D 3LZ0B 3KWQC 5CPKA 5KDMA 3MGRC 3TU4A 3AZLD 1P3IB 4WU8D 2NQBD 3B0BA 3VH6W 3O62C 2JSSA 4J8UA 1HQ3A 3AZNC 4AWLC 1N1JB 2FJ7C 3RELC 5BNXA 1M18C 2PYOC 2NZDD 4HGAB 1ZLAB 4H9PA 3AZGB 1AOIB 2L5AA 1P3MC 1TZYA 1P3LA 5E5AA 4WU9D 4H9QA 5B33C 5B0YC 2AROB 5F99B 3R45A 1H3OB 3VH5A 3AZLB 3WA9C 3LZ1A 5AV9C 4WU8B 5B0ZC 5AV5A 3B6FA 3WTPE 5CPIC 5CP6A 1P3AA 3AZKA 5GXQC 4J8WC 5B24D 5B32G 1JFIA 5DNMC 2YFWB 3W99D 5B1LD 4EO5C 1S32D 1P3FA 2NZDB 4LD9C 5DNNC 5AV8D 3LJAD 3B0DB 5JRGA 3AYWD 3WTPA 2F8NK 4Z66A 3MVDA 3AV1A 3B6GA 4G92B 3AZEA 3AFAD 4KHAA 5C3IC 5B31A 2CV5D 4WU9B 1P3GD 3KUYD 1R4VA 4QLCD 3REIA 3VH5W 5AY8D 5BNVA 2HIOD 5GT3D 3TU4C 1KX4C 1EQZA 3UTBD 4H9OA 5B2ID 1A7WA 3MNND 3KWQA 5B24B 3MGRA 4JJNC 1F1EA 3W99B 5B1LB 3C1BD 1S32B 4KUDC 3X1TD 3LJAB 5AV8B 3MGQD 4YS3A 3AV2C 4Z5TD 4J8XC 3AYWB 5GT0C 3O62A 5AVCC 3AZNA 3AFAB 3B0CT 3LELC 3RELA 2FJ7A 1M18A 2PYOA 3W97D 1TZYC 3AZID 1P3GB 4XZQC 3KUYB 3W96D 1M1AC 4QLCB 1P3MA 3UTAC 5AY8B 4XUJD 2HIOB 5GT3B 4KGCD 4X23D 3X1UD 3AZMA 5B33A 5B0YA 3UTBB 4DRBA 5B2IB 3MNNB 1ID3D 4M6BA 2BYKA 3C1BB 3WA9A 3KXBD 1HTAA 3X1TB 5AV9A 5B0ZA 3MGQB 4R8PC 3MGSD 5CPIA 4Z5TB 3W98D 5GXQA 4J8WA 5GSUD 5B40C 3AZJD 3AZHD 3X1VD 3W97B 4LD9A 5DNNA 3AZIB 3W96B 3LZ1D 1ZLAC 1P3KD 1AOIC 4XUJB 3NQJB 4KGCB 4X23B 4H9RB 3X1UB 4H9NB 1M19C 5B2JD 1P34A 5BNXB 2AROC 1ID3B 5F99C 5AV6D 3KXBB 3AZLC 4Z66D 1KX4A 4WU8C 3MGSB 2NQBC 4YS3C 1KU5A 5B32A 4NFTA 4UUZB 3W98B 5GSUB 4WZSB 2BYMB 4ZUXA 4JJNA 4KUDA 4J8VD 3NQUB 3AZJB 3AZHB 3X1VB 4ZBJB 4WNNA 3AV2A 3C1CA 3B0DC 4J8XA 3LZ1B 5GT0A 3AN2D 4YM6D 3VH6T 1P3KB 3B6FB 2IO5C 5AVCA 2YFVA 5BT1D 3LELA 4G92C 1B6WA 1JFIB 4XZQA 1KX5D 5B2JB 3A6ND 3AZMC 1M1AA 3REJD 3UTAA 1TAFA 5B1MD 5AV6B 4Z66B 4E44A 3REHD 3AZND 2FJ7D 5AVBD 2PYOD 5B24C 4J8VB 2HUEB 5B1LC 1S32C 3REIB 4R8PA 3LJAC 5AV8C 1KX3D 3AZFC 3AN2B 1P3BD 4YM6B 5B40A 4H9OB 1N1JA 3AFAC 1U35D 3V9RB 2CV5C 1KX5B 1P3GC 3WA9D 3A6NB 1ZLAA 1P34C 3REJB 1AOIA 4QLCC 3MGPC 5B1MB 5GT3C 4CAYB 5JA4B 3REHB 3AZNB 4AWLB 1F66C 5G49B 5DNMD 1M19A 2FJ7B 5AVBB 3UTBC 2AROA 2PYOB 4LD9D 5B2IC 5F99A 3WKJC 3MNNC 5B32C 3WAAD 2LY8A 3VH5T 4E45A 1BH9B 3AZLA 4ZUXC 1P3PD 3C1BC 3UT9C 4WU8A 3X1TC 2RVQC 1KX3B 2NQBA 4Z5TC 3C1CC 1P3BB 1WWIA 2F8ND 5BO0B 3X1SD 5CPJD 3REKD 4NE3A 1U35B 3W97C 2NZDA 2BYKB 3AZIC 5CPKD 3WA9B 4CSRB 3TU4D 1KX4D 1P3OC 4XUJC 4J8UD 4X23C 5DNMB 3X1UC 1HQ3D 4KGCC 4LD9B 4DRAA 1ID3C 3WAAB 4J8XD 3LZ0C 1P3PB 3KXBC 1ULYA 1P3IC 5AVCD 3MGSC 3LELD 5C3IB 1TZYD 2F8NB 3W98C 5B24A 5E5AD 3X1SB 5GSUC 1P3LD 5CPJB 5B1LA 1S32A 3REKB 3AZJC 3AZHC 3X1VC 3UTAD 4ZBJC 5AV8A 3LJAA 5CPKB 3AZFA 5KDMB 4HGAC 3TU4B 1KX4B 3AYWA 5AV5D 3AZGC 1P3KC 3B6FD 5CP6D 1P3AD 5FUGA 3AFAA 3AZKD 4J8UB 2CV5A 1HQ3B 1P3GA 5BS7C 5B2JC 4H9SC 4R8PD 1P3FD 4QLCA 3MGPA 4J8XB 5AY8A 5JRGD 5AV6C 5GT3A 4H9PB 3WTPD 5AVCB 1F66A 2YFVB 5B40D 3MVDD 3LELB 3AV1D 3UTBA 3B6GD 5B2IA 1TZYB 3AZED 3WKJA 3MNNA 1P3LB 5E5AB 5B31D 4H9QB 1BH8A 3C1BA 4J8VC 2HUEC 3UT9A 3UTAB 3R45B 3X1TA 3REID 2NZDC 4Z5TA 3AN2C 4YM6C 5AV5B 1M19D 5CP6B 4NE5A 1EQZD 1P3AB 5BT1C 3AZKB 3W97A 3KWQD 2CWEA 3AZIA 3MGRD 1KX5C 3A6NC 3W96A 4WU9C 4R8PB 1P3FB 3REJC 1P3OA 4XUJA 4YS3D 5B1MC 5JRGB 3AZMD 3WTPB 5B40B 3NQJA 3O62D 3MVDB 4KGCA 4X23A 4H9RA 3X1UA 3REHC 4H9NA 3AV1B 3B6GB 3AZEB 5AVBC 4KHAB 3RELD 1M18D 1ID3A 5B31B 3LZ0A 3KXBA 1P3IA 3W99C 1P3MD 3MGSA 1KX3C 5BNVB 1P3BC 3KSYA 4UUZA 4Z2MG 3W98A 3AYWC 1WWSA 5GSUA 1M19B 2BYMA 1EQZB 2F8NG 4G91B 5B33D 5B0YD
chains in the Genus database with same CATH superfamily
3NQUA 3AZJA 3AZHA 3X1VA 3KWQB 1U35C 3MGRB 2NQBB 5AV9D 5B0ZD 3KUYC 3AZGA 1P3KA 4YS3B 5CPID 5AY8C 2HIOC 3O62B 5GXQD 4J8WD 3AL0C 5BS7A 5B2JA 4H9SA 4DQYB 3RELB 1M18B 5DNND 3AZFD 3WAAC 1H3OA 5AV6A 1P3PC 2IO5B 1P3MB 2ZY3A 1B67A 3MGQC 4NE6A 2ZM5A 3AZMB 3X1SC 5B33B 5B0YB 4J8VA 1P34D 5CPJC 3REKC 2YFWA 3MGPD 3IP4C 5CPKC 3AN2A 5AV9B 1F66D 4YM6A 5B0ZB 3W96C 2Y2NA 5CPIB 3WKJD 5B32D 5GXQB 4J8WB 5CHLB 3V9RA 4WV4B 4ZUXD 1HQ3C 4J8UC 4JJND 3A6NA 4WU9A 4EO5B 1KX5A 3UT9D 4KUDD 3B0CW 2RVQD 5DNNB 3REJA 3AZFB 5B1MA 3AV2D 3C1CD 2JE5A 2Y2QA 2Y2LA 4CAYA 5JA4A 5GT0D 3REHA 5FUGB 5G49A 2UWXA 2VQRA 5AVBA 2CV5B 1Q9CA 1P3LC 5E5AC 4XZQD 1BH9A 3KFUG 1PZRA 1P34B 1BFMA 5B31G 3MGPB 1M1AD 3W99A 1P3OD 1KX3A 1F66B 1P3BA 3LZ1C 5AV5C 5BO0A 3B6FC 5CP6C 2J8PA 1P3AC 3WKJB 1Z2CB 5B32B 3AZKC 