4QLCD

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
KRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcD00
1P3PC 3AZKB 2AROA 1P3BB 3LJAA 2F8NG 3VH5W 2HUEB 3UTBB 3REHD 5F99A 5JRGA 3AZGC 2FJ7A 5DNMB 3TU4C 4ZUXD 3WA9D 3AYWA 4KGCB 3UTAA 4JJNA 1P3AA 4WU9D 1KX5D 1F66A 3W99B 1P3LD 1U35D 5B2JC 3X1SC 5BS7C 5GSUB 3AZLC 1TZYA 3REKB 5JA4A 2HIOC 1ZLAB 3AZKA 1P3BA 4X23D 3WKJA 3UTBA 5DNMA 4J8VD 1P3IB 3AV1C 3AFAC 5AV9C 3AZMD 3LELB 3KUYB 1P34D 4KGCA 3NQUA 5KDMB 5AVCD 3W99A 3REHB 3REJD 5GSUA 3KWQB 3REKA 1KX3D 2JSSA 3W96D 5CPJD 3VH6W 1ZLAA 5B32D 4KHAB 1P3FD 3X1TC 4UUZB 5B33D 4ZBJB 3R45B 4XUJC 3MNND 3MGQC 3MVDD 1P3LB 3WTPD 3AZFA 3LELA 3W98A 5AV6C 5B2IA 4G92C 5KDMA 3AZHA 4Z2MH 4X23B 3KXBC 5GT3C 2NQBC 4G91C 5B0ZA 3NQJA 3KWQA 4Z5TB 4HGAB 5CPKD 4H9PB 4WU8A 4YS3B 4UUZA 3R45A 3VH5T 1BH8B 4NE5A 4XZQC 3AN2B 1ID3D 1AOIA 4EO5B 2HUEC 4LD9B 1B6WA 3B0DC 1EQZB 4NE6A 1HQ3B 1M1AA 4KUDB 3AZJC 4H9OB 3O62B 3UT9D 2AROD 1P3FB 5AV8C 5AVBB 5F99D 5JRGD 4QLCB 3X1VA 1M18C 2CV5C 2FJ7D 4Z5TA 3B6FB 3MNNB 2BYKB 5B31A 3LZ1B 3AYWD 1F1EA 3UTAD 4JJND 1BH8A 1P3AD 3MGSC 3AN2A 3MGRB 3B0BA 3C1BC 4LD9A 2IO5B 3LZ0B 1S32B 1EQZA 1HQ3A 1TZYD 1P3IC 1P3KC 4KUDA 4H9OA 3O62A 3A6NB 1KX4C 5GXQC 3AV2C 3AZKD 1P3BD 3WKJD 3UTBD 4QLCA 3B6FA 5BT1D 5DNMD 1WWIA 5B24B 4J8WB 2BYKA 5E5AB 3REHC 4NE3A 3VH6T 4KGCD 2F8NH 2NZDB 3W99D 3MGPB 4ZUXC 3WA9C 3LJAB 3LZ0A 1KX5C 4WU9C 1S32A 5F99B 4E44A 5B1LC 5GSUD 2FJ7B 3REKD 3A6NA 1U35C 1ZLAD 4H9QB 1F66B 4JJNB 1P3AB 2PYOC 4J8UB 4X23C 5B24A 4J8WA 3AZLA 5E5AA 3AZFD 2HIOA 3LELD 3KUYD 2NZDA 4J8VC 3AZHD 3MGPA 3C1CB 3AZMC 5DNNB 1P34C 3WKJB 5B0ZD 5AVCC 3KWQD 5AY8B 4H9QA 1M19B 5BNVA 4WU8D 5CP6B 3REJC 4H9SC 5GT0B 1KX3C 3AZNB 3W96C 5CPJC 3NQUB 5B32C 4J8UA 1P3FC 5B33C 4YM6B 4WNNB 1M1AD 3MVDC 4Z66C 3WTPC 3C1CA 5DNNA 5CPIB 1P3GB 3X1VD 4Z5TD 5AV5A 4AWLB 4M6BA 5G49B 5AY8A 3REIB 1M19A 4YS3D 3V9RB 5CP6A 5B31D 3AZFB 5GT0A 3AZNA 3B6GB 3W98B 5B2IB 5CPKC 3AN2D 2NQBA 2YFVB 3AZHB 4LD9D 4J8XB 2F8NA 5B0ZB 1EQZD 4YM6A 4WNNA 1HQ3D 3NQJB 1ID3C 4KUDD 3O62D 1P3OB 5CPIA 4WU8B 1P3GA 5AVBD 1BFMA 4QLCD 3UT9C 3B6FD 2AROC 1AOIB 5G49A 3REIA 3V9RA 5JRGC 5F99C 3LZ1D 2FJ7C 3B6GA 1M1AB 3WAAB 3AZIB 