4LD9C

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
RAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
total genus 21
structure length 98
sequence length 98
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9C00
3C1CB 2LY8A 5CHLB 1M1AD 4XZQA 1KX3A 3W96A 3O62C 5B32D 3REKA 3AN2B 3MGPA 5G49A 3WTPC 3AYWB 4H9SC 3AZMB 2IO5C 5AV5D 3LZ1B 1S32D 2NQBA 2HUEB 5B2JC 1M1AA 2HIOB 4X23D 5B32A 4NE6A 5B33D 3B0DB 5B31D 3MNND 5AVCC 2F8NB 5FUGB 5B24C 3MGRC 4J8XD 4XUJD 5AV5A 1ID3B 1S32A 1HQ3B 4YM6B 5AV9C 5GSUC 1P3GB 4Z2MG 4X23A 1P3BD 1P3OD 5B33A 3O62B 5B31A 3MVDD 5DNND 5B2IC 3B6GA 5BS7C 3MNNA 3WTPB 4AWLC 4G92B 4Z2MH 4J8XA 4XUJA 1EQZD 5GT0C 2IO5B 4QLCD 5AV8D 3UTAC 3AV2D 1N1JB 3WA9C 5B2JB 4J8VD 5B40D 5B1LB 4WZSB 1P3BA 1U35D 1P3OA 3C1BC 4KGCD 2YFVA 3LZ0C 3MVDA 5DNNA 3KUYD 3AZED 1WWSA 5F99C 3V9RB 4R8PD 3AZHD 5AVCB 1EQZA 3KSYA 5B24B 5B31G 1P3LC 3MGSD 4QLCA 3MGRB 2NZDD 5AV8A 3AV2A 4H9NA 4H9OB 2F8NK 2BYKB 3REKC 3MGPC 5AV9B 5GSUB 4J8VA 5B40A 1U35A 1P3AC 4KGCA 1ZLAA 3KUYA 3AZEA 5B2IB 4R8PA 3AZHA 4AWLB 3KXBC 2NZDA 3MGSA 1P34C 2FJ7A 5GT0B 4J8UC 5B32C 4Z66A 3UTAB 1P3PD 4M6BA 3WAAC 3W97D 3WA9B 3AZGD 1H3OB 4WNNB 5BT1C 5AY8D 3C1BB 5CP6D 3LZ0B 1S32C 4H9PA 2F8NG 2AROC 1P3FD 5F99B 1TAFA 1P3LB 3AZFC 1P3PA 5AVBD 1F1EA 3WTPE 3MGPB 3REKB 5G49B 3WKJD 3W97A 3AZGA 3VH6T 2JSSA 4WU9D 3NQJA 5AY8A 1P3AB 4XUJC 5CP6A 1ULYA 3REJD 3REHC 1P3FA 2L5AA 3KXBB 5BO0A 5CPKA 1P3OC 1P34B 3A6ND 4J8UB 5B32B 5AVBA 3WKJA 1BH9A 5E5AA 4WU9A 2BYMA 3WAAB 1TZYC 1EQZC 3AZJC 5B0YC 3X1UD 3REJA 1S32B 5JRGD 4J8WD 1P3KD 3B6FD 2AROB 4Z5TC 4J8VC 3AZKC 1P3MC 5BNVB 3A6NA 4UUZA 4KGCC 3R45A 3X1TC 3VH5T 3AZFB 3KUYC 4R8PC 3LJAD 4H9RA 3AZHC 3AV1D 2NZDC 4WU8D 3TU4B 3RELD 3UTBC 3X1VD 1AOID 3AZLD 1KX4D 2YFWA 3X1UA 5GXQD 5JRGA 4J8WA 1P3KA 3B6GD 3B6FA 3REHB 4DRBA 3C1CD 4KUDC 3AZND 2CV5D 1P3OB 5KDMA 1BH8B 3VH5A 3AN2D 1P3ID 3LJAA 3AYWD 3W99C 3AV1A 1KX5D 3MGQD 5B0ZD 4WU8A 5DNMC 3AZMD 1TZYB 5JA4B 3RELA 3KWQC 3X1VA 3REID 3AZLA 1KX4A 1AOIA 1EQZB 3LZ1D 4YS3D 1M19C 5GXQA 3AZJB 5B1MD 5B0YB 5BNXA 4NE3A 3C1CA 4Z5TB 4J8VB 4NFTA 3AZKB 3AZNA 2HIOD 2CV5A 1P3MB 4KGCB 3X1TB 4JJND 3AN2A 1P3IA 3AYWA 5CPIC 4R8PB 4KHAA 1KX5A 3MGQA 2F8ND 5B0ZA 3AZHB 3AZMA 1A7WA 3REIA 2NZDB 1ID3D 3LZ1A 3UTBB 1Q9CA 4YS3A 1ZLAD 5B1MA 5CPJD 3W98C 5AVBC 1HQ3D 4YM6D 1P3GD 3LELD 3WKJC 3X1SD 2HIOA 4XZQC 4WU9C 4KUDB 2FJ7D 1KX3C 3W96C 3O62D 4CSRB 4Z66D 4JJNA 4H9PB 3WTPD 1M18D 2F8NA 5FUGA 3W99B 5DNMB 1ID3A 4CAYB 3KWQB 5CPJA 4E44A 1M19B 1HQ3A 4YM6A 2NQBC 1P3GA 3LELA 1M1AC 3X1SA 5B2JD 5B1LD 1JFIB 3NQJB 3O62A 3NQUB 4ZBJC 5JRGC 3WTPA 1M18A 5CPIB 4H9SA 5AVCD 3AFAD 5AV5C 5BO0B 3MGRD 3W98B 4NE5A 5AVBB 1N1JA 3WKJB 5B2JA 5B1LA 5CPKD 4X23C 4WU9B 4XZQB 3X1VC 1KX3B 5B33C 3W96B 3UT9D 5B31C 5GXQC 2F8NH 3B6GC 3MNNC 5E5AD 5AVCA 3AFAA 4EO5C 4J8XC 3AZNC 2CV5C 3MGRA 5GT0D 5C3IC 3UTAD 4H9OA 2NQBB 1P3IC 3AYWC 3B0CT 3AZID 3B0BA 1KX5C 3MGQC 1M1AB 5B0ZC 1P3BC 3WA9D 2CWEA 3REIC 3UT9A 4H9QA 4ZUXD 3VH6W 5DNNC 4YS3C 5B1MC 5GT3D 2YFWB 3LZ0D 3MVDC 4LD9D 4ZBJB 5JRGB 5BS7A 5F99D 3VH6A 4QLCC 1P3LD 5AV5B 5GT0A 5AV8C 5AV6D 2PYOD 3AV2C 3UTAA 4JJNC 3AZIA 5B40C 3WA9A 1H3OA 1U35C 4X23B 1P3AD 1ID3C 3X1VB 5B33B 4ZUXA 1ZLAC 4LD9A 5GT3A 5B31B 3LZ0A 3AZEC 5CPJC 5GXQB 3B6GB 5F99A 3MNNB 3LELC 5BNXB 3KXBD 3X1SC 3MGSC 4EO5B 4XUJB 4J8XB 5AV6A 3AZNB 2CV5B 1P3LA 1P34D 2FJ7C 2PYOA 4Z66C 5C3IB 4J8UD 1F66D 2RVQD 1P3IB 1M18C 3VH5W 4KHAB 4G92C 1KX5B 3MGQB 3WAAD 5B0ZB 1P3AA 1P3BB 4E45A 5BT1D 3REIB 4HGAC 2YFVB 4YS3B 3MVDB 5DNNB 5B1MB 2AROD 3KXBA 5B1LC 4QLCB 1P34A 5AV8B 4J8UA 3AZFD 3AV2B 1P3PC 1F66A 4H9NB 4JJNB 3W97C 3AZGC 5B40B 3WAAA 3AFAC 1U35B 5AY8C 3TU4D 5CP6C 1ZLAB 3KUYB 5CPJB 3AZEB 1P3FC 2AROA 3REHD 1HTAA 3LELB 5CPKC 3X1SB 3MGSB 5BNVA 2FJ7B 3UT9C 4Z66B 3AZFA 5E5AC 1M18B 5B32G 3TU4A 1TZYD 2NQBD 4HGAB 3REJC 1B67A 3AZJD 5B0YD 3REHA 3AZIC 1KU5A 4Z5TD 1TAFB 3AZKD 3A6NC 1P3MD 4ZUXC 3X1TD 4LD9C 1BH8A 5GT3C 1P3PB 3W97B 3AZGB 1TZYA 5JA4A 3AFAB 4G91C 5AY8B 5AV6C 3UTBD 2PYOC 4DRAA 5CP6B 3X1UC 3AZJA 5B0YA 4J8WC 1P3KC 3B6FC 1P3FB 4Z5TA 5B24D 1WWIA 3AZKA 5CPKB 4KUDD 1P3MA 3X1TA 3UT9B 4H9QB 5AV9D 3LJAC 5GSUD 1BH9B 3AV1C 5E5AB 3W99D 4WU8C 2BYMB 3RELC 1AOIC 5DNMD 3AZLC 1KX4C 3UTBA 3KWQD 1M19D 3REJB 1B6WA 3V9RA 5B2ID 1F66C 2RVQC 3C1CC 3AZIB 5B24A 4KUDA 3A6NB 4UUZB 4CSRA 3R45B 2BYKA 4ZUXB 4LD9B 3AN2C 5GT3B 5AV9A 5GSUA 5CPID 3W99A 4H9RB 3AZMC 5DNMA 3C1BD 4CAYA 4G91B 3LZ1C 3KWQA 5AV6B 2PYOB 1M19A 3X1UB 5B2IA 3W98D 2HUEC 4J8WB 1P3KB 3B6FB 2HIOC 1JFIA 4XZQD 3TU4C 3B0CW 4WV4B 3NQUA 5KDMB 1KX3D 3W96D 3B0DC 3REKD 3MGPD 3LJAB 5CPIA 3AV1B 4WNNA 4WU8B 3C1BA 3RELB 1BFMA 1AOIB 3AZLB 1KX4B 3W98A 1HQ3C 4YM6C 1F66B 1R4VA 1P3GC
