4LD9C

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
RAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 21
structure length 98
sequence length 98
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9C00
1ZLAA 4XZQA 4J8VC 1BH8A 5B33C 5B1LD 5AV5D 2AROA 5DNND 1P3MA 4Z66D 4WV4B 5G49B 3MGPA 2PYOB 1P34B 1TAFA 4X23D 5GT3D 4KUDC 3AN2B 2FJ7D 1BH9B 3UTBA 1AOID 3B6GD 3AZKC 3REKA 3AZGD 4XUJD 4CAYB 4KHAB 4KUDB 5AY8C 1P3ID 3AZKB 4R8PD 2RVQD 5G49A 3REJC 1P34A 1U35B 2NQBD 4J8VA 5AY8B 5B2ID 1Q9CA 5B33A 4KGCD 1BH9A 5GXQD 4H9PA 4CAYA 5JRGD 4KHAA 3NQJB 4KUDA 4J8UD 3C1CD 5E5AD 4G92C 3WKJC 3AZKA 3KUYC 2HIOD 3R45B 5AY8A 3W99D 4G92B 3AV2D 1ID3B 3WKJB 4G91B 3KUYB 3REJA 5AV5C 1P3KC 3AZFC 5B0ZD 3NQJA 4YS3C 1P3GC 5B1LB 5AV5B 1P3KB 4Z66B 5F99C 3AZFB 3R45A 3MGQC 4XZQD 3WKJA 1ID3A 5AV8C 2AROD 1P3IC 2FJ7B 3KUYA 1KX4C 1AOIB 3MGPD 4UUZA 3B6GB 4R8PC 3MGQB 3AZLC 1N1JA 3AZGB 2F8ND 2L5AA 5CP6C 2RVQC 1P3AC 1P3IB 5B40C 1KX4B 5AV5A 4R8PB 3AZLB 1P3KA 1P3FC 1P3BC 4Z66A 3AZFA 4Z5TD 2NQBB 3LJAC 5BO0B 4YS3A 1P3GA 4KGCB 5F99A 1AOIA 3UT9D 3MGQA 3AZGA 3NQUB 1WWSA 3LJAB 5JRGB 4J8VD 5B33D 2HUEC 4J8UB 1P3IA 3C1CB 1KX4A 5E5AB 3AV2C 4R8PA 3AZLA 5CP6A 1P3AA 2HIOB 2HUEB 5B40A 5BO0A 3W99B 3AV2B 4H9OB 1P3FA 1P3BA 1M19C 2BYMB 3VH6A 5C3IB 4LD9C 3LJAA 5AY8D 5B32C 5B0ZB 3A6NC 4HGAB 1M19B 3REJD 2CWEA 5BNXA 4LD9B 3WA9C 4XZQB 3LZ1C 4H9OA 5B32G 3AV2A 2AROB 2BYMA 3MGPB 3WA9B 3VH5A 2F8NB 3LZ0C 3LZ1B 3WKJD 4J8WD 4H9RB 4J8XD 2NZDC 1M19A 2F8NG 3KUYD 4JJNC 4LD9A 4Z5TB 3A6NA 3UT9C 3WTPC 3AYWC 2NZDB 1KX5C 1F66C 1P3KD 3X1VC 3AZFD 3UT9B 3WA9A 5B31C 3KSYA 3AYWB 2F8NA 4J8VB 3LZ1A 4H9QB 1KU5A 1F66B 4YS3D 5B33B 1P3GD 4H9RA 3UTAC 5F99D 4H9PB 5B31B 3MGQD 3LZ0A 4Z5TA 3B6FD 5KDMA 5AV8D 2NZDA 5B31G 1KX4D 3AZLD 5CP6D 5BS7C 3UT9A 4E45A 3WTPA 3KWQD 1P3AD 3AYWA 1KX5A 4H9QA 5B40D 1F66A 4EO5C 5AV6C 1P3FD 1B6WA 3TU4C 5FUGB 1P3BD 5GSUD 3REJB 5B31A 3O62C 1P3LC 1HTAA 3LJAD 5AVCC 3V9RB 3AZJC 3UTAA 5JA4B 4NE5A 3VH6W 4J8WC 4J8XC 1A7WA 5AVCB 3AZJB 3B0DC 4J8WB 5CPKC 4J8XB 5FUGA 4DRBA 5BS7A 1EQZC 1P3OC 4UUZB 1TZYC 1N1JB 4YM6D 1M1AC 1S32C 3B0DB 3V9RA 3MGSC 5AV6A 3TU4A 1M19D 5JA4A 3O62A 1P3LA 4LD9D 5B32D 5AVCA 3A6ND 3AZJA 4Z2MH 3B6FC 4M6BA 4YS3B 1P3GB 4J8WA 4J8XA 3AFAC 1F1EA 5F99B 4NFTA 3WA9D 3B6FB 3WTPE 3MVDC 3LZ1D 4WNNB 3RELD 5AV8B 3KWQC 5DNMC 4NE6A 5CPKA 3C1BC 1EQZA 3AZND 1P3OA 1TZYA 3AZHC 5CP6B 5GSUC 3LZ0D 1M1AA 3KWQB 3MGSA 5DNMB 1P3AB 3C1BB 2NZDD 5B40B 3VH6T 4WZSB 4JJND 1P3FB 1P3BB 4E44A 5GSUB 3WTPD 3AYWD 3B6FA 1KX5D 1WWIA 4WNNA 1F66D 5AV8A 3W97C 4QLCC 5BT1D 3AFAA 3W96D 3X1VD 5BNXB 5B31D 3REHC 3REID 3MVDA 4AWLC 3KWQA 5DNMA 2YFWB 3LELC 3C1BA 3B0BA 4YM6C 3UTAD 5AV9D 3AZHA 5GSUA 4AWLB 5BNVA 3LELB 4YM6B 4H9SC 3AZED 3MNNC 1M18C 5B32B 3A6NB 2YFWA 3W97A 4QLCA 5AV6D 3TU4D 3X1SD 3RELC 1M18B 3REHA 3O62D 1P3LD 3AZNC 5AVCD 3AZJD 3LELA 4YM6A 4ZUXC 3RELB 4WU8C 5B1MC 3AZNB 5B32A 3LZ0B 4H9SA 5KDMB 2CV5C 5CPKD 5B2JC 3MNNA 1EQZD 1M18A 3AZID 1JFIA 4JJNB 3AZMC 1P3OD 1TZYD 5BT1C 3KXBC 3W96C 5CPIC 1M1AD 5CPJC 1S32D 3WTPB 3MGSD 2BYKB 5B2JB 3REIC 1KX5B 3RELA 3AZMB 3KXBB 3X1TC 3W96B 3X1VB 3AZNA 5CPJB 5AV9C 3REIB 4ZUXA 2LY8A 4WU8A 5B24C 5B1MA 3X1UC 3AFAD 3UTAB 2PYOC 3AZEC 4JJNA 1P34C 5AV9B 3MVDD 2CV5A 5DNMD 2BYKA 5B2JA 5B24B 3X1UB 3C1BD 3AN2C 1P3PC 3AZEB 3AZMA 2IO5C 3KXBA 3W96A 3AZHD 3X1SC 3X1VA 5CPIA 5CPJA 3REIA 1P3PB 3W98C 2YFVB 4EO5B 2IO5B 3B0CW 5AV6B 3X1TA 4H9NB 3X1SB 3TU4B 5AV9A 3O62B 1P3LB 1U35C 4WU9C 3W98B 1KX3C 4DRAA 3W97D 5B24A 3X1UA 4QLCD 3WAAD 5B0YC 3AZEA 2PYOA 3REHD 1HQ3D 3MGRC 4WU9B 1KX3B 3AZIC 5AVBD 3LELD 4NE3A 3AN2A 1P3PA 2F8NK 2YFVA 5B0YB 5CPKB 3MGRB 4H9NA 3X1SA 1EQZB 3AZIB 2JSSA 1P3OB 1TZYB 3VH5W 3W98A 3AV1D 1M1AB 1S32B 1ID3C 3MGSB 1H3OB 4G91C 3MNND 1M18D 1U35A 5GT0D 4WU9A 1KX3A 5B0YA 5B1LC 3MGRA 5DNNC 3AFAB 4Z66C 3AZIA 3MVDB 3B0CT 4ZUXD 1S32A 1H3OA 4X23C 5GT3C 4WU8D 5DNNB 5B1MD 2FJ7C 1AOIC 3B6GC 1ZLAD 3AZGC 4XUJC 3AZHB 5BNVB 4X23B 5GT3B 4ZBJC 2CV5D 5B2JD 1P3MD 3AZMD 3WAAC 3KXBD 4XUJB 5CPID 5CPJD 1HQ3C 4ZBJB 2NQBC 5B2IC 5AVBC 3UTBD 5B1LA 3W97B 5DNNA 4QLCB 3WAAB 3X1TD 4Z2MG 3REKD 4KGCC 1R4VA 4CSRB 3VH5T 5GXQC 3REHB 1HQ3B 5B2IB 5JRGC 5AVBB 4X23A 5GT3A 1B67A 5B24D 4J8UC 3X1UD 3C1CC 3AV1C 2FJ7A 2PYOD 5E5AC 5GXQB 3B6GA 1P34D 4XUJA 5GT0C 2HIOC 1P3PD 3AV1B 3AN2D 3W99C 2F8NH 3WAAA 5CHLB 4CSRA 3MNNB 1JFIB 5GT0B 1HQ3A 2NQBA 5C3IC 5B2IA 4KUDD 5AVBA 5B0ZC 3W98D 4HGAC 3AZKD 4KGCA 5GXQA 3NQUA 1U35D 4WU9D 5JRGA 1KX3D 1ZLAC 4XZQC 4J8UA 3C1CA 3AV1A 4ZUXB 5B0YD 5E5AA 4WU8B 1P3MC 3MGRD 2AROC 5B1MB 1BFMA 5GT0A 2HIOA 3MGPC 1ZLAB 3W99A 1BH8B 2CV5B 1P3MB 3UTBC 3REKC 1TAFB 5B0ZA 5CPIB 4Z5TC 1ID3D 3UTBB 3X1TB 3REKB 1ULYA