2RVQD 3MGRD 3RELB 2YFVA 1M18A 3AYWC 4J8XA 3UTAC 3LZ0D 1P3AC 1S32D 5B40B 3X1VB 3A6ND 1P3OA 1P3MB 3MGSA 5B0YB 5B31B 1TZYC 3C1BA 3X1UB 3AZKC 1P3BC 5B24D 4J8WD 3AZLD 5E5AD 3WKJC 3UTBC 5FUGB 3AV2A 5BT1C 5DNMC 2NZDD 3WAAA 5B1MB 3AZIA 3B0CW 3RELA 3MGPD 3LJAD 4KGCC 5B40A 3W99C 3AZEB 3W97A 1P3MA 5B32G 5B0YA 4R8PA 5GSUC 3REKC 1P3PB 1F66D 3X1UA 1ZLAC 4J8UD 3AZGB 5B1LA 5FUGA 1WWSA 4AWLC 4CSRA 3TU4B 5B1MA 2LY8A 3C1CD 3AZFC 3LELC 5CHLB 5DNND 3KUYC 2PYOA 4E45A 5AV5D 1Q9CA 3AZEA 3X1SB 5AY8D 4CAYB 1M19D 3AZLB 5B0ZC 5CP6D 2HIOB 3KWQC 5GT0D 1P3PA 3AZND 2NQBD 2YFWB 4WU8C 3AZGA 5AVCA 5BO0B 4ZBJC 1JFIA 4WV4B 4YM6D 3TU4A 3AV1B 3AFAB 5AV9B 2BYMB 1P3LC 5BNVB 5CPID 1P3GD 1M1AC 5B33A 5B2JA 4WZSB 3X1SA 5BS7A 4CAYA 3REID 3MVDA 4Z66A 3X1VC 4Z5TC 4HGAC 3B6GD 3W98D 5B2ID 3X1TB 2YFWA 4YS3C 5B31C 4DRAA 5BO0A 4J8XD 3AN2C 3AV1A 3AFAA 5AV9A 2BYMA 4EO5C 5AV5B 1P3OD 4LD9C 1BH9A 5AV6B 3MGSD 3B0CT 5CPKA 1EQZC 1HQ3C 4KUDC 3O62C 1HTAA 3KXBB 3C1BD 5GT3B 2NQBB 1AOID 5AVBC 4QLCC 2F8NB 3B6FC 3MNNC 3WAAD 3AZID 3X1TA 3RELD 1A7WA 2L5AA 3LZ1C 4XUJA 4H9RB 4XZQB 3MGQA 2RVQC 5B40D 3MGRC 3B0DB 3W97D 2IO5C 5AV6A 3LZ0C 4R8PD 5B0YD 3AZJB 1S32C 1P3MD 4NFTA 3A6NC 3KXBA 3X1UD 5AV8B 5GT3A 5B1LD 1M18B 2CV5B 5B1MD 5B24C 3VH5A 4J8WC 1H3OA 5E5AC 3KSYA 2PYOD 3MGSB 4H9RA 4XZQA 2NZDC 1B67A 3C1BB 3MGPC 3AZED 3LJAC 2CWEA 1P3KB 3AZJA 1KX4B 5GXQB 3AV2B 1P3PD 5AV8A 3AZGD 2CV5A 1F66C 4JJNC 4J8UC 3TU4D 3W97B 4R8PB 4ZUXB 3WA9B 5B2JD 3C1CC 5DNNC 1KX5B 3X1SD 4WU9B 5B1LB 1P3IA 1P3KA 4Z66D 2HIOD 1KX4A 1U35B 5B31G 5GXQA 5AV5C 3KUYA 4CSRB 3WTPE 5AY8C 1M19C 5CP6C 2PYOB 5GT0C 3AZNC 3VH6A 3AV1D 3AFAD 5AV9D 3REHA 5C3IB 4J8VB 1KU5A 4YM6C 4KHAA 4ZUXA 3AZMB 3WA9A 1P34B 5CPIC 1KX5A 4WU9A 5BNXB 5AVCB 1P3GC 1P3LA 1JFIB 1U35A 3REIC 3X1TD 3REJB 1KX3B 3W96B 5CPJB 4XUJD 5B32B 4X23A 3MGQD 3B6GC 3W98C 1TAFB 5B2IC 5B33B 5B2JB 3AZHC 4J8XC 1ULYA 4Z2MG 4J8VA 5AV6D 3MVDB 4Z66B 4H9PA 4YS3A 3WTPB 3AZMA 3KXBD 1P34A 1P3OC 5GT3D 5BNXA 2F8ND 4DRBA 1AOIC 3REJA 4H9SA 1KX3A 1BH9B 3W96A 5CPJA 5CPKB 4XZQD 5B32A 3WAAC 3AZIC 1TAFA 1N1JB 1P3FA 3RELC 5AVBA 3MNNA 4H9NB 1ID3B 2F8NK 3AZJD 5B40C 3WTPA 3LZ1A 5AV8D 3W97C 1P3MC 4R8PC 5B0YC 3MGRA 1M18D 2CV5D 3UT9B 4XUJB 2AROB 3MGQB 3X1UC 5JRGB 4G92B 5B1MC 1N1JA 3AYWB 3UTAB 4G91B 1ID3A 4H9NA 1P3ID 1P3KD 1R4VA 1KX4D 5GXQD 3AV2D 5C3IC 3AZEC 1H3OB 1TZYB 5JA4B 3UT9A