1U35A 3LZ0D 1BH8B 4ZUXB 4JJNB 4CSRA 4Z2MH 4KUDB 3UT9B 1P3ID 2F8NH 4WNNB 3KUYA 1P3FC 3AV2B 3C1CB 5JRGC 2HIOA 3VH6A 5GT0B 3WTPC 4Z66C 3MVDC 5DNMA 3AV1C 2ZY2A 3B6GC 3AZEC 3WAAA 4XZQB 5B31C 1P3PA 1ZLAD 1M1AB 1P3OB 3AZGD 1AOID 1TAFB 3REIC 3A1KA 3MGQA 2F8NA 3X1SA 1EQZC 4G91C 5CPJA 2AROD 3REKA 5F99D 3LZ0B 3KWQC 5CPKA 5KDMA 3MGRC 3TU4A 3AZLD 1P3IB 4WU8D 2NQBD 3B0BA 3VH6W 3O62C 2JSSA 4J8UA 1HQ3A 3AZNC 4AWLC 1N1JB 2FJ7C 3RELC 5BNXA 1M18C 2PYOC 2NZDD 4HGAB 1ZLAB 4H9PA 3AZGB 1AOIB 2L5AA 1P3MC 1TZYA 3H0RC 1P3LA 5E5AA 4WU9D 4H9QA 5B33C 5B0YC 2AROB 3EG5B 5F99B 3R45A 1H3OB 3VH5A 3AZLB 3WA9C 3LZ1A 5AV9C 4WU8B 2XD5A 5AV5A 5B0ZC 3B6FA 5CP6A 5CPIC 3WTPE 1P3AA 3AZKA 5GXQC 4J8WC 5B24D 5B32G 1JFIA 2ZY4A 5DNMC 2YFWB 3W99D 5B1LD 4EO5C 1S32D 1P3FA 2NZDB 4LD9C 5DNNC 5AV8D 3LJAD 3B0DB 5JRGA 3AYWD 3WTPA 2F8NK 4Z66A 3MVDA 3AV1A 3B6GA 4G92B 3AZEA 3AFAD 4KHAA 5C3IC 5B31A 2CV5D 4WU9B 1P3GD 3KUYD 1R4VA 4QLCD 3REIA 3VH5W 5AY8D 5BNVA 2HIOD 5GT3D 3TU4C 1KX4C 2DQNC 1EQZA 3UTBD 2BG1A 4H9OA 1A7WA 5B2ID 3MNND 3KWQA 5B24B 3MGRA 4JJNC 1F1EA 3W99B 5B1LB 3C1BD 1S32B 4KUDC 3X1TD 3LJAB 5AV8B 3MGQD 4YS3A 2G5HC 3AV2C 4Z5TD 4J8XC 3AYWB 2JCHA 5GT0C 3O62A 2Y2IA 5AVCC 3AZNA 3AFAB 3B0CT 3LELC 3RELA 2FJ7A 1M18A 2PYOA 3W97D 1T3UA 1TZYC 3AZID 1P3GB 4XZQC 3KUYB 3W96D 1M1AC 4QLCB 1P3MA 3UTAC 5AY8B 4XUJD 2HIOB 5GT3B 4KGCD 4X23D 3X1UD 3AZMA 5B33A 5B0YA 3UTBB 4DRBA 5B2IB 3MNNB 1ID3D 4M6BA 2ZY5A 2BYKA 3C1BB 3WA9A 3KXBD 1HTAA 3X1TB 5AV9A 5B0ZA 3MGQB 4R8PC 3MGSD 3EPLA 4Z5TB 5CPIA 3EPJA 3W98D 5GXQA 4J8WA 5GSUD 5B40C 3AZJD 3AZHD 3X1VD 3W97B 4LD9A 5DNNA 3AZIB 2W8SA 3W96B 3LZ1D 1ZLAC 1P3KD 1AOIC 4XUJB 3NQJB 4KGCB 4X23B 4H9RB 3X1UB 4H9NB 1M19C 5B2JD 1P34A 5BNXB 2AROC 1ID3B 5F99C 5AV6D 3KXBB 3AZLC 2Y2MA 4Z66D 1KX4A 4WU8C 3MGSB 2NQBC 4YS3C 1KU5A 5B32A 4NFTA 4UUZB 3W98B 3H0LC 5GSUB 2BYMB 4ZUXA 2Y2OA 4WZSB 4JJNA 4KUDA 4J8VD 3NQUB 3AZJB 3AZHB 3X1VB 4ZBJB 4WNNA 3AV2A 3C1CA 3B0DC 4J8XA 3LZ1B 5GT0A 3AN2D 3VH6T 4YM6D 1P3KB 3B6FB 2IO5C 5AVCA 2YFVA 5BT1D 3LELA 4G92C 1B6WA 1JFIB 4XZQA 1KX5D 5B2JB 3A6ND 3AZMC 1M1AA 3REJD 3UTAA 1TAFA 5B1MD 5AV6B 2RIQA 4Z66B 4E44A 3REHD 3AZND 2FJ7D 5AVBD 2PYOD 2Y2HA 5B24C 4J8VB 2HUEB 5B1LC 1S32C 3REIB 4R8PA 3LJAC 5AV8C 1KX3D 3AZFC 3AN2B 1P3BD 4YM6B 5B40A 3H0MC 4H9OB 1N1JA 3AFAC 1U35D 3V9RB 2CV5C 1KX5B 1P3GC 3WA9D 3A6NB 2FFFB 1ZLAA 2Y2KA 1P34C 3REJB 1AOIA 4QLCC 3MGPC 5B1MB 5GT3C 4CAYB 5JA4B 3REHB 3AZNB 4AWLB 1F66C 5G49B 5DNMD 1M19A 2FJ7B 5AVBB 3UTBC 2AROA 2PYOB 4LD9D 2Y2PA 5B2IC 5F99A 3WKJC 3MNNC 5B32C 3WAAD 2LY8A 3VH5T 4E45A 1BH9B 3AZLA 4ZUXC 1P3PD 3C1BC 3UT9C 4WU8A 3X1TC 2RVQC 1KX3B 2NQBA 4Z5TC 3C1CC 1P3BB 1WWIA 2F8ND 5BO0B 3F6TA 3X1SD 5CPJD 2Y2JA 3REKD 4NE3A 1U35B 3W97C 2NZDA 2BYKB 3AZIC 5CPKD 2Y2GA 4CSRB 3WA9B 3TU4D 1KX4D 2F2AC 1P3OC 4XUJC 4J8UD 4X23C 5DNMB 3X1UC 1HQ3D 4KGCC 4LD9B 4DRAA 1ID3C 3WAAB 4J8XD 3LZ0C 1P3PB 3KXBC 1ULYA 1P3IC 5AVCD 3MGSC 3LELD 5C3IB 1TZYD 2F8NB 3W98C 2DF4C 5B24A 5E5AD 3X1SB 5GSUC 1P3LD 5CPJB 5B1LA 1S32A 3REKB 3AZJC 3AZHC 3X1VC 3UTAD 4ZBJC 5AV8A 3LJAA 5CPKB 3AZFA 5KDMB 4HGAC 3TU4B 1KX4B 3AYWA 5AV5D 3AZGC 1P3KC 3B6FD 5CP6D 1P3AD 5FUGA 3AFAA 3AZKD 4J8UB 2CV5A 1HQ3B 1P3GA 5BS7C 5B2JC 4H9SC 4R8PD 1P3FD 4QLCA 3P5JB 3MGPA 4J8XB 5AY8A 2G5IC 5JRGD 5GT3A 5AV6C 4H9PB 3WTPD 5AVCB 1F66A 2YFVB 5B40D 3MVDD 2XD1A 3FDDA 3LELB 3AV1D 3UTBA 3B6GD 5B2IA 1TZYB 3AZED 3WKJA 3MNNA 1P3LB 5E5AB 5B31D 4H9QB 1BH8A 3EPKA 3C1BA 4J8VC 2HUEC 3UT9A 3UTAB 3R45B 3X1TA 3REID 2NZDC 4Z5TA 4WJ3C 3AN2C 4YM6C 5AV5B 1M19D 5CP6B 4NE5A 1EQZD 1P3AB 5BT1C 3AZKB 3W97A 3KWQD 2CWEA 3AZIA 3MGRD 1KX5C 3A6NC 3W96A 1W2EA 4WU9C 4R8PB 1P3FB 3EPHA 3REJC 1P3OA 4XUJA 4YS3D 5B1MC 5JRGB 3AZMD 3WTPB 5B40B 3NQJA 3O62D 3MVDB 4KGCA 4X23A 4H9RA 3X1UA 3REHC 4H9NA 3AV1B 3B6GB 3AZEB 5AVBC 4KHAB 3RELD 1M18D 1ID3A 5B31B 3LZ0A 3KXBA 1P3IA 3W99C 4UPKA 1P3MD 3MGSA 1KX3C 5BNVB 3A1IA 1P3BC 3KSYA 4UUZA 4Z2MG 3W98A 3AYWC 1WWSA 5GSUA 1M19B 2BYMA 1EQZB 2F8NG 4G91B 5B33D 5B0YD
chains in the Genus database with same CATH topology