chains in the Genus database with same CATH superfamily
2JCHA 1ZLAA 4XZQA 4J8VC 1BH8A 5B33C 5B1LD 5AV5D 2AROA 5DNND 1P3MA 4Z66D 4WV4B 5G49B 3MGPA 2PYOB 1P34B 2ZY2A 3KFUG 1TAFA 2W8SA 2XD1A 4X23D 5GT3D 4KUDC 3AN2B 2FJ7D 1BH9B 3UTBA 1AOID 3B6GD 3AZKC 3REKA 3AZGD 4XUJD 2Y2OA 4CAYB 4KHAB 4KUDB 2F2AC 5AY8C 1P3ID 3AZKB 4R8PD 2RVQD 5G49A 3REJC 3EPJA 1P34A 1U35B 2NQBD 4J8VA 5AY8B 3H0MC 1Q9CA 5B2ID 5B33A 2Y2HA 4KGCD 1BH9A 5GXQD 4H9PA 4CAYA 5JRGD 4KHAA 3NQJB 4KUDA 4J8UD 3C1CD 5E5AD 4G92C 3WKJC 3AZKA 3KUYC 2HIOD 3R45B 5AY8A 3W99D 4G92B 3AV2D 1ID3B 3WKJB 4G91B 3KUYB 3REJA 5AV5C 1P3KC 3AZFC 5B0ZD 3NQJA 2ZM5A 4YS3C 1P3GC 5B1LB 5AV5B 1P3KB 4Z66B 5F99C 3AZFB 3R45A 3MGQC 4XZQD 3WKJA 1ID3A 5AV8C 2AROD 1P3IC 2FJ7B 3KUYA 1KX4C 1AOIB 3AL0C 3MGPD 4UUZA 3B6GB 4R8PC 3MGQB 3AZLC 1N1JA 1T3UA 3AZGB 2L5AA 5CP6C 2RVQC 2F8ND 1P3AC 1P3IB 5B40C 1KX4B 5AV5A 4R8PB 3AZLB 1P3KA 1P3FC 1P3BC 4Z66A 3AZFA 4Z5TD 2NQBB 3LJAC 5BO0B 4YS3A 1P3GA 4KGCB 5F99A 1AOIA 3EPLA 3UT9D 3MGQA 3AZGA 3NQUB 1WWSA 3LJAB 5JRGB 4J8VD 5B33D 2HUEC 4J8UB 1P3IA 3C1CB 1KX4A 5E5AB 3AV2C 3A1KA 4R8PA 3AZLA 5CP6A 1P3AA 2HIOB 2HUEB 5B40A 5BO0A 3W99B 3AV2B 4H9OB 1P3FA 1P3BA 2ZY3A 1M19C 1W2EA 2BYMB 3VH6A 5C3IB 4LD9C 3LJAA 5AY8D 5B32C 5B0ZB 3A6NC 4HGAB 2XD5A 1M19B 3EPHA 3REJD 2CWEA 5BNXA 4LD9B 3WA9C 4XZQB 3LZ1C 4H9OA 5B32G 3AV2A 2AROB 2BYMA 3MGPB 3WA9B 3VH5A 2F8NB 3LZ0C 3LZ1B 3WKJD 4J8WD 4H9RB 4J8XD 4DQYB 2NZDC 1M19A 2F8NG 2J8PA 3KUYD 4JJNC 4LD9A 4Z5TB 3A6NA 3UT9C 3WTPC 3AYWC 2NZDB 1KX5C 1F66C 1P3KD 3X1VC 3AZFD 3UT9B 3WA9A 5B31C 2ZY5A 3KSYA 3AYWB 2F8NA 2Y2MA 4J8VB 3LZ1A 4H9QB 1KU5A 1F66B 4YS3D 5B33B 1P3GD 4H9RA 3UTAC 5F99D 4H9PB 5B31B 3MGQD 3LZ0A 4Z5TA 3B6FD 5KDMA 5AV8D 2NZDA 5B31G 1KX4D 3AZLD 5CP6D 5BS7C 3UT9A 4E45A 3WTPA 3KWQD 1P3AD 3AYWA 1KX5A 4H9QA 5B40D 1F66A 4EO5C 2UWXA 5AV6C 1P3FD 1B6WA 3TU4C 5FUGB 1P3BD 5GSUD 3REJB 5B31A 3O62C 1P3LC 1HTAA 3LJAD 5AVCC 3V9RB 3AZJC 3UTAA 5JA4B 4NE5A 3VH6W 4J8WC 4J8XC 1A7WA 5AVCB 3AZJB 3B0DC 4J8WB 5CPKC 4J8XB 3H0LC 5FUGA 4DRBA 5BS7A 1EQZC 3A1IA 1P3OC 4UUZB 1TZYC 2ZY4A 1N1JB 4YM6D 1M1AC 1S32C 3B0DB 3V9RA 3MGSC 5AV6A 1PZRA 3TU4A 1M19D 5JA4A 3O62A 1P3LA 4LD9D 5B32D 5AVCA 3A6ND 3AZJA 4Z2MH 3B6FC 4M6BA 4YS3B 1P3GB 4J8WA 4J8XA 3AFAC 1F1EA 5F99B 4NFTA 3WA9D 3B6FB 3WTPE 3MVDC 3LZ1D 4WNNB 3RELD 5AV8B 3KWQC 5DNMC 4NE6A 5CPKA 3C1BC 1EQZA 3AZND 1P3OA 1TZYA 3AZHC 5CP6B 5GSUC 3LZ0D 3F6TA 1M1AA 3KWQB 3MGSA 5DNMB 1P3AB 3C1BB 2NZDD 5B40B 3VH6T 4WZSB 4JJND 1P3FB 2VQRA 1P3BB 4E44A 3IP4C 5GSUB 3WTPD 3AYWD 3B6FA 1KX5D 1WWIA 4WNNA 1F66D 5AV8A 3W97C 3EPKA 4QLCC 5BT1D 3AFAA 3W96D 3X1VD 5BNXB 5B31D 3REHC 3REID 3MVDA 4AWLC 3KWQA 5DNMA 2YFWB 3LELC 3C1BA 3B0BA 3H0RC 4YM6C 3UTAD 5AV9D 3AZHA 2DF4C 5GSUA 4AWLB 5BNVA 3LELB 4YM6B 4H9SC 3AZED 3MNNC 1M18C 5B32B 3A6NB 2YFWA 3W97A 4QLCA 5AV6D 3TU4D 3X1SD 3RELC 1M18B 3REHA 3O62D 1P3LD 3AZNC 5AVCD 3AZJD 3LELA 4YM6A 4ZUXC 3RELB 4WU8C 5B1MC 3AZNB 2JE5A 5B32A 3LZ0B 4H9SA 5KDMB 2CV5C 5CPKD 5B2JC 3MNNA 1EQZD 1M18A 3AZID 1JFIA 4JJNB 3AZMC 1P3OD 1TZYD 5BT1C 3KXBC 3W96C 5CPIC 1M1AD 5CPJC 2Y2QA 3WTPB 1S32D 3MGSD 2BYKB 5B2JB 3REIC 1KX5B 3RELA 3AZMB 3KXBB 3X1TC 3W96B 3X1VB 3AZNA 5CPJB 5AV9C 3REIB 4ZUXA 2LY8A 4WU8A 5B24C 5B1MA 3X1UC 3AFAD 3UTAB 2PYOC 3AZEC 4JJNA 1P34C 5AV9B 3MVDD 2CV5A 5DNMD 2BYKA 2BG1A 5B2JA 5B24B 2RIQA 3X1UB 3C1BD 3AN2C 1P3PC 3AZEB 3AZMA 2IO5C 3KXBA 3W96A 3AZHD 3X1SC 3X1VA 5CPIA 5CPJA 2Y2IA 3REIA 1P3PB 3FDDA 3W98C 2YFVB 4EO5B 2IO5B 3B0CW 5AV6B 3X1TA 4H9NB 3X1SB 3TU4B 2Y2PA 2Y2KA 5AV9A 3O62B 1U35C 1P3LB 4WU9C 3W98B 1KX3C 4DRAA 3W97D 5B24A 3X1UA 4QLCD 3WAAD 4WJ3C 5B0YC 3AZEA 2PYOA 3REHD 1HQ3D 3MGRC 4WU9B 1KX3B 3AZIC 5AVBD 3LELD 4NE3A 3AN2A 1P3PA 2F8NK 2YFVA 5B0YB 5CPKB 3MGRB 4H9NA 3X1SA 1EQZB 3AZIB 2JSSA 1P3OB 1TZYB 3VH5W 3W98A 3AV1D 1M1AB 1S32B 1ID3C 3MGSB 1H3OB 4G91C 3MNND 1M18D 1U35A 5GT0D 4WU9A 2G5HC 1KX3A 5B0YA 5B1LC 3MGRA 5DNNC 3AFAB 4Z66C 3AZIA 1Z2CB 3MVDB 3B0CT 4ZUXD 1S32A 1H3OA 4X23C 5GT3C 4WU8D 5DNNB 5B1MD 2FJ7C 1AOIC 3B6GC 1ZLAD 3AZGC 2Y2GA 4XUJC 3AZHB 5BNVB 4X23B 5GT3B 4ZBJC 2CV5D 5B2JD 1P3MD 3AZMD 3WAAC 3KXBD 2FFFB 4XUJB 5CPID 5CPJD 1HQ3C 4ZBJB 2NQBC 2Y2NA 5B2IC 5AVBC 3UTBD 5B1LA 3W97B 5DNNA 4QLCB 3WAAB 3X1TD 4Z2MG 3REKD 4KGCC 3EG5B 1R4VA 4CSRB 3VH5T 5GXQC 3REHB 1HQ3B 5B2IB 5JRGC 5AVBB 4X23A 5GT3A 1B67A 5B24D 4J8UC 3X1UD 3C1CC 3AV1C 2FJ7A 2PYOD 5E5AC 5GXQB 3B6GA 1P34D 4XUJA 5GT0C 2HIOC 1P3PD 3AV1B 3AN2D 3W99C 2F8NH 3WAAA 5CHLB 4CSRA 3MNNB 2DQNC 1JFIB 5GT0B 1HQ3A 2NQBA 5C3IC 2Y2LA 5B2IA 4KUDD 5AVBA 5B0ZC 3W98D 3P5JB 4HGAC 3AZKD 4KGCA 5GXQA 3NQUA 1U35D 4WU9D 5JRGA 1KX3D 1ZLAC 4XZQC 4J8UA 2G5IC 3C1CA 3AV1A 4ZUXB 5B0YD 5E5AA 4WU8B 1P3MC 3MGRD 2AROC 5B1MB 1BFMA 5GT0A 2HIOA 3MGPC 1ZLAB 3W99A 1BH8B 2CV5B 1P3MB 3UTBC 3REKC 1TAFB 5B0ZA 5CPIB 4Z5TC 1ID3D 2Y2JA 3UTBB 3X1TB 3REKB 1ULYA 4UPKA