chains in the Genus database with same CATH superfamily
1P3PC 3AZKB 2AROA 1P3BB 3LJAA 2F8NG 3VH5W 2HUEB 2Y2PA 3UTBB 3REHD 5F99A 5JRGA 3AZGC 2FJ7A 5DNMB 3TU4C 4ZUXD 3FDDA 3WA9D 3AYWA 4KGCB 3UTAA 2DQNC 4JJNA 4WU9D 1P3AA 1KX5D 1F66A 3W99B 1P3LD 1U35D 5B2JC 1Z2CB 3X1SC 5BS7C 5GSUB 3AZLC 1TZYA 3REKB 5JA4A 2HIOC 1ZLAB 3AZKA 1P3BA 4X23D 3WKJA 3UTBA 2Y2JA 5DNMA 4J8VD 1P3IB 2ZY4A 3AV1C 3AFAC 5AV9C 3AZMD 3LELB 3KUYB 1P34D 4KGCA 3NQUA 5KDMB 5AVCD 3W99A 3REHB 3REJD 5GSUA 3KWQB 3REKA 1KX3D 2JSSA 3W96D 5CPJD 3VH6W 1ZLAA 5B32D 4KHAB 1P3FD 3X1TC 4UUZB 5B33D 4ZBJB 3R45B 4XUJC 3MNND 3MGQC 2Y2IA 3MVDD 1P3LB 3WTPD 3AZFA 3LELA 3W98A 5AV6C 5B2IA 4G92C 5KDMA 3AZHA 4Z2MH 4X23B 3KXBC 5GT3C 2NQBC 4G91C 5B0ZA 3NQJA 3KWQA 4Z5TB 4HGAB 5CPKD 4H9PB 4WU8A 4YS3B 4UUZA 2F2AC 3R45A 3VH5T 1BH8B 4NE5A 4XZQC 3AN2B 1ID3D 1AOIA 4EO5B 2HUEC 4LD9B 1B6WA 3B0DC 1EQZB 3KFUG 4NE6A 1HQ3B 1M1AA 4KUDB 3AZJC 4H9OB 3O62B 3UT9D 2AROD 1P3FB 5AV8C 2XD5A 5AVBB 5F99D 5JRGD 4QLCB 3X1VA 1M18C 2CV5C 2FJ7D 4Z5TA 3B6FB 2ZM5A 3MNNB 2BYKB 5B31A 3LZ1B 3AYWD 1F1EA 3UTAD 4JJND 1BH8A 1P3AD 2BG1A 3MGSC 3AN2A 3MGRB 2JCHA 3B0BA 3C1BC 4LD9A 2IO5B 3LZ0B 1S32B 1EQZA 1HQ3A 1TZYD 1P3IC 1P3KC 4KUDA 4H9OA 3O62A 3A6NB 1KX4C 5GXQC 3AV2C 3AZKD 1P3BD 3WKJD 3UTBD 4QLCA 2ZY2A 3B6FA 5BT1D 5DNMD 1WWIA 5B24B 4J8WB 2BYKA 5E5AB 3REHC 4NE3A 3VH6T 4KGCD 2F8NH 2G5IC 2NZDB 3W99D 3MGPB 1T3UA 4ZUXC 3WA9C 3LJAB 3LZ0A 1KX5C 4WU9C 1S32A 5F99B 4E44A 5B1LC 5GSUD 2FJ7B 3REKD 3A6NA 1U35C 1ZLAD 4H9QB 1F66B 4JJNB 1P3AB 2PYOC 4J8UB 3A1KA 5B24A 4X23C 4J8WA 3AZLA 5E5AA 3AZFD 2HIOA 3LELD 3KUYD 2NZDA 4J8VC 3AZHD 3MGPA 3C1CB 3AZMC 5DNNB 1P34C 3WKJB 5B0ZD 3EPKA 5AVCC 3KWQD 5AY8B 4H9QA 1M19B 5BNVA 4WU8D 5CP6B 1PZRA 3REJC 4H9SC 5GT0B 1KX3C 2J8PA 3AZNB 3W96C 5CPJC 3NQUB 5B32C 4J8UA 1P3FC 4DQYB 5B33C 4YM6B 4WNNB 1M1AD 3MVDC 4Z66C 3WTPC 3C1CA 5DNNA 5CPIB 2Y2OA 4UPKA 1P3GB 3X1VD 2Y2LA 3EPJA 4Z5TD 5AV5A 4AWLB 4M6BA 5G49B 5AY8A 3REIB 1M19A 4YS3D 3V9RB 5CP6A 5B31D 3AZFB 5GT0A 3AZNA 3B6GB 3W98B 