4QLCD

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
KRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chromatin binding protein/dna
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcD00
1R4VA 4LD9C 3REJC 3X1TB 4J8VC 5B40D 1KX3A 3AZHA 3VH6T 4XZQC 1P34C 1EQZA 5AY8A 5B2ID 3AZKB 3AZNC 3WTPB 3AFAC 3AZFC 1HQ3D 3AYWD 4J8WC 3REKA 1AOIC 3MNND 4WNNA 4NE5A 4YS3C 5AV5B 2IO5C 3KXBD 3C1CB 3B0CT 5B1LA 4E44A 5AVCB 3W98C 3WTPE 3REIC 3W99B 3B6FA 1HTAA 4NE6A 4Z5TC 2F8NK 2LY8A 5B0ZA 4R8PA 3WKJA 5CPKB 4WZSB 3AZEA 3RELA 3UTBB 3AZMB 5B1MB 2YFVB 1TAFB 5AVCD 3MGSA 2JSSA 1BH9A 5AV9D 1ID3A 4WU8C 3X1UC 5B24B 5B40C 3UT9B 1P3BD 5JRGB 3KUYB 3AZLA 5B0YC 1P3AA 1P3OB 5AVBA 4WU9D 5B2JB 3AV1D 5GSUA 5E5AD 5GT0C 5DNNC 3W97C 1KX3B 3B6GD 2NZDA 1M1AA 3X1TC 3AZIA 1EQZB 5B32A 3KWQB 4G91B 4X23D 5KDMA 4XUJA 3AZKC 3MGQD 3WA9A 3WTPC 4G92B 3TU4A 3UTAA 2HUEB 1H3OA 1F66B 4NFTA 3KWQD 5AV5C 1ZLAA 5BT1D 3AZJA 3A6ND 3B6FB 4NE3A 4CSRA 3C1CC 2YFWB 4R8PB 5B0ZB 2CV5D 5AVCC 3W99C 3WAAD 3AZEB 5GXQA 3C1BB 1S32A 3LZ1B 5GT3B 1M19A 4H9OA 3VH5A 5CPKC 5CHLB 3LJAD 2PYOB 3MGSB 1JFIA 3UTBC 3AZMC 3MVDB 3MGPA 5B1MC 1P3LA 1ID3B 5CPID 3REJD 4H9NA 5DNMB 3LELB 4J8VD 3AZGA 3C1BD 5B24C 5AVBB 3UT9C 4XZQD 4JJNB 5JRGC 3KUYC 2BYKA 5B2IA 5BNVB 2PYOD 4QLCA 1P3OC 3AZND 3MVDD 2AROA 2NZDB 1M1AB 2NQBA 3AZFD 1P3IA 5B2JC 3V9RB 5B31A 5B32B 4J8WD 1AOID 1KX3C 4AWLB 2HIOB 5B33B 5KDMB 1EQZC 3KWQC 4JJND 2F8NA 4G91C 3O62A 4H9QA 3REID 4Z5TD 5G49B 1BFMA 3NQUA 1ZLAB 4G92C 1F66C 2HUEC 4KUDB 4CSRB 1TZYB 5BO0B 3W96B 5JA4A 5AV6B 3B6FC 1P3KB 5AV9A 1S32B 4R8PC 5CP6A 5B0ZC 4WU8D 1M19B 3X1UD 4CAYB 3AZEC 3AN2B 3C1BC 1JFIB 3LZ1C 5GT3C 4YM6B 3MGPB 1P3LB 4KUDD 5B0YD 4WU9A 1TZYD 2PYOC 3MGSC 3KSYA 5F99B 1ID3C 3VH6A 3MVDC 3AZGB 1P3KD 1M18B 3LZ0A 5DNND 5GT0D 3B6GA 3W97D 5CPJB 3NQJB 3X1TD 5DNMC 3LELC 3AN2D 4QLCB 4X23A 1P3PB 5AVBC 4JJNC 2FJ7A 1P3FB 1B67A 5B31B 1KX5B 3AZKD 3WTPD 1M18D 2NZDC 1M1AC 1P3GB 5B32C 5CPJD 1U35A 5C3IB 3X1VA 5AV8A 5AV5D 2HIOC 3O62B 4AWLC 5B33C 1P3PD 1KX4B 4KHAB 5BNXA 3X1SB 3C1CD 1P3FD 3AV2B 4ZUXB 3W99D 4J8UA 4Z66B 5BS7A 3LJAA 5CPKD 1BH8A 1ZLAC 4KUDC 3UTBD 1TZYC 3AZMD 5CP6B 5B1MD 3W96C 5AV6C 4LD9A 3REJA 1P3KC 4J8XA 3AV2D 3R45A 1S32C 1M19C 3AZHB 4XZQA 5B24D 1P34A 3UT9D 5AY8B 3AN2C 5JRGD 3KUYD 1P3MA 4YM6C 3MGPC 3AZNA 1P3LC 3LZ0B 1P3OD 3AFAA 3REKB 4J8WA 5B2JD 5F99C 4WNNB 3REHA 3AZGC 1M18C 4H9PA 4YS3A 1KX3D 3AZHD 5CPJC 5B1LB 2FJ7B 1EQZD 3W98A 4QLCC 3REIA 1P3PC 3VH5W 4UUZA 4KGCA 4Z5TA 1P3FC 4WV4B 2BYMA 5B31C 1KX5C 1U35B 3WKJB 5AV8B 3RELB 3MGRA 1P3GC 1F66D 5C3IC 3O62C 1BH9B 3B6FD 4J8UB 1KX4C 4WU8A 3X1SC 5B0ZD 4R8PD 4DRAA 4M6BA 3AV2C 5B40A 4ZUXC 3AZLB 1BH8B 3AZED 3RELD 1P3AB 3LZ1D 5B0YA 5GT3D 4Z66C 4H9RA 4H9SA 3B0DB 5GSUB 4J8XB 3MGSD 1ID3D 5CP6C 5DNNA 1HQ3A 3W97A 3AYWA 3AZIB 3X1TA 3MNNA 5DNMD 3LELD 1P3MB 2CWEA 3KXBA 5FUGA 3AZHC 4Z2MG 5B32G 4XUJB 5AVBD 5AY8C 3AZKA 3WA9B 3REHB 3WTPA 4H9PB 3LZ0C 3TU4B 3UTAB 1H3OB 2NZDD 1M1AD 3REKC 1N1JA 5B32D 4Z2MH 4DRBA 5AV5A 3AZJB 2HIOD 4UUZB 4KGCB 5B33D 5B1LC 2FJ7C 3C1CA 5AVCA 5GXQB 3MGRB 3UTAD 3WKJC 4H9OB 1U35C 1P3BA 3VH6W 5AV8C 3RELC 1ZLAD 4ZBJB 2YFVA 1TAFA 3AV1A 3W96D 5B40B 5AV6D 4H9NB 5E5AA 5GXQD 1S32D 1M19D 1WWIA 5B24A 2L5AA 2BYKB 3AZLC 5B2IB 3KUYA 3B0CW 1P3AC 4YM6D 2AROB 3MGPD 1HQ3B 1P3LD 3AYWB 2NQBB 1P3IB 3B0DC 5GSUC 3MGQA 5B2JA 3MNNB 4J8XC 5F99D 3AZGD 3B0BA 3KXBB 5FUGB 5B31G 3AZIC 2F8NB 3KWQA 1P3MC 3A6NA 4H9QB 4QLCD 2AROD 4XUJC 2F8NG 2CV5A 2NQBD 1P3ID 1N1JB 3WA9C 5B31D 3REHC 1KX5D 3WAAA 3NQUB 3TU4C 3UTAC 1F66A 1F1EA 1P3GD 5JA4B 2F8ND 3AZJC 2F8NH 5AV9B 3O62D 4KGCC 1B6WA 1KU5A 1KX4D 2YFWA 5CPIA 1P3BB 3X1SD 4J8VA 5GXQC 4ZUXD 3MGRC 3C1BA 3LZ1A 5GT3A 4WU9B 4Z66D 3AV1B 2PYOA 5E5AB 3MVDA 4ZBJC 3B6GB 5CP6D 3AZFA 1AOIA 5DNMA 3LELA 4X23B 5B2IC 4H9SC 4JJNA 3MGQB 4EO5B 5AY8D 5BNVA 2AROC 4E45A 1HQ3C 3AYWC 3LZ0D 2NQBC 1P3IC 3V9RA 3MNNC 3REKD 3X1VB 3KXBC 4HGAB 3A6NB 2HIOA 1ULYA 5B33A 2CV5B 5BNXB 5B1LD 2FJ7D 3WAAB 3X1UA 5G49A 3WKJD 3LJAB 1U35D 3X1VD 5AV8D 4KUDA 2RVQD 1TZYA 5BO0A 5CPIB 3W96A 4LD9B 5AV6A 3REJB 3VH5T 3R45B 5AV9C 4J8VB 1P3KA 5GT0A 4J8UD 1P3BC 4XZQB 1P34B 1WWSA 4CAYA 3AZLD 3AN2A 3AZNB 4YM6A 1Q9CA 4WU9C 1P3AD 3AFAB 3AZFB 3AV1C 4J8WB 4LD9D 5GSUD 1AOIB 5E5AC 4J8XD 5F99A 4YS3B 1M18A 3B6GC 2IO5B 5CPJA 3NQJA 3AZID 1P34D 3W98B 4X23C 3REIB 1P3MD 1P3PA 4Z5TB 3AFAD 3MGQC 4XUJD 4EO5C 2BYMB 1P3FA 1KX5A 3WA9D 3REHD 3W99A 4YS3D 3TU4D 1P3GA 3X1VC 5CPKA 5BT1C 3W98D 3A6NC 4HGAC 3AZJD 3UTBA 2RVQC 3AZMA 4KGCD 5B1MA 4WU8B 2CV5C 1KX4A 3X1UB 4KHAA 3X1SA 3WAAC 3AV2A 4ZUXA 4J8UC 3MGRD 5B0YB 5BS7C 4Z66A 3LJAC 3UT9A 4H9RB 5JRGA 1A7WA 1P3OA 5DNNB 5GT0B 3W97B 5CPIC