3NQUA 3AZJA 3AZHA 3X1VA 3KWQB 1U35C 3MGRB 2NQBB 5AV9D 5B0ZD 3KUYC 3AZGA 1P3KA 4YS3B 5CPID 5AY8C 2HIOC 3O62B 5GXQD 4J8WD 3AL0C 5BS7A 5B2JA 4H9SA 4DQYB 3RELB 1M18B 5DNND 3AZFD 3WAAC 1H3OA 5AV6A 1P3PC 2IO5B 1P3MB 2ZY3A 1B67A 3MGQC 4NE6A 2ZM5A 3AZMB 3X1SC 5B33B 5B0YB 4J8VA 1P34D 5CPJC 3REKC 2YFWA 3MGPD 3IP4C 5CPKC 3AN2A 5AV9B 1F66D 4YM6A 5B0ZB 3W96C 2Y2NA 5CPIB 3WKJD 5B32D 5GXQB 4J8WB 5CHLB 3V9RA 4WV4B 4ZUXD 1HQ3C 4J8UC 4JJND 3A6NA 4WU9A 4EO5B 1KX5A 3UT9D 4KUDD 3B0CW 2RVQD 5DNNB 3REJA 3AZFB 5B1MA 3AV2D 3C1CD 2JE5A 2Y2QA 2Y2LA 4CAYA 5JA4A 5GT0D 3REHA 5FUGB 5G49A 2UWXA 2VQRA 5AVBA 2CV5B 1Q9CA 1P3LC 5E5AC 4XZQD 1BH9A 3KFUG 1PZRA 1P34B 1BFMA 5B31G 3MGPB 1M1AD 3W99A 1P3OD 1KX3A 1F66B 1P3BA 3LZ1C 5AV5C 5BO0A 3B6FC 5CP6C 2J8PA 1P3AC 3WKJB 1Z2CB 5B32B 3AZKC 1U35A 3LZ0D 1BH8B 4ZUXB 4JJNB 4CSRA 4Z2MH 4KUDB 3UT9B 1P3ID 2F8NH 4WNNB 3KUYA 1P3FC 3AV2B 3C1CB 5JRGC 2HIOA 3VH6A 5GT0B 3WTPC 4Z66C 3MVDC 5DNMA 3AV1C 2ZY2A 3B6GC 3AZEC 3WAAA 4XZQB 5B31C 1P3PA 1ZLAD 1M1AB 1P3OB 3AZGD 1AOID 1TAFB 3REIC 3A1KA 3MGQA 2F8NA 3X1SA 1EQZC 4G91C 5CPJA 2AROD 3REKA 5F99D 3LZ0B 3KWQC 5CPKA 5KDMA 3MGRC 3TU4A 3AZLD 1P3IB 4WU8D 2NQBD 3B0BA 3VH6W 3O62C 2JSSA 4J8UA 1HQ3A 3AZNC 4AWLC 1N1JB 2FJ7C 3RELC 5BNXA 1M18C 2PYOC 2NZDD 4HGAB 1ZLAB 4H9PA 3AZGB 1AOIB 2L5AA 1P3MC 1TZYA 3H0RC 1P3LA 5E5AA 4WU9D 4H9QA 5B33C 5B0YC 2AROB 3EG5B 5F99B 3R45A 1H3OB 3VH5A 3AZLB 3WA9C 3LZ1A 5AV9C 4WU8B 2XD5A 5AV5A 5B0ZC 3B6FA 5CP6A 5CPIC 3WTPE 1P3AA 3AZKA 5GXQC 4J8WC 5B24D 5B32G 1JFIA 2ZY4A 5DNMC 2YFWB 3W99D 5B1LD 4EO5C 1S32D 1P3FA 2NZDB 4LD9C 5DNNC 5AV8D 3LJAD 3B0DB 5JRGA 3AYWD 3WTPA 2F8NK 4Z66A 3MVDA 3AV1A 3B6GA 4G92B 3AZEA 3AFAD 4KHAA 5C3IC 5B31A 2CV5D 4WU9B 1P3GD 3KUYD 1R4VA 4QLCD 3REIA 3VH5W 5AY8D 5BNVA 2HIOD 5GT3D 3TU4C 1KX4C 2DQNC 1EQZA 3UTBD 2BG1A 4H9OA 1A7WA 5B2ID 3MNND 3KWQA 5B24B 3MGRA 4JJNC 1F1EA 3W99B 5B1LB 3C1BD 1S32B 4KUDC 3X1TD 3LJAB 5AV8B 3MGQD 4YS3A 2G5HC 3AV2C 4Z5TD 4J8XC 3AYWB 2JCHA 5GT0C 3O62A 2Y2IA 5AVCC 3AZNA 3AFAB 3B0CT 3LELC 3RELA 2FJ7A 1M18A 2PYOA 3W97D 1T3UA 1TZYC 3AZID 1P3GB 4XZQC 3KUYB 3W96D 1M1AC 4QLCB 1P3MA 3UTAC 5AY8B 4XUJD 2HIOB 5GT3B 4KGCD 4X23D 3X1UD 3AZMA 5B33A 5B0YA 3UTBB 4DRBA 5B2IB 3MNNB 1ID3D 4M6BA 2ZY5A 2BYKA 3C1BB 3WA9A 3KXBD 1HTAA 3X1TB 5AV9A 5B0ZA 3MGQB 4R8PC 3MGSD 3EPLA 4Z5TB 5CPIA 3EPJA 3W98D 5GXQA 4J8WA 5GSUD 5B40C 3AZJD 3AZHD 3X1VD 3W97B 4LD9A 5DNNA 3AZIB 2W8SA 3W96B 3LZ1D 1ZLAC 1P3KD 1AOIC 4XUJB 3NQJB 4KGCB 4X23B 4H9RB 3X1UB 4H9NB 1M19C 5B2JD 1P34A 5BNXB 2AROC 1ID3B 5F99C 5AV6D 3KXBB 3AZLC 2Y2MA 4Z66D 1KX4A 4WU8C 3MGSB 2NQBC 4YS3C 1KU5A 5B32A 4NFTA 4UUZB 3W98B 3H0LC 5GSUB 2BYMB 4ZUXA 2Y2OA 4WZSB 4JJNA 4KUDA 4J8VD 3NQUB 3AZJB 3AZHB 3X1VB 4ZBJB 4WNNA 3AV2A 3C1CA 3B0DC 4J8XA 3LZ1B 5GT0A 3AN2D 3VH6T 4YM6D 1P3KB 3B6FB 2IO5C 5AVCA 2YFVA 5BT1D 3LELA 4G92C 1B6WA 1JFIB 4XZQA 1KX5D 5B2JB 3A6ND 3AZMC 1M1AA 3REJD 3UTAA 1TAFA 5B1MD 5AV6B 2RIQA 4Z66B 4E44A 3REHD 3AZND 2FJ7D 5AVBD 2PYOD 2Y2HA 5B24C 4J8VB 2HUEB 5B1LC 1S32C 3REIB 4R8PA 3LJAC 5AV8C 1KX3D 3AZFC 3AN2B 1P3BD 4YM6B 5B40A 3H0MC 4H9OB 1N1JA 3AFAC 1U35D 3V9RB 2CV5C 1KX5B 1P3GC 3WA9D 3A6NB 2FFFB 1ZLAA 2Y2KA 1P34C 3REJB 1AOIA 4QLCC 3MGPC 5B1MB 5GT3C 4CAYB 5JA4B 3REHB 3AZNB 4AWLB 1F66C 5G49B 5DNMD 1M19A 2FJ7B 5AVBB 3UTBC 2AROA 2PYOB 4LD9D 2Y2PA 5B2IC 5F99A 3WKJC 3MNNC 5B32C 3WAAD 2LY8A 3VH5T 4E45A 1BH9B 3AZLA 4ZUXC 1P3PD 3C1BC 3UT9C 4WU8A 3X1TC 2RVQC 1KX3B 2NQBA 4Z5TC 3C1CC 1P3BB 1WWIA 2F8ND 5BO0B 3F6TA 3X1SD 5CPJD 2Y2JA 3REKD 4NE3A 1U35B 3W97C 2NZDA 2BYKB 3AZIC 5CPKD 2Y2GA 4CSRB 3WA9B 3TU4D 1KX4D 2F2AC 1P3OC 4XUJC 4J8UD 4X23C 5DNMB 3X1UC 1HQ3D 4KGCC 4LD9B 4DRAA 1ID3C 3WAAB 4J8XD 3LZ0C 1P3PB 3KXBC 1ULYA 1P3IC 5AVCD 3MGSC 3LELD 5C3IB 1TZYD 2F8NB 3W98C 2DF4C 5B24A 5E5AD 3X1SB 5GSUC 1P3LD 5CPJB 5B1LA 1S32A 3REKB 3AZJC 3AZHC 3X1VC 3UTAD 4ZBJC 5AV8A 3LJAA 5CPKB 3AZFA 5KDMB 4HGAC 3TU4B 1KX4B 3AYWA 5AV5D 3AZGC 1P3KC 3B6FD 5CP6D 1P3AD 5FUGA 3AFAA 3AZKD 4J8UB 2CV5A 1HQ3B 1P3GA 5BS7C 5B2JC 4H9SC 4R8PD 1P3FD 4QLCA 3P5JB 3MGPA 4J8XB 5AY8A 2G5IC 5JRGD 5GT3A 5AV6C 4H9PB 3WTPD 5AVCB 1F66A 2YFVB 5B40D 3MVDD 2XD1A 3FDDA 3LELB 3AV1D 3UTBA 3B6GD 5B2IA 1TZYB 3AZED 3WKJA 3MNNA 1P3LB 5E5AB 5B31D 4H9QB 1BH8A 3EPKA 3C1BA 4J8VC 2HUEC 3UT9A 3UTAB 3R45B 3X1TA 3REID 2NZDC 4Z5TA 4WJ3C 3AN2C 4YM6C 5AV5B 1M19D 5CP6B 4NE5A 1EQZD 1P3AB 5BT1C 3AZKB 3W97A 3KWQD 2CWEA 3AZIA 3MGRD 1KX5C 3A6NC 3W96A 1W2EA 4WU9C 4R8PB 1P3FB 3EPHA 3REJC 1P3OA 4XUJA 4YS3D 5B1MC 5JRGB 3AZMD 3WTPB 5B40B 3NQJA 3O62D 3MVDB 4KGCA 4X23A 4H9RA 