5B2IB 5CPKC 3AN2D 2NQBA 2YFVB 3AZHB 4LD9D 4J8XB 2F8NA 5B0ZB 1EQZD 4YM6A 4WNNA 1HQ3D 3NQJB 1ID3C 4KUDD 3O62D 1P3OB 5CPIA 4WU8B 1P3GA 5AVBD 1BFMA 4QLCD 3UT9C 3B6FD 2AROC 1AOIB 5G49A 3REIA 3V9RA 5JRGC 5F99C 3LZ1D 2FJ7C 3B6GA 1M1AB 3WAAB 3AZIB 2RVQD 3MGRD 3RELB 2YFVA 1M18A 3AYWC 4J8XA 3UTAC 3LZ0D 1P3AC 2RIQA 1S32D 5B40B 3X1VB 3A6ND 1P3OA 1P3MB 3MGSA 5B0YB 5B31B 1TZYC 3C1BA 3X1UB 3AZKC 1P3BC 5B24D 4J8WD 3H0LC 3AZLD 5E5AD 3WKJC 3UTBC 5FUGB 3AV2A 5BT1C 5DNMC 2NZDD 3WAAA 5B1MB 3AZIA 3B0CW 3RELA 3MGPD 3LJAD 4KGCC 5B40A 3W99C 3AZEB 3W97A 1P3MA 5B32G 5B0YA 4R8PA 5GSUC 3REKC 1P3PB 1F66D 3X1UA 1ZLAC 4J8UD 3AZGB 5B1LA 5FUGA 1WWSA 3A1IA 4AWLC 4CSRA 3TU4B 5B1MA 2LY8A 3C1CD 3AZFC 3LELC 5CHLB 5DNND 3KUYC 2PYOA 3H0RC 4E45A 5AV5D 1Q9CA 3AZEA 3X1SB 5AY8D 4CAYB 1M19D 3AZLB 5B0ZC 5CP6D 2HIOB 3KWQC 5GT0D 1P3PA 3AZND 1W2EA 2Y2KA 2NQBD 2YFWB 4WU8C 3AZGA 5AVCA 2VQRA 5BO0B 4ZBJC 2W8SA 1JFIA 4WV4B 4YM6D 3TU4A 3AV1B 3AFAB 5AV9B 2BYMB 1P3LC 5BNVB 5CPID 1P3GD 1M1AC 5B33A 5B2JA 4WZSB 3X1SA 5BS7A 4CAYA 3REID 3MVDA 4Z66A 3X1VC 4Z5TC 4HGAC 3B6GD 3W98D 5B2ID 3X1TB 2YFWA 4YS3C 5B31C 4DRAA 5BO0A 2XD1A 4J8XD 2Y2NA 3AN2C 3AV1A 3AFAA 5AV9A 2BYMA 3P5JB 4EO5C 5AV5B 1P3OD 4LD9C 1BH9A 5AV6B 3MGSD 3B0CT 5CPKA 1EQZC 1HQ3C 4KUDC 3O62C 1HTAA 3KXBB 3C1BD 5GT3B 2NQBB 1AOID 5AVBC 4QLCC 2F8NB 3B6FC 3MNNC 3WAAD 3AZID 3X1TA 3RELD 1A7WA 2L5AA 3LZ1C 4XUJA 4H9RB 4XZQB 3MGQA 2RVQC 5B40D 3MGRC 3B0DB 3W97D 2IO5C 5AV6A 3LZ0C 4R8PD 5B0YD 3AZJB 1S32C 1P3MD 4NFTA 3A6NC 3KXBA 3X1UD 5AV8B 5GT3A 5B1LD 1M18B 2CV5B 2JE5A 5B1MD 5B24C 3VH5A 4J8WC 1H3OA 5E5AC 3KSYA 2PYOD 3MGSB 4H9RA 4XZQA 2NZDC 1B67A 3C1BB 3MGPC 3AZED 3LJAC 2CWEA 1P3KB 3AZJA 1KX4B 2UWXA 2ZY5A 5GXQB 3AV2B 1P3PD 5AV8A 3H0MC 3AZGD 2CV5A 1F66C 4JJNC 4J8UC 3TU4D 3EG5B 3W97B 4R8PB 4ZUXB 3WA9B 5B2JD 3C1CC 5DNNC 1KX5B 3X1SD 4WU9B 5B1LB 3F6TA 1P3IA 1P3KA 4Z66D 2HIOD 1KX4A 1U35B 5B31G 5GXQA 5AV5C 3KUYA 4CSRB 3WTPE 5AY8C 2FFFB 1M19C 5CP6C 2PYOB 5GT0C 3AZNC 3VH6A 3AV1D 3AFAD 5AV9D 3REHA 5C3IB 4J8VB 3AL0C 1KU5A 4YM6C 4KHAA 4ZUXA 3AZMB 3WA9A 1P34B 3EPLA 5CPIC 1KX5A 4WU9A 5BNXB 5AVCB 1P3GC 1P3LA 1JFIB 1U35A 3EPHA 3REIC 3X1TD 3REJB 1KX3B 3W96B 5CPJB 2ZY3A 