chains in the Genus database with same CATH superfamily
3C1CB 2LY8A 5CHLB 1M1AD 4XZQA 1KX3A 3W96A 3O62C 5B32D 3REKA 3AN2B 3MGPA 5G49A 3WTPC 3AYWB 4H9SC 3AZMB 2IO5C 5AV5D 3LZ1B 1S32D 2NQBA 2HUEB 5B2JC 1M1AA 2HIOB 4X23D 5B32A 4NE6A 5B33D 3B0DB 5B31D 3MNND 5AVCC 2F8NB 5FUGB 1Z2CB 5B24C 3MGRC 4J8XD 4XUJD 5AV5A 1ID3B 3F6TA 4DQYB 1S32A 1HQ3B 4YM6B 5AV9C 5GSUC 1P3GB 1PZRA 4Z2MG 4X23A 1P3BD 1P3OD 5B33A 3O62B 5B31A 3MVDD 5DNND 5B2IC 3B6GA 5BS7C 3MNNA 3WTPB 4AWLC 4G92B 4Z2MH 4J8XA 4XUJA 1EQZD 5GT0C 2IO5B 4QLCD 5AV8D 3UTAC 3AV2D 2G5IC 1N1JB 3WA9C 5B2JB 4J8VD 5B40D 5B1LB 4WZSB 1P3BA 1U35D 1P3OA 3C1BC 4KGCD 3EPJA 2YFVA 3LZ0C 3MVDA 5DNNA 3KUYD 4UPKA 3AZED 1WWSA 5F99C 3V9RB 4R8PD 3AZHD 5AVCB 1EQZA 3KSYA 5B24B 5B31G 1P3LC 3MGSD 4QLCA 3MGRB 2NZDD 5AV8A 3AV2A 4H9NA 4H9OB 2F8NK 2BYKB 3REKC 3MGPC 5AV9B 5GSUB 4J8VA 5B40A 1U35A 1P3AC 4KGCA 2J8PA 1ZLAA 3KUYA 3AZEA 5B2IB 4R8PA 3AZHA 4AWLB 3KXBC 2NZDA 3MGSA 1P34C 2FJ7A 5GT0B 4J8UC 5B32C 4Z66A 3UTAB 1P3PD 2Y2IA 4M6BA 3WAAC 3W97D 3WA9B 3AZGD 1H3OB 4WNNB 5BT1C 5AY8D 3C1BB 5CP6D 2F2AC 3LZ0B 1S32C 4H9PA 2F8NG 2AROC 1P3FD 5F99B 1TAFA 1P3LB 3AZFC 1P3PA 5AVBD 1F1EA 3WTPE 3MGPB 3REKB 5G49B 1W2EA 3W97A 3WKJD 3AZGA 3VH6T 2JSSA 4WU9D 3NQJA 5AY8A 1P3AB 4XUJC 5CP6A 1ULYA 2DQNC 3REHC 3REJD 1P3FA 2L5AA 3A1KA 3EPKA 3KXBB 2DF4C 5BO0A 5CPKA 3EPLA 1P3OC 1P34B 3A6ND 4J8UB 5B32B 5AVBA 3WKJA 1BH9A 2UWXA 5E5AA 2ZY5A 2BYMA 4WU9A 1TZYC 3WAAB 1EQZC 3AZJC 5B0YC 3X1UD 3REJA 1S32B 5JRGD 4J8WD 1P3KD 3B6FD 2AROB 4Z5TC 4J8VC 3AZKC 1P3MC 5BNVB 3A6NA 4UUZA 4KGCC 3R45A 3X1TC 3VH5T 3AZFB 3KUYC 4R8PC 3LJAD 4H9RA 3AZHC 3AV1D 3H0LC 2NZDC 4WU8D 3TU4B 3RELD 3UTBC 3X1VD 1AOID 3AZLD 1KX4D 2YFWA 3X1UA 5GXQD 5JRGA 4J8WA 1P3KA 3B6GD 3B6FA 3REHB 4DRBA 3C1CD 4KUDC 3AZND 2CV5D 3IP4C 5KDMA 1P3OB 1BH8B 2ZY4A 3VH5A 3AN2D 1P3ID 3LJAA 3AYWD 3W99C 3AV1A 1KX5D 3MGQD 5B0ZD 4WU8A 5DNMC 3AZMD 1TZYB 5JA4B 3RELA 3KWQC 3X1VA 3REID 3AZLA 1KX4A 1AOIA 1EQZB 3LZ1D 4YS3D 1M19C 5GXQA 3AZJB 5B1MD 5B0YB 5BNXA 4NE3A 3C1CA 3H0RC 4Z5TB 4J8VB 4NFTA 3AZKB 3AZNA 2HIOD 2CV5A 1P3MB 2VQRA 4KGCB 3X1TB 4JJND 3AN2A 1P3IA 3AYWA 5CPIC 4R8PB 4KHAA 1KX5A 3MGQA 2F8ND 5B0ZA 3AZHB 3AZMA 2RIQA 1A7WA 3REIA 2NZDB 1ID3D 3LZ1A 3UTBB 1Q9CA 4YS3A 1ZLAD 5B1MA 5CPJD 3W98C 5AVBC 1HQ3D 4YM6D 2FFFB 2BG1A 1P3GD 3LELD 3WKJC 4WJ3C 3X1SD 2HIOA 4XZQC 4WU9C 4KUDB 2FJ7D 1KX3C 3W96C 3O62D 4CSRB 2Y2LA 4Z66D 4JJNA 4H9PB 3FDDA 3WTPD 1M18D 2F8NA 5FUGA 3W99B 2ZM5A 5DNMB 1ID3A 4CAYB 3KWQB 5CPJA 1T3UA 4E44A 1M19B 1HQ3A 4YM6A 3P5JB 2NQBC 1P3GA 3LELA 1M1AC 3X1SA 5B2JD 5B1LD 2ZY3A 1JFIB 2Y2OA 3NQJB 3O62A 3NQUB 4ZBJC 5JRGC 3WTPA 1M18A 5CPIB 2Y2PA 4H9SA 5AVCD 3AFAD 5AV5C 5BO0B 3MGRD 2W8SA 3W98B 4NE5A 5AVBB 1N1JA 3WKJB 5B2JA 5B1LA 5CPKD 4X23C 4WU9B 4XZQB 3X1VC 1KX3B 3A1IA 5B33C 3W96B 3UT9D 5B31C 5GXQC 2F8NH 3B6GC 3MNNC 5E5AD 5AVCA 3AFAA 4EO5C 4J8XC 3AZNC 2CV5C 3MGRA 5GT0D 5C3IC 3UTAD 4H9OA 2NQBB 1P3IC 3AYWC 3B0CT 3AZID 3EPHA 3B0BA 1KX5C 3MGQC 1M1AB 5B0ZC 1P3BC 3WA9D 2CWEA 3REIC 3UT9A 4H9QA 4ZUXD 3VH6W 5DNNC 4YS3C 5B1MC 5GT3D 2YFWB 3LZ0D 3MVDC 4LD9D 2Y2NA 4ZBJB 5BS7A 5JRGB 5F99D 3VH6A 4QLCC 1P3LD 5AV5B 5GT0A 5AV8C 5AV6D 2PYOD 3AV2C 3UTAA 4JJNC 3AZIA 5B40C 3WA9A 1H3OA 2Y2GA 1U35C 4X23B 1P3AD 1ID3C 3X1VB 3AL0C 5B33B 4ZUXA 1ZLAC 4LD9A 5GT3A 5B31B 3LZ0A 3AZEC 5CPJC 5GXQB 3B6GB 5F99A 3MNNB 3LELC 5BNXB 3KXBD 3X1SC 3MGSC 4EO5B 4XUJB 4J8XB 5AV6A 3AZNB 2CV5B 1P3LA 1P34D 2FJ7C 2PYOA 4Z66C 5C3IB 4J8UD 1F66D 2RVQD 1P3IB 1M18C 3VH5W 4KHAB 4G92C 1KX5B 3MGQB 3WAAD 5B0ZB 1P3AA 1P3BB 2Y2MA 4E45A 5BT1D 3REIB 2JCHA 4HGAC 2JE5A 2YFVB 4YS3B 3MVDB 5DNNB 5B1MB 2AROD 3KXBA 5B1LC 4QLCB 1P34A 5AV8B 4J8UA 3AZFD 3AV2B 1P3PC 1F66A 4H9NB 4JJNB 3W97C 3AZGC 5B40B 3WAAA 3AFAC 1U35B 5AY8C 3TU4D 5CP6C 1ZLAB 3KUYB 5CPJB 3AZEB 1P3FC 2AROA 3REHD 2G5HC 1HTAA 3LELB 5CPKC 3X1SB 3MGSB 5BNVA 2FJ7B 2Y2JA 3UT9C 4Z66B 3AZFA 5E5AC 1M18B 5B32G 3TU4A 1TZYD 2NQBD 2Y2KA 4HGAB 3REJC 1B67A 3AZJD 5B0YD 3REHA 3EG5B 3AZIC 1KU5A 4Z5TD 1TAFB 3AZKD 3A6NC 1P3MD 4ZUXC 3X1TD 4LD9C 1BH8A 5GT3C 1P3PB 3KFUG 3W97B 3AZGB 1TZYA 5JA4A 3AFAB 4G91C 5AY8B 5AV6C 3UTBD 2PYOC 4DRAA 5CP6B 3X1UC 3AZJA 5B0YA 4J8WC 1P3KC 3B6FC 1P3FB 4Z5TA 5B24D 1WWIA 3AZKA 5CPKB 4KUDD 1P3MA 3X1TA 3UT9B 2XD5A 4H9QB 3H0MC 5AV9D 3LJAC 5GSUD 1BH9B 3AV1C 5E5AB 3W99D 4WU8C 2BYMB 3RELC 1AOIC 5DNMD 3AZLC 1KX4C 3UTBA 2XD1A 3KWQD 2Y2HA 1M19D 3REJB 1B6WA 3V9RA 5B2ID 1F66C 2RVQC 3C1CC 3AZIB 5B24A 4KUDA 2Y2QA 3A6NB 4UUZB 4CSRA 3R45B 2BYKA 4ZUXB 4LD9B 3AN2C 5GT3B 5AV9A 5GSUA 5CPID 3W99A 4H9RB 3AZMC 5DNMA 3C1BD 4CAYA 4G91B 3LZ1C 3KWQA 5AV6B 2PYOB 1M19A 3X1UB 5B2IA 3W98D 2HUEC 4J8WB 1P3KB 3B6FB 2ZY2A 2HIOC 1JFIA 4XZQD 3TU4C 3B0CW 4WV4B 3NQUA 5KDMB 1KX3D 3W96D 3B0DC 3REKD 3MGPD 3LJAB 5CPIA 3AV1B 4WNNA 4WU8B 3C1BA 3RELB 1BFMA 1AOIB 3AZLB 1KX4B 3W98A 1HQ3C 4YM6C 1F66B 1R4VA 1P3GC