3X1UA 3REHC 4H9NA 3AV1B 3B6GB 3AZEB 5AVBC 4KHAB 3RELD 1M18D 1ID3A 5B31B 3LZ0A 3KXBA 1P3IA 3W99C 4UPKA 1P3MD 3MGSA 1KX3C 5BNVB 3A1IA 1P3BC 3KSYA 4UUZA 4Z2MG 3W98A 3AYWC 1WWSA 5GSUA 1M19B 2BYMA 1EQZB 2F8NG 4G91B 5B33D 5B0YD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  3AZJ A;  3AZH A;  3X1V A;  3KWQ B;  1U35 C;  3MGR B;  2NQB B;  5AV9 D;  5B0Z D;  3KUY C;  3AZG A;  1P3K A;  4YS3 B;  5CPI D;  5AY8 C;  2HIO C;  3O62 B;  5GXQ D;  4J8W D;  5BS7 A;  5B2J A;  4H9S A;  3REL B;  1M18 B;  5DNN D;  3AZF D;  3WAA C;  1H3O A;  5AV6 A;  1P3P C;  2IO5 B;  1P3M B;  1B67 A;  3MGQ C;  4NE6 A;  3AZM B;  3X1S C;  5B33 B;  5B0Y B;  4J8V A;  1P34 D;  5CPJ C;  3REK C;  2YFW A;  3MGP D;  5CPK C;  3AN2 A;  5AV9 B;  1F66 D;  4YM6 A;  5B0Z B;  3W96 C;  5CPI B;  3WKJ D;  5B32 D;  5GXQ B;  4J8W B;  5CHL B;  3V9R A;  4WV4 B;  4ZUX D;  1HQ3 C;  4J8U C;  4JJN D;  3A6N A;  4WU9 A;  4EO5 B;  1KX5 A;  3UT9 D;  4KUD D;  3B0C W;  2RVQ D;  5DNN B;  3REJ A;  3AZF B;  5B1M A;  3AV2 D;  3C1C D;  4CAY A;  5JA4 A;  5GT0 D;  3REH A;  5FUG B;  5G49 A;  5AVB A;  2CV5 B;  1Q9C A;  1P3L C;  5E5A C;  4XZQ D;  1BH9 A;  1P34 B;  1BFM A;  5B31 G;  3MGP B;  1M1A D;  3W99 A;  1P3O D;  1KX3 A;  1F66 B;  1P3B A;  3LZ1 C;  5AV5 C;  5BO0 A;  3B6F C;  5CP6 C;  1P3A C;  3WKJ B;  5B32 B;  3AZK C;  1U35 A;  3LZ0 D;  1BH8 B;  4ZUX B;  4JJN B;  4CSR A;  4Z2M H;  4KUD B;  3UT9 B;  1P3I D;  2F8N H;  4WNN B;  3KUY A;  1P3F C;  3AV2 B;  3C1C B;  5JRG C;  2HIO A;  3VH6 A;  5GT0 B;  3WTP C;  4Z66 C;  3MVD C;  5DNM A;  3AV1 C;  3B6G C;  3AZE C;  3WAA A;  4XZQ B;  5B31 C;  1P3P A;  1ZLA D;  1M1A B;  1P3O B;  3AZG D;  1AOI D;  1TAF B;  3REI C;  3MGQ A;  2F8N A;  3X1S A;  1EQZ C;  4G91 C;  5CPJ A;  2ARO D;  3REK A;  5F99 D;  3LZ0 B;  3KWQ C;  5CPK A;  5KDM A;  3MGR C;  3TU4 A;  3AZL D;  1P3I B;  4WU8 D;  2NQB D;  3B0B A;  3VH6 W;  3O62 C;  2JSS A;  4J8U A;  1HQ3 A;  3AZN C;  4AWL C;  1N1J B;  2FJ7 C;  3REL C;  5BNX A;  1M18 C;  2PYO C;  2NZD D;  4HGA B;  1ZLA B;  4H9P A;  3AZG B;  1AOI B;  2L5A A;  1P3M C;  1TZY A;  1P3L A;  5E5A A;  4WU9 D;  4H9Q A;  5B33 C;  5B0Y C;  2ARO B;  5F99 B;  3R45 A;  1H3O B;  3VH5 A;  3AZL B;  3WA9 C;  3LZ1 A;  5AV9 C;  4WU8 B;  5B0Z C;  5AV5 A;  3B6F A;  3WTP E;  5CPI C;  5CP6 A;  1P3A A;  3AZK A;  5GXQ C;  4J8W C;  5B24 D;  5B32 G;  1JFI A;  5DNM C;  2YFW B;  3W99 D;  5B1L D;  4EO5 C;  1S32 D;  1P3F A;  2NZD B;  4LD9 C;  5DNN C;  5AV8 D;  3LJA D;  3B0D B;  5JRG A;  3AYW D;  3WTP A;  2F8N K;  4Z66 A;  3MVD A;  3AV1 A;  3B6G A;  4G92 B;  3AZE A;  3AFA D;  4KHA A;  5C3I C;  5B31 A;  2CV5 D;  4WU9 B;  1P3G D;  3KUY D;  1R4V A;  4QLC D;  3REI A;  3VH5 W;  5AY8 D;  5BNV A;  2HIO D;  5GT3 D;  3TU4 C;  1KX4 C;  1EQZ A;  3UTB D;  4H9O A;  5B2I D;  1A7W A;  3MNN D;  3KWQ A;  5B24 B;  3MGR A;  4JJN C;  1F1E A;  3W99 B;  5B1L B;  3C1B D;  1S32 B;  4KUD C;  3X1T D;  3LJA B;  5AV8 B;  3MGQ D;  4YS3 A;  3AV2 C;  4Z5T D;  4J8X C;  3AYW B;  5GT0 C;  3O62 A;  5AVC C;  3AZN A;  3AFA B;  3B0C T;  3LEL C;  3REL A;  2FJ7 A;  1M18 A;  2PYO A;  3W97 D;  1TZY C;  3AZI D;  1P3G B;  4XZQ C;  3KUY B;  3W96 D;  1M1A C;  4QLC B;  1P3M A;  3UTA C;  5AY8 B;  4XUJ D;  2HIO B;  5GT3 B;  4KGC D;  4X23 D;  3X1U D;  3AZM A;  5B33 A;  5B0Y A;  3UTB B;  4DRB A;  5B2I B;  3MNN B;  1ID3 D;  4M6B A;  2BYK A;  3C1B B;  3WA9 A;  3KXB D;  1HTA A;  3X1T B;  5AV9 A;  5B0Z A;  3MGQ B;  4R8P C;  3MGS D;  5CPI A;  4Z5T B;  3W98 D;  5GXQ A;  4J8W A;  5GSU D;  5B40 C;  3AZJ D;  3AZH D;  3X1V D;  3W97 B;  4LD9 A;  5DNN A;  3AZI B;  3W96 B;  3LZ1 D;  1ZLA C;  1P3K D;  1AOI C;  4XUJ B;  3NQJ B;  4KGC B;  4X23 B;  4H9R B;  3X1U B;  4H9N B;  1M19 C;  5B2J D;  1P34 A;  5BNX B;  2ARO C;  1ID3 B;  5F99 C;  5AV6 D;  3KXB B;  3AZL C;  4Z66 D;  1KX4 A;  4WU8 C;  3MGS B;  2NQB C;  4YS3 C;  1KU5 A;  5B32 A;  4NFT A;  4UUZ B;  3W98 B;  5GSU B;  4WZS B;  2BYM B;  4ZUX A;  4JJN A;  4KUD A;  4J8V D;  3NQU B;  3AZJ B;  3AZH B;  3X1V B;  4ZBJ B;  4WNN A;  3AV2 A;  3C1C A;  3B0D C;  4J8X A;  3LZ1 B;  5GT0 A;  3AN2 D;  4YM6 D;  3VH6 T;  1P3K B;  3B6F B;  2IO5 C;  5AVC A;  2YFV A;  5BT1 D;  3LEL A;  4G92 C;  1B6W A;  1JFI B;  4XZQ A;  1KX5 D;  5B2J B;  3A6N D;  3AZM C;  