chains in the Genus database with same CATH superfamily
1R4VA 4LD9C 3REJC 3X1TB 4J8VC 5B40D 1KX3A 2FFFB 3AZHA 3VH6T 4XZQC 1P34C 1EQZA 2ZY3A 2Y2NA 5AY8A 5B2ID 3AZKB 3AZNC 3WTPB 3AFAC 3AZFC 1HQ3D 2XD1A 3AYWD 4J8WC 3REKA 1AOIC 3MNND 4WNNA 4NE5A 4YS3C 5AV5B 2DQNC 2IO5C 3KXBD 3C1CB 4E44A 3B0CT 5B1LA 5AVCB 3W98C 3WTPE 3IP4C 3REIC 3W99B 3B6FA 1HTAA 4NE6A 4Z5TC 2F8NK 2LY8A 5B0ZA 4R8PA 3WKJA 5CPKB 4WZSB 3AZEA 4UPKA 3RELA 2Y2IA 3UTBB 3AZMB 5B1MB 2YFVB 1TAFB 5AVCD 3MGSA 2J8PA 2JSSA 1BH9A 5AV9D 1ID3A 4WU8C 3X1UC 5B24B 5B40C 3UT9B 1P3BD 5JRGB 3KUYB 3AZLA 5B0YC 1P3AA 1P3OB 2Y2QA 5AVBA 4WU9D 5B2JB 3AV1D 5GSUA 5E5AD 5GT0C 5DNNC 3EPLA 3W97C 1KX3B 3B6GD 2NZDA 1M1AA 3X1TC 3AZIA 1EQZB 5B32A 3KWQB 4G91B 3H0LC 4X23D 5KDMA 4XUJA 3AZKC 3MGQD 3WA9A 3WTPC 2DF4C 4G92B 3TU4A 3UTAA 2HUEB 1H3OA 1F66B 4NFTA 3KWQD 5AV5C 1ZLAA 5BT1D 3AZJA 3A6ND 3B6FB 4NE3A 3H0RC 2RIQA 4CSRA 3C1CC 2YFWB 5B0ZB 4R8PB 2CV5D 5AVCC 3W99C 3WAAD 3AZEB 5GXQA 3C1BB 1S32A 3LZ1B 5GT3B 1M19A 4H9OA 2XD5A 3VH5A 5CPKC 5CHLB 3LJAD 2PYOB 3MGSB 4DQYB 1JFIA 3UTBC 2UWXA 2Y2OA 3MVDB 3MGPA 5B1MC 3AZMC 1P3LA 1ID3B 5CPID 3REJD 4H9NA 5DNMB 3LELB 4J8VD 3AZGA 3C1BD 5B24C 5AVBB 3UT9C 4XZQD 4JJNB 5JRGC 3KUYC 2BYKA 5B2IA 5BNVB 2PYOD 4QLCA 1P3OC 3AZND 3MVDD 2AROA 2NZDB 1M1AB 2NQBA 3AZFD 1P3IA 5B2JC 3V9RB 5B31A 5B32B 4J8WD 1AOID 1KX3C 2Y2LA 4AWLB 2HIOB 5B33B 5KDMB 1EQZC 3KFUG 3KWQC 4JJND 2F8NA 4G91C 3O62A 4H9QA 3REID 4Z5TD 5G49B 1BFMA 3NQUA 1ZLAB 4G92C 1F66C 2HUEC 4KUDB 4CSRB 3AL0C 1TZYB 5BO0B 3W96B 5JA4A 5AV6B 3EG5B 2Y2JA 3B6FC 1P3KB 5AV9A 1S32B 4R8PC 5CP6A 5B0ZC 4WU8D 1M19B 3X1UD 4CAYB 3AZEC 3AN2B 3C1BC 1JFIB 3LZ1C 2Y2KA 5GT3C 4YM6B 3MGPB 1P3LB 4KUDD 5B0YD 4WU9A 1TZYD 2PYOC 3MGSC 3KSYA 5F99B 1ID3C 3VH6A 3MVDC 3AZGB 1P3KD 1M18B 3LZ0A 5DNND 3FDDA 5GT0D 3B6GA 3W97D 5CPJB 3NQJB 3X1TD 5DNMC 3LELC 3AN2D 4QLCB 3A1IA 4X23A 1P3PB 5AVBC 4JJNC 2FJ7A 1P3FB 1B67A 5B31B 1KX5B 3AZKD 3WTPD 1M18D 2NZDC 1M1AC 1P3GB 5B32C 5CPJD 1U35A 5C3IB 3X1VA 5AV8A 5AV5D 2HIOC 3O62B 4AWLC 5B33C 1P3PD 1KX4B 4KHAB 5BNXA 3X1SB 3C1CD 1P3FD 3AV2B 4ZUXB 3W99D 4J8UA 4Z66B 5BS7A 3LJAA 5CPKD 1BH8A 1ZLAC 4KUDC 3UTBD 1TZYC 3AZMD 5CP6B 5B1MD 3W96C 5AV6C 4LD9A 3REJA 3A1KA 2VQRA 4J8XA 3AV2D 3R45A 1P3KC 1S32C 2ZY4A 1PZRA 1M19C 3AZHB 4XZQA 5B24D 1P34A 3UT9D 5AY8B 3AN2C 5JRGD 3KUYD 1P3MA 4YM6C 3MGPC 3AZNA 1P3LC 3LZ0B 1P3OD 3AFAA 3REKB 2ZY2A 4J8WA 5B2JD 5F99C 4WNNB 3REHA 3AZGC 1M18C 4H9PA 4YS3A 1KX3D 3AZHD 5CPJC 5B1LB 2FJ7B 1EQZD 3W98A 4QLCC 3REIA 1P3PC 3VH5W 4UUZA 4KGCA 4Z5TA 1P3FC 4WV4B 2BYMA 5B31C 1KX5C 1U35B 3WKJB 5AV8B 3RELB 3MGRA 1Z2CB 3P5JB 1P3GC 1F66D 5C3IC 3O62C 1BH9B 3H0MC 3B6FD 4J8UB 1KX4C 4WU8A 3X1SC 5B0ZD 4R8PD 4DRAA 4M6BA 3AV2C 5B40A 4ZUXC 3AZLB 2JCHA 1BH8B 3AZED 3RELD 1P3AB 3LZ1D 5B0YA 5GT3D 4Z66C 3EPHA 4H9RA 4H9SA 3B0DB 5GSUB 4J8XB 3MGSD 1ID3D 5CP6C 5DNNA 1HQ3A 3W97A 3AYWA 2ZY5A 3AZIB 3X1TA 3MNNA 5DNMD 3LELD 1P3MB 2CWEA 3KXBA 5FUGA 3AZHC 4Z2MG 5B32G 4XUJB 5AVBD 5AY8C 3AZKA 3WA9B 3REHB 3WTPA 4H9PB 3LZ0C 2Y2MA 2Y2GA 3UTAB 3TU4B 1H3OB 2NZDD 1M1AD 3REKC 1N1JA 5B32D 4Z2MH 4DRBA 5AV5A 3AZJB 2HIOD 4UUZB 4KGCB 5B33D 5B1LC 2FJ7C 3C1CA 5AVCA 5GXQB 3MGRB 3UTAD 3WKJC 4H9OB 1U35C 1P3BA 3VH6W 5AV8C 3RELC 1ZLAD 4ZBJB 2YFVA 1TAFA 3AV1A 3W96D 5B40B 5AV6D 4H9NB 5E5AA 5GXQD 1S32D 1M19D 1WWIA 5B24A 2L5AA 2BYKB 3AZLC 5B2IB 2BG1A 3KUYA 3B0CW 1P3AC 4YM6D 2AROB 3MGPD 1HQ3B 1P3LD 3AYWB 2NQBB 1P3IB 3B0DC 5GSUC 3MGQA 5B2JA 3MNNB 4J8XC 5F99D 2JE5A 3AZGD 3B0BA 3KXBB 5FUGB 5B31G 3AZIC 2F8NB 3KWQA 1P3MC 3A6NA 4H9QB 4QLCD 2AROD 4XUJC 2F8NG 2CV5A 2NQBD 1P3ID 1N1JB 3WA9C 5B31D 3REHC 1KX5D 3WAAA 3NQUB 3TU4C 3UTAC 1F66A 1F1EA 1P3GD 3F6TA 5JA4B 2F8ND 3AZJC 2F8NH 5AV9B 3O62D 4KGCC 1B6WA 1KU5A 1KX4D 2YFWA 5CPIA 1P3BB 3X1SD 1W2EA 4J8VA 2F2AC 5GXQC 4ZUXD 3MGRC 3C1BA 3LZ1A 5GT3A 3EPKA 4WU9B 4Z66D 3AV1B 2PYOA 5E5AB 3MVDA 4ZBJC 3B6GB 5CP6D 3AZFA 1AOIA 5DNMA 3LELA 4X23B 5B2IC 2W8SA 4H9SC 3MGQB 4JJNA 4EO5B 5AY8D 5BNVA 2AROC 4E45A 1HQ3C 3AYWC 3LZ0D 2NQBC 1P3IC 3V9RA 3MNNC 3REKD 3X1VB 3KXBC 4HGAB 3A6NB 2HIOA 1ULYA 5B33A 2CV5B 5BNXB 5B1LD 2FJ7D 3WAAB 3X1UA 5G49A 3WKJD 3LJAB 1U35D 3X1VD 5AV8D 4KUDA 2RVQD 1TZYA 5BO0A 5CPIB 3W96A 4LD9B 5AV6A 3REJB 3VH5T 3R45B 5AV9C 4J8VB 1P3KA 5GT0A 4J8UD 1P3BC 4XZQB 1P34B 1WWSA 4CAYA 3AZLD 3AN2A 3AZNB 4YM6A 1Q9CA 4WU9C 1P3AD 3AFAB 3AZFB 3AV1C 4J8WB 4LD9D 5GSUD 1AOIB 5E5AC 4J8XD 5F99A 4YS3B 1M18A 3B6GC 2IO5B 5CPJA 3NQJA 1T3UA 3AZID 1P34D 3W98B 4X23C 3REIB 1P3MD 4WJ3C 1P3PA 4Z5TB 3AFAD 3MGQC 4XUJD 4EO5C 2BYMB 1P3FA 1KX5A 2G5HC 3WA9D 3REHD 3W99A 4YS3D 3EPJA 3TU4D 1P3GA 3X1VC 5CPKA 5BT1C 3W98D 3A6NC 4HGAC 3AZJD 2G5IC 2RVQC 3UTBA 3AZMA 4KGCD 5B1MA 4WU8B 2CV5C 1KX4A 3X1UB 4KHAA 3X1SA 3WAAC 3AV2A 4ZUXA 4J8UC 3MGRD 5B0YB 5BS7C 2Y2HA 2Y2PA 4Z66A 3LJAC 3UT9A 4H9RB 5JRGA 1A7WA 2ZM5A 1P3OA 5DNNB 5GT0B 3W97B 5CPIC