chains in the Genus database with same CATH topology
3C1CB 2LY8A 5CHLB 1M1AD 4XZQA 1KX3A 3W96A 3O62C 5B32D 3REKA 3AN2B 3MGPA 5G49A 3WTPC 3AYWB 4H9SC 3AZMB 2IO5C 5AV5D 3LZ1B 1S32D 2NQBA 2HUEB 5B2JC 1M1AA 2HIOB 4X23D 5B32A 4NE6A 5B33D 3B0DB 5B31D 3MNND 5AVCC 2F8NB 5FUGB 1Z2CB 5B24C 3MGRC 4J8XD 4XUJD 5AV5A 1ID3B 3F6TA 4DQYB 1S32A 1HQ3B 4YM6B 5AV9C 5GSUC 1P3GB 1PZRA 4Z2MG 4X23A 1P3BD 1P3OD 5B33A 3O62B 5B31A 3MVDD 5DNND 5B2IC 3B6GA 5BS7C 3MNNA 3WTPB 4AWLC 4G92B 4Z2MH 4J8XA 4XUJA 1EQZD 5GT0C 2IO5B 4QLCD 5AV8D 3UTAC 3AV2D 2G5IC 1N1JB 3WA9C 5B2JB 4J8VD 5B40D 5B1LB 4WZSB 1P3BA 1U35D 1P3OA 3C1BC 4KGCD 3EPJA 2YFVA 3LZ0C 3MVDA 5DNNA 3KUYD 4UPKA 3AZED 1WWSA 5F99C 3V9RB 4R8PD 3AZHD 5AVCB 1EQZA 3KSYA 5B24B 5B31G 1P3LC 3MGSD 4QLCA 3MGRB 2NZDD 5AV8A 3AV2A 4H9NA 4H9OB 2F8NK 2BYKB 3REKC 3MGPC 5AV9B 5GSUB 4J8VA 5B40A 1U35A 1P3AC 4KGCA 2J8PA 1ZLAA 3KUYA 3AZEA 5B2IB 4R8PA 3AZHA 4AWLB 3KXBC 2NZDA 3MGSA 1P34C 2FJ7A 5GT0B 4J8UC 5B32C 4Z66A 3UTAB 1P3PD 2Y2IA 4M6BA 3WAAC 3W97D 3WA9B 3AZGD 1H3OB 4WNNB 5BT1C 5AY8D 3C1BB 5CP6D 2F2AC 3LZ0B 1S32C 4H9PA 2F8NG 2AROC 1P3FD 5F99B 1TAFA 1P3LB 3AZFC 1P3PA 5AVBD 1F1EA 3WTPE 3MGPB 3REKB 5G49B 1W2EA 3W97A 3WKJD 3AZGA 3VH6T 2JSSA 4WU9D 3NQJA 5AY8A 1P3AB 4XUJC 5CP6A 1ULYA 2DQNC 3REHC 3REJD 1P3FA 2L5AA 3A1KA 3EPKA 3KXBB 2DF4C 5BO0A 5CPKA 3EPLA 1P3OC 1P34B 3A6ND 4J8UB 5B32B 5AVBA 3WKJA 1BH9A 2UWXA 5E5AA 2ZY5A 2BYMA 4WU9A 1TZYC 3WAAB 1EQZC 3AZJC 5B0YC 3X1UD 3REJA 1S32B 5JRGD 4J8WD 1P3KD 3B6FD 2AROB 4Z5TC 4J8VC 3AZKC 1P3MC 5BNVB 3A6NA 4UUZA 4KGCC 3R45A 3X1TC 3VH5T 3AZFB 3KUYC 4R8PC 3LJAD 4H9RA 3AZHC 3AV1D 3H0LC 2NZDC 4WU8D 3TU4B 3RELD 3UTBC 3X1VD 1AOID 3AZLD 1KX4D 2YFWA 3X1UA 5GXQD 5JRGA 4J8WA 1P3KA 3B6GD 3B6FA 3REHB 4DRBA 3C1CD 4KUDC 3AZND 2CV5D 3IP4C 5KDMA 1P3OB 1BH8B 2ZY4A 3VH5A 3AN2D 1P3ID 3LJAA 3AYWD 3W99C 3AV1A 1KX5D 3MGQD 5B0ZD 4WU8A 5DNMC 3AZMD 1TZYB 5JA4B 3RELA 3KWQC 3X1VA 3REID 3AZLA 1KX4A 1AOIA 1EQZB 3LZ1D 4YS3D 1M19C 5GXQA 3AZJB 5B1MD 5B0YB 5BNXA 4NE3A 3C1CA 3H0RC 4Z5TB 4J8VB 4NFTA 3AZKB 3AZNA 2HIOD 2CV5A 1P3MB 2VQRA 4KGCB 3X1TB 4JJND 3AN2A 1P3IA 3AYWA 5CPIC 4R8PB 4KHAA 1KX5A 3MGQA 2F8ND 5B0ZA 3AZHB 3AZMA 2RIQA 1A7WA 3REIA 2NZDB 1ID3D 3LZ1A 3UTBB 1Q9CA 4YS3A 1ZLAD 5B1MA 5CPJD 3W98C 5AVBC 1HQ3D 4YM6D 2FFFB 2BG1A 1P3GD 3LELD 3WKJC 4WJ3C 3X1SD 2HIOA 4XZQC 4WU9C 4KUDB 2FJ7D 1KX3C 3W96C 3O62D 4CSRB 2Y2LA 4Z66D 4JJNA 4H9PB 3FDDA 3WTPD 1M18D 2F8NA 5FUGA 3W99B 2ZM5A 5DNMB 1ID3A 4CAYB 3KWQB 5CPJA 1T3UA 4E44A 1M19B 1HQ3A 4YM6A 3P5JB 2NQBC 1P3GA 3LELA 1M1AC 3X1SA 5B2JD 5B1LD 2ZY3A 1JFIB 2Y2OA 3NQJB 3O62A 3NQUB 4ZBJC 5JRGC 3WTPA 1M18A 5CPIB 2Y2PA 4H9SA 5AVCD 3AFAD 5AV5C 5BO0B 3MGRD 2W8SA 3W98B 4NE5A 5AVBB 1N1JA 3WKJB 5B2JA 5B1LA 5CPKD 4X23C 4WU9B 4XZQB 3X1VC 1KX3B 3A1IA 5B33C 3W96B 3UT9D 5B31C 5GXQC 2F8NH 3B6GC 3MNNC 5E5AD 5AVCA 3AFAA 4EO5C 4J8XC 3AZNC 2CV5C 3MGRA 5GT0D 5C3IC 3UTAD 4H9OA 2NQBB 1P3IC 3AYWC 3B0CT 3AZID 3EPHA 3B0BA 1KX5C 3MGQC 1M1AB 5B0ZC 1P3BC 3WA9D 2CWEA 3REIC 3UT9A 4H9QA 4ZUXD 3VH6W 5DNNC 4YS3C 5B1MC 5GT3D 2YFWB 3LZ0D 3MVDC 4LD9D 2Y2NA 4ZBJB 5BS7A 5JRGB 5F99D 3VH6A 4QLCC 1P3LD 5AV5B 5GT0A 5AV8C 5AV6D 2PYOD 3AV2C 3UTAA 4JJNC 3AZIA 5B40C 3WA9A 1H3OA 2Y2GA 1U35C 4X23B 1P3AD 1ID3C 3X1VB 3AL0C 5B33B 4ZUXA 1ZLAC 4LD9A 5GT3A 5B31B 3LZ0A 3AZEC 5CPJC 5GXQB 3B6GB 5F99A 3MNNB 3LELC 5BNXB 3KXBD 3X1SC 3MGSC 4EO5B 4XUJB 4J8XB 5AV6A 3AZNB 2CV5B 1P3LA 1P34D 2FJ7C 2PYOA 4Z66C 5C3IB 4J8UD 1F66D 2RVQD 1P3IB 1M18C 3VH5W 4KHAB 4G92C 1KX5B 3MGQB 3WAAD 5B0ZB 1P3AA 1P3BB 2Y2MA 4E45A 5BT1D 3REIB 2JCHA 4HGAC 2JE5A 2YFVB 4YS3B 3MVDB 5DNNB 5B1MB 2AROD 3KXBA 5B1LC 4QLCB 1P34A 5AV8B 4J8UA 3AZFD 3AV2B 1P3PC 1F66A 4H9NB 4JJNB 3W97C 3AZGC 5B40B 3WAAA 3AFAC 1U35B 5AY8C 3TU4D 5CP6C 1ZLAB 3KUYB 5CPJB 3AZEB 1P3FC 2AROA 3REHD 2G5HC 1HTAA 3LELB 5CPKC 