chains in the Genus database with same CATH topology
2JCHA 1ZLAA 4XZQA 4J8VC 1BH8A 5B33C 5B1LD 5AV5D 2AROA 5DNND 1P3MA 4Z66D 4WV4B 5G49B 3MGPA 2PYOB 1P34B 2ZY2A 3KFUG 1TAFA 2W8SA 2XD1A 4X23D 5GT3D 4KUDC 3AN2B 2FJ7D 1BH9B 3UTBA 1AOID 3B6GD 3AZKC 3REKA 3AZGD 4XUJD 2Y2OA 4CAYB 4KHAB 4KUDB 2F2AC 5AY8C 1P3ID 3AZKB 4R8PD 2RVQD 5G49A 3REJC 3EPJA 1P34A 1U35B 2NQBD 4J8VA 5AY8B 3H0MC 1Q9CA 5B2ID 5B33A 2Y2HA 4KGCD 1BH9A 5GXQD 4H9PA 4CAYA 5JRGD 4KHAA 3NQJB 4KUDA 4J8UD 3C1CD 5E5AD 4G92C 3WKJC 3AZKA 3KUYC 2HIOD 3R45B 5AY8A 3W99D 4G92B 3AV2D 1ID3B 3WKJB 4G91B 3KUYB 3REJA 5AV5C 1P3KC 3AZFC 5B0ZD 3NQJA 2ZM5A 4YS3C 1P3GC 5B1LB 5AV5B 1P3KB 4Z66B 5F99C 3AZFB 3R45A 3MGQC 4XZQD 3WKJA 1ID3A 5AV8C 2AROD 1P3IC 2FJ7B 3KUYA 1KX4C 1AOIB 3AL0C 3MGPD 4UUZA 3B6GB 4R8PC 3MGQB 3AZLC 1N1JA 1T3UA 3AZGB 2L5AA 5CP6C 2RVQC 2F8ND 1P3AC 1P3IB 5B40C 1KX4B 5AV5A 4R8PB 3AZLB 1P3KA 1P3FC 1P3BC 4Z66A 3AZFA 4Z5TD 2NQBB 3LJAC 5BO0B 4YS3A 1P3GA 4KGCB 5F99A 1AOIA 3EPLA 3UT9D 3MGQA 3AZGA 3NQUB 1WWSA 3LJAB 5JRGB 4J8VD 5B33D 2HUEC 4J8UB 1P3IA 3C1CB 1KX4A 5E5AB 3AV2C 3A1KA 4R8PA 3AZLA 5CP6A 1P3AA 2HIOB 2HUEB 5B40A 5BO0A 3W99B 3AV2B 4H9OB 1P3FA 1P3BA 2ZY3A 1M19C 1W2EA 2BYMB 3VH6A 5C3IB 4LD9C 3LJAA 5AY8D 5B32C 5B0ZB 3A6NC 4HGAB 2XD5A 1M19B 3EPHA 3REJD 2CWEA 5BNXA 4LD9B 3WA9C 4XZQB 3LZ1C 4H9OA 5B32G 3AV2A 2AROB 2BYMA 3MGPB 3WA9B 3VH5A 2F8NB 3LZ0C 3LZ1B 3WKJD 4J8WD 4H9RB 4J8XD 4DQYB 2NZDC 1M19A 2F8NG 2J8PA 3KUYD 4JJNC 4LD9A 4Z5TB 3A6NA 3UT9C 3WTPC 3AYWC 2NZDB 1KX5C 1F66C 1P3KD 3X1VC 3AZFD 3UT9B 3WA9A 5B31C 2ZY5A 3KSYA 3AYWB 2F8NA 2Y2MA 4J8VB 3LZ1A 4H9QB 1KU5A 1F66B 4YS3D 5B33B 1P3GD 4H9RA 3UTAC 5F99D 4H9PB 5B31B 3MGQD 3LZ0A 4Z5TA 3B6FD 5KDMA 5AV8D 2NZDA 5B31G 1KX4D 3AZLD 5CP6D 5BS7C 3UT9A 4E45A 3WTPA 3KWQD 1P3AD 3AYWA 1KX5A 4H9QA 5B40D 1F66A 4EO5C 2UWXA 5AV6C 1P3FD 1B6WA 3TU4C 5FUGB 1P3BD 5GSUD 3REJB 5B31A 3O62C 1P3LC 1HTAA 3LJAD 5AVCC 3V9RB 3AZJC 3UTAA 5JA4B 4NE5A 3VH6W 4J8WC 4J8XC 1A7WA 5AVCB 3AZJB 3B0DC 4J8WB 5CPKC 4J8XB 3H0LC 5FUGA 4DRBA 5BS7A 1EQZC 3A1IA 1P3OC 4UUZB 1TZYC 2ZY4A 1N1JB 4YM6D 1M1AC 1S32C 3B0DB 3V9RA 3MGSC 5AV6A 1PZRA 3TU4A 1M19D 5JA4A 3O62A 1P3LA 4LD9D 5B32D 5AVCA 3A6ND 3AZJA 4Z2MH 3B6FC 4M6BA 4YS3B 1P3GB 4J8WA 4J8XA 3AFAC 1F1EA 5F99B 4NFTA 3WA9D 3B6FB 3WTPE 3MVDC 3LZ1D 4WNNB 3RELD 5AV8B 3KWQC 5DNMC 4NE6A 5CPKA 3C1BC 1EQZA 3AZND 1P3OA 1TZYA 3AZHC 5CP6B 5GSUC 3LZ0D 3F6TA 1M1AA 3KWQB 3MGSA 5DNMB 1P3AB 3C1BB 2NZDD 5B40B 3VH6T 4WZSB 4JJND 1P3FB 2VQRA 1P3BB 4E44A 3IP4C 5GSUB 3WTPD 3AYWD 3B6FA 1KX5D 1WWIA 4WNNA 1F66D 5AV8A 3W97C 3EPKA 4QLCC 5BT1D 3AFAA 3W96D 3X1VD 5BNXB 5B31D 3REHC 3REID 3MVDA 4AWLC 3KWQA 5DNMA 2YFWB 3LELC 3C1BA 3B0BA 3H0RC 4YM6C 3UTAD 5AV9D 3AZHA 2DF4C 5GSUA 4AWLB 5BNVA 3LELB 4YM6B 4H9SC 3AZED 3MNNC 1M18C 5B32B 3A6NB 2YFWA 3W97A 4QLCA 5AV6D 3TU4D 3X1SD 3RELC 1M18B 3REHA 3O62D 1P3LD 3AZNC 5AVCD 3AZJD 3LELA 4YM6A 4ZUXC 3RELB 4WU8C 5B1MC 3AZNB 2JE5A 5B32A 3LZ0B 4H9SA 5KDMB 2CV5C 5CPKD 5B2JC 3MNNA 1EQZD 1M18A 3AZID 1JFIA 4JJNB 3AZMC 1P3OD 1TZYD 5BT1C 3KXBC 3W96C 5CPIC 1M1AD 5CPJC 2Y2QA 3WTPB 1S32D 3MGSD 2BYKB 5B2JB 3REIC 1KX5B 3RELA 3AZMB 3KXBB 3X1TC 3W96B 3X1VB 3AZNA 5CPJB 5AV9C 3REIB 4ZUXA 2LY8A 4WU8A 5B24C 5B1MA 3X1UC 3AFAD 3UTAB 2PYOC 3AZEC 4JJNA 1P34C 5AV9B 3MVDD 2CV5A 5DNMD 2BYKA 2BG1A 5B2JA 5B24B 2RIQA 3X1UB 3C1BD 3AN2C 1P3PC 3AZEB 3AZMA 2IO5C 3KXBA 3W96A 3AZHD 3X1SC 3X1VA 5CPIA 5CPJA 2Y2IA 3REIA 1P3PB 3FDDA 3W98C 2YFVB 4EO5B 2IO5B 3B0CW 5AV6B 3X1TA 4H9NB 3X1SB 3TU4B 2Y2PA 2Y2KA 5AV9A 3O62B 1U35C 1P3LB 4WU9C 3W98B 1KX3C 4DRAA 3W97D 5B24A 3X1UA 4QLCD 3WAAD 4WJ3C 5B0YC 3AZEA 2PYOA 3REHD 1HQ3D 3MGRC 4WU9B 1KX3B 3AZIC 5AVBD 3LELD 4NE3A 3AN2A 1P3PA 2F8NK 2YFVA 5B0YB 5CPKB 3MGRB 4H9NA 3X1SA 1EQZB 3AZIB 2JSSA 1P3OB 1TZYB 3VH5W 3W98A 3AV1D 1M1AB 1S32B 1ID3C 3MGSB 1H3OB 