chains in the Genus database with same CATH topology
1R4VA 4LD9C 3REJC 3X1TB 4J8VC 5B40D 1KX3A 2FFFB 3AZHA 3VH6T 4XZQC 1P34C 1EQZA 2ZY3A 2Y2NA 5AY8A 5B2ID 3AZKB 3AZNC 3WTPB 3AFAC 3AZFC 1HQ3D 2XD1A 3AYWD 4J8WC 3REKA 1AOIC 3MNND 4WNNA 4NE5A 4YS3C 5AV5B 2DQNC 2IO5C 3KXBD 3C1CB 4E44A 3B0CT 5B1LA 5AVCB 3W98C 3WTPE 3IP4C 3REIC 3W99B 3B6FA 1HTAA 4NE6A 4Z5TC 2F8NK 2LY8A 5B0ZA 4R8PA 3WKJA 5CPKB 4WZSB 3AZEA 4UPKA 3RELA 2Y2IA 3UTBB 3AZMB 5B1MB 2YFVB 1TAFB 5AVCD 3MGSA 2J8PA 2JSSA 1BH9A 5AV9D 1ID3A 4WU8C 3X1UC 5B24B 5B40C 3UT9B 1P3BD 5JRGB 3KUYB 3AZLA 5B0YC 1P3AA 1P3OB 2Y2QA 5AVBA 4WU9D 5B2JB 3AV1D 5GSUA 5E5AD 5GT0C 5DNNC 3EPLA 3W97C 1KX3B 3B6GD 2NZDA 1M1AA 3X1TC 3AZIA 1EQZB 5B32A 3KWQB 4G91B 3H0LC 4X23D 5KDMA 4XUJA 3AZKC 3MGQD 3WA9A 3WTPC 2DF4C 4G92B 3TU4A 3UTAA 2HUEB 1H3OA 1F66B 4NFTA 3KWQD 5AV5C 1ZLAA 5BT1D 3AZJA 3A6ND 3B6FB 4NE3A 3H0RC 2RIQA 4CSRA 3C1CC 2YFWB 5B0ZB 4R8PB 2CV5D 5AVCC 3W99C 3WAAD 3AZEB 5GXQA 3C1BB 1S32A 3LZ1B 5GT3B 1M19A 4H9OA 2XD5A 3VH5A 5CPKC 5CHLB 3LJAD 2PYOB 3MGSB 4DQYB 1JFIA 3UTBC 2UWXA 2Y2OA 3MVDB 3MGPA 5B1MC 3AZMC 1P3LA 1ID3B 5CPID 3REJD 4H9NA 5DNMB 3LELB 4J8VD 3AZGA 3C1BD 5B24C 5AVBB 3UT9C 4XZQD 4JJNB 5JRGC 3KUYC 2BYKA 5B2IA 5BNVB 2PYOD 4QLCA 1P3OC 3AZND 3MVDD 2AROA 2NZDB 1M1AB 2NQBA 3AZFD 1P3IA 5B2JC 3V9RB 5B31A 5B32B 4J8WD 1AOID 1KX3C 2Y2LA 4AWLB 2HIOB 5B33B 5KDMB 1EQZC 3KFUG 3KWQC 4JJND 2F8NA 4G91C 3O62A 4H9QA 3REID 4Z5TD 5G49B 1BFMA 3NQUA 1ZLAB 4G92C 1F66C 2HUEC 4KUDB 4CSRB 3AL0C 1TZYB 5BO0B 3W96B 5JA4A 5AV6B 3EG5B 2Y2JA 3B6FC 1P3KB 5AV9A 1S32B 4R8PC 5CP6A 5B0ZC 4WU8D 1M19B 3X1UD 4CAYB 3AZEC 3AN2B 3C1BC 1JFIB 3LZ1C 2Y2KA 5GT3C 4YM6B 3MGPB 1P3LB 4KUDD 5B0YD 4WU9A 1TZYD 2PYOC 3MGSC 3KSYA 5F99B 1ID3C 3VH6A 3MVDC 3AZGB 1P3KD 1M18B 3LZ0A 5DNND 3FDDA 5GT0D 3B6GA 3W97D 5CPJB 3NQJB 3X1TD 5DNMC 3LELC 3AN2D 4QLCB 3A1IA 4X23A 1P3PB 5AVBC 4JJNC 2FJ7A 1P3FB 1B67A 5B31B 1KX5B 3AZKD 3WTPD 1M18D 2NZDC 1M1AC 1P3GB 5B32C 5CPJD 1U35A 5C3IB 3X1VA 5AV8A 5AV5D 2HIOC 3O62B 4AWLC 5B33C 1P3PD 1KX4B 4KHAB 5BNXA 3X1SB 3C1CD 1P3FD 3AV2B 4ZUXB 3W99D 4J8UA 4Z66B 5BS7A 3LJAA 5CPKD 1BH8A 1ZLAC 4KUDC 3UTBD 1TZYC 3AZMD 5CP6B 5B1MD 3W96C 5AV6C 4LD9A 3REJA 3A1KA 2VQRA 4J8XA 3AV2D 3R45A 1P3KC 1S32C 2ZY4A 1PZRA 1M19C 3AZHB 4XZQA 5B24D 1P34A 3UT9D 5AY8B 3AN2C 5JRGD 3KUYD 1P3MA 4YM6C 3MGPC 3AZNA 1P3LC 3LZ0B 1P3OD 3AFAA 3REKB 2ZY2A 4J8WA 5B2JD 5F99C 4WNNB 3REHA 3AZGC 1M18C 4H9PA 4YS3A 1KX3D 3AZHD 5CPJC 5B1LB 2FJ7B 1EQZD 3W98A 4QLCC 3REIA 1P3PC 3VH5W 4UUZA 4KGCA 4Z5TA 1P3FC 4WV4B 2BYMA 5B31C 1KX5C 1U35B 3WKJB 5AV8B 3RELB 3MGRA 1Z2CB 3P5JB 1P3GC 1F66D 5C3IC 3O62C 1BH9B 3H0MC 3B6FD 4J8UB 1KX4C 4WU8A 3X1SC 5B0ZD 4R8PD 4DRAA 4M6BA 3AV2C 5B40A 4ZUXC 3AZLB 2JCHA 1BH8B 3AZED 3RELD 1P3AB 3LZ1D 5B0YA 5GT3D 4Z66C 3EPHA 4H9RA 4H9SA 3B0DB 5GSUB 4J8XB 3MGSD 1ID3D 5CP6C 5DNNA 1HQ3A 3W97A 3AYWA 2ZY5A 3AZIB 3X1TA 3MNNA 5DNMD 3LELD 1P3MB 2CWEA 3KXBA 5FUGA 3AZHC 4Z2MG 5B32G 4XUJB 5AVBD 5AY8C 3AZKA 3WA9B 3REHB 3WTPA 4H9PB 3LZ0C 2Y2MA 2Y2GA 3UTAB 3TU4B 1H3OB 2NZDD 1M1AD 3REKC 1N1JA 5B32D 4Z2MH 4DRBA 5AV5A 3AZJB 2HIOD 4UUZB 4KGCB 5B33D 5B1LC 2FJ7C 3C1CA 5AVCA 5GXQB 3MGRB 3UTAD 3WKJC 4H9OB 1U35C 1P3BA 3VH6W 5AV8C 3RELC 1ZLAD 4ZBJB 2YFVA 1TAFA 3AV1A 3W96D 5B40B 5AV6D 4H9NB 5E5AA 5GXQD 1S32D 1M19D 1WWIA 5B24A 2L5AA 2BYKB 3AZLC 5B2IB 2BG1A 3KUYA 3B0CW 1P3AC 4YM6D 2AROB 3MGPD 1HQ3B 1P3LD 3AYWB 2NQBB 1P3IB 3B0DC 5GSUC 3MGQA 5B2JA 3MNNB 4J8XC 5F99D 2JE5A 3AZGD 3B0BA 3KXBB 5FUGB 5B31G 3AZIC 2F8NB 3KWQA 1P3MC 3A6NA 4H9QB 4QLCD 2AROD 4XUJC 2F8NG 2CV5A 2NQBD 1P3ID 1N1JB 3WA9C 5B31D 3REHC 1KX5D 3WAAA 3NQUB 3TU4C 3UTAC 1F66A 1F1EA 1P3GD 3F6TA 5JA4B 2F8ND 3AZJC 2F8NH 5AV9B 3O62D 4KGCC 1B6WA 1KU5A 1KX4D 2YFWA 5CPIA 1P3BB 3X1SD 1W2EA 4J8VA 2F2AC 5GXQC 4ZUXD 3MGRC 3C1BA 3LZ1A 5GT3A 3EPKA 4WU9B 4Z66D 3AV1B 