3X1SB 3MGSB 5BNVA 2FJ7B 2Y2JA 3UT9C 4Z66B 3AZFA 5E5AC 1M18B 5B32G 3TU4A 1TZYD 2NQBD 2Y2KA 4HGAB 3REJC 1B67A 3AZJD 5B0YD 3REHA 3EG5B 3AZIC 1KU5A 4Z5TD 1TAFB 3AZKD 3A6NC 1P3MD 4ZUXC 3X1TD 4LD9C 1BH8A 5GT3C 1P3PB 3KFUG 3W97B 3AZGB 1TZYA 5JA4A 3AFAB 4G91C 5AY8B 5AV6C 3UTBD 2PYOC 4DRAA 5CP6B 3X1UC 3AZJA 5B0YA 4J8WC 1P3KC 3B6FC 1P3FB 4Z5TA 5B24D 1WWIA 3AZKA 5CPKB 4KUDD 1P3MA 3X1TA 3UT9B 2XD5A 4H9QB 3H0MC 5AV9D 3LJAC 5GSUD 1BH9B 3AV1C 5E5AB 3W99D 4WU8C 2BYMB 3RELC 1AOIC 5DNMD 3AZLC 1KX4C 3UTBA 2XD1A 3KWQD 2Y2HA 1M19D 3REJB 1B6WA 3V9RA 5B2ID 1F66C 2RVQC 3C1CC 3AZIB 5B24A 4KUDA 2Y2QA 3A6NB 4UUZB 4CSRA 3R45B 2BYKA 4ZUXB 4LD9B 3AN2C 5GT3B 5AV9A 5GSUA 5CPID 3W99A 4H9RB 3AZMC 5DNMA 3C1BD 4CAYA 4G91B 3LZ1C 3KWQA 5AV6B 2PYOB 1M19A 3X1UB 5B2IA 3W98D 2HUEC 4J8WB 1P3KB 3B6FB 2ZY2A 2HIOC 1JFIA 4XZQD 3TU4C 3B0CW 4WV4B 3NQUA 5KDMB 1KX3D 3W96D 3B0DC 3REKD 3MGPD 3LJAB 5CPIA 3AV1B 4WNNA 4WU8B 3C1BA 3RELB 1BFMA 1AOIB 3AZLB 1KX4B 3W98A 1HQ3C 4YM6C 1F66B 1R4VA 1P3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C B;  2LY8 A;  5CHL B;  1M1A D;  4XZQ A;  1KX3 A;  3W96 A;  3O62 C;  5B32 D;  3REK A;  3AN2 B;  3MGP A;  5G49 A;  3WTP C;  3AYW B;  4H9S C;  3AZM B;  2IO5 C;  5AV5 D;  3LZ1 B;  1S32 D;  2NQB A;  2HUE B;  5B2J C;  1M1A A;  2HIO B;  4X23 D;  5B32 A;  4NE6 A;  5B33 D;  3B0D B;  5B31 D;  3MNN D;  5AVC C;  2F8N B;  5FUG B;  5B24 C;  3MGR C;  4J8X D;  4XUJ D;  5AV5 A;  1ID3 B;  1S32 A;  1HQ3 B;  4YM6 B;  5AV9 C;  5GSU C;  1P3G B;  4Z2M G;  4X23 A;  1P3B D;  1P3O D;  5B33 A;  3O62 B;  5B31 A;  3MVD D;  5DNN D;  5B2I C;  3B6G A;  5BS7 C;  3MNN A;  3WTP B;  4AWL C;  4G92 B;  4Z2M H;  4J8X A;  4XUJ A;  1EQZ D;  5GT0 C;  2IO5 B;  4QLC D;  5AV8 D;  3UTA C;  3AV2 D;  1N1J B;  3WA9 C;  5B2J B;  4J8V D;  5B40 D;  5B1L B;  4WZS B;  1P3B A;  1U35 D;  1P3O A;  3C1B C;  4KGC D;  2YFV A;  3LZ0 C;  3MVD A;  5DNN A;  3KUY D;  3AZE D;  1WWS A;  5F99 C;  3V9R B;  4R8P D;  3AZH D;  5AVC B;  1EQZ A;  3KSY A;  5B24 B;  5B31 G;  1P3L C;  3MGS D;  4QLC A;  3MGR B;  2NZD D;  5AV8 A;  3AV2 A;  4H9N A;  4H9O B;  2F8N K;  2BYK B;  3REK C;  3MGP C;  5AV9 B;  5GSU B;  4J8V A;  5B40 A;  1U35 A;  1P3A C;  4KGC A;  1ZLA A;  3KUY A;  3AZE A;  5B2I B;  4R8P A;  3AZH A;  4AWL B;  3KXB C;  2NZD A;  3MGS A;  1P34 C;  2FJ7 A;  5GT0 B;  4J8U C;  5B32 C;  4Z66 A;  3UTA B;  1P3P D;  4M6B A;  3WAA C;  3W97 D;  3WA9 B;  3AZG D;  1H3O B;  4WNN B;  5BT1 C;  5AY8 D;  3C1B B;  5CP6 D;  3LZ0 B;  1S32 C;  4H9P A;  2F8N G;  2ARO C;  1P3F D;  5F99 B;  1TAF A;  1P3L B;  3AZF C;  1P3P A;  5AVB D;  1F1E A;  3WTP E;  3MGP B;  3REK B;  5G49 B;  3WKJ D;  3W97 A;  3AZG A;  3VH6 T;  2JSS A;  4WU9 D;  3NQJ A;  5AY8 A;  1P3A B;  4XUJ C;  5CP6 A;  1ULY A;  3REJ D;  3REH C;  1P3F A;  2L5A A;  3KXB B;  5BO0 A;  5CPK A;  1P3O C;  1P34 B;  3A6N D;  4J8U B;  5B32 B;  5AVB A;  3WKJ A;  1BH9 A;  5E5A A;  4WU9 A;  2BYM A;  3WAA B;  1TZY C;  1EQZ C;  3AZJ C;  5B0Y C;  3X1U D;  3REJ A;  1S32 B;  5JRG D;  4J8W D;  1P3K D;  3B6F D;  2ARO B;  4Z5T C;  4J8V C;  3AZK C;  1P3M C;  5BNV B;  3A6N A;  4UUZ A;  4KGC C;  3R45 A;  3X1T C;  3VH5 T;  3AZF B;  3KUY C;  4R8P C;  3LJA D;  4H9R A;  3AZH C;  3AV1 D;  2NZD C;  4WU8 D;  3TU4 B;  3REL D;  3UTB C;  3X1V D;  1AOI D;  3AZL D;  1KX4 D;  2YFW A;  3X1U A;  5GXQ D;  5JRG A;  4J8W A;  1P3K A;  3B6G D;  3B6F A;  3REH B;  4DRB A;  3C1C D;  4KUD C;  3AZN D;  2CV5 D;  1P3O B;  5KDM A;  1BH8 B;  3VH5 A;  3AN2 D;  1P3I D;  3LJA A;  3AYW D;  3W99 C;  3AV1 A;  1KX5 D;  3MGQ D;  5B0Z D;  4WU8 A;  5DNM C;  3AZM D;  1TZY B;  5JA4 B;  3REL A;  3KWQ C;  3X1V A;  3REI D;  3AZL A;  1KX4 A;  1AOI A;  1EQZ B;  3LZ1 D;  4YS3 D;  1M19 C;  5GXQ A;  3AZJ B;  5B1M D;  5B0Y B;  5BNX A;  4NE3 A;  3C1C A;  4Z5T B;  4J8V B;  4NFT A;  3AZK B;  3AZN A;  2HIO D;  2CV5 A;  1P3M B;  4KGC B;  3X1T B;  4JJN D;  3AN2 A;  1P3I A;  3AYW A;  5CPI C;  4R8P B;  4KHA A;  1KX5 A;  3MGQ A;  2F8N D;  5B0Z A;  3AZH B;  3AZM A;  1A7W A;  3REI A;  2NZD B;  1ID3 D;  3LZ1 A;  3UTB B;  1Q9C A;  4YS3 A;  1ZLA D;  5B1M A;  5CPJ D;  3W98 C;  5AVB C;  1HQ3 D;  4YM6 D;  1P3G D;  3LEL D;  3WKJ C;  3X1S D;  2HIO A;  4XZQ C;  4WU9 C;  4KUD B;  2FJ7 D;  1KX3 C;  3W96 C;  3O62 D;  4CSR B;  4Z66 D;  4JJN A;  4H9P B;  3WTP D;  1M18 D;  2F8N A;  5FUG A;  3W99 B;  5DNM B;  1ID3 A;  4CAY B;  3KWQ B;  5CPJ A;  4E44 A;  1M19 