4G91C 3MNND 1M18D 1U35A 5GT0D 4WU9A 2G5HC 1KX3A 5B0YA 5B1LC 3MGRA 5DNNC 3AFAB 4Z66C 3AZIA 1Z2CB 3MVDB 3B0CT 4ZUXD 1S32A 1H3OA 4X23C 5GT3C 4WU8D 5DNNB 5B1MD 2FJ7C 1AOIC 3B6GC 1ZLAD 3AZGC 2Y2GA 4XUJC 3AZHB 5BNVB 4X23B 5GT3B 4ZBJC 2CV5D 5B2JD 1P3MD 3AZMD 3WAAC 3KXBD 2FFFB 4XUJB 5CPID 5CPJD 1HQ3C 4ZBJB 2NQBC 2Y2NA 5B2IC 5AVBC 3UTBD 5B1LA 3W97B 5DNNA 4QLCB 3WAAB 3X1TD 4Z2MG 3REKD 4KGCC 3EG5B 1R4VA 4CSRB 3VH5T 5GXQC 3REHB 1HQ3B 5B2IB 5JRGC 5AVBB 4X23A 5GT3A 1B67A 5B24D 4J8UC 3X1UD 3C1CC 3AV1C 2FJ7A 2PYOD 5E5AC 5GXQB 3B6GA 1P34D 4XUJA 5GT0C 2HIOC 1P3PD 3AV1B 3AN2D 3W99C 2F8NH 3WAAA 5CHLB 4CSRA 3MNNB 2DQNC 1JFIB 5GT0B 1HQ3A 2NQBA 5C3IC 2Y2LA 5B2IA 4KUDD 5AVBA 5B0ZC 3W98D 3P5JB 4HGAC 3AZKD 4KGCA 5GXQA 3NQUA 1U35D 4WU9D 5JRGA 1KX3D 1ZLAC 4XZQC 4J8UA 2G5IC 3C1CA 3AV1A 4ZUXB 5B0YD 5E5AA 4WU8B 1P3MC 3MGRD 2AROC 5B1MB 1BFMA 5GT0A 2HIOA 3MGPC 1ZLAB 3W99A 1BH8B 2CV5B 1P3MB 3UTBC 3REKC 1TAFB 5B0ZA 5CPIB 4Z5TC 1ID3D 2Y2JA 3UTBB 3X1TB 3REKB 1ULYA 4UPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA A;  4XZQ A;  4J8V C;  1BH8 A;  5B33 C;  5B1L D;  5AV5 D;  2ARO A;  5DNN D;  1P3M A;  4Z66 D;  4WV4 B;  5G49 B;  3MGP A;  2PYO B;  1P34 B;  1TAF A;  4X23 D;  5GT3 D;  4KUD C;  3AN2 B;  2FJ7 D;  1BH9 B;  3UTB A;  1AOI D;  3B6G D;  3AZK C;  3REK A;  3AZG D;  4XUJ D;  4CAY B;  4KHA B;  4KUD B;  5AY8 C;  1P3I D;  3AZK B;  4R8P D;  2RVQ D;  5G49 A;  3REJ C;  1P34 A;  1U35 B;  2NQB D;  4J8V A;  5AY8 B;  5B2I D;  1Q9C A;  5B33 A;  4KGC D;  1BH9 A;  5GXQ D;  4H9P A;  4CAY A;  5JRG D;  4KHA A;  3NQJ B;  4KUD A;  4J8U D;  3C1C D;  5E5A D;  4G92 C;  3WKJ C;  3AZK A;  3KUY C;  2HIO D;  3R45 B;  5AY8 A;  3W99 D;  4G92 B;  3AV2 D;  1ID3 B;  3WKJ B;  4G91 B;  3KUY B;  3REJ A;  5AV5 C;  1P3K C;  3AZF C;  5B0Z D;  3NQJ A;  4YS3 C;  1P3G C;  5B1L B;  5AV5 B;  1P3K B;  4Z66 B;  5F99 C;  3AZF B;  3R45 A;  3MGQ C;  4XZQ D;  3WKJ A;  1ID3 A;  5AV8 C;  2ARO D;  1P3I C;  2FJ7 B;  3KUY A;  1KX4 C;  1AOI B;  3MGP D;  4UUZ A;  3B6G B;  4R8P C;  3MGQ B;  3AZL C;  1N1J A;  3AZG B;  2F8N D;  2L5A A;  5CP6 C;  2RVQ C;  1P3A C;  1P3I B;  5B40 C;  1KX4 B;  5AV5 A;  4R8P B;  3AZL B;  1P3K A;  1P3F C;  1P3B C;  4Z66 A;  3AZF A;  4Z5T D;  2NQB B;  3LJA C;  5BO0 B;  4YS3 A;  1P3G A;  4KGC B;  5F99 A;  1AOI A;  3UT9 D;  3MGQ A;  3AZG A;  3NQU B;  1WWS A;  3LJA B;  5JRG B;  4J8V D;  5B33 D;  2HUE C;  4J8U B;  1P3I A;  3C1C B;  1KX4 A;  5E5A B;  3AV2 C;  4R8P A;  3AZL A;  5CP6 A;  1P3A A;  2HIO B;  2HUE B;  5B40 A;  5BO0 A;  3W99 B;  3AV2 B;  4H9O B;  1P3F A;  1P3B A;  1M19 C;  2BYM B;  3VH6 A;  5C3I B;  4LD9 C;  3LJA A;  5AY8 D;  5B32 C;  5B0Z B;  3A6N C;  4HGA B;  1M19 B;  3REJ D;  2CWE A;  5BNX A;  4LD9 B;  3WA9 C;  4XZQ B;  3LZ1 C;  4H9O A;  5B32 G;  3AV2 A;  2ARO B;  2BYM A;  3MGP B;  3WA9 B;  3VH5 A;  2F8N B;  3LZ0 C;  3LZ1 B;  3WKJ D;  4J8W D;  4H9R B;  4J8X D;  2NZD C;  1M19 A;  2F8N G;  3KUY D;  4JJN C;  4LD9 A;  4Z5T B;  3A6N A;  3UT9 C;  3WTP C;  3AYW C;  2NZD B;  1KX5 C;  1F66 C;  1P3K D;  3X1V C;  3AZF D;  3UT9 B;  3WA9 A;  5B31 C;  3KSY A;  3AYW B;  2F8N A;  4J8V B;  3LZ1 A;  4H9Q B;  1KU5 A;  1F66 B;  4YS3 D;  5B33 B;  1P3G D;  4H9R A;  3UTA C;  5F99 D;  4H9P B;  5B31 B;  3MGQ D;  3LZ0 A;  4Z5T A;  3B6F D;  5KDM A;  5AV8 D;  2NZD A;  5B31 G;  1KX4 D;  3AZL D;  5CP6 D;  5BS7 C;  3UT9 A;  4E45 A;  3WTP A;  3KWQ D;  1P3A D;  3AYW A;  1KX5 A;  4H9Q A;  5B40 D;  1F66 A;  4EO5 C;  5AV6 C;  1P3F D;  1B6W A;  3TU4 C;  5FUG B;  1P3B D;  5GSU D;  3REJ B;  5B31 A;  3O62 C;  1P3L C;  1HTA A;  3LJA D;  5AVC C;  3V9R B;  3AZJ C;  3UTA A;  5JA4 B;  4NE5 A;  3VH6 W;  4J8W C;  4J8X C;  1A7W A;  5AVC B;  3AZJ B;  3B0D C;  4J8W B;  5CPK C;  4J8X B;  5FUG A;  4DRB A;  5BS7 A;  1EQZ C;  1P3O C;  4UUZ B;  1TZY C;  1N1J B;  4YM6 D;  1M1A C;  1S32 C;  3B0D B;  3V9R A;  3MGS C;  5AV6 A;  3TU4 A;  1M19 D;  5JA4 A;  3O62 A;  1P3L A;  4LD9 D;  5B32 D;  5AVC A;  3A6N D;  3AZJ A;  4Z2M H;  3B6F C;  4M6B A;  4YS3 B;  1P3G B;  4J8W A;  4J8X A;  3AFA C;  1F1E A;  5F99 B;  4NFT A;  3WA9 D;  3B6F B;  3WTP E;  3MVD C;  3LZ1 D;  4WNN B;  3REL D;  5AV8 B;  3KWQ C;  5DNM C;  4NE6 A;  5CPK A;  3C1B C;  1EQZ A;  3AZN D;  1P3O A;  1TZY A;  3AZH C;  5CP6 B;  5GSU C;  3LZ0 D;  1M1A A;  3KWQ B;  3MGS A;  5DNM B;  1P3A B;  3C1B B;  2NZD D;  5B40 B;  3VH6 T;  4WZS B;  4JJN D;  1P3F B;  1P3B B;  