4XUJD 5B32B 4X23A 3MGQD 3B6GC 3W98C 1TAFB 5B2IC 5B33B 5B2JB 3AZHC 3IP4C 4J8XC 1ULYA 4Z2MG 4J8VA 5AV6D 2Y2GA 3MVDB 4Z66B 4H9PA 4YS3A 3WTPB 3AZMA 3KXBD 1P34A 1P3OC 5GT3D 5BNXA 2F8ND 4DRBA 1AOIC 3REJA 4H9SA 1KX3A 2Y2QA 1BH9B 3W96A 5CPJA 5CPKB 4XZQD 5B32A 3WAAC 3AZIC 1TAFA 1N1JB 1P3FA 3RELC 5AVBA 3MNNA 4H9NB 1ID3B 2F8NK 2G5HC 3AZJD 5B40C 3WTPA 3LZ1A 5AV8D 3W97C 1P3MC 4R8PC 5B0YC 3MGRA 1M18D 2CV5D 3UT9B 4XUJB 2AROB 2Y2MA 3MGQB 3X1UC 2DF4C 5JRGB 2Y2HA 4G92B 5B1MC 1N1JA 3AYWB 3UTAB 4G91B 1ID3A 4H9NA 1P3ID 1P3KD 1R4VA 1KX4D 4WJ3C 5GXQD 3AV2D 5C3IC 3AZEC 1H3OB 1TZYB 5JA4B 3UT9A
chains in the Genus database with same CATH topology
1P3PC 3AZKB 2AROA 1P3BB 3LJAA 2F8NG 3VH5W 2HUEB 2Y2PA 3UTBB 3REHD 5F99A 5JRGA 3AZGC 2FJ7A 5DNMB 3TU4C 4ZUXD 3FDDA 3WA9D 3AYWA 4KGCB 3UTAA 2DQNC 4JJNA 4WU9D 1P3AA 1KX5D 1F66A 3W99B 1P3LD 1U35D 5B2JC 1Z2CB 3X1SC 5BS7C 5GSUB 3AZLC 1TZYA 3REKB 5JA4A 2HIOC 1ZLAB 3AZKA 1P3BA 4X23D 3WKJA 3UTBA 2Y2JA 5DNMA 4J8VD 1P3IB 2ZY4A 3AV1C 3AFAC 5AV9C 3AZMD 3LELB 3KUYB 1P34D 4KGCA 3NQUA 5KDMB 5AVCD 3W99A 3REHB 3REJD 5GSUA 3KWQB 3REKA 1KX3D 2JSSA 3W96D 5CPJD 3VH6W 1ZLAA 5B32D 4KHAB 1P3FD 3X1TC 4UUZB 5B33D 4ZBJB 3R45B 4XUJC 3MNND 3MGQC 2Y2IA 3MVDD 1P3LB 3WTPD 3AZFA 3LELA 3W98A 5AV6C 5B2IA 4G92C 5KDMA 3AZHA 4Z2MH 4X23B 3KXBC 5GT3C 2NQBC 4G91C 5B0ZA 3NQJA 3KWQA 4Z5TB 4HGAB 5CPKD 4H9PB 4WU8A 4YS3B 4UUZA 2F2AC 3R45A 3VH5T 1BH8B 4NE5A 4XZQC 3AN2B 1ID3D 1AOIA 4EO5B 2HUEC 4LD9B 1B6WA 3B0DC 1EQZB 3KFUG 4NE6A 1HQ3B 1M1AA 4KUDB 3AZJC 4H9OB 3O62B 3UT9D 2AROD 1P3FB 5AV8C 2XD5A 5AVBB 5F99D 5JRGD 4QLCB 3X1VA 1M18C 2CV5C 2FJ7D 4Z5TA 3B6FB 2ZM5A 3MNNB 2BYKB 5B31A 3LZ1B 3AYWD 1F1EA 3UTAD 4JJND 1BH8A 1P3AD 2BG1A 3MGSC 3AN2A 3MGRB 2JCHA 3B0BA 3C1BC 4LD9A 2IO5B 3LZ0B 1S32B 1EQZA 1HQ3A 1TZYD 1P3IC 1P3KC 4KUDA 4H9OA 3O62A 3A6NB 1KX4C 5GXQC 3AV2C 3AZKD 1P3BD 3WKJD 3UTBD 4QLCA 2ZY2A 3B6FA 5BT1D 5DNMD 1WWIA 5B24B 4J8WB 2BYKA 5E5AB 3REHC 4NE3A 3VH6T 4KGCD 2F8NH 2G5IC 2NZDB 3W99D 3MGPB 1T3UA 4ZUXC 3WA9C 3LJAB 3LZ0A 1KX5C 4WU9C 1S32A 5F99B 4E44A 5B1LC 5GSUD 2FJ7B 3REKD 3A6NA 1U35C 1ZLAD 4H9QB 1F66B 4JJNB 1P3AB 2PYOC 4J8UB 3A1KA 5B24A 4X23C 4J8WA 3AZLA 5E5AA 3AZFD 2HIOA 3LELD 3KUYD 2NZDA 4J8VC 3AZHD 3MGPA 3C1CB 3AZMC 5DNNB 1P34C 3WKJB 5B0ZD 3EPKA 5AVCC 3KWQD 5AY8B 4H9QA 1M19B 5BNVA 4WU8D 5CP6B 1PZRA 3REJC 4H9SC 5GT0B 1KX3C 2J8PA 3AZNB 3W96C 5CPJC 3NQUB 5B32C 4J8UA 1P3FC 4DQYB 5B33C 4YM6B 4WNNB 1M1AD 3MVDC 4Z66C 3WTPC 3C1CA 5DNNA 5CPIB 2Y2OA 4UPKA 1P3GB 3X1VD 2Y2LA 3EPJA 4Z5TD 5AV5A 4AWLB 4M6BA 5G49B 5AY8A 3REIB 1M19A 4YS3D 3V9RB 5CP6A 5B31D 3AZFB 5GT0A 3AZNA 3B6GB 3W98B 5B2IB 5CPKC 3AN2D 2NQBA 2YFVB 3AZHB 4LD9D 4J8XB 2F8NA 5B0ZB 1EQZD 4YM6A 4WNNA 1HQ3D 3NQJB 1ID3C 4KUDD 3O62D 1P3OB 5CPIA 4WU8B 1P3GA 5AVBD 1BFMA 4QLCD 3UT9C 3B6FD 2AROC 1AOIB 5G49A 3REIA 3V9RA 5JRGC 5F99C 3LZ1D 2FJ7C 3B6GA 1M1AB 3WAAB 3AZIB 2RVQD 3MGRD 3RELB 2YFVA 1M18A 3AYWC 4J8XA 3UTAC 3LZ0D 1P3AC 2RIQA 1S32D 5B40B 3X1VB 3A6ND 1P3OA 1P3MB 3MGSA 5B0YB 5B31B 1TZYC 3C1BA 3X1UB 3AZKC 1P3BC 5B24D 4J8WD 3H0LC 3AZLD 5E5AD 3WKJC 3UTBC 5FUGB 3AV2A 5BT1C 5DNMC 2NZDD 3WAAA 5B1MB 3AZIA 3B0CW 3RELA 3MGPD 3LJAD 4KGCC 5B40A 3W99C 3AZEB 3W97A 1P3MA 5B32G 5B0YA 4R8PA 5GSUC 3REKC 1P3PB 1F66D 3X1UA 1ZLAC 4J8UD 3AZGB 5B1LA 5FUGA 1WWSA 3A1IA 4AWLC 4CSRA 3TU4B 5B1MA 2LY8A 3C1CD 3AZFC 3LELC 5CHLB 5DNND 3KUYC 2PYOA 3H0RC 4E45A 5AV5D 1Q9CA 3AZEA 3X1SB 5AY8D 4CAYB 1M19D 3AZLB 5B0ZC 5CP6D 2HIOB 3KWQC 5GT0D 1P3PA 3AZND 1W2EA 2Y2KA 2NQBD 2YFWB 4WU8C 3AZGA 5AVCA 2VQRA 5BO0B 4ZBJC 2W8SA 1JFIA 4WV4B 4YM6D 3TU4A 3AV1B 3AFAB 5AV9B 2BYMB 1P3LC 5BNVB 5CPID 1P3GD 1M1AC 5B33A 5B2JA 4WZSB 3X1SA 5BS7A 4CAYA 3REID 3MVDA 4Z66A 3X1VC 4Z5TC 4HGAC 3B6GD 3W98D 5B2ID 3X1TB 2YFWA 4YS3C 5B31C 4DRAA 5BO0A 2XD1A 4J8XD 2Y2NA 3AN2C 3AV1A 3AFAA 5AV9A 2BYMA 3P5JB 4EO5C 5AV5B 1P3OD 4LD9C 1BH9A 5AV6B 3MGSD 3B0CT 5CPKA 1EQZC 1HQ3C 4KUDC 3O62C 1HTAA 3KXBB 3C1BD 5GT3B 2NQBB 1AOID 5AVBC 4QLCC 2F8NB 3B6FC 3MNNC 3WAAD 3AZID 3X1TA 3RELD 1A7WA 2L5AA 3LZ1C 4XUJA 4H9RB 4XZQB 3MGQA 2RVQC 5B40D 3MGRC 3B0DB 3W97D 2IO5C 5AV6A 3LZ0C 4R8PD 5B0YD 3AZJB 1S32C 1P3MD 4NFTA 3A6NC 3KXBA 3X1UD 5AV8B 5GT3A 5B1LD 1M18B 2CV5B 2JE5A 5B1MD 5B24C 3VH5A 4J8WC 1H3OA 5E5AC 3KSYA 2PYOD 3MGSB 4H9RA 4XZQA 2NZDC 1B67A 3C1BB 3MGPC 3AZED 3LJAC 2CWEA 1P3KB 3AZJA 1KX4B 2UWXA 2ZY5A 5GXQB 3AV2B 1P3PD 5AV8A 3H0MC 3AZGD 