B;  1HQ3 A;  4YM6 A;  2NQB C;  1P3G A;  3LEL A;  1M1A C;  3X1S A;  5B2J D;  5B1L D;  1JFI B;  3NQJ B;  3O62 A;  3NQU B;  4ZBJ C;  5JRG C;  3WTP A;  1M18 A;  5CPI B;  4H9S A;  5AVC D;  3AFA D;  5AV5 C;  5BO0 B;  3MGR D;  3W98 B;  4NE5 A;  5AVB B;  1N1J A;  3WKJ B;  5B2J A;  5B1L A;  5CPK D;  4X23 C;  4WU9 B;  4XZQ B;  3X1V C;  1KX3 B;  5B33 C;  3W96 B;  3UT9 D;  5B31 C;  5GXQ C;  2F8N H;  3B6G C;  3MNN C;  5E5A D;  5AVC A;  3AFA A;  4EO5 C;  4J8X C;  3AZN C;  2CV5 C;  3MGR A;  5GT0 D;  5C3I C;  3UTA D;  4H9O A;  2NQB B;  1P3I C;  3AYW C;  3B0C T;  3AZI D;  3B0B A;  1KX5 C;  3MGQ C;  1M1A B;  5B0Z C;  1P3B C;  3WA9 D;  2CWE A;  3REI C;  3UT9 A;  4H9Q A;  4ZUX D;  3VH6 W;  5DNN C;  4YS3 C;  5B1M C;  5GT3 D;  2YFW B;  3LZ0 D;  3MVD C;  4LD9 D;  4ZBJ B;  5JRG B;  5BS7 A;  5F99 D;  3VH6 A;  4QLC C;  1P3L D;  5AV5 B;  5GT0 A;  5AV8 C;  5AV6 D;  2PYO D;  3AV2 C;  3UTA A;  4JJN C;  3AZI A;  5B40 C;  3WA9 A;  1H3O A;  1U35 C;  4X23 B;  1P3A D;  1ID3 C;  3X1V B;  5B33 B;  4ZUX A;  1ZLA C;  4LD9 A;  5GT3 A;  5B31 B;  3LZ0 A;  3AZE C;  5CPJ C;  5GXQ B;  3B6G B;  5F99 A;  3MNN B;  3LEL C;  5BNX B;  3KXB D;  3X1S C;  3MGS C;  4EO5 B;  4XUJ B;  4J8X B;  5AV6 A;  3AZN B;  2CV5 B;  1P3L A;  1P34 D;  2FJ7 C;  2PYO A;  4Z66 C;  5C3I B;  4J8U D;  1F66 D;  2RVQ D;  1P3I B;  1M18 C;  3VH5 W;  4KHA B;  4G92 C;  1KX5 B;  3MGQ B;  3WAA D;  5B0Z B;  1P3A A;  1P3B B;  4E45 A;  5BT1 D;  3REI B;  4HGA C;  2YFV B;  4YS3 B;  3MVD B;  5DNN B;  5B1M B;  2ARO D;  3KXB A;  5B1L C;  4QLC B;  1P34 A;  5AV8 B;  4J8U A;  3AZF D;  3AV2 B;  1P3P C;  1F66 A;  4H9N B;  4JJN B;  3W97 C;  3AZG C;  5B40 B;  3WAA A;  3AFA C;  1U35 B;  5AY8 C;  3TU4 D;  5CP6 C;  1ZLA B;  3KUY B;  5CPJ B;  3AZE B;  1P3F C;  2ARO A;  3REH D;  1HTA A;  3LEL B;  5CPK C;  3X1S B;  3MGS B;  5BNV A;  2FJ7 B;  3UT9 C;  4Z66 B;  3AZF A;  5E5A C;  1M18 B;  5B32 G;  3TU4 A;  1TZY D;  2NQB D;  4HGA B;  3REJ C;  1B67 A;  3AZJ D;  5B0Y D;  3REH A;  3AZI C;  1KU5 A;  4Z5T D;  1TAF B;  3AZK D;  3A6N C;  1P3M D;  4ZUX C;  3X1T D;  4LD9 C;  1BH8 A;  5GT3 C;  1P3P B;  3W97 B;  3AZG B;  1TZY A;  5JA4 A;  3AFA B;  4G91 C;  5AY8 B;  5AV6 C;  3UTB D;  2PYO C;  4DRA A;  5CP6 B;  3X1U C;  3AZJ A;  5B0Y A;  4J8W C;  1P3K C;  3B6F C;  1P3F B;  4Z5T A;  5B24 D;  1WWI A;  3AZK A;  5CPK B;  4KUD D;  1P3M A;  3X1T A;  3UT9 B;  4H9Q B;  5AV9 D;  3LJA C;  5GSU D;  1BH9 B;  3AV1 C;  5E5A B;  3W99 D;  4WU8 C;  2BYM B;  3REL C;  1AOI C;  5DNM D;  3AZL C;  1KX4 C;  3UTB A;  3KWQ D;  1M19 D;  3REJ B;  1B6W A;  3V9R A;  5B2I D;  1F66 C;  2RVQ C;  3C1C C;  3AZI B;  5B24 A;  4KUD A;  3A6N B;  4UUZ B;  4CSR A;  3R45 B;  2BYK A;  4ZUX B;  4LD9 B;  3AN2 C;  5GT3 B;  5AV9 A;  5GSU A;  5CPI D;  3W99 A;  4H9R B;  3AZM C;  5DNM A;  3C1B D;  4CAY A;  4G91 B;  3LZ1 C;  3KWQ A;  5AV6 B;  2PYO B;  1M19 A;  3X1U B;  5B2I A;  3W98 D;  2HUE C;  4J8W B;  1P3K B;  3B6F B;  2HIO C;  1JFI A;  4XZQ D;  3TU4 C;  3B0C W;  4WV4 B;  3NQU A;  5KDM B;  1KX3 D;  3W96 D;  3B0D C;  3REK D;  3MGP D;  3LJA B;  5CPI A;  3AV1 B;  4WNN A;  4WU8 B;  3C1B A;  3REL B;  1BFM A;  1AOI B;  3AZL B;  1KX4 B;  3W98 A;  1HQ3 C;  4YM6 C;  1F66 B;  1R4V A;  1P3G C; 
#chains in the Genus database with same CATH topology
 3C1C B;  2LY8 A;  5CHL B;  1M1A D;  4XZQ A;  1KX3 A;  3W96 A;  3O62 C;  5B32 D;  3REK A;  3AN2 B;  3MGP A;  5G49 A;  3WTP C;  3AYW B;  4H9S C;  3AZM B;  2IO5 C;  5AV5 D;  3LZ1 B;  1S32 D;  2NQB A;  2HUE B;  5B2J C;  1M1A A;  2HIO B;  4X23 D;  5B32 A;  4NE6 A;  5B33 D;  3B0D B;  5B31 D;  3MNN D;  5AVC C;  2F8N B;  5FUG B;  1Z2C B;  5B24 C;  3MGR C;  4J8X D;  4XUJ D;  5AV5 A;  1ID3 B;  3F6T A;  4DQY B;  1S32 A;  1HQ3 B;  4YM6 B;  5AV9 C;  5GSU C;  1P3G B;  1PZR A;  4Z2M G;  4X23 A;  1P3B D;  1P3O D;  5B33 A;  3O62 B;  5B31 A;  3MVD D;  5DNN D;  5B2I C;  3B6G A;  5BS7 C;  3MNN A;  3WTP B;  4AWL C;  4G92 B;  4Z2M H;  4J8X A;  4XUJ A;  1EQZ D;  5GT0 C;  2IO5 B;  4QLC D;  5AV8 D;  3UTA C;  3AV2 D;  2G5I C;  1N1J B;  3WA9 C;  5B2J B;  4J8V D;  5B40 D;  5B1L B;  4WZS B;  1P3B A;  1U35 D;  1P3O A;  3C1B C;  4KGC D;  3EPJ A;  2YFV A;  3LZ0 C;  3MVD A;  5DNN A;  3KUY D;  4UPK A;  3AZE D;  1WWS A;  5F99 C;  3V9R B;  4R8P D;  3AZH D;  5AVC B;  1EQZ A;  3KSY A;  5B24 B;  5B31 G;  1P3L C;  3MGS D;  4QLC A;  3MGR B;  2NZD D;  5AV8 A;  3AV2 A;  4H9N A;  