4E44 A;  5GSU B;  3WTP D;  3AYW D;  3B6F A;  1KX5 D;  1WWI A;  4WNN A;  1F66 D;  5AV8 A;  3W97 C;  4QLC C;  5BT1 D;  3AFA A;  3W96 D;  3X1V D;  5BNX B;  5B31 D;  3REH C;  3REI D;  3MVD A;  4AWL C;  3KWQ A;  5DNM A;  2YFW B;  3LEL C;  3C1B A;  3B0B A;  4YM6 C;  3UTA D;  5AV9 D;  3AZH A;  5GSU A;  4AWL B;  5BNV A;  3LEL B;  4YM6 B;  4H9S C;  3AZE D;  3MNN C;  1M18 C;  5B32 B;  3A6N B;  2YFW A;  3W97 A;  4QLC A;  5AV6 D;  3TU4 D;  3X1S D;  3REL C;  1M18 B;  3REH A;  3O62 D;  1P3L D;  3AZN C;  5AVC D;  3AZJ D;  3LEL A;  4YM6 A;  4ZUX C;  3REL B;  4WU8 C;  5B1M C;  3AZN B;  5B32 A;  3LZ0 B;  4H9S A;  5KDM B;  2CV5 C;  5CPK D;  5B2J C;  3MNN A;  1EQZ D;  1M18 A;  3AZI D;  1JFI A;  4JJN B;  3AZM C;  1P3O D;  1TZY D;  5BT1 C;  3KXB C;  3W96 C;  5CPI C;  1M1A D;  5CPJ C;  1S32 D;  3WTP B;  3MGS D;  2BYK B;  5B2J B;  3REI C;  1KX5 B;  3REL A;  3AZM B;  3KXB B;  3X1T C;  3W96 B;  3X1V B;  3AZN A;  5CPJ B;  5AV9 C;  3REI B;  4ZUX A;  2LY8 A;  4WU8 A;  5B24 C;  5B1M A;  3X1U C;  3AFA D;  3UTA B;  2PYO C;  3AZE C;  4JJN A;  1P34 C;  5AV9 B;  3MVD D;  2CV5 A;  5DNM D;  2BYK A;  5B2J A;  5B24 B;  3X1U B;  3C1B D;  3AN2 C;  1P3P C;  3AZE B;  3AZM A;  2IO5 C;  3KXB A;  3W96 A;  3AZH D;  3X1S C;  3X1V A;  5CPI A;  5CPJ A;  3REI A;  1P3P B;  3W98 C;  2YFV B;  4EO5 B;  2IO5 B;  3B0C W;  5AV6 B;  3X1T A;  4H9N B;  3X1S B;  3TU4 B;  5AV9 A;  3O62 B;  1P3L B;  1U35 C;  4WU9 C;  3W98 B;  1KX3 C;  4DRA A;  3W97 D;  5B24 A;  3X1U A;  4QLC D;  3WAA D;  5B0Y C;  3AZE A;  2PYO A;  3REH D;  1HQ3 D;  3MGR C;  4WU9 B;  1KX3 B;  3AZI C;  5AVB D;  3LEL D;  4NE3 A;  3AN2 A;  1P3P A;  2F8N K;  2YFV A;  5B0Y B;  5CPK B;  3MGR B;  4H9N A;  3X1S A;  1EQZ B;  3AZI B;  2JSS A;  1P3O B;  1TZY B;  3VH5 W;  3W98 A;  3AV1 D;  1M1A B;  1S32 B;  1ID3 C;  3MGS B;  1H3O B;  4G91 C;  3MNN D;  1M18 D;  1U35 A;  5GT0 D;  4WU9 A;  1KX3 A;  5B0Y A;  5B1L C;  3MGR A;  5DNN C;  3AFA B;  4Z66 C;  3AZI A;  3MVD B;  3B0C T;  4ZUX D;  1S32 A;  1H3O A;  4X23 C;  5GT3 C;  4WU8 D;  5DNN B;  5B1M D;  2FJ7 C;  1AOI C;  3B6G C;  1ZLA D;  3AZG C;  4XUJ C;  3AZH B;  5BNV B;  4X23 B;  5GT3 B;  4ZBJ C;  2CV5 D;  5B2J D;  1P3M D;  3AZM D;  3WAA C;  3KXB D;  4XUJ B;  5CPI D;  5CPJ D;  1HQ3 C;  4ZBJ B;  2NQB C;  5B2I C;  5AVB C;  3UTB D;  5B1L A;  3W97 B;  5DNN A;  4QLC B;  3WAA B;  3X1T D;  4Z2M G;  3REK D;  4KGC C;  1R4V A;  4CSR B;  3VH5 T;  5GXQ C;  3REH B;  1HQ3 B;  5B2I B;  5JRG C;  5AVB B;  4X23 A;  5GT3 A;  1B67 A;  5B24 D;  4J8U C;  3X1U D;  3C1C C;  3AV1 C;  2FJ7 A;  2PYO D;  5E5A C;  5GXQ B;  3B6G A;  1P34 D;  4XUJ A;  5GT0 C;  2HIO C;  1P3P D;  3AV1 B;  3AN2 D;  3W99 C;  2F8N H;  3WAA A;  5CHL B;  4CSR A;  3MNN B;  1JFI B;  5GT0 B;  1HQ3 A;  2NQB A;  5C3I C;  5B2I A;  4KUD D;  5AVB A;  5B0Z C;  3W98 D;  4HGA C;  3AZK D;  4KGC A;  5GXQ A;  3NQU A;  1U35 D;  4WU9 D;  5JRG A;  1KX3 D;  1ZLA C;  4XZQ C;  4J8U A;  3C1C A;  3AV1 A;  4ZUX B;  5B0Y D;  5E5A A;  4WU8 B;  1P3M C;  3MGR D;  2ARO C;  5B1M B;  1BFM A;  5GT0 A;  2HIO A;  3MGP C;  1ZLA B;  3W99 A;  1BH8 B;  2CV5 B;  1P3M B;  3UTB C;  3REK C;  1TAF B;  5B0Z A;  5CPI B;  4Z5T C;  1ID3 D;  3UTB B;  3X1T B;  3REK B;  1ULY A; 
#chains in the Genus database with same CATH topology
 2JCH A;  1ZLA A;  4XZQ A;  4J8V C;  1BH8 A;  5B33 C;  5B1L D;  5AV5 D;  2ARO A;  5DNN D;  1P3M A;  4Z66 D;  4WV4 B;  5G49 B;  3MGP A;  2PYO B;  1P34 B;  2ZY2 A;  3KFU G;  1TAF A;  2W8S A;  2XD1 A;  4X23 D;  5GT3 D;  4KUD C;  3AN2 B;  2FJ7 D;  1BH9 B;  3UTB A;  1AOI D;  3B6G D;  3AZK C;  3REK A;  3AZG D;  4XUJ D;  2Y2O A;  4CAY B;  4KHA B;  4KUD B;  2F2A C;  5AY8 C;  1P3I D;  3AZK B;  4R8P D;  2RVQ D;  5G49 A;  3REJ C;  3EPJ A;  1P34 A;  1U35 B;  2NQB D;  4J8V A;  5AY8 B;  3H0M C;  1Q9C A;  5B2I D;  5B33 A;  2Y2H A;  4KGC D;  1BH9 A;  5GXQ D;  4H9P A;  4CAY A;  5JRG D;  4KHA A;  3NQJ B;  4KUD A;  4J8U D;  3C1C D;  5E5A D;  4G92 C;  3WKJ C;  3AZK A;  3KUY C;  2HIO D;  3R45 B;  5AY8 A;  3W99 D;  4G92 B;  3AV2 D;  1ID3 B;  3WKJ B;  4G91 B;  3KUY B;  3REJ A;  5AV5 C;  1P3K C;  3AZF C;  5B0Z D;  3NQJ A;  2ZM5 A;  4YS3 C;  1P3G C;  5B1L B;  5AV5 B;  1P3K B;  4Z66 B;  5F99 C;  3AZF B;  3R45 A;  3MGQ C;  4XZQ D;  3WKJ A;  1ID3 A;  5AV8 C;  2ARO D;  1P3I C;  2FJ7 B;  3KUY A;  1KX4 C;  1AOI B;  3AL0 C;  3MGP D;  4UUZ A;  3B6G B;  4R8P C;  3MGQ B;  3AZL