1M1A A;  3REJ D;  3UTA A;  1TAF A;  5B1M D;  5AV6 B;  4Z66 B;  4E44 A;  3REH D;  3AZN D;  2FJ7 D;  5AVB D;  2PYO D;  5B24 C;  4J8V B;  2HUE B;  5B1L C;  1S32 C;  3REI B;  4R8P A;  3LJA C;  5AV8 C;  1KX3 D;  3AZF C;  3AN2 B;  1P3B D;  4YM6 B;  5B40 A;  4H9O B;  1N1J A;  3AFA C;  1U35 D;  3V9R B;  2CV5 C;  1KX5 B;  1P3G C;  3WA9 D;  3A6N B;  1ZLA A;  1P34 C;  3REJ B;  1AOI A;  4QLC C;  3MGP C;  5B1M B;  5GT3 C;  4CAY B;  5JA4 B;  3REH B;  3AZN B;  4AWL B;  1F66 C;  5G49 B;  5DNM D;  1M19 A;  2FJ7 B;  5AVB B;  3UTB C;  2ARO A;  2PYO B;  4LD9 D;  5B2I C;  5F99 A;  3WKJ C;  3MNN C;  5B32 C;  3WAA D;  2LY8 A;  3VH5 T;  4E45 A;  1BH9 B;  3AZL A;  4ZUX C;  1P3P D;  3C1B C;  3UT9 C;  4WU8 A;  3X1T C;  2RVQ C;  1KX3 B;  2NQB A;  4Z5T C;  3C1C C;  1P3B B;  1WWI A;  2F8N D;  5BO0 B;  3X1S D;  5CPJ D;  3REK D;  4NE3 A;  1U35 B;  3W97 C;  2NZD A;  2BYK B;  3AZI C;  5CPK D;  3WA9 B;  4CSR B;  3TU4 D;  1KX4 D;  1P3O C;  4XUJ C;  4J8U D;  4X23 C;  5DNM B;  3X1U C;  1HQ3 D;  4KGC C;  4LD9 B;  4DRA A;  1ID3 C;  3WAA B;  4J8X D;  3LZ0 C;  1P3P B;  3KXB C;  1ULY A;  1P3I C;  5AVC D;  3MGS C;  3LEL D;  5C3I B;  1TZY D;  2F8N B;  3W98 C;  5B24 A;  5E5A D;  3X1S B;  5GSU C;  1P3L D;  5CPJ B;  5B1L A;  1S32 A;  3REK B;  3AZJ C;  3AZH C;  3X1V C;  3UTA D;  4ZBJ C;  5AV8 A;  3LJA A;  5CPK B;  3AZF A;  5KDM B;  4HGA C;  3TU4 B;  1KX4 B;  3AYW A;  5AV5 D;  3AZG C;  1P3K C;  3B6F D;  5CP6 D;  1P3A D;  5FUG A;  3AFA A;  3AZK D;  4J8U B;  2CV5 A;  1HQ3 B;  1P3G A;  5BS7 C;  5B2J C;  4H9S C;  4R8P D;  1P3F D;  4QLC A;  3MGP A;  4J8X B;  5AY8 A;  5JRG D;  5AV6 C;  5GT3 A;  4H9P B;  3WTP D;  5AVC B;  1F66 A;  2YFV B;  5B40 D;  3MVD D;  3LEL B;  3AV1 D;  3UTB A;  3B6G D;  5B2I A;  1TZY B;  3AZE D;  3WKJ A;  3MNN A;  1P3L B;  5E5A B;  5B31 D;  4H9Q B;  1BH8 A;  3C1B A;  4J8V C;  2HUE C;  3UT9 A;  3UTA B;  3R45 B;  3X1T A;  3REI D;  2NZD C;  4Z5T A;  3AN2 C;  4YM6 C;  5AV5 B;  1M19 D;  5CP6 B;  4NE5 A;  1EQZ D;  1P3A B;  5BT1 C;  3AZK B;  3W97 A;  3KWQ D;  2CWE A;  3AZI A;  3MGR D;  1KX5 C;  3A6N C;  3W96 A;  4WU9 C;  4R8P B;  1P3F B;  3REJ C;  1P3O A;  4XUJ A;  4YS3 D;  5B1M C;  5JRG B;  3AZM D;  3WTP B;  5B40 B;  3NQJ A;  3O62 D;  3MVD B;  4KGC A;  4X23 A;  4H9R A;  3X1U A;  3REH C;  4H9N A;  3AV1 B;  3B6G B;  3AZE B;  5AVB C;  4KHA B;  3REL D;  1M18 D;  1ID3 A;  5B31 B;  3LZ0 A;  3KXB A;  1P3I A;  3W99 C;  1P3M D;  3MGS A;  1KX3 C;  5BNV B;  1P3B C;  3KSY A;  4UUZ A;  4Z2M G;  3W98 A;  3AYW C;  1WWS A;  5GSU A;  1M19 B;  2BYM A;  1EQZ B;  2F8N G;  4G91 B;  5B33 D;  5B0Y D; 
#chains in the Genus database with same CATH topology
 3NQU A;  3AZJ A;  3AZH A;  3X1V A;  3KWQ B;  1U35 C;  3MGR B;  2NQB B;  5AV9 D;  5B0Z D;  3KUY C;  3AZG A;  1P3K A;  4YS3 B;  5CPI D;  5AY8 C;  2HIO C;  3O62 B;  5GXQ D;  4J8W D;  3AL0 C;  5BS7 A;  5B2J A;  4H9S A;  4DQY B;  3REL B;  1M18 B;  5DNN D;  3AZF D;  3WAA C;  1H3O A;  5AV6 A;  1P3P C;  2IO5 B;  1P3M B;  2ZY3 A;  1B67 A;  3MGQ C;  4NE6 A;  2ZM5 A;  3AZM B;  3X1S C;  5B33 B;  5B0Y B;  4J8V A;  1P34 D;  5CPJ C;  3REK C;  2YFW A;  3MGP D;  3IP4 C;  5CPK C;  3AN2 A;  5AV9 B;  1F66 D;  4YM6 A;  5B0Z B;  3W96 C;  2Y2N A;  5CPI B;  3WKJ D;  5B32 D;  5GXQ B;  4J8W B;  5CHL B;  3V9R A;  4WV4 B;  4ZUX D;  1HQ3 C;  4J8U C;  4JJN D;  3A6N A;  4WU9 A;  4EO5 B;  1KX5 A;  3UT9 D;  4KUD D;  3B0C W;  2RVQ D;  5DNN B;  3REJ A;  3AZF B;  5B1M A;  3AV2 D;  3C1C D;  2JE5 A;  2Y2Q A;  2Y2L A;  4CAY A;  5JA4 A;  5GT0 D;  3REH A;  5FUG B;  5G49 A;  2UWX A;  2VQR A;  5AVB A;  2CV5 B;  1Q9C A;  1P3L C;  5E5A C;  4XZQ D;  1BH9 A;  3KFU G;  1PZR A;  1P34 B;  1BFM A;  5B31 G;  3MGP B;  1M1A D;  3W99 A;  1P3O D;  1KX3 A;  1F66 B;  1P3B A;  3LZ1 C;  5AV5 C;  5BO0 A;  3B6F C;  5CP6 C;  2J8P A;  1P3A C;  3WKJ B;  1Z2C B;  5B32 B;  3AZK C;  1U35 A;  3LZ0 D;  1BH8 B;  4ZUX B;  4JJN B;  4CSR A;  4Z2M H;  4KUD B;  3UT9 B;  1P3I D;  2F8N H;  4WNN B;  3KUY A;  1P3F C;  3AV2 B;  3C1C B;  5JRG C;  2HIO A;  3VH6 A;  5GT0 B;  3WTP C;  4Z66 C;  3MVD C;  5DNM A;  3AV1 C;  2ZY2 A;  3B6G C;  3AZE C;  3WAA A;  4XZQ B;  5B31 C;  1P3P A;  1ZLA D;  1M1A B;  1P3O B;  3AZG D;  1AOI D;  1TAF B;  3REI C;  3A1K A;  3MGQ A;  2F8N A;  3X1S A;  1EQZ C;  4G91 C;  5CPJ A;  2ARO D;  3REK A;  5F99 D;  3LZ0 B;  3KWQ C;  5CPK A;  5KDM A;  3MGR C;  3TU4 A;  3AZL D;  1P3I B;  4WU8 D;  2NQB D;  3B0B A;  3VH6 W;  3O62 C;  2JSS A;  4J8U A;  1HQ3 A;  3AZN C;  4AWL C;  1N1J B;  2FJ7 C;  3REL C;  5BNX A;  1M18 C;  2PYO C;  2NZD D;  4HGA B;  1ZLA B;  4H9P A;  3AZG B;  1AOI B;  2L5A A;  1P3M C;  1TZY A;  3H0R C;  1P3L A;  5E5A A;  4WU9 D;  4H9Q A;  5B33 C;  5B0Y C;  2ARO B;  3EG5 B;  5F99 B;  3R45 A;  1H3O B;  3VH5 A;  3AZL B;  3WA9 C;  3LZ1 A;  5AV9 C;  4WU8 B;  2XD5 A;  5AV5 A;  5B0Z C;  3B6F A;  5CP6 A;  5CPI C;  3WTP E;  1P3A A;  3AZK A;  5GXQ C;  4J8W C;  5B24 D;  5B32 G;  1JFI A;  2ZY4 A;  5DNM C;  2YFW B;  3W99 D;  5B1L D;  4EO5 C;  1S32 D;  1P3F A;  2NZD B;  4LD9 C;  5DNN C;  5AV8 D;  3LJA D;  3B0D B;  5JRG A;  3AYW D;  3WTP A;  2F8N K;  4Z66 A;  3MVD A;  3AV1 A;  3B6G A;  4G92 B;  3AZE A;  3AFA D;  4KHA A;  5C3I C;  5B31 A;  2CV5 D;  4WU9 B;  1P3G D;  3KUY D;  1R4V A;  4QLC D;  3REI A;  3VH5 W;  5AY8 D;  5BNV A;  2HIO D;  5GT3 D;  3TU4 C;  1KX4 C;  2DQN C;  1EQZ A;  3UTB D;  2BG1 A;  4H9O A;  1A7W A;  5B2I D;  3MNN D;  3KWQ A;  5B24 B;  3MGR A;  4JJN C;  1F1E A;  3W99 B;  5B1L B;  3C1B D;  1S32 B;  4KUD C;  3X1T D;  3LJA B;  5AV8 B;  3MGQ D;  4YS3 A;  2G5H C;  3AV2 C;  4Z5T D;  4J8X C;  3AYW B;  2JCH A;  5GT0 C;  3O62 A;  2Y2I A;  5AVC C;  3AZN A;  3AFA B;  3B0C T;  3LEL C;  3REL A;  2FJ7 A;  1M18 A;  2PYO A;  3W97 D;  1T3U A;  1TZY C;  3AZI D;  1P3G B;  4XZQ C;  3KUY B;  3W96 D;  1M1A C;  4QLC B;  1P3M A;  3UTA C;  5AY8 B;  4XUJ D;  2HIO B;  5GT3 B;  4KGC D;  4X23 D;  3X1U D;  3AZM A;  5B33 A;  5B0Y A;  3UTB B;  4DRB A;  5B2I B;  3MNN B;  1ID3 D;  4M6B A;  2ZY5 A;  2BYK A;  3C1B B;  3WA9 A;  3KXB D;  1HTA A;  3X1T B;  5AV9 A;  5B0Z A;  3MGQ B;  4R8P C;  3MGS D;  3EPL A;  4Z5T B;  5CPI A;  3EPJ A;  3W98 D;  5GXQ A;  4J8W A;  5GSU D;  5B40 C;  3AZJ D;  3AZH D;  3X1V D;  3W97 B;  4LD9 A;  5DNN A;  3AZI B;  2W8S A;  3W96 B;  3LZ1 D;  1ZLA C;  1P3K D;  1AOI C;  4XUJ B;  3NQJ B;  4KGC B;  4X23 B;  4H9R B;  3X1U B;  4H9N B;  1M19 C;  5B2J D;  1P34 A;  5BNX B;  2ARO C;  1ID3 B;  5F99 C;  5AV6 D;  3KXB B;  3AZL C;  2Y2M A;  4Z66 D;  1KX4 A;  4WU8 C;  3MGS B;  2NQB C;  4YS3 C;  1KU5 A;  5B32 A;  4NFT A;  4UUZ B;  3W98 B;  3H0L C;  5GSU B;  2BYM B;  4ZUX A;  2Y2O A;  4WZS B;  4JJN A;  4KUD A;  4J8V D;  3NQU B;  3AZJ B;  3AZH B;  3X1V B;  4ZBJ B;  4WNN A;  3AV2 A;  3C1C A;  3B0D C;  4J8X A;  3LZ1 B;  5GT0 A;  3AN2 D;  3VH6 T;  4YM6 D;  1P3K B;  3B6F B;  2IO5 C;  5AVC A;  2YFV A;  5BT1 D;  3LEL A;  4G92 C;  1B6W A;  1JFI B;  4XZQ A;  1KX5 D;  5B2J B;  3A6N D;  3AZM C;  1M1A A;  3REJ D;  3UTA A;  1TAF A;  5B1M D;  5AV6 B;  2RIQ A;  4Z66 B;  4E44 A;  3REH D;  3AZN D;  2FJ7 D;  5AVB D;  2PYO D;  2Y2H A;  5B24 C;  4J8V B;  2HUE B;  5B1L C;  1S32 C;  3REI B;  4R8P A;  3LJA C;  5AV8 C;  1KX3 D;  3AZF C;  3AN2 B;  1P3B D;  4YM6 B;  5B40 A;  3H0M C;  4H9O B;  1N1J A;  3AFA C;  1U35 D;  3V9R B;  2CV5 C;  1KX5 B;  1P3G C;  3WA9 D;  3A6N B;  2FFF B;  1ZLA A;  2Y2K A;  1P34 C;  3REJ B;  1AOI A;  4QLC C;  3MGP C;  5B1M B;  5GT3 C;  4CAY B;  5JA4 B;  3REH B;  3AZN B;  4AWL B;  1F66 C;  5G49 B;  5DNM D;  1M19 A;  2FJ7 B;  5AVB B;  3UTB C;  2ARO A;  2PYO B;  4LD9 D;  2Y2P A;  5B2I C;  5F99 A;  3WKJ C;  3MNN C;  5B32 C;  3WAA D;  2LY8 A;  3VH5 T;  4E45 A;  1BH9 B;  3AZL A;  4ZUX C;  1P3P D;  3C1B C;  3UT9 C;  4WU8 A;  3X1T C;  2RVQ C;  1KX3 B;  2NQB A;  4Z5T C;  3C1C C;  1P3B B;  1WWI A;  2F8N D;  5BO0 B;  3F6T A;  3X1S D;  5CPJ D;  2Y2J A;  3REK D;  4NE3 A;  1U35 B;  3W97 C;  2NZD A;  2BYK B;  3AZI C;  5CPK D;  2Y2G A;  4CSR B;  3WA9 B;  3TU4 D;  1KX4 D;  2F2A C;  1P3O C;  4XUJ C;  4J8U D;  4X23 C;  5DNM B;  3X1U C;  1HQ3 D;  4KGC C;  4LD9 B;  4DRA A;  1ID3 C;  3WAA B;  4J8X D;  3LZ0 C;  1P3P B;  3KXB C;  1ULY A;  1P3I C;  5AVC D;  3MGS C;  3LEL D;  5C3I B;  1TZY D;  2F8N B;  3W98 C;  2DF4 C;  5B24 A;  5E5A D;  3X1S B;  5GSU C;  1P3L D;  5CPJ B;  5B1L A;  1S32 A;  3REK B;  3AZJ C;  3AZH C;  3X1V C;  3UTA D;  4ZBJ C;  5AV8 A;  3LJA A;  5CPK B;  3AZF A;  5KDM B;  4HGA C;  3TU4 B;  1KX4 B;  3AYW A;  5AV5 D;  3AZG C;  1P3K C;  3B6F D;  5CP6 D;  1P3A D;  5FUG A;  3AFA A;  3AZK D;  4J8U B;  2CV5 A;  1HQ3 B;  1P3G A;  5BS7 C;  5B2J C;  4H9S C;  4R8P D;  1P3F D;  4QLC A;  3P5J B;  3MGP A;  4J8X B;  5AY8 A;  2G5I C;  5JRG D;  5GT3 A;  5AV6 C;  4H9P B;  3WTP D;  5AVC B;  1F66 A;  2YFV B;  5B40 D;  3MVD D;  2XD1 A;  3FDD A;  3LEL B;  3AV1 D;  3UTB A;  3B6G D;  5B2I A;  1TZY B;  3AZE D;  3WKJ A;  3MNN A;  1P3L B;  5E5A B;  5B31 D;  4H9Q B;  1BH8 A;  3EPK A;  3C1B A;  4J8V C;  2HUE C;  3UT9 A;  3UTA B;  3R45 B;  3X1T A;  3REI D;  2NZD C;  4Z5T A;  4WJ3 C;  3AN2 C;  4YM6 C;  5AV5 B;  1M19 D;  5CP6 B;  4NE5 A;  1EQZ D;  1P3A B;  5BT1 C;  3AZK B;  3W97 A;  3KWQ D;  2CWE A;  3AZI A;  3MGR D;  1KX5 C;  3A6N C;  3W96 A;  1W2E A;  4WU9 C;  4R8P B;  1P3F B;  3EPH A;  3REJ C;  1P3O A;  4XUJ A;  4YS3 D;  5B1M C;  5JRG B;  3AZM D;  3WTP B;  5B40 B;  3NQJ A;  3O62 D;  3MVD B;  4KGC A;  4X23 A;  4H9R A;  3X1U A;  3REH C;  4H9N A;  3AV1 B;  3B6G B;  3AZE B;  5AVB C;  4KHA B;  3REL D;  1M18 D;  1ID3 A;  5B31 B;  3LZ0 A;  3KXB A;  1P3I A;  3W99 C;  4UPK A;  1P3M D;  3MGS A;  1KX3 C;  5BNV B;  3A1I A;  1P3B C;  3KSY A;  4UUZ A;  4Z2M G;  3W98 A;  3AYW C;  1WWS A;  5GSU A;  1M19 B;  2BYM A;  1EQZ B;  2F8N G;  4G91 B;  5B33 D;  5B0Y D; 
#chains in the Genus database with same CATH homology
 3NQU A;  3AZJ A;  3AZH A;  3X1V A;  3KWQ B;  1U35 C;  3MGR B;  2NQB B;  5AV9 D;  5B0Z D;  3KUY C;  3AZG A;  1P3K A;  4YS3 B;  5CPI D;  5AY8 C;  2HIO C;  3O62 B;  5GXQ D;  4J8W D;  3AL0 C;  5BS7 A;  5B2J A;  4H9S A;  4DQY B;  3REL B;  1M18 B;  5DNN D;  3AZF D;  3WAA C;  1H3O A;  5AV6 A;  1P3P C;  2IO5 B;  1P3M B;  2ZY3 A;  1B67 A;  3MGQ C;  4NE6 A;  2ZM5 A;  3AZM B;  3X1S C;  5B33 B;  5B0Y B;  4J8V A;  1P34 D;  5CPJ C;  3REK C;  2YFW A;  3MGP D;  3IP4 C;  5CPK C;  3AN2 A;  5AV9 B;  1F66 D;  4YM6 A;  5B0Z B;  3W96 C;  2Y2N A;  5CPI B;  3WKJ D;  5B32 D;  5GXQ B;  4J8W B;  5CHL B;  3V9R A;  4WV4 B;  4ZUX D;  1HQ3 C;  4J8U C;  4JJN D;  3A6N A;  4WU9 A;  4EO5 B;  1KX5 A;  3UT9 D;  4KUD D;  3B0C W;  2RVQ D;  5DNN B;  3REJ A;  3AZF B;  5B1M A;  3AV2 D;  3C1C D;  2JE5 A;  2Y2Q A;  2Y2L A;  4CAY A;  5JA4 A;  5GT0 D;  3REH A;  5FUG B;  5G49 A;  2UWX A;  2VQR A;  5AVB A;  2CV5 B;  1Q9C A;  1P3L C;  5E5A C;  4XZQ D;  1BH9 A;  3KFU G;  1PZR A;  1P34 B;  1BFM A;  5B31 G;  3MGP B;  1M1A D;  3W99 A;  1P3O D;  1KX3 A;  1F66 B;  1P3B A;  3LZ1 C;  5AV5 C;  5BO0 A;  3B6F C;  5CP6 C;  2J8P A;  1P3A C;  3WKJ B;  1Z2C B;  5B32 B;  3AZK C;  1U35 A;  3LZ0 D;  1BH8 B;  4ZUX B;  4JJN B;  4CSR A;  4Z2M H;  4KUD B;  3UT9 B;  1P3I D;  2F8N H;  4WNN B;  3KUY A;  1P3F C;  3AV2 B;  3C1C B;  5JRG C;  2HIO A;  3VH6 A;  5GT0 B;  3WTP C;  4Z66 C;  3MVD C;  5DNM A;  3AV1 C;  2ZY2 A;  3B6G C;  3AZE C;  3WAA A;  4XZQ B;  5B31 C;  1P3P A;  1ZLA D;  1M1A B;  1P3O B;  3AZG D;  1AOI D;  1TAF B;  3REI C;  3A1K A;  3MGQ A;  2F8N A;  3X1S A;  1EQZ C;  4G91 C;  5CPJ A;  2ARO D;  3REK A;  5F99 D;  3LZ0 B;  3KWQ C;  5CPK A;  5KDM A;  3MGR C;  3TU4 A;  3AZL D;  1P3I B;  4WU8 D;  2NQB D;  3B0B A;  3VH6 W;  3O62 C;  2JSS A;  4J8U A;  1HQ3 A;  3AZN C;  4AWL C;  1N1J B;  2FJ7 C;  3REL C;  5BNX A;  1M18 C;  2PYO C;  2NZD D;  4HGA B;  1ZLA B;  4H9P A;  3AZG B;  1AOI B;  2L5A A;  1P3M C;  1TZY A;  3H0R C;  1P3L A;  5E5A A;  4WU9 D;  4H9Q A;  5B33 C;  5B0Y C;  2ARO B;  3EG5 B;  5F99 B;  3R45 A;  1H3O B;  3VH5 A;  3AZL B;  3WA9 C;  3LZ1 A;  5AV9 C;  4WU8 B;  2XD5 A;  5AV5 A;  5B0Z C;  3B6F A;  5CP6 A;  5CPI C;  3WTP E;  1P3A A;  3AZK A;  5GXQ C;  4J8W C;  5B24 D;  5B32 G;  1JFI A;  2ZY4 A;  5DNM C;  2YFW B;  3W99 D;  5B1L D;  4EO5 C;  1S32 D;  1P3F A;  2NZD B;  4LD9 C;  5DNN C;  5AV8 D;  3LJA D;  3B0D B;  5JRG A;  3AYW D;  3WTP A;  2F8N K;  4Z66 A;  3MVD A;  3AV1 A;  3B6G A;  4G92 B;  3AZE A;  3AFA D;  4KHA A;  5C3I C;  5B31 A;  2CV5 D;  4WU9 B;  1P3G D;  3KUY D;  1R4V A;  4QLC D;  3REI A;  3VH5 W;  5AY8 D;  5BNV A;  2HIO D;  5GT3 D;  3TU4 C;  1KX4 C;  2DQN C;  1EQZ A;  3UTB D;  2BG1 A;  4H9O A;  1A7W A;  5B2I D;  3MNN D;  3KWQ A;  5B24 B;  3MGR A;  4JJN C;  1F1E A;  3W99 B;  5B1L B;  3C1B D;  1S32 B;  4KUD C;  3X1T D;  3LJA B;  5AV8 B;  3MGQ D;  4YS3 A;  2G5H C;  3AV2 C;  4Z5T