4H9O B;  2F8N K;  2BYK B;  3REK C;  3MGP C;  5AV9 B;  5GSU B;  4J8V A;  5B40 A;  1U35 A;  1P3A C;  4KGC A;  2J8P A;  1ZLA A;  3KUY A;  3AZE A;  5B2I B;  4R8P A;  3AZH A;  4AWL B;  3KXB C;  2NZD A;  3MGS A;  1P34 C;  2FJ7 A;  5GT0 B;  4J8U C;  5B32 C;  4Z66 A;  3UTA B;  1P3P D;  2Y2I A;  4M6B A;  3WAA C;  3W97 D;  3WA9 B;  3AZG D;  1H3O B;  4WNN B;  5BT1 C;  5AY8 D;  3C1B B;  5CP6 D;  2F2A C;  3LZ0 B;  1S32 C;  4H9P A;  2F8N G;  2ARO C;  1P3F D;  5F99 B;  1TAF A;  1P3L B;  3AZF C;  1P3P A;  5AVB D;  1F1E A;  3WTP E;  3MGP B;  3REK B;  5G49 B;  1W2E A;  3W97 A;  3WKJ D;  3AZG A;  3VH6 T;  2JSS A;  4WU9 D;  3NQJ A;  5AY8 A;  1P3A B;  4XUJ C;  5CP6 A;  1ULY A;  2DQN C;  3REH C;  3REJ D;  1P3F A;  2L5A A;  3A1K A;  3EPK A;  3KXB B;  2DF4 C;  5BO0 A;  5CPK A;  3EPL A;  1P3O C;  1P34 B;  3A6N D;  4J8U B;  5B32 B;  5AVB A;  3WKJ A;  1BH9 A;  2UWX A;  5E5A A;  2ZY5 A;  2BYM A;  4WU9 A;  1TZY C;  3WAA B;  1EQZ C;  3AZJ C;  5B0Y C;  3X1U D;  3REJ A;  1S32 B;  5JRG D;  4J8W D;  1P3K D;  3B6F D;  2ARO B;  4Z5T C;  4J8V C;  3AZK C;  1P3M C;  5BNV B;  3A6N A;  4UUZ A;  4KGC C;  3R45 A;  3X1T C;  3VH5 T;  3AZF B;  3KUY C;  4R8P C;  3LJA D;  4H9R A;  3AZH C;  3AV1 D;  3H0L C;  2NZD C;  4WU8 D;  3TU4 B;  3REL D;  3UTB C;  3X1V D;  1AOI D;  3AZL D;  1KX4 D;  2YFW A;  3X1U A;  5GXQ D;  5JRG A;  4J8W A;  1P3K A;  3B6G D;  3B6F A;  3REH B;  4DRB A;  3C1C D;  4KUD C;  3AZN D;  2CV5 D;  3IP4 C;  5KDM A;  1P3O B;  1BH8 B;  2ZY4 A;  3VH5 A;  3AN2 D;  1P3I D;  3LJA A;  3AYW D;  3W99 C;  3AV1 A;  1KX5 D;  3MGQ D;  5B0Z D;  4WU8 A;  5DNM C;  3AZM D;  1TZY B;  5JA4 B;  3REL A;  3KWQ C;  3X1V A;  3REI D;  3AZL A;  1KX4 A;  1AOI A;  1EQZ B;  3LZ1 D;  4YS3 D;  1M19 C;  5GXQ A;  3AZJ B;  5B1M D;  5B0Y B;  5BNX A;  4NE3 A;  3C1C A;  3H0R C;  4Z5T B;  4J8V B;  4NFT A;  3AZK B;  3AZN A;  2HIO D;  2CV5 A;  1P3M B;  2VQR A;  4KGC B;  3X1T B;  4JJN D;  3AN2 A;  1P3I A;  3AYW A;  5CPI C;  4R8P B;  4KHA A;  1KX5 A;  3MGQ A;  2F8N D;  5B0Z A;  3AZH B;  3AZM A;  2RIQ A;  1A7W A;  3REI A;  2NZD B;  1ID3 D;  3LZ1 A;  3UTB B;  1Q9C A;  4YS3 A;  1ZLA D;  5B1M A;  5CPJ D;  3W98 C;  5AVB C;  1HQ3 D;  4YM6 D;  2FFF B;  2BG1 A;  1P3G D;  3LEL D;  3WKJ C;  4WJ3 C;  3X1S D;  2HIO A;  4XZQ C;  4WU9 C;  4KUD B;  2FJ7 D;  1KX3 C;  3W96 C;  3O62 D;  4CSR B;  2Y2L A;  4Z66 D;  4JJN A;  4H9P B;  3FDD A;  3WTP D;  1M18 D;  2F8N A;  5FUG A;  3W99 B;  2ZM5 A;  5DNM B;  1ID3 A;  4CAY B;  3KWQ B;  5CPJ A;  1T3U A;  4E44 A;  1M19 B;  1HQ3 A;  4YM6 A;  3P5J B;  2NQB C;  1P3G A;  3LEL A;  1M1A C;  3X1S A;  5B2J D;  5B1L D;  2ZY3 A;  1JFI B;  2Y2O A;  3NQJ B;  3O62 A;  3NQU B;  4ZBJ C;  5JRG C;  3WTP A;  1M18 A;  5CPI B;  2Y2P A;  4H9S A;  5AVC D;  3AFA D;  5AV5 C;  5BO0 B;  3MGR D;  2W8S A;  3W98 B;  4NE5 A;  5AVB B;  1N1J A;  3WKJ B;  5B2J A;  5B1L A;  5CPK D;  4X23 C;  4WU9 B;  4XZQ B;  3X1V C;  1KX3 B;  3A1I A;  5B33 C;  3W96 B;  3UT9 D;  5B31 C;  5GXQ C;  2F8N H;  3B6G C;  3MNN C;  5E5A D;  5AVC A;  3AFA A;  4EO5 C;  4J8X C;  3AZN C;  2CV5 C;  3MGR A;  5GT0 D;  5C3I C;  3UTA D;  4H9O A;  2NQB B;  1P3I C;  3AYW C;  3B0C T;  3AZI D;  3EPH A;  3B0B A;  1KX5 C;  3MGQ C;  1M1A B;  5B0Z C;  1P3B C;  3WA9 D;  2CWE A;  3REI C;  3UT9 A;  4H9Q A;  4ZUX D;  3VH6 W;  5DNN C;  4YS3 C;  5B1M C;  5GT3 D;  2YFW B;  3LZ0 D;  3MVD C;  4LD9 D;  2Y2N A;  4ZBJ B;  5BS7 A;  5JRG B;  5F99 D;  3VH6 A;  4QLC C;  1P3L D;  5AV5 B;  5GT0 A;  5AV8 C;  5AV6 D;  2PYO D;  3AV2 C;  3UTA A;  4JJN C;  3AZI A;  5B40 C;  3WA9 A;  1H3O A;  2Y2G A;  1U35 C;  4X23 B;  1P3A D;  1ID3 C;  3X1V B;  3AL0 C;  5B33 B;  4ZUX A;  1ZLA C;  4LD9 A;  5GT3 A;  5B31 B;  3LZ0 A;  3AZE C;  5CPJ C;  5GXQ B;  3B6G B;  5F99 A;  3MNN B;  3LEL C;  5BNX B;  3KXB D;  3X1S C;  3MGS C;  4EO5 B;  4XUJ B;  4J8X B;  5AV6 A;  3AZN B;  2CV5 B;  1P3L A;  1P34 D;  2FJ7 C;  2PYO A;  4Z66 C;  5C3I B;  4J8U D;  1F66 D;  2RVQ D;  1P3I B;  1M18 C;  3VH5 W;  4KHA B;  4G92 C;  1KX5 B;  3MGQ B;  3WAA D;  5B0Z B;  1P3A A;  1P3B B;  2Y2M A;  4E45 A;  5BT1 D;  3REI B;  2JCH A;  4HGA C;  2JE5 A;  2YFV B;  4YS3 B;  3MVD B;  5DNN B;  5B1M B;  2ARO D;  3KXB A;  5B1L C;  4QLC B;  1P34 A;  5AV8 B;  4J8U A;  3AZF D;  3AV2 B;  1P3P C;  1F66 A;  4H9N B;  4JJN B;  3W97 C;  3AZG C;  5B40 B;  3WAA A;  3AFA C;  1U35 B;  5AY8 C;  3TU4 D;  5CP6 C;  1ZLA B;  3KUY B;  