2PYOA 5E5AB 3MVDA 4ZBJC 3B6GB 5CP6D 3AZFA 1AOIA 5DNMA 3LELA 4X23B 5B2IC 2W8SA 4H9SC 3MGQB 4JJNA 4EO5B 5AY8D 5BNVA 2AROC 4E45A 1HQ3C 3AYWC 3LZ0D 2NQBC 1P3IC 3V9RA 3MNNC 3REKD 3X1VB 3KXBC 4HGAB 3A6NB 2HIOA 1ULYA 5B33A 2CV5B 5BNXB 5B1LD 2FJ7D 3WAAB 3X1UA 5G49A 3WKJD 3LJAB 1U35D 3X1VD 5AV8D 4KUDA 2RVQD 1TZYA 5BO0A 5CPIB 3W96A 4LD9B 5AV6A 3REJB 3VH5T 3R45B 5AV9C 4J8VB 1P3KA 5GT0A 4J8UD 1P3BC 4XZQB 1P34B 1WWSA 4CAYA 3AZLD 3AN2A 3AZNB 4YM6A 1Q9CA 4WU9C 1P3AD 3AFAB 3AZFB 3AV1C 4J8WB 4LD9D 5GSUD 1AOIB 5E5AC 4J8XD 5F99A 4YS3B 1M18A 3B6GC 2IO5B 5CPJA 3NQJA 1T3UA 3AZID 1P34D 3W98B 4X23C 3REIB 1P3MD 4WJ3C 1P3PA 4Z5TB 3AFAD 3MGQC 4XUJD 4EO5C 2BYMB 1P3FA 1KX5A 2G5HC 3WA9D 3REHD 3W99A 4YS3D 3EPJA 3TU4D 1P3GA 3X1VC 5CPKA 5BT1C 3W98D 3A6NC 4HGAC 3AZJD 2G5IC 2RVQC 3UTBA 3AZMA 4KGCD 5B1MA 4WU8B 2CV5C 1KX4A 3X1UB 4KHAA 3X1SA 3WAAC 3AV2A 4ZUXA 4J8UC 3MGRD 5B0YB 5BS7C 2Y2HA 2Y2PA 4Z66A 3LJAC 3UT9A 4H9RB 5JRGA 1A7WA 2ZM5A 1P3OA 5DNNB 5GT0B 3W97B 5CPIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4V A;  4LD9 C;  3REJ C;  3X1T B;  4J8V C;  5B40 D;  1KX3 A;  3AZH A;  3VH6 T;  4XZQ C;  1P34 C;  1EQZ A;  5AY8 A;  5B2I D;  3AZK B;  3AZN C;  3WTP B;  3AFA C;  3AZF C;  1HQ3 D;  3AYW D;  4J8W C;  3REK A;  1AOI C;  3MNN D;  4WNN A;  4NE5 A;  4YS3 C;  5AV5 B;  2IO5 C;  3KXB D;  3C1C B;  3B0C T;  5B1L A;  4E44 A;  5AVC B;  3W98 C;  3WTP E;  3REI C;  3W99 B;  3B6F A;  1HTA A;  4NE6 A;  4Z5T C;  2F8N K;  2LY8 A;  5B0Z A;  4R8P A;  3WKJ A;  5CPK B;  4WZS B;  3AZE A;  3REL A;  3UTB B;  3AZM B;  5B1M B;  2YFV B;  1TAF B;  5AVC D;  3MGS A;  2JSS A;  1BH9 A;  5AV9 D;  1ID3 A;  4WU8 C;  3X1U C;  5B24 B;  5B40 C;  3UT9 B;  1P3B D;  5JRG B;  3KUY B;  3AZL A;  5B0Y C;  1P3A A;  1P3O B;  5AVB A;  4WU9 D;  5B2J B;  3AV1 D;  5GSU A;  5E5A D;  5GT0 C;  5DNN C;  3W97 C;  1KX3 B;  3B6G D;  2NZD A;  1M1A A;  3X1T C;  3AZI A;  1EQZ B;  5B32 A;  3KWQ B;  4G91 B;  4X23 D;  5KDM A;  4XUJ A;  3AZK C;  3MGQ D;  3WA9 A;  3WTP C;  4G92 B;  3TU4 A;  3UTA A;  2HUE B;  1H3O A;  1F66 B;  4NFT A;  3KWQ D;  5AV5 C;  1ZLA A;  5BT1 D;  3AZJ A;  3A6N D;  3B6F B;  4NE3 A;  4CSR A;  3C1C C;  2YFW B;  4R8P B;  5B0Z B;  2CV5 D;  5AVC C;  3W99 C;  3WAA D;  3AZE B;  5GXQ A;  3C1B B;  1S32 A;  3LZ1 B;  5GT3 B;  1M19 A;  4H9O A;  3VH5 A;  5CPK C;  5CHL B;  3LJA D;  2PYO B;  3MGS B;  1JFI A;  3UTB C;  3AZM C;  3MVD B;  3MGP A;  5B1M C;  1P3L A;  1ID3 B;  5CPI D;  3REJ D;  4H9N A;  5DNM B;  3LEL B;  4J8V D;  3AZG A;  3C1B D;  5B24 C;  5AVB B;  3UT9 C;  4XZQ D;  4JJN B;  5JRG C;  3KUY C;  2BYK A;  5B2I A;  5BNV B;  2PYO D;  4QLC A;  1P3O C;  3AZN D;  3MVD D;  2ARO A;  2NZD B;  1M1A B;  2NQB A;  3AZF D;  1P3I A;  5B2J C;  3V9R B;  5B31 A;  5B32 B;  4J8W D;  1AOI D;  1KX3 C;  4AWL B;  2HIO B;  5B33 B;  5KDM B;  1EQZ C;  3KWQ C;  4JJN D;  2F8N A;  4G91 C;  3O62 A;  4H9Q A;  3REI D;  4Z5T D;  5G49 B;  1BFM A;  3NQU A;  1ZLA B;  4G92 C;  1F66 C;  2HUE C;  4KUD B;  4CSR B;  1TZY B;  5BO0 B;  3W96 B;  5JA4 A;  5AV6 B;  3B6F C;  1P3K B;  5AV9 A;  1S32 B;  4R8P C;  5CP6 A;  5B0Z C;  4WU8 D;  1M19 B;  3X1U D;  4CAY B;  3AZE C;  3AN2 B;  3C1B C;  1JFI B;  3LZ1 C;  5GT3 C;  4YM6 B;  3MGP B;  1P3L B;  4KUD D;  5B0Y D;  4WU9 A;  1TZY D;  2PYO C;  3MGS C;  3KSY A;  5F99 B;  1ID3 C;  3VH6 A;  3MVD C;  3AZG B;  1P3K D;  1M18 B;  3LZ0 A;  5DNN D;  5GT0 D;  3B6G A;  3W97 D;  5CPJ B;  3NQJ B;  3X1T D;  5DNM C;  3LEL C;  3AN2 D;  4QLC B;  4X23 A;  1P3P B;  5AVB C;  4JJN C;  2FJ7 A;  1P3F B;  1B67 A;  5B31 B;  1KX5 B;  3AZK D;  3WTP D;  1M18 D;  2NZD C;  1M1A C;  1P3G B;  5B32 C;  5CPJ D;  1U35 A;  5C3I B;  3X1V A;  5AV8 A;  5AV5 D;  2HIO C;  3O62 B;  4AWL C;  5B33 C;  1P3P D;  1KX4 B;  4KHA B;  5BNX A;  3X1S B;  3C1C D;  1P3F D;  3AV2 B;  4ZUX B;  3W99 D;  4J8U A;  4Z66 B;  5BS7 A;  3LJA A;  5CPK D;  1BH8 A;  1ZLA C;  4KUD C;  3UTB D;  1TZY C;  3AZM D;  5CP6 B;  5B1M D;  3W96 C;  5AV6 C;  4LD9 A;  3REJ A;  1P3K C;  4J8X A;  3AV2 D;  3R45 A;  1S32 C;  1M19 C;  3AZH B;  4XZQ A;  5B24 D;  1P34 A;  3UT9 D;  5AY8 B;  3AN2 C;  5JRG D;  3KUY D;  1P3M A;  4YM6 C;  3MGP C;  3AZN A;  1P3L C;  3LZ0 B;  1P3O D;  3AFA A;  3REK B;  4J8W A;  5B2J D;  5F99 C;  4WNN B;  3REH A;  3AZG C;  1M18 C;  4H9P A;  4YS3 A;  1KX3 D;  3AZH D;  5CPJ C;  5B1L B;  2FJ7 B;  1EQZ D;  3W98 A;  4QLC C;  3REI A;  1P3P C;  3VH5 W;  4UUZ A;  4KGC A;  4Z5T A;  1P3F C;  4WV4 B;  2BYM A;  5B31 C;  1KX5 C;  1U35 B;  3WKJ B;  5AV8 B;  3REL B;  3MGR A;  1P3G C;  1F66 D;  5C3I C;  3O62 C;  1BH9 B;  3B6F D;  4J8U B;  1KX4 C;  4WU8 A;  3X1S C;  5B0Z D;  4R8P D;  4DRA A;  4M6B A;  3AV2 C;  5B40 A;  4ZUX C;  3AZL B;  1BH8 B;  3AZE D;  3REL D;  1P3A B;  3LZ1 D;  5B0Y A;  5GT3 D;  4Z66 C;  4H9R A;  4H9S A;  3B0D B;  5GSU B;  4J8X B;  3MGS D;  1ID3 D;  5CP6 C;  5DNN A;  1HQ3 A;  3W97 A;  3AYW A;  3AZI B;  3X1T A;  3MNN A;  5DNM D;  3LEL D;  1P3M B;  2CWE A;  3KXB A;  5FUG A;  3AZH C;  4Z2M G;  5B32 G;  4XUJ B;  5AVB D;  5AY8 C;  3AZK A;  3WA9 B;  3REH B;  3WTP A;  4H9P B;  3LZ0 C;  3TU4 B;  3UTA B;  1H3O B;  2NZD D;  1M1A D;  3REK C;  1N1J A;  5B32 D;  4Z2M H;  4DRB A;  5AV5 A;  3AZJ B;  2HIO D;  4UUZ B;  4KGC B;  5B33 D;  5B1L C;  2FJ7 C;  3C1C A;  5AVC A;  5GXQ B;  3MGR B;  3UTA D;  3WKJ C;  4H9O B;  1U35 C;  1P3B A;  3VH6 W;  5AV8 C;  3REL C;  1ZLA D;  4ZBJ B;  2YFV A;  1TAF A;  3AV1 A;  3W96 D;  5B40 B;  5AV6 D;  4H9N B;  5E5A A;  5GXQ D;  1S32 D;  1M19 D;  1WWI A;  5B24 A;  2L5A A;  2BYK B;  3AZL C;  5B2I B;  3KUY A;  3B0C W;  1P3A C;  4YM6 D;  2ARO B;  3MGP D;  1HQ3 B;  1P3L D;  3AYW B;  2NQB B;  1P3I B;  3B0D C;  5GSU C;  3MGQ A;  5B2J A;  3MNN B;  4J8X C;  5F99 D;  3AZG D;  3B0B A;  3KXB B;  5FUG B;  5B31 G;  3AZI C;  2F8N B;  3KWQ A;  1P3M C;  3A6N A;  4H9Q B;  4QLC D;  2ARO D;  4XUJ C;  2F8N G;  2CV5 A;  2NQB D;  1P3I D;  1N1J B;  3WA9 C;  5B31 D;  3REH C;  1KX5 D;  3WAA A;  3NQU B;  3TU4 C;  3UTA C;  1F66 A;  1F1E A;  1P3G D;  5JA4 B;  2F8N D;  3AZJ C;  2F8N H;  5AV9 B;  3O62 D;  4KGC C;  1B6W A;  1KU5 A;  1KX4 D;  2YFW A;  5CPI A;  1P3B B;  3X1S D;  4J8V A;  5GXQ C;  4ZUX D;  3MGR C;  3C1B A;  3LZ1 A;  5GT3 A;  4WU9 B;  4Z66 D;  3AV1 B;  2PYO A;  5E5A B;  3MVD A;  4ZBJ C;  3B6G B;  5CP6 D;  3AZF A;  1AOI A;  5DNM A;  3LEL A;  4X23 B;  5B2I C;  4H9S C;  4JJN A;  3MGQ B;  4EO5 B;  5AY8 D;  5BNV A;  2ARO C;  4E45 A;  1HQ3 C;  3AYW C;  3LZ0 D;  2NQB C;  1P3I C;  3V9R A;  3MNN C;  3REK D;  3X1V B;  3KXB C;  4HGA B;  3A6N B;  2HIO A;  1ULY A;  5B33 A;  2CV5 B;  5BNX B;  5B1L D;  2FJ7 D;  3WAA B;  3X1U A;  5G49 A;  3WKJ D;  3LJA B;  1U35 D;  3X1V D;  5AV8 D;  4KUD A;  2RVQ D;  1TZY A;  5BO0 A;  5CPI B;  3W96 A;  4LD9 B;  5AV6 A;  3REJ B;  3VH5 T;  3R45 B;  5AV9 C;  4J8V B;  1P3K A;  5GT0 A;  4J8U D;  1P3B C;  4XZQ B;  1P34 B;  1WWS A;  4CAY A;  3AZL D;  3AN2 A;  3AZN B;  4YM6 A;  1Q9C A;  4WU9 C;  1P3A D;  3AFA B;  3AZF B;  3AV1 C;  4J8W B;  4LD9 D;  5GSU D;  1AOI B;  5E5A C;  4J8X D;  5F99 A;  4YS3 B;  1M18 A;  3B6G C;  2IO5 B;  5CPJ A;  3NQJ A;  3AZI D;  1P34 D;  3W98 B;  4X23 C;  3REI B;  1P3M D;  1P3P A;  4Z5T B;  3AFA D;  3MGQ C;  4XUJ D;  4EO5 C;  2BYM B;  1P3F A;  1KX5 A;  3WA9 D;  3REH D;  3W99 A;  4YS3 D;  3TU4 D;  1P3G A;  3X1V C;  5CPK A;  5BT1 C;  3W98 D;  3A6N C;  4HGA C;  3AZJ D;  3UTB A;  2RVQ C;  3AZM A;  4KGC D;  5B1M A;  4WU8 B;  2CV5 C;  1KX4 A;  3X1U B;  4KHA A;  3X1S A;  3WAA C;  3AV2 A;  4ZUX A;  4J8U C;  3MGR D;  5B0Y B;  5BS7 C;  4Z66 A;  3LJA C;  3UT9 A;  4H9R B;  5JRG A;  1A7W A;  1P3O A;  5DNN B;  5GT0 B;  3W97 B;  5CPI C; 
#chains in the Genus database with same CATH topology
 1R4V A;  4LD9 C;  3REJ C;  3X1T B;  4J8V C;  5B40 D;  1KX3 A;  2FFF B;  3AZH A;  3VH6 T;  4XZQ C;  1P34 C;  1EQZ A;  2ZY3 A;  2Y2N A;  5AY8 A;  5B2I D;  3AZK B;  3AZN C;  3WTP B;  3AFA C;  3AZF C;  1HQ3 D;  2XD1 A;  3AYW D;  4J8W C;  3REK A;  1AOI C;  3MNN D;  4WNN A;  4NE5 A;  4YS3 C;  5AV5 B;  2DQN C;  2IO5 C;  3KXB D;  3C1C B;  4E44 A;  3B0C T;  5B1L A;  5AVC B;  3W98 C;  3WTP E;  3IP4 C;  3REI C;  3W99 B;  3B6F A;  1HTA A;  4NE6 A;  4Z5T C;  2F8N K;  2LY8 A;  5B0Z A;  4R8P A;  3WKJ A;  5CPK B;  4WZS B;  3AZE A;  4UPK A;  3REL A;  2Y2I A;  3UTB B;  3AZM B;  5B1M B;  2YFV B;  1TAF B;  5AVC D;  3MGS A;  2J8P A;  2JSS A;  1BH9 A;  5AV9 D;  1ID3 A;  4WU8 C;  3X1U C;  5B24 B;  5B40 C;  3UT9 B;  1P3B D;  5JRG B;  3KUY B;  3AZL A;  5B0Y C;  1P3A A;  1P3O B;  2Y2Q A;  5AVB A;  4WU9 D;  5B2J B;  3AV1 D;  5GSU A;  5E5A D;  5GT0 C;  5DNN C;  3EPL A;  3W97 C;  1KX3 B;  3B6G D;  2NZD A;  1M1A A;  3X1T C;  3AZI A;  1EQZ B;  5B32 A;  3KWQ B;  4G91 B;  3H0L C;  4X23 D;  5KDM A;  4XUJ A;  3AZK C;  3MGQ D;  3WA9 A;  3WTP C;  2DF4 C;  4G92 B;  3TU4 A;  3UTA A;  