C;  1N1J A;  1T3U A;  3AZG B;  2L5A A;  5CP6 C;  2RVQ C;  2F8N D;  1P3A C;  1P3I B;  5B40 C;  1KX4 B;  5AV5 A;  4R8P B;  3AZL B;  1P3K A;  1P3F C;  1P3B C;  4Z66 A;  3AZF A;  4Z5T D;  2NQB B;  3LJA C;  5BO0 B;  4YS3 A;  1P3G A;  4KGC B;  5F99 A;  1AOI A;  3EPL A;  3UT9 D;  3MGQ A;  3AZG A;  3NQU B;  1WWS A;  3LJA B;  5JRG B;  4J8V D;  5B33 D;  2HUE C;  4J8U B;  1P3I A;  3C1C B;  1KX4 A;  5E5A B;  3AV2 C;  3A1K A;  4R8P A;  3AZL A;  5CP6 A;  1P3A A;  2HIO B;  2HUE B;  5B40 A;  5BO0 A;  3W99 B;  3AV2 B;  4H9O B;  1P3F A;  1P3B A;  2ZY3 A;  1M19 C;  1W2E A;  2BYM B;  3VH6 A;  5C3I B;  4LD9 C;  3LJA A;  5AY8 D;  5B32 C;  5B0Z B;  3A6N C;  4HGA B;  2XD5 A;  1M19 B;  3EPH A;  3REJ D;  2CWE A;  5BNX A;  4LD9 B;  3WA9 C;  4XZQ B;  3LZ1 C;  4H9O A;  5B32 G;  3AV2 A;  2ARO B;  2BYM A;  3MGP B;  3WA9 B;  3VH5 A;  2F8N B;  3LZ0 C;  3LZ1 B;  3WKJ D;  4J8W D;  4H9R B;  4J8X D;  4DQY B;  2NZD C;  1M19 A;  2F8N G;  2J8P A;  3KUY D;  4JJN C;  4LD9 A;  4Z5T B;  3A6N A;  3UT9 C;  3WTP C;  3AYW C;  2NZD B;  1KX5 C;  1F66 C;  1P3K D;  3X1V C;  3AZF D;  3UT9 B;  3WA9 A;  5B31 C;  2ZY5 A;  3KSY A;  3AYW B;  2F8N A;  2Y2M A;  4J8V B;  3LZ1 A;  4H9Q B;  1KU5 A;  1F66 B;  4YS3 D;  5B33 B;  1P3G D;  4H9R A;  3UTA C;  5F99 D;  4H9P B;  5B31 B;  3MGQ D;  3LZ0 A;  4Z5T A;  3B6F D;  5KDM A;  5AV8 D;  2NZD A;  5B31 G;  1KX4 D;  3AZL D;  5CP6 D;  5BS7 C;  3UT9 A;  4E45 A;  3WTP A;  3KWQ D;  1P3A D;  3AYW A;  1KX5 A;  4H9Q A;  5B40 D;  1F66 A;  4EO5 C;  2UWX A;  5AV6 C;  1P3F D;  1B6W A;  3TU4 C;  5FUG B;  1P3B D;  5GSU D;  3REJ B;  5B31 A;  3O62 C;  1P3L C;  1HTA A;  3LJA D;  5AVC C;  3V9R B;  3AZJ C;  3UTA A;  5JA4 B;  4NE5 A;  3VH6 W;  4J8W C;  4J8X C;  1A7W A;  5AVC B;  3AZJ B;  3B0D C;  4J8W B;  5CPK C;  4J8X B;  3H0L C;  5FUG A;  4DRB A;  5BS7 A;  1EQZ C;  3A1I A;  1P3O C;  4UUZ B;  1TZY C;  2ZY4 A;  1N1J B;  4YM6 D;  1M1A C;  1S32 C;  3B0D B;  3V9R A;  3MGS C;  5AV6 A;  1PZR A;  3TU4 A;  1M19 D;  5JA4 A;  3O62 A;  1P3L A;  4LD9 D;  5B32 D;  5AVC A;  3A6N D;  3AZJ A;  4Z2M H;  3B6F C;  4M6B A;  4YS3 B;  1P3G B;  4J8W A;  4J8X A;  3AFA C;  1F1E A;  5F99 B;  4NFT A;  3WA9 D;  3B6F B;  3WTP E;  3MVD C;  3LZ1 D;  4WNN B;  3REL D;  5AV8 B;  3KWQ C;  5DNM C;  4NE6 A;  5CPK A;  3C1B C;  1EQZ A;  3AZN D;  1P3O A;  1TZY A;  3AZH C;  5CP6 B;  5GSU C;  3LZ0 D;  3F6T A;  1M1A A;  3KWQ B;  3MGS A;  5DNM B;  1P3A B;  3C1B B;  2NZD D;  5B40 B;  3VH6 T;  4WZS B;  4JJN D;  1P3F B;  2VQR A;  1P3B B;  4E44 A;  3IP4 C;  5GSU B;  3WTP D;  3AYW D;  3B6F A;  1KX5 D;  1WWI A;  4WNN A;  1F66 D;  5AV8 A;  3W97 C;  3EPK A;  4QLC C;  5BT1 D;  3AFA A;  3W96 D;  3X1V D;  5BNX B;  5B31 D;  3REH C;  3REI D;  3MVD A;  4AWL C;  3KWQ A;  5DNM A;  2YFW B;  3LEL C;  3C1B A;  3B0B A;  3H0R C;  4YM6 C;  3UTA D;  5AV9 D;  3AZH A;  2DF4 C;  5GSU A;  4AWL B;  5BNV A;  3LEL B;  4YM6 B;  4H9S C;  3AZE D;  3MNN C;  1M18 C;  5B32 B;  3A6N B;  2YFW A;  3W97 A;  4QLC A;  5AV6 D;  3TU4 D;  3X1S D;  3REL C;  1M18 B;  3REH A;  3O62 D;  1P3L D;  3AZN C;  5AVC D;  3AZJ D;  3LEL A;  4YM6 A;  4ZUX C;  3REL B;  4WU8 C;  5B1M C;  3AZN B;  2JE5 A;  5B32 A;  3LZ0 B;  4H9S A;  5KDM B;  2CV5 C;  5CPK D;  5B2J C;  3MNN A;  1EQZ D;  1M18 A;  3AZI D;  1JFI A;  4JJN B;  3AZM C;  1P3O D;  1TZY D;  5BT1 C;  3KXB C;  3W96 C;  5CPI C;  1M1A D;  5CPJ C;  2Y2Q A;  3WTP B;  1S32 D;  3MGS D;  2BYK B;  5B2J B;  3REI C;  1KX5 B;  3REL A;  3AZM B;  3KXB B;  3X1T C;  3W96 B;  3X1V B;  3AZN A;  5CPJ B;  5AV9 C;  3REI B;  4ZUX A;  2LY8 A;  4WU8 A;  5B24 C;  5B1M A;  3X1U C;  3AFA D;  3UTA B;  2PYO C;  3AZE C;  4JJN A;  1P34 C;  5AV9 B;  3MVD D;  2CV5 A;  5DNM D;  2BYK A;  2BG1 A;  5B2J A;  5B24 B;  2RIQ A;  3X1U B;  3C1B D;  3AN2 C;  1P3P C;  3AZE B;  3AZM A;  2IO5 C;  3KXB A;  3W96 A;  3AZH D;  3X1S C;  3X1V A;  5CPI A;  5CPJ A;  2Y2I A;  3REI A;  1P3P B;  3FDD A;  3W98 C;  2YFV B;  4EO5 B;  2IO5 B;  3B0C W;  5AV6 B;  3X1T A;  4H9N B;  3X1S B;  3TU4 B;  2Y2P A;  2Y2K A;  5AV9 A;  3O62 B;  1U35 C;  1P3L B;  4WU9 C;  3W98 B;  1KX3 C;  4DRA A;  3W97 D;  5B24 A;  3X1U A;  4QLC D;  3WAA D;  4WJ3 C;  5B0Y C;  3AZE A;  2PYO A;  3REH D;  1HQ3 D;  3MGR C;  4WU9 B;  1KX3 B;  3AZI C;  5AVB D;  3LEL D;  4NE3 A;  3AN2 A;  1P3P A;  2F8N K;  2YFV A;  5B0Y B;  5CPK B;  3MGR B;  4H9N A;  3X1S A;  1EQZ B;  3AZI B;  2JSS A;  