D;  4J8X C;  3AYW B;  2JCH A;  5GT0 C;  3O62 A;  2Y2I A;  5AVC C;  3AZN A;  3AFA B;  3B0C T;  3LEL C;  3REL A;  2FJ7 A;  1M18 A;  2PYO A;  3W97 D;  1T3U A;  1TZY C;  3AZI D;  1P3G B;  4XZQ C;  3KUY B;  3W96 D;  1M1A C;  4QLC B;  1P3M A;  3UTA C;  5AY8 B;  4XUJ D;  2HIO B;  5GT3 B;  4KGC D;  4X23 D;  3X1U D;  3AZM A;  5B33 A;  5B0Y A;  3UTB B;  4DRB A;  5B2I B;  3MNN B;  1ID3 D;  4M6B A;  2ZY5 A;  2BYK A;  3C1B B;  3WA9 A;  3KXB D;  1HTA A;  3X1T B;  5AV9 A;  5B0Z A;  3MGQ B;  4R8P C;  3MGS D;  3EPL A;  4Z5T B;  5CPI A;  3EPJ A;  3W98 D;  5GXQ A;  4J8W A;  5GSU D;  5B40 C;  3AZJ D;  3AZH D;  3X1V D;  3W97 B;  4LD9 A;  5DNN A;  3AZI B;  2W8S A;  3W96 B;  3LZ1 D;  1ZLA C;  1P3K D;  1AOI C;  4XUJ B;  3NQJ B;  4KGC B;  4X23 B;  4H9R B;  3X1U B;  4H9N B;  1M19 C;  5B2J D;  1P34 A;  5BNX B;  2ARO C;  1ID3 B;  5F99 C;  5AV6 D;  3KXB B;  3AZL C;  2Y2M A;  4Z66 D;  1KX4 A;  4WU8 C;  3MGS B;  2NQB C;  4YS3 C;  1KU5 A;  5B32 A;  4NFT A;  4UUZ B;  3W98 B;  3H0L C;  5GSU B;  2BYM B;  4ZUX A;  2Y2O A;  4WZS B;  4JJN A;  4KUD A;  4J8V D;  3NQU B;  3AZJ B;  3AZH B;  3X1V B;  4ZBJ B;  4WNN A;  3AV2 A;  3C1C A;  3B0D C;  4J8X A;  3LZ1 B;  5GT0 A;  3AN2 D;  3VH6 T;  4YM6 D;  1P3K B;  3B6F B;  2IO5 C;  5AVC A;  2YFV A;  5BT1 D;  3LEL A;  4G92 C;  1B6W A;  1JFI B;  4XZQ A;  1KX5 D;  5B2J B;  3A6N D;  3AZM C;  1M1A A;  3REJ D;  3UTA A;  1TAF A;  5B1M D;  5AV6 B;  2RIQ A;  4Z66 B;  4E44 A;  3REH D;  3AZN D;  2FJ7 D;  5AVB D;  2PYO D;  2Y2H A;  5B24 C;  4J8V B;  2HUE B;  5B1L C;  1S32 C;  3REI B;  4R8P A;  3LJA C;  5AV8 C;  1KX3 D;  3AZF C;  3AN2 B;  1P3B D;  4YM6 B;  5B40 A;  3H0M C;  4H9O B;  1N1J A;  3AFA C;  1U35 D;  3V9R B;  2CV5 C;  1KX5 B;  1P3G C;  3WA9 D;  3A6N B;  2FFF B;  1ZLA A;  2Y2K A;  1P34 C;  3REJ B;  1AOI A;  4QLC C;  3MGP C;  5B1M B;  5GT3 C;  4CAY B;  5JA4 B;  3REH B;  3AZN B;  4AWL B;  1F66 C;  5G49 B;  5DNM D;  1M19 A;  2FJ7 B;  5AVB B;  3UTB C;  2ARO A;  2PYO B;  4LD9 D;  2Y2P A;  5B2I C;  5F99 A;  3WKJ C;  3MNN C;  5B32 C;  3WAA D;  2LY8 A;  3VH5 T;  4E45 A;  1BH9 B;  3AZL A;  4ZUX C;  1P3P D;  3C1B C;  3UT9 C;  4WU8 A;  3X1T C;  2RVQ C;  1KX3 B;  2NQB A;  4Z5T C;  3C1C C;  1P3B B;  1WWI A;  2F8N D;  5BO0 B;  3F6T A;  3X1S D;  5CPJ D;  2Y2J A;  3REK D;  4NE3 A;  1U35 B;  3W97 C;  2NZD A;  2BYK B;  3AZI C;  5CPK D;  2Y2G A;  4CSR B;  3WA9 B;  3TU4 D;  1KX4 D;  2F2A C;  1P3O C;  4XUJ C;  4J8U D;  4X23 C;  5DNM B;  3X1U C;  1HQ3 D;  4KGC C;  4LD9 B;  4DRA A;  1ID3 C;  3WAA B;  4J8X D;  3LZ0 C;  1P3P B;  3KXB C;  1ULY A;  1P3I C;  5AVC D;  3MGS C;  3LEL D;  5C3I B;  1TZY D;  2F8N B;  3W98 C;  2DF4 C;  5B24 A;  5E5A D;  3X1S B;  5GSU C;  1P3L D;  5CPJ B;  5B1L A;  1S32 A;  3REK B;  3AZJ C;  3AZH C;  3X1V C;  3UTA D;  4ZBJ C;  5AV8 A;  3LJA A;  5CPK B;  3AZF A;  5KDM B;  4HGA C;  3TU4 B;  1KX4 B;  3AYW A;  5AV5 D;  3AZG C;  1P3K C;  3B6F D;  5CP6 D;  1P3A D;  5FUG A;  3AFA A;  3AZK D;  4J8U B;  2CV5 A;  1HQ3 B;  1P3G A;  5BS7 C;  5B2J C;  4H9S C;  4R8P D;  1P3F D;  4QLC A;  3P5J B;  3MGP A;  4J8X B;  5AY8 A;  2G5I C;  5JRG D;  5GT3 A;  5AV6 C;  4H9P B;  3WTP D;  5AVC B;  1F66 A;  2YFV B;  5B40 D;  3MVD D;  2XD1 A;  3FDD A;  3LEL B;  3AV1 D;  3UTB A;  3B6G D;  5B2I A;  1TZY B;  3AZE D;  3WKJ A;  3MNN A;  1P3L B;  5E5A B;  5B31 D;  4H9Q B;  1BH8 A;  3EPK A;  3C1B A;  4J8V C;  2HUE C;  3UT9 A;  3UTA B;  3R45 B;  3X1T A;  3REI D;  2NZD C;  4Z5T A;  4WJ3 C;  3AN2 C;  4YM6 C;  5AV5 B;  1M19 D;  5CP6 B;  4NE5 A;  1EQZ D;  1P3A B;  5BT1 C;  3AZK B;  3W97 A;  3KWQ D;  2CWE A;  3AZI A;  3MGR D;  1KX5 C;  3A6N C;  3W96 A;  1W2E A;  4WU9 C;  4R8P B;  1P3F B;  3EPH A;  3REJ C;  1P3O A;  4XUJ A;  4YS3 D;  5B1M C;  5JRG B;  3AZM D;  3WTP B;  5B40 B;  3NQJ A;  3O62 D;  3MVD B;  4KGC A;  4X23 A;  4H9R A;  3X1U A;  3REH C;  4H9N A;  3AV1 B;  3B6G B;  3AZE B;  5AVB C;  4KHA B;  3REL D;  1M18 D;  1ID3 A;  5B31 B;  3LZ0 A;  3KXB A;  1P3I A;  3W99 C;  4UPK A;  1P3M D;  3MGS A;  1KX3 C;  5BNV B;  3A1I A;  1P3B C;  3KSY A;  4UUZ A;  4Z2M G;  3W98 A;  3AYW C;  1WWS A;  5GSU A;  1M19 B;  2BYM A;  1EQZ B;  2F8N G;  4G91 B;  5B33 D;  5B0Y D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...