2HUE B;  1H3O A;  1F66 B;  4NFT A;  3KWQ D;  5AV5 C;  1ZLA A;  5BT1 D;  3AZJ A;  3A6N D;  3B6F B;  4NE3 A;  3H0R C;  2RIQ A;  4CSR A;  3C1C C;  2YFW B;  5B0Z B;  4R8P B;  2CV5 D;  5AVC C;  3W99 C;  3WAA D;  3AZE B;  5GXQ A;  3C1B B;  1S32 A;  3LZ1 B;  5GT3 B;  1M19 A;  4H9O A;  2XD5 A;  3VH5 A;  5CPK C;  5CHL B;  3LJA D;  2PYO B;  3MGS B;  4DQY B;  1JFI A;  3UTB C;  2UWX A;  2Y2O A;  3MVD B;  3MGP A;  5B1M C;  3AZM C;  1P3L A;  1ID3 B;  5CPI D;  3REJ D;  4H9N A;  5DNM B;  3LEL B;  4J8V D;  3AZG A;  3C1B D;  5B24 C;  5AVB B;  3UT9 C;  4XZQ D;  4JJN B;  5JRG C;  3KUY C;  2BYK A;  5B2I A;  5BNV B;  2PYO D;  4QLC A;  1P3O C;  3AZN D;  3MVD D;  2ARO A;  2NZD B;  1M1A B;  2NQB A;  3AZF D;  1P3I A;  5B2J C;  3V9R B;  5B31 A;  5B32 B;  4J8W D;  1AOI D;  1KX3 C;  2Y2L A;  4AWL B;  2HIO B;  5B33 B;  5KDM B;  1EQZ C;  3KFU G;  3KWQ C;  4JJN D;  2F8N A;  4G91 C;  3O62 A;  4H9Q A;  3REI D;  4Z5T D;  5G49 B;  1BFM A;  3NQU A;  1ZLA B;  4G92 C;  1F66 C;  2HUE C;  4KUD B;  4CSR B;  3AL0 C;  1TZY B;  5BO0 B;  3W96 B;  5JA4 A;  5AV6 B;  3EG5 B;  2Y2J A;  3B6F C;  1P3K B;  5AV9 A;  1S32 B;  4R8P C;  5CP6 A;  5B0Z C;  4WU8 D;  1M19 B;  3X1U D;  4CAY B;  3AZE C;  3AN2 B;  3C1B C;  1JFI B;  3LZ1 C;  2Y2K A;  5GT3 C;  4YM6 B;  3MGP B;  1P3L B;  4KUD D;  5B0Y D;  4WU9 A;  1TZY D;  2PYO C;  3MGS C;  3KSY A;  5F99 B;  1ID3 C;  3VH6 A;  3MVD C;  3AZG B;  1P3K D;  1M18 B;  3LZ0 A;  5DNN D;  3FDD A;  5GT0 D;  3B6G A;  3W97 D;  5CPJ B;  3NQJ B;  3X1T D;  5DNM C;  3LEL C;  3AN2 D;  4QLC B;  3A1I A;  4X23 A;  1P3P B;  5AVB C;  4JJN C;  2FJ7 A;  1P3F B;  1B67 A;  5B31 B;  1KX5 B;  3AZK D;  3WTP D;  1M18 D;  2NZD C;  1M1A C;  1P3G B;  5B32 C;  5CPJ D;  1U35 A;  5C3I B;  3X1V A;  5AV8 A;  5AV5 D;  2HIO C;  3O62 B;  4AWL C;  5B33 C;  1P3P D;  1KX4 B;  4KHA B;  5BNX A;  3X1S B;  3C1C D;  1P3F D;  3AV2 B;  4ZUX B;  3W99 D;  4J8U A;  4Z66 B;  5BS7 A;  3LJA A;  5CPK D;  1BH8 A;  1ZLA C;  4KUD C;  3UTB D;  1TZY C;  3AZM D;  5CP6 B;  5B1M D;  3W96 C;  5AV6 C;  4LD9 A;  3REJ A;  3A1K A;  2VQR A;  4J8X A;  3AV2 D;  3R45 A;  1P3K C;  1S32 C;  2ZY4 A;  1PZR A;  1M19 C;  3AZH B;  4XZQ A;  5B24 D;  1P34 A;  3UT9 D;  5AY8 B;  3AN2 C;  5JRG D;  3KUY D;  1P3M A;  4YM6 C;  3MGP C;  3AZN A;  1P3L C;  3LZ0 B;  1P3O D;  3AFA A;  3REK B;  2ZY2 A;  4J8W A;  5B2J D;  5F99 C;  4WNN B;  3REH A;  3AZG C;  1M18 C;  4H9P A;  4YS3 A;  1KX3 D;  3AZH D;  5CPJ C;  5B1L B;  2FJ7 B;  1EQZ D;  3W98 A;  4QLC C;  3REI A;  1P3P C;  3VH5 W;  4UUZ A;  4KGC A;  4Z5T A;  1P3F C;  4WV4 B;  2BYM A;  5B31 C;  1KX5 C;  1U35 B;  3WKJ B;  5AV8 B;  3REL B;  3MGR A;  1Z2C B;  3P5J B;  1P3G C;  1F66 D;  5C3I C;  3O62 C;  1BH9 B;  3H0M C;  3B6F D;  4J8U B;  1KX4 C;  4WU8 A;  3X1S C;  5B0Z D;  4R8P D;  4DRA A;  4M6B A;  3AV2 C;  5B40 A;  4ZUX C;  3AZL B;  2JCH A;  1BH8 B;  3AZE D;  3REL D;  1P3A B;  3LZ1 D;  5B0Y A;  5GT3 D;  4Z66 C;  3EPH A;  4H9R A;  4H9S A;  3B0D B;  5GSU B;  4J8X B;  3MGS D;  1ID3 D;  5CP6 C;  5DNN A;  1HQ3 A;  3W97 A;  3AYW A;  2ZY5 A;  3AZI B;  3X1T A;  3MNN A;  5DNM D;  3LEL D;  1P3M B;  2CWE A;  3KXB A;  5FUG A;  3AZH C;  4Z2M G;  5B32 G;  4XUJ B;  5AVB D;  5AY8 C;  3AZK A;  3WA9 B;  3REH B;  3WTP A;  4H9P B;  3LZ0 C;  2Y2M A;  2Y2G A;  3UTA B;  3TU4 B;  1H3O B;  2NZD D;  1M1A D;  3REK C;  1N1J A;  5B32 D;  4Z2M H;  4DRB A;  5AV5 A;  3AZJ B;  2HIO D;  4UUZ B;  4KGC B;  5B33 D;  5B1L C;  2FJ7 C;  3C1C A;  5AVC A;  5GXQ B;  3MGR B;  3UTA D;  3WKJ C;  4H9O B;  1U35 C;  1P3B A;  3VH6 W;  5AV8 C;  3REL C;  1ZLA D;  4ZBJ B;  2YFV A;  1TAF A;  3AV1 A;  3W96 D;  5B40 B;  5AV6 D;  4H9N B;  5E5A A;  5GXQ D;  1S32 D;  1M19 D;  1WWI A;  5B24 A;  2L5A A;  2BYK B;  3AZL C;  5B2I B;  2BG1 A;  3KUY A;  3B0C W;  1P3A C;  4YM6 D;  2ARO B;  3MGP D;  1HQ3 B;  1P3L D;  3AYW B;  2NQB B;  1P3I B;  3B0D C;  5GSU C;  3MGQ A;  5B2J A;  3MNN B;  4J8X C;  5F99 D;  2JE5 A;  3AZG D;  3B0B A;  3KXB B;  5FUG B;  5B31 G;  3AZI C;  2F8N B;  3KWQ A;  1P3M C;  3A6N A;  4H9Q B;  4QLC D;  2ARO D;  4XUJ C;  2F8N G;  2CV5 A;  2NQB D;  1P3I D;  1N1J B;  3WA9 C;  5B31 D;  3REH C;  1KX5 D;  3WAA A;  3NQU B;  3TU4 C;  3UTA C;  1F66 A;  1F1E A;  1P3G D;  3F6T A;  5JA4 B;  2F8N D;  3AZJ C;  2F8N H;  5AV9 B;  3O62 D;  4KGC C;  1B6W A;  1KU5 A;  1KX4 D;  2YFW A;  5CPI A;  1P3B B;  3X1S D;  1W2E A;  4J8V A;  2F2A