1P3O B;  1TZY B;  3VH5 W;  3W98 A;  3AV1 D;  1M1A B;  1S32 B;  1ID3 C;  3MGS B;  1H3O B;  4G91 C;  3MNN D;  1M18 D;  1U35 A;  5GT0 D;  4WU9 A;  2G5H C;  1KX3 A;  5B0Y A;  5B1L C;  3MGR A;  5DNN C;  3AFA B;  4Z66 C;  3AZI A;  1Z2C B;  3MVD B;  3B0C T;  4ZUX D;  1S32 A;  1H3O A;  4X23 C;  5GT3 C;  4WU8 D;  5DNN B;  5B1M D;  2FJ7 C;  1AOI C;  3B6G C;  1ZLA D;  3AZG C;  2Y2G A;  4XUJ C;  3AZH B;  5BNV B;  4X23 B;  5GT3 B;  4ZBJ C;  2CV5 D;  5B2J D;  1P3M D;  3AZM D;  3WAA C;  3KXB D;  2FFF B;  4XUJ B;  5CPI D;  5CPJ D;  1HQ3 C;  4ZBJ B;  2NQB C;  2Y2N A;  5B2I C;  5AVB C;  3UTB D;  5B1L A;  3W97 B;  5DNN A;  4QLC B;  3WAA B;  3X1T D;  4Z2M G;  3REK D;  4KGC C;  3EG5 B;  1R4V A;  4CSR B;  3VH5 T;  5GXQ C;  3REH B;  1HQ3 B;  5B2I B;  5JRG C;  5AVB B;  4X23 A;  5GT3 A;  1B67 A;  5B24 D;  4J8U C;  3X1U D;  3C1C C;  3AV1 C;  2FJ7 A;  2PYO D;  5E5A C;  5GXQ B;  3B6G A;  1P34 D;  4XUJ A;  5GT0 C;  2HIO C;  1P3P D;  3AV1 B;  3AN2 D;  3W99 C;  2F8N H;  3WAA A;  5CHL B;  4CSR A;  3MNN B;  2DQN C;  1JFI B;  5GT0 B;  1HQ3 A;  2NQB A;  5C3I C;  2Y2L A;  5B2I A;  4KUD D;  5AVB A;  5B0Z C;  3W98 D;  3P5J B;  4HGA C;  3AZK D;  4KGC A;  5GXQ A;  3NQU A;  1U35 D;  4WU9 D;  5JRG A;  1KX3 D;  1ZLA C;  4XZQ C;  4J8U A;  2G5I C;  3C1C A;  3AV1 A;  4ZUX B;  5B0Y D;  5E5A A;  4WU8 B;  1P3M C;  3MGR D;  2ARO C;  5B1M B;  1BFM A;  5GT0 A;  2HIO A;  3MGP C;  1ZLA B;  3W99 A;  1BH8 B;  2CV5 B;  1P3M B;  3UTB C;  3REK C;  1TAF B;  5B0Z A;  5CPI B;  4Z5T C;  1ID3 D;  2Y2J A;  3UTB B;  3X1T B;  3REK B;  1ULY A;  4UPK A; 
#chains in the Genus database with same CATH homology
 2JCH A;  1ZLA A;  4XZQ A;  4J8V C;  1BH8 A;  5B33 C;  5B1L D;  5AV5 D;  2ARO A;  5DNN D;  1P3M A;  4Z66 D;  4WV4 B;  5G49 B;  3MGP A;  2PYO B;  1P34 B;  2ZY2 A;  3KFU G;  1TAF A;  2W8S A;  2XD1 A;  4X23 D;  5GT3 D;  4KUD C;  3AN2 B;  2FJ7 D;  1BH9 B;  3UTB A;  1AOI D;  3B6G D;  3AZK C;  3REK A;  3AZG D;  4XUJ D;  2Y2O A;  4CAY B;  4KHA B;  4KUD B;  2F2A C;  5AY8 C;  1P3I D;  3AZK B;  4R8P D;  2RVQ D;  5G49 A;  3REJ C;  3EPJ A;  1P34 A;  1U35 B;  2NQB D;  4J8V A;  5AY8 B;  3H0M C;  1Q9C A;  5B2I D;  5B33 A;  2Y2H A;  4KGC D;  1BH9 A;  5GXQ D;  4H9P A;  4CAY A;  5JRG D;  4KHA A;  3NQJ B;  4KUD A;  4J8U D;  3C1C D;  5E5A D;  4G92 C;  3WKJ C;  3AZK A;  3KUY C;  2HIO D;  3R45 B;  5AY8 A;  3W99 D;  4G92 B;  3AV2 D;  1ID3 B;  3WKJ B;  4G91 B;  3KUY B;  3REJ A;  5AV5 C;  1P3K C;  3AZF C;  5B0Z D;  3NQJ A;  2ZM5 A;  4YS3 C;  1P3G C;  5B1L B;  5AV5 B;  1P3K B;  4Z66 B;  5F99 C;  3AZF B;  3R45 A;  3MGQ C;  4XZQ D;  3WKJ A;  1ID3 A;  5AV8 C;  2ARO D;  1P3I C;  2FJ7 B;  3KUY A;  1KX4 C;  1AOI B;  3AL0 C;  3MGP D;  4UUZ A;  3B6G B;  4R8P C;  3MGQ B;  3AZL C;  1N1J A;  1T3U A;  3AZG B;  2L5A A;  5CP6 C;  2RVQ C;  2F8N D;  1P3A C;  1P3I B;  5B40 C;  1KX4 B;  5AV5 A;  4R8P B;  3AZL B;  1P3K A;  1P3F C;  1P3B C;  4Z66 A;  3AZF A;  4Z5T D;  2NQB B;  3LJA C;  5BO0 B;  4YS3 A;  1P3G A;  4KGC B;  5F99 A;  1AOI A;  3EPL A;  3UT9 D;  3MGQ A;  3AZG A;  3NQU B;  1WWS A;  3LJA B;  5JRG B;  4J8V D;  5B33 D;  2HUE C;  4J8U B;  1P3I A;  3C1C B;  1KX4 A;  5E5A B;  3AV2 C;  3A1K A;  4R8P A;  3AZL A;  5CP6 A;  1P3A A;  2HIO B;  2HUE B;  5B40 A;  5BO0 A;  3W99 B;  3AV2 B;  4H9O B;  1P3F A;  1P3B A;  2ZY3 A;  1M19 C;  1W2E A;  2BYM B;  3VH6 A;  5C3I B;  4LD9 C;  3LJA A;  5AY8 D;  5B32 C;  5B0Z B;  3A6N C;  4HGA B;  2XD5 A;  1M19 B;  3EPH A;  3REJ D;  2CWE A;  5BNX A;  4LD9 B;  3WA9 C;  4XZQ B;  3LZ1 C;  4H9O A;  5B32 G;  3AV2 A;  2ARO B;  2BYM A;  3MGP B;  3WA9 B;  3VH5 A;  2F8N B;  3LZ0 C;  3LZ1 B;  3WKJ D;  4J8W D;  4H9R B;  4J8X D;  4DQY B;  2NZD C;  1M19 A;  2F8N G;  2J8P A;  3KUY D;  4JJN C;  4LD9 A;  4Z5T B;  3A6N A;  3UT9 C;  3WTP C;  3AYW C;  2NZD B;  1KX5 C;  1F66 C;  1P3K D;  3X1V C;  3AZF D;  3UT9 B;  3WA9 A;  5B31 C;  2ZY5 A;  3KSY A;  3AYW B;  2F8N A;  2Y2M A;  4J8V B;  3LZ1 A;  4H9Q B;  1KU5 A;  1F66 B;  4YS3 D;  5B33 B;  1P3G D;  4H9R A;  3UTA C;  5F99 D;  4H9P B;  5B31 B;  3MGQ D;  3LZ0 A;  4Z5T A;  3B6F D;  5KDM A;  5AV8 D;  2NZD A;  5B31 G;  1KX4 D;  3AZL D;  5CP6 D;  5BS7 C;  3UT9 A;  4E45 A;  3WTP A;  3KWQ D;  1P3A D;  3AYW A;  1KX5 A;  4H9Q A;  5B40 D;  1F66 A;  4EO5 C;  2UWX A;  5AV6 C;  1P3F D;  1B6W A;  3TU4 C;  5FUG B;  1P3B D;  5GSU D;  3REJ B;  5B31 A;  3O62 C;  1P3L C;  1HTA A;  