5CPJ B;  3AZE B;  1P3F C;  2ARO A;  3REH D;  2G5H C;  1HTA A;  3LEL B;  5CPK C;  3X1S B;  3MGS B;  5BNV A;  2FJ7 B;  2Y2J A;  3UT9 C;  4Z66 B;  3AZF A;  5E5A C;  1M18 B;  5B32 G;  3TU4 A;  1TZY D;  2NQB D;  2Y2K A;  4HGA B;  3REJ C;  1B67 A;  3AZJ D;  5B0Y D;  3REH A;  3EG5 B;  3AZI C;  1KU5 A;  4Z5T D;  1TAF B;  3AZK D;  3A6N C;  1P3M D;  4ZUX C;  3X1T D;  4LD9 C;  1BH8 A;  5GT3 C;  1P3P B;  3KFU G;  3W97 B;  3AZG B;  1TZY A;  5JA4 A;  3AFA B;  4G91 C;  5AY8 B;  5AV6 C;  3UTB D;  2PYO C;  4DRA A;  5CP6 B;  3X1U C;  3AZJ A;  5B0Y A;  4J8W C;  1P3K C;  3B6F C;  1P3F B;  4Z5T A;  5B24 D;  1WWI A;  3AZK A;  5CPK B;  4KUD D;  1P3M A;  3X1T A;  3UT9 B;  2XD5 A;  4H9Q B;  3H0M C;  5AV9 D;  3LJA C;  5GSU D;  1BH9 B;  3AV1 C;  5E5A B;  3W99 D;  4WU8 C;  2BYM B;  3REL C;  1AOI C;  5DNM D;  3AZL C;  1KX4 C;  3UTB A;  2XD1 A;  3KWQ D;  2Y2H A;  1M19 D;  3REJ B;  1B6W A;  3V9R A;  5B2I D;  1F66 C;  2RVQ C;  3C1C C;  3AZI B;  5B24 A;  4KUD A;  2Y2Q A;  3A6N B;  4UUZ B;  4CSR A;  3R45 B;  2BYK A;  4ZUX B;  4LD9 B;  3AN2 C;  5GT3 B;  5AV9 A;  5GSU A;  5CPI D;  3W99 A;  4H9R B;  3AZM C;  5DNM A;  3C1B D;  4CAY A;  4G91 B;  3LZ1 C;  3KWQ A;  5AV6 B;  2PYO B;  1M19 A;  3X1U B;  5B2I A;  3W98 D;  2HUE C;  4J8W B;  1P3K B;  3B6F B;  2ZY2 A;  2HIO C;  1JFI A;  4XZQ D;  3TU4 C;  3B0C W;  4WV4 B;  3NQU A;  5KDM B;  1KX3 D;  3W96 D;  3B0D C;  3REK D;  3MGP D;  3LJA B;  5CPI A;  3AV1 B;  4WNN A;  4WU8 B;  3C1B A;  3REL B;  1BFM A;  1AOI B;  3AZL B;  1KX4 B;  3W98 A;  1HQ3 C;  4YM6 C;  1F66 B;  1R4V A;  1P3G C; 
#chains in the Genus database with same CATH homology
 3C1C B;  2LY8 A;  5CHL B;  1M1A D;  4XZQ A;  1KX3 A;  3W96 A;  3O62 C;  5B32 D;  3REK A;  3AN2 B;  3MGP A;  5G49 A;  3WTP C;  3AYW B;  4H9S C;  3AZM B;  2IO5 C;  5AV5 D;  3LZ1 B;  1S32 D;  2NQB A;  2HUE B;  5B2J C;  1M1A A;  2HIO B;  4X23 D;  5B32 A;  4NE6 A;  5B33 D;  3B0D B;  5B31 D;  3MNN D;  5AVC C;  2F8N B;  5FUG B;  1Z2C B;  5B24 C;  3MGR C;  4J8X D;  4XUJ D;  5AV5 A;  1ID3 B;  3F6T A;  4DQY B;  1S32 A;  1HQ3 B;  4YM6 B;  5AV9 C;  5GSU C;  1P3G B;  1PZR A;  4Z2M G;  4X23 A;  1P3B D;  1P3O D;  5B33 A;  3O62 B;  5B31 A;  3MVD D;  5DNN D;  5B2I C;  3B6G A;  5BS7 C;  3MNN A;  3WTP B;  4AWL C;  4G92 B;  4Z2M H;  4J8X A;  4XUJ A;  1EQZ D;  5GT0 C;  2IO5 B;  4QLC D;  5AV8 D;  3UTA C;  3AV2 D;  2G5I C;  1N1J B;  3WA9 C;  5B2J B;  4J8V D;  5B40 D;  5B1L B;  4WZS B;  1P3B A;  1U35 D;  1P3O A;  3C1B C;  4KGC D;  3EPJ A;  2YFV A;  3LZ0 C;  3MVD A;  5DNN A;  3KUY D;  4UPK A;  3AZE D;  1WWS A;  5F99 C;  3V9R B;  4R8P D;  3AZH D;  5AVC B;  1EQZ A;  3KSY A;  5B24 B;  5B31 G;  1P3L C;  3MGS D;  4QLC A;  3MGR B;  2NZD D;  5AV8 A;  3AV2 A;  4H9N A;  4H9O B;  2F8N K;  2BYK B;  3REK C;  3MGP C;  5AV9 B;  5GSU B;  4J8V A;  5B40 A;  1U35 A;  1P3A C;  4KGC A;  2J8P A;  1ZLA A;  3KUY A;  3AZE A;  5B2I B;  4R8P A;  3AZH A;  4AWL B;  3KXB C;  2NZD A;  3MGS A;  1P34 C;  2FJ7 A;  5GT0 B;  4J8U C;  5B32 C;  4Z66 A;  3UTA B;  1P3P D;  2Y2I A;  4M6B A;  3WAA C;  3W97 D;  3WA9 B;  3AZG D;  1H3O B;  4WNN B;  5BT1 C;  5AY8 D;  3C1B B;  5CP6 D;  2F2A C;  3LZ0 B;  1S32 C;  4H9P A;  2F8N G;  2ARO C;  1P3F D;  5F99 B;  1TAF A;  1P3L B;  3AZF C;  1P3P A;  5AVB D;  1F1E A;  3WTP E;  3MGP B;  3REK B;  5G49 B;  1W2E A;  3W97 A;  3WKJ D;  3AZG A;  3VH6 T;  2JSS A;  4WU9 D;  3NQJ A;  5AY8 A;  1P3A B;  4XUJ C;  5CP6 A;  1ULY A;  2DQN C;  3REH C;  3REJ D;  1P3F A;  2L5A A;  3A1K A;  3EPK A;  3KXB B;  2DF4 C;  5BO0 A;  5CPK A;  3EPL A;  1P3O C;  1P34 B;  3A6N D;  4J8U B;  5B32 B;  5AVB A;  3WKJ A;  1BH9 A;  2UWX A;  5E5A A;  2ZY5 A;  2BYM A;  4WU9 A;  1TZY C;  3WAA B;  1EQZ C;  3AZJ C;  5B0Y C;  3X1U D;  3REJ A;  1S32 B;  5JRG D;  4J8W D;  1P3K D;  3B6F D;  2ARO B;  4Z5T C;  4J8V C;  3AZK C;  1P3M C;  5BNV B;  3A6N A;  4UUZ A;  4KGC C;  3R45 A;  3X1T C;  3VH5 T;  3AZF B;  3KUY C;  4R8P C;  3LJA D;  4H9R A;  3AZH C;  3AV1 D;  3H0L C;  2NZD C;  4WU8 D;  3TU4 B;  3REL D;  3UTB C;  3X1V D;  1AOI D;  3AZL D;  1KX4 D;  2YFW A;  3X1U A;  5GXQ D;  5JRG A;  4J8W A;  1P3K A;  3B6G D;  3B6F A;  3REH B;  4DRB A;  3C1C D;  4KUD C;  3AZN D;  2CV5 D;  3IP4 C;  5KDM A;  1P3O B;  1BH8 B;  2ZY4 A;  3VH5 A;  3AN2 D;  1P3I D;  3LJA A;  3AYW D;  3W99 C;  3AV1 A;  1KX5 D;  3MGQ D;  5B0Z D;  4WU8 A;  5DNM C;  3AZM D;  1TZY B;  5JA4 