2CV5A 1F66C 4JJNC 4J8UC 3TU4D 3EG5B 3W97B 4R8PB 4ZUXB 3WA9B 5B2JD 3C1CC 5DNNC 1KX5B 3X1SD 4WU9B 5B1LB 3F6TA 1P3IA 1P3KA 4Z66D 2HIOD 1KX4A 1U35B 5B31G 5GXQA 5AV5C 3KUYA 4CSRB 3WTPE 5AY8C 2FFFB 1M19C 5CP6C 2PYOB 5GT0C 3AZNC 3VH6A 3AV1D 3AFAD 5AV9D 3REHA 5C3IB 4J8VB 3AL0C 1KU5A 4YM6C 4KHAA 4ZUXA 3AZMB 3WA9A 1P34B 3EPLA 5CPIC 1KX5A 4WU9A 5BNXB 5AVCB 1P3GC 1P3LA 1JFIB 1U35A 3EPHA 3REIC 3X1TD 3REJB 1KX3B 3W96B 5CPJB 2ZY3A 4XUJD 5B32B 4X23A 3MGQD 3B6GC 3W98C 1TAFB 5B2IC 5B33B 5B2JB 3AZHC 3IP4C 4J8XC 1ULYA 4Z2MG 4J8VA 5AV6D 2Y2GA 3MVDB 4Z66B 4H9PA 4YS3A 3WTPB 3AZMA 3KXBD 1P34A 1P3OC 5GT3D 5BNXA 2F8ND 4DRBA 1AOIC 3REJA 4H9SA 1KX3A 2Y2QA 1BH9B 3W96A 5CPJA 5CPKB 4XZQD 5B32A 3WAAC 3AZIC 1TAFA 1N1JB 1P3FA 3RELC 5AVBA 3MNNA 4H9NB 1ID3B 2F8NK 2G5HC 3AZJD 5B40C 3WTPA 3LZ1A 5AV8D 3W97C 1P3MC 4R8PC 5B0YC 3MGRA 1M18D 2CV5D 3UT9B 4XUJB 2AROB 2Y2MA 3MGQB 3X1UC 2DF4C 5JRGB 2Y2HA 4G92B 5B1MC 1N1JA 3AYWB 3UTAB 4G91B 1ID3A 4H9NA 1P3ID 1P3KD 1R4VA 1KX4D 4WJ3C 5GXQD 3AV2D 5C3IC 3AZEC 1H3OB 1TZYB 5JA4B 3UT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P C;  3AZK B;  2ARO A;  1P3B B;  3LJA A;  2F8N G;  3VH5 W;  2HUE B;  3UTB B;  3REH D;  5F99 A;  5JRG A;  3AZG C;  2FJ7 A;  5DNM B;  3TU4 C;  4ZUX D;  3WA9 D;  3AYW A;  4KGC B;  3UTA A;  4JJN A;  1P3A A;  4WU9 D;  1KX5 D;  1F66 A;  3W99 B;  1P3L D;  1U35 D;  5B2J C;  3X1S C;  5BS7 C;  5GSU B;  3AZL C;  1TZY A;  3REK B;  5JA4 A;  2HIO C;  1ZLA B;  3AZK A;  1P3B A;  4X23 D;  3WKJ A;  3UTB A;  5DNM A;  4J8V D;  1P3I B;  3AV1 C;  3AFA C;  5AV9 C;  3AZM D;  3LEL B;  3KUY B;  1P34 D;  4KGC A;  3NQU A;  5KDM B;  5AVC D;  3W99 A;  3REH B;  3REJ D;  5GSU A;  3KWQ B;  3REK A;  1KX3 D;  2JSS A;  3W96 D;  5CPJ D;  3VH6 W;  1ZLA A;  5B32 D;  4KHA B;  1P3F D;  3X1T C;  4UUZ B;  5B33 D;  4ZBJ B;  3R45 B;  4XUJ C;  3MNN D;  3MGQ C;  3MVD D;  1P3L B;  3WTP D;  3AZF A;  3LEL A;  3W98 A;  5AV6 C;  5B2I A;  4G92 C;  5KDM A;  3AZH A;  4Z2M H;  4X23 B;  3KXB C;  5GT3 C;  2NQB C;  4G91 C;  5B0Z A;  3NQJ A;  3KWQ A;  4Z5T B;  4HGA B;  5CPK D;  4H9P B;  4WU8 A;  4YS3 B;  4UUZ A;  3R45 A;  3VH5 T;  1BH8 B;  4NE5 A;  4XZQ C;  3AN2 B;  