3LJA D;  5AVC C;  3V9R B;  3AZJ C;  3UTA A;  5JA4 B;  4NE5 A;  3VH6 W;  4J8W C;  4J8X C;  1A7W A;  5AVC B;  3AZJ B;  3B0D C;  4J8W B;  5CPK C;  4J8X B;  3H0L C;  5FUG A;  4DRB A;  5BS7 A;  1EQZ C;  3A1I A;  1P3O C;  4UUZ B;  1TZY C;  2ZY4 A;  1N1J B;  4YM6 D;  1M1A C;  1S32 C;  3B0D B;  3V9R A;  3MGS C;  5AV6 A;  1PZR A;  3TU4 A;  1M19 D;  5JA4 A;  3O62 A;  1P3L A;  4LD9 D;  5B32 D;  5AVC A;  3A6N D;  3AZJ A;  4Z2M H;  3B6F C;  4M6B A;  4YS3 B;  1P3G B;  4J8W A;  4J8X A;  3AFA C;  1F1E A;  5F99 B;  4NFT A;  3WA9 D;  3B6F B;  3WTP E;  3MVD C;  3LZ1 D;  4WNN B;  3REL D;  5AV8 B;  3KWQ C;  5DNM C;  4NE6 A;  5CPK A;  3C1B C;  1EQZ A;  3AZN D;  1P3O A;  1TZY A;  3AZH C;  5CP6 B;  5GSU C;  3LZ0 D;  3F6T A;  1M1A A;  3KWQ B;  3MGS A;  5DNM B;  1P3A B;  3C1B B;  2NZD D;  5B40 B;  3VH6 T;  4WZS B;  4JJN D;  1P3F B;  2VQR A;  1P3B B;  4E44 A;  3IP4 C;  5GSU B;  3WTP D;  3AYW D;  3B6F A;  1KX5 D;  1WWI A;  4WNN A;  1F66 D;  5AV8 A;  3W97 C;  3EPK A;  4QLC C;  5BT1 D;  3AFA A;  3W96 D;  3X1V D;  5BNX B;  5B31 D;  3REH C;  3REI D;  3MVD A;  4AWL C;  3KWQ A;  5DNM A;  2YFW B;  3LEL C;  3C1B A;  3B0B A;  3H0R C;  4YM6 C;  3UTA D;  5AV9 D;  3AZH A;  2DF4 C;  5GSU A;  4AWL B;  5BNV A;  3LEL B;  4YM6 B;  4H9S C;  3AZE D;  3MNN C;  1M18 C;  5B32 B;  3A6N B;  2YFW A;  3W97 A;  4QLC A;  5AV6 D;  3TU4 D;  3X1S D;  3REL C;  1M18 B;  3REH A;  3O62 D;  1P3L D;  3AZN C;  5AVC D;  3AZJ D;  3LEL A;  4YM6 A;  4ZUX C;  3REL B;  4WU8 C;  5B1M C;  3AZN B;  2JE5 A;  5B32 A;  3LZ0 B;  4H9S A;  5KDM B;  2CV5 C;  5CPK D;  5B2J C;  3MNN A;  1EQZ D;  1M18 A;  3AZI D;  1JFI A;  4JJN B;  3AZM C;  1P3O D;  1TZY D;  5BT1 C;  3KXB C;  3W96 C;  5CPI C;  1M1A D;  5CPJ C;  2Y2Q A;  3WTP B;  1S32 D;  3MGS D;  2BYK B;  5B2J B;  3REI C;  1KX5 B;  3REL A;  3AZM B;  3KXB B;  3X1T C;  3W96 B;  3X1V B;  3AZN A;  5CPJ B;  5AV9 C;  3REI B;  4ZUX A;  2LY8 A;  4WU8 A;  5B24 C;  5B1M A;  3X1U C;  3AFA D;  3UTA B;  2PYO C;  3AZE C;  4JJN A;  1P34 C;  5AV9 B;  3MVD D;  2CV5 A;  5DNM D;  2BYK A;  2BG1 A;  5B2J A;  5B24 B;  2RIQ A;  3X1U B;  3C1B D;  3AN2 C;  1P3P C;  3AZE B;  3AZM A;  2IO5 C;  3KXB A;  3W96 A;  3AZH D;  3X1S C;  3X1V A;  5CPI A;  5CPJ A;  2Y2I A;  3REI A;  1P3P B;  3FDD A;  3W98 C;  2YFV B;  4EO5 B;  2IO5 B;  3B0C W;  5AV6 B;  3X1T A;  4H9N B;  3X1S B;  3TU4 B;  2Y2P A;  2Y2K A;  5AV9 A;  3O62 B;  1U35 C;  1P3L B;  4WU9 C;  3W98 B;  1KX3 C;  4DRA A;  3W97 D;  5B24 A;  3X1U A;  4QLC D;  3WAA D;  4WJ3 C;  5B0Y C;  3AZE A;  2PYO A;  3REH D;  1HQ3 D;  3MGR C;  4WU9 B;  1KX3 B;  3AZI C;  5AVB D;  3LEL D;  4NE3 A;  3AN2 A;  1P3P A;  2F8N K;  2YFV A;  5B0Y B;  5CPK B;  3MGR B;  4H9N A;  3X1S A;  1EQZ B;  3AZI B;  2JSS A;  1P3O B;  1TZY B;  3VH5 W;  3W98 A;  3AV1 D;  1M1A B;  1S32 B;  1ID3 C;  3MGS B;  1H3O B;  4G91 C;  3MNN D;  1M18 D;  1U35 A;  5GT0 D;  4WU9 A;  2G5H C;  1KX3 A;  5B0Y A;  5B1L C;  3MGR A;  5DNN C;  3AFA B;  4Z66 C;  3AZI A;  1Z2C B;  3MVD B;  3B0C T;  4ZUX D;  1S32 A;  1H3O A;  4X23 C;  5GT3 C;  4WU8 D;  5DNN B;  5B1M D;  2FJ7 C;  1AOI C;  3B6G C;  1ZLA D;  3AZG C;  2Y2G A;  4XUJ C;  3AZH B;  5BNV B;  4X23 B;  5GT3 B;  4ZBJ C;  2CV5 D;  5B2J D;  1P3M D;  3AZM D;  3WAA C;  3KXB D;  2FFF B;  4XUJ B;  5CPI D;  5CPJ D;  1HQ3 C;  4ZBJ B;  2NQB C;  2Y2N A;  5B2I C;  5AVB C;  3UTB D;  5B1L A;  3W97 B;  5DNN A;  4QLC B;  3WAA B;  3X1T D;  4Z2M G;  3REK D;  4KGC C;  3EG5 B;  1R4V A;  4CSR B;  3VH5 T;  5GXQ C;  3REH B;  1HQ3 B;  5B2I B;  5JRG C;  5AVB B;  4X23 A;  5GT3 A;  1B67 A;  5B24 D;  4J8U C;  3X1U D;  3C1C C;  3AV1 C;  2FJ7 A;  2PYO D;  5E5A C;  5GXQ B;  3B6G A;  1P34 D;  4XUJ A;  5GT0 C;  2HIO C;  1P3P D;  3AV1 B;  3AN2 D;  3W99 C;  2F8N H;  3WAA A;  5CHL B;  4CSR A;  3MNN B;  2DQN C;  1JFI B;  5GT0 B;  1HQ3 A;  2NQB A;  5C3I C;  2Y2L A;  5B2I A;  4KUD D;  5AVB A;  5B0Z C;  3W98 D;  3P5J B;  4HGA C;  3AZK D;  4KGC A;  5GXQ A;  3NQU A;  1U35 D;  4WU9 D;  5JRG A;  1KX3 D;  1ZLA C;  4XZQ C;  4J8U A;  2G5I C;  3C1C A;  3AV1 A;  4ZUX B;  5B0Y D;  5E5A A;  4WU8 B;  1P3M C;  3MGR D;  2ARO C;  5B1M B;  1BFM A;  5GT0 A;  2HIO A;  3MGP C;  1ZLA B;  3W99 A;  1BH8 B;  2CV5 B;  1P3M B;  3UTB C;  3REK C;  1TAF B;  5B0Z A;  5CPI B;  4Z5T C;  1ID3 D;  2Y2J A;  3UTB B;  3X1T B;  3REK B;  1ULY A;  4UPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...