B;  3REL A;  3KWQ C;  3X1V A;  3REI D;  3AZL A;  1KX4 A;  1AOI A;  1EQZ B;  3LZ1 D;  4YS3 D;  1M19 C;  5GXQ A;  3AZJ B;  5B1M D;  5B0Y B;  5BNX A;  4NE3 A;  3C1C A;  3H0R C;  4Z5T B;  4J8V B;  4NFT A;  3AZK B;  3AZN A;  2HIO D;  2CV5 A;  1P3M B;  2VQR A;  4KGC B;  3X1T B;  4JJN D;  3AN2 A;  1P3I A;  3AYW A;  5CPI C;  4R8P B;  4KHA A;  1KX5 A;  3MGQ A;  2F8N D;  5B0Z A;  3AZH B;  3AZM A;  2RIQ A;  1A7W A;  3REI A;  2NZD B;  1ID3 D;  3LZ1 A;  3UTB B;  1Q9C A;  4YS3 A;  1ZLA D;  5B1M A;  5CPJ D;  3W98 C;  5AVB C;  1HQ3 D;  4YM6 D;  2FFF B;  2BG1 A;  1P3G D;  3LEL D;  3WKJ C;  4WJ3 C;  3X1S D;  2HIO A;  4XZQ C;  4WU9 C;  4KUD B;  2FJ7 D;  1KX3 C;  3W96 C;  3O62 D;  4CSR B;  2Y2L A;  4Z66 D;  4JJN A;  4H9P B;  3FDD A;  3WTP D;  1M18 D;  2F8N A;  5FUG A;  3W99 B;  2ZM5 A;  5DNM B;  1ID3 A;  4CAY B;  3KWQ B;  5CPJ A;  1T3U A;  4E44 A;  1M19 B;  1HQ3 A;  4YM6 A;  3P5J B;  2NQB C;  1P3G A;  3LEL A;  1M1A C;  3X1S A;  5B2J D;  5B1L D;  2ZY3 A;  1JFI B;  2Y2O A;  3NQJ B;  3O62 A;  3NQU B;  4ZBJ C;  5JRG C;  3WTP A;  1M18 A;  5CPI B;  2Y2P A;  4H9S A;  5AVC D;  3AFA D;  5AV5 C;  5BO0 B;  3MGR D;  2W8S A;  3W98 B;  4NE5 A;  5AVB B;  1N1J A;  3WKJ B;  5B2J A;  5B1L A;  5CPK D;  4X23 C;  4WU9 B;  4XZQ B;  3X1V C;  1KX3 B;  3A1I A;  5B33 C;  3W96 B;  3UT9 D;  5B31 C;  5GXQ C;  2F8N H;  3B6G C;  3MNN C;  5E5A D;  5AVC A;  3AFA A;  4EO5 C;  4J8X C;  3AZN C;  2CV5 C;  3MGR A;  5GT0 D;  5C3I C;  3UTA D;  4H9O A;  2NQB B;  1P3I C;  3AYW C;  3B0C T;  3AZI D;  3EPH A;  3B0B A;  1KX5 C;  3MGQ C;  1M1A B;  5B0Z C;  1P3B C;  3WA9 D;  2CWE A;  3REI C;  3UT9 A;  4H9Q A;  4ZUX D;  3VH6 W;  5DNN C;  4YS3 C;  5B1M C;  5GT3 D;  2YFW B;  3LZ0 D;  3MVD C;  4LD9 D;  2Y2N A;  4ZBJ B;  5BS7 A;  5JRG B;  5F99 D;  3VH6 A;  4QLC C;  1P3L D;  5AV5 B;  5GT0 A;  5AV8 C;  5AV6 D;  2PYO D;  3AV2 C;  3UTA A;  4JJN C;  3AZI A;  5B40 C;  3WA9 A;  1H3O A;  2Y2G A;  1U35 C;  4X23 B;  1P3A D;  1ID3 C;  3X1V B;  3AL0 C;  5B33 B;  4ZUX A;  1ZLA C;  4LD9 A;  5GT3 A;  5B31 B;  3LZ0 A;  3AZE C;  5CPJ C;  5GXQ B;  3B6G B;  5F99 A;  3MNN B;  3LEL C;  5BNX B;  3KXB D;  3X1S C;  3MGS C;  4EO5 B;  4XUJ B;  4J8X B;  5AV6 A;  3AZN B;  2CV5 B;  1P3L A;  1P34 D;  2FJ7 C;  2PYO A;  4Z66 C;  5C3I B;  4J8U D;  1F66 D;  2RVQ D;  1P3I B;  1M18 C;  3VH5 W;  4KHA B;  4G92 C;  1KX5 B;  3MGQ B;  3WAA D;  5B0Z B;  1P3A A;  1P3B B;  2Y2M A;  4E45 A;  5BT1 D;  3REI B;  2JCH A;  4HGA C;  2JE5 A;  2YFV B;  4YS3 B;  3MVD B;  5DNN B;  5B1M B;  2ARO D;  3KXB A;  5B1L C;  4QLC B;  1P34 A;  5AV8 B;  4J8U A;  3AZF D;  3AV2 B;  1P3P C;  1F66 A;  4H9N B;  4JJN B;  3W97 C;  3AZG C;  5B40 B;  3WAA A;  3AFA C;  1U35 B;  5AY8 C;  3TU4 D;  5CP6 C;  1ZLA B;  3KUY B;  5CPJ B;  3AZE B;  1P3F C;  2ARO A;  3REH D;  2G5H C;  1HTA A;  3LEL B;  5CPK C;  3X1S B;  3MGS B;  5BNV A;  2FJ7 B;  2Y2J A;  3UT9 C;  4Z66 B;  3AZF A;  5E5A C;  1M18 B;  5B32 G;  3TU4 A;  1TZY D;  2NQB D;  2Y2K A;  4HGA B;  3REJ C;  1B67 A;  3AZJ D;  5B0Y D;  3REH A;  3EG5 B;  3AZI C;  1KU5 A;  4Z5T D;  1TAF B;  3AZK D;  3A6N C;  1P3M D;  4ZUX C;  3X1T D;  4LD9 C;  1BH8 A;  5GT3 C;  1P3P B;  3KFU G;  3W97 B;  3AZG B;  1TZY A;  5JA4 A;  3AFA B;  4G91 C;  5AY8 B;  5AV6 C;  3UTB D;  2PYO C;  4DRA A;  5CP6 B;  3X1U C;  3AZJ A;  5B0Y A;  4J8W C;  1P3K C;  3B6F C;  1P3F B;  4Z5T A;  5B24 D;  1WWI A;  3AZK A;  5CPK B;  4KUD D;  1P3M A;  3X1T A;  3UT9 B;  2XD5 A;  4H9Q B;  3H0M C;  5AV9 D;  3LJA C;  5GSU D;  1BH9 B;  3AV1 C;  5E5A B;  3W99 D;  4WU8 C;  2BYM B;  3REL C;  1AOI C;  5DNM D;  3AZL C;  1KX4 C;  3UTB A;  2XD1 A;  3KWQ D;  2Y2H A;  1M19 D;  3REJ B;  1B6W A;  3V9R A;  5B2I D;  1F66 C;  2RVQ C;  3C1C C;  3AZI B;  5B24 A;  4KUD A;  2Y2Q A;  3A6N B;  4UUZ B;  4CSR A;  3R45 B;  2BYK A;  4ZUX B;  4LD9 B;  3AN2 C;  5GT3 B;  5AV9 A;  5GSU A;  5CPI D;  3W99 A;  4H9R B;  3AZM C;  5DNM A;  3C1B D;  4CAY A;  4G91 B;  3LZ1 C;  3KWQ A;  5AV6 B;  2PYO B;  1M19 A;  3X1U B;  5B2I A;  3W98 D;  2HUE C;  4J8W B;  1P3K B;  3B6F B;  2ZY2 A;  2HIO C;  1JFI A;  4XZQ D;  3TU4 C;  3B0C W;  4WV4 B;  3NQU A;  5KDM B;  1KX3 D;  3W96 D;  3B0D C;  3REK D;  3MGP D;  3LJA B;  5CPI A;  3AV1 B;  4WNN A;  4WU8 B;  3C1B A;  3REL B;  1BFM A;  1AOI B;  3AZL B;  1KX4 B;  3W98 A;  1HQ3 C;  4YM6 C;  1F66 B;  1R4V A;  1P3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...