C;  5GXQ C;  4ZUX D;  3MGR C;  3C1B A;  3LZ1 A;  5GT3 A;  3EPK A;  4WU9 B;  4Z66 D;  3AV1 B;  2PYO A;  5E5A B;  3MVD A;  4ZBJ C;  3B6G B;  5CP6 D;  3AZF A;  1AOI A;  5DNM A;  3LEL A;  4X23 B;  5B2I C;  2W8S A;  4H9S C;  3MGQ B;  4JJN A;  4EO5 B;  5AY8 D;  5BNV A;  2ARO C;  4E45 A;  1HQ3 C;  3AYW C;  3LZ0 D;  2NQB C;  1P3I C;  3V9R A;  3MNN C;  3REK D;  3X1V B;  3KXB C;  4HGA B;  3A6N B;  2HIO A;  1ULY A;  5B33 A;  2CV5 B;  5BNX B;  5B1L D;  2FJ7 D;  3WAA B;  3X1U A;  5G49 A;  3WKJ D;  3LJA B;  1U35 D;  3X1V D;  5AV8 D;  4KUD A;  2RVQ D;  1TZY A;  5BO0 A;  5CPI B;  3W96 A;  4LD9 B;  5AV6 A;  3REJ B;  3VH5 T;  3R45 B;  5AV9 C;  4J8V B;  1P3K A;  5GT0 A;  4J8U D;  1P3B C;  4XZQ B;  1P34 B;  1WWS A;  4CAY A;  3AZL D;  3AN2 A;  3AZN B;  4YM6 A;  1Q9C A;  4WU9 C;  1P3A D;  3AFA B;  3AZF B;  3AV1 C;  4J8W B;  4LD9 D;  5GSU D;  1AOI B;  5E5A C;  4J8X D;  5F99 A;  4YS3 B;  1M18 A;  3B6G C;  2IO5 B;  5CPJ A;  3NQJ A;  1T3U A;  3AZI D;  1P34 D;  3W98 B;  4X23 C;  3REI B;  1P3M D;  4WJ3 C;  1P3P A;  4Z5T B;  3AFA D;  3MGQ C;  4XUJ D;  4EO5 C;  2BYM B;  1P3F A;  1KX5 A;  2G5H C;  3WA9 D;  3REH D;  3W99 A;  4YS3 D;  3EPJ A;  3TU4 D;  1P3G A;  3X1V C;  5CPK A;  5BT1 C;  3W98 D;  3A6N C;  4HGA C;  3AZJ D;  2G5I C;  2RVQ C;  3UTB A;  3AZM A;  4KGC D;  5B1M A;  4WU8 B;  2CV5 C;  1KX4 A;  3X1U B;  4KHA A;  3X1S A;  3WAA C;  3AV2 A;  4ZUX A;  4J8U C;  3MGR D;  5B0Y B;  5BS7 C;  2Y2H A;  2Y2P A;  4Z66 A;  3LJA C;  3UT9 A;  4H9R B;  5JRG A;  1A7W A;  2ZM5 A;  1P3O A;  5DNN B;  5GT0 B;  3W97 B;  5CPI C; 
#chains in the Genus database with same CATH homology
 1R4V A;  4LD9 C;  3REJ C;  3X1T B;  4J8V C;  5B40 D;  1KX3 A;  2FFF B;  3AZH A;  3VH6 T;  4XZQ C;  1P34 C;  1EQZ A;  2ZY3 A;  2Y2N A;  5AY8 A;  5B2I D;  3AZK B;  3AZN C;  3WTP B;  3AFA C;  3AZF C;  1HQ3 D;  2XD1 A;  3AYW D;  4J8W C;  3REK A;  1AOI C;  3MNN D;  4WNN A;  4NE5 A;  4YS3 C;  5AV5 B;  2DQN C;  2IO5 C;  3KXB D;  3C1C B;  4E44 A;  3B0C T;  5B1L A;  5AVC B;  3W98 C;  3WTP E;  3IP4 C;  3REI C;  3W99 B;  3B6F A;  1HTA A;  4NE6 A;  4Z5T C;  2F8N K;  2LY8 A;  5B0Z A;  4R8P A;  3WKJ A;  5CPK B;  4WZS B;  3AZE A;  4UPK A;  3REL A;  2Y2I A;  3UTB B;  3AZM B;  5B1M B;  2YFV B;  1TAF B;  5AVC D;  3MGS A;  2J8P A;  2JSS A;  1BH9 A;  5AV9 D;  1ID3 A;  4WU8 C;  3X1U C;  5B24 B;  5B40 C;  3UT9 B;  1P3B D;  5JRG B;  3KUY B;  3AZL A;  5B0Y C;  1P3A A;  1P3O B;  2Y2Q A;  5AVB A;  4WU9 D;  5B2J B;  3AV1 D;  5GSU A;  5E5A D;  5GT0 C;  5DNN C;  3EPL A;  3W97 C;  1KX3 B;  3B6G D;  2NZD A;  1M1A A;  3X1T C;  3AZI A;  1EQZ B;  5B32 A;  3KWQ B;  4G91 B;  3H0L C;  4X23 D;  5KDM A;  4XUJ A;  3AZK C;  3MGQ D;  3WA9 A;  3WTP C;  2DF4 C;  4G92 B;  3TU4 A;  3UTA A;  2HUE B;  1H3O A;  1F66 B;  4NFT A;  3KWQ D;  5AV5 C;  1ZLA A;  5BT1 D;  3AZJ A;  3A6N D;  3B6F B;  4NE3 A;  3H0R C;  2RIQ A;  4CSR A;  3C1C C;  2YFW B;  5B0Z B;  4R8P B;  2CV5 D;  5AVC C;  3W99 C;  3WAA D;  3AZE B;  5GXQ A;  3C1B B;  1S32 A;  3LZ1 B;  5GT3 B;  1M19 A;  4H9O A;  2XD5 A;  3VH5 A;  5CPK C;  5CHL B;  3LJA D;  2PYO B;  3MGS B;  4DQY B;  1JFI A;  3UTB C;  2UWX A;  2Y2O A;  3MVD B;  3MGP A;  5B1M C;  3AZM C;  1P3L A;  1ID3 B;  5CPI D;  3REJ D;  4H9N A;  5DNM B;  3LEL B;  4J8V D;  3AZG A;  3C1B D;  5B24 C;  5AVB B;  3UT9 C;  4XZQ D;  4JJN B;  5JRG C;  3KUY C;  2BYK A;  5B2I A;  5BNV B;  2PYO D;  4QLC A;  1P3O C;  3AZN D;  3MVD D;  2ARO A;  2NZD B;  1M1A B;  2NQB A;  3AZF D;  1P3I A;  5B2J C;  3V9R B;  5B31 A;  5B32 B;  4J8W D;  1AOI D;  1KX3 C;  2Y2L A;  4AWL B;  2HIO B;  5B33 B;  5KDM B;  1EQZ C;  3KFU G;  3KWQ C;  4JJN D;  2F8N A;  4G91 C;  3O62 A;  4H9Q A;  3REI D;  4Z5T D;  5G49 B;  1BFM A;  3NQU A;  1ZLA B;  4G92 C;  1F66 C;  2HUE C;  4KUD B;  4CSR B;  3AL0 C;  1TZY B;  5BO0 B;  3W96 B;  5JA4 A;  5AV6 B;  3EG5 B;  2Y2J A;  3B6F C;  1P3K B;  5AV9 A;  1S32 B;  4R8P C;  5CP6 A;  5B0Z C;  4WU8 D;  1M19 B;  3X1U D;  4CAY B;  3AZE C;  3AN2 B;  3C1B C;  1JFI B;  3LZ1 C;  2Y2K A;  5GT3 C;  4YM6 B;  3MGP B;  1P3L B;  4KUD D;  5B0Y D;  4WU9 A;  1TZY D;  2PYO C;  3MGS C;  3KSY A;  5F99 B;  1ID3 C;  3VH6 A;  3MVD C;  3AZG B;  1P3K D;  1M18 B;  3LZ0 A;  5DNN D;  3FDD A;  5GT0 D;  3B6G A;  3W97 D;  5CPJ B;  3NQJ B;  3X1T D;  5DNM C;  3LEL C;  3AN2 D;  4QLC B;  3A1I A;  4X23 A;  1P3P B;  5AVB C;  4JJN C;  2FJ7 A;  1P3F B;  1B67 A;  5B31 B;  1KX5 B;  3AZK D;  3WTP D;  1M18 D;  2NZD C;  1M1A C;  1P3G B;  5B32 C;  5CPJ D;  1U35 A;  5C3I B;  3X1V A;  5AV8 A;  5AV5 D;  2HIO C;  3O62 B;  4AWL C;  5B33 C;  1P3P D;  1KX4 B;  4KHA B;  5BNX A;  3X1S B;  3C1C D;  1P3F D;  3AV2 B;  4ZUX B;  3W99 D;  4J8U A;  4Z66 B;  5BS7 A;  3LJA A;  5CPK D;  1BH8 A;  1ZLA C;  4KUD C;  3UTB D;  1TZY C;  3AZM D;  5CP6 B;  5B1M D;  3W96 C;  5AV6 C;  4LD9 A;  3REJ A;  3A1K A;  2VQR A;  4J8X A;  3AV2 D;  3R45 A;  1P3K C;  1S32 C;  2ZY4 A;  1PZR A;  1M19 C;  3AZH B;  4XZQ A;  5B24 D;  1P34 A;  3UT9 D;  5AY8 B;  3AN2 C;  5JRG D;  3KUY D;  1P3M A;  4YM6 C;  3MGP C;  3AZN A;  1P3L C;  3LZ0 B;  1P3O D;  3AFA A;  3REK B;  2ZY2 A;  4J8W A;  5B2J D;  5F99 C;  4WNN B;  3REH A;  3AZG C;  1M18 C;  4H9P A;  4YS3 A;  1KX3 D;  3AZH D;  5CPJ C;  5B1L B;  2FJ7 B;  1EQZ D;  3W98 A;  4QLC C;  3REI A;  1P3P C;  3VH5 W;  4UUZ A;  4KGC A;  4Z5T A;  1P3F C;  4WV4 B;  2BYM A;  5B31 C;  1KX5 C;  1U35 B;  3WKJ B;  5AV8 B;  3REL B;  3MGR A;  1Z2C B;  3P5J B;  1P3G C;  1F66 D;  5C3I C;  3O62 C;  1BH9 B;  3H0M C;  3B6F D;  4J8U B;  1KX4 C;  4WU8 A;  3X1S C;  5B0Z D;  4R8P D;  4DRA A;  4M6B A;  3AV2 C;  5B40 A;  4ZUX C;  3AZL B;  2JCH A;  1BH8 B;  3AZE D;  3REL D;  1P3A B;  3LZ1 D;  5B0Y A;  5GT3 D;  4Z66 C;  3EPH A;  4H9R A;  4H9S A;  3B0D B;  5GSU B;  4J8X B;  3MGS D;  1ID3 D;  5CP6 C;  5DNN A;  1HQ3 A;  3W97 A;  3AYW A;  2ZY5 A;  3AZI B;  3X1T A;  3MNN A;  5DNM D;  3LEL D;  1P3M B;  2CWE A;  3KXB A;  5FUG A;  3AZH C;  4Z2M G;  5B32 G;  4XUJ B;  5AVB D;  5AY8 C;  3AZK A;  3WA9 B;  3REH B;  3WTP A;  4H9P B;  3LZ0 C;  2Y2M A;  2Y2G A;  3UTA B;  3TU4 B;  1H3O B;  2NZD D;  1M1A D;  3REK C;  1N1J A;  5B32 D;  4Z2M H;  4DRB A;  5AV5 A;  3AZJ B;  2HIO D;  4UUZ B;  4KGC B;  5B33 D;  5B1L C;  2FJ7 C;  3C1C A;  5AVC A;  5GXQ B;  3MGR B;  3UTA D;  3WKJ C;  4H9O B;  1U35 C;  1P3B A;  3VH6 W;  5AV8 C;  3REL C;  1ZLA D;  4ZBJ B;  2YFV A;  1TAF A;  3AV1 A;  3W96 D;  5B40 B;  5AV6 D;  4H9N B;  5E5A A;  5GXQ D;  1S32 D;  1M19 D;  1WWI A;  5B24 A;  2L5A A;  2BYK B;  3AZL C;  5B2I B;  2BG1 A;  3KUY A;  3B0C W;  1P3A C;  4YM6 D;  2ARO B;  3MGP D;  1HQ3 B;  1P3L D;  3AYW B;  2NQB B;  1P3I B;  3B0D C;  5GSU C;  3MGQ A;  5B2J A;  3MNN B;  4J8X C;  5F99 D;  2JE5 A;  3AZG D;  3B0B A;  3KXB B;  5FUG B;  5B31 G;  3AZI C;  2F8N B;  3KWQ A;  1P3M C;  3A6N A;  4H9Q B;  4QLC D;  2ARO D;  4XUJ C;  2F8N G;  2CV5 A;  2NQB D;  1P3I D;  1N1J B;  3WA9 C;  5B31 D;  3REH C;  1KX5 D;  3WAA A;  3NQU B;  3TU4 C;  3UTA C;  1F66 A;  1F1E A;  1P3G D;  3F6T A;  5JA4 B;  2F8N D;  3AZJ C;  2F8N H;  5AV9 B;  3O62 D;  4KGC C;  1B6W A;  1KU5 A;  1KX4 D;  2YFW A;  5CPI A;  1P3B B;  3X1S D;  1W2E A;  4J8V A;  2F2A C;  5GXQ C;  4ZUX D;  3MGR C;  3C1B A;  3LZ1 A;  5GT3 A;  3EPK A;  4WU9 B;  4Z66 D;  3AV1 B;  2PYO A;  5E5A B;  3MVD A;  4ZBJ C;  3B6G B;  5CP6 D;  3AZF A;  1AOI A;  5DNM A;  3LEL A;  4X23 B;  5B2I C;  2W8S A;  4H9S C;  3MGQ B;  4JJN A;  4EO5 B;  5AY8 D;  5BNV A;  2ARO C;  4E45 A;  1HQ3 C;  3AYW C;  3LZ0 D;  2NQB C;  1P3I C;  3V9R A;  3MNN C;  3REK D;  3X1V B;  3KXB C;  4HGA B;  3A6N B;  2HIO A;  1ULY A;  5B33 A;  2CV5 B;  5BNX B;  5B1L D;  2FJ7 D;  3WAA B;  3X1U A;  5G49 A;  3WKJ D;  3LJA B;  1U35 D;  3X1V D;  5AV8 D;  4KUD A;  2RVQ D;  1TZY A;  5BO0 A;  5CPI B;  3W96 A;  4LD9 B;  5AV6 A;  3REJ B;  3VH5 T;  3R45 B;  5AV9 C;  4J8V B;  1P3K A;  5GT0 A;  4J8U D;  1P3B C;  4XZQ B;  1P34 B;  1WWS A;  4CAY A;  3AZL D;  3AN2 A;  3AZN B;  4YM6 A;  1Q9C A;  4WU9 C;  1P3A D;  3AFA B;  3AZF B;  3AV1 C;  4J8W B;  4LD9 D;  5GSU D;  1AOI B;  5E5A C;  4J8X D;  5F99 A;  4YS3 B;  1M18 A;  3B6G C;  2IO5 B;  5CPJ A;  3NQJ A;  1T3U A;  3AZI D;  1P34 D;  3W98 B;  4X23 C;  3REI B;  1P3M D;  4WJ3 C;  1P3P A;  4Z5T B;  3AFA D;  3MGQ C;  4XUJ D;  4EO5 C;  2BYM B;  1P3F A;  1KX5 A;  2G5H C;  3WA9 D;  3REH D;  3W99 A;  4YS3 D;  3EPJ A;  3TU4 D;  1P3G A;  3X1V C;  5CPK A;  5BT1 C;  3W98 D;  3A6N C;  4HGA C;  3AZJ D;  2G5I C;  2RVQ C;  3UTB A;  3AZM A;  4KGC D;  5B1M A;  4WU8 B;  2CV5 C;  1KX4 A;  3X1U B;  4KHA A;  3X1S A;  3WAA C;  3AV2 A;  4ZUX A;  4J8U C;  3MGR D;  5B0Y B;  5BS7 C;  2Y2H A;  2Y2P A;  4Z66 A;  3LJA C;  3UT9 A;  4H9R B;  5JRG A;  1A7W A;  2ZM5 A;  1P3O A;  5DNN B;  5GT0 B;  3W97 B;  5CPI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...