1ID3 D;  1AOI A;  4EO5 B;  2HUE C;  4LD9 B;  1B6W A;  3B0D C;  1EQZ B;  4NE6 A;  1HQ3 B;  1M1A A;  4KUD B;  3AZJ C;  4H9O B;  3O62 B;  3UT9 D;  2ARO D;  1P3F B;  5AV8 C;  5AVB B;  5F99 D;  5JRG D;  4QLC B;  3X1V A;  1M18 C;  2CV5 C;  2FJ7 D;  4Z5T A;  3B6F B;  3MNN B;  2BYK B;  5B31 A;  3LZ1 B;  3AYW D;  1F1E A;  3UTA D;  4JJN D;  1BH8 A;  1P3A D;  3MGS C;  3AN2 A;  3MGR B;  3B0B A;  3C1B C;  4LD9 A;  2IO5 B;  3LZ0 B;  1S32 B;  1EQZ A;  1HQ3 A;  1TZY D;  1P3I C;  1P3K C;  4KUD A;  4H9O A;  3O62 A;  3A6N B;  1KX4 C;  5GXQ C;  3AV2 C;  3AZK D;  1P3B D;  3WKJ D;  3UTB D;  4QLC A;  3B6F A;  5BT1 D;  5DNM D;  1WWI A;  5B24 B;  4J8W B;  2BYK A;  5E5A B;  3REH C;  4NE3 A;  3VH6 T;  4KGC D;  2F8N H;  2NZD B;  3W99 D;  3MGP B;  4ZUX C;  3WA9 C;  3LJA B;  3LZ0 A;  1KX5 C;  4WU9 C;  1S32 A;  5F99 B;  4E44 A;  5B1L C;  5GSU D;  2FJ7 B;  3REK D;  3A6N A;  1U35 C;  1ZLA D;  4H9Q B;  1F66 B;  4JJN B;  1P3A B;  2PYO C;  4J8U B;  4X23 C;  5B24 A;  4J8W A;  3AZL A;  5E5A A;  3AZF D;  2HIO A;  3LEL D;  3KUY D;  2NZD A;  4J8V C;  3AZH D;  3MGP A;  3C1C B;  3AZM C;  5DNN B;  1P34 C;  3WKJ B;  5B0Z D;  5AVC C;  3KWQ D;  5AY8 B;  4H9Q A;  1M19 B;  5BNV A;  4WU8 D;  5CP6 B;  3REJ C;  4H9S C;  5GT0 B;  1KX3 C;  3AZN B;  3W96 C;  5CPJ C;  3NQU B;  5B32 C;  4J8U A;  1P3F C;  5B33 C;  4YM6 B;  4WNN B;  1M1A D;  3MVD C;  4Z66 C;  3WTP C;  3C1C A;  5DNN A;  5CPI B;  1P3G B;  3X1V D;  4Z5T D;  5AV5 A;  4AWL B;  4M6B A;  5G49 B;  5AY8 A;  3REI B;  1M19 A;  4YS3 D;  3V9R B;  5CP6 A;  5B31 D;  3AZF B;  5GT0 A;  3AZN A;  3B6G B;  3W98 B;  5B2I B;  5CPK C;  3AN2 D;  2NQB A;  2YFV B;  3AZH B;  4LD9 D;  4J8X B;  2F8N A;  5B0Z B;  1EQZ D;  4YM6 A;  4WNN A;  1HQ3 D;  3NQJ B;  1ID3 C;  4KUD D;  3O62 D;  1P3O B;  5CPI A;  4WU8 B;  1P3G A;  5AVB D;  1BFM A;  4QLC D;  3UT9 C;  3B6F D;  2ARO C;  1AOI B;  5G49 A;  3REI A;  3V9R A;  5JRG C;  5F99 C;  3LZ1 D;  2FJ7 C;  3B6G A;  1M1A B;  3WAA B;  3AZI B;  2RVQ D;  3MGR D;  3REL B;  2YFV A;  1M18 A;  3AYW C;  4J8X A;  3UTA C;  3LZ0 D;  1P3A C;  1S32 D;  5B40 B;  3X1V B;  3A6N D;  1P3O A;  1P3M B;  3MGS A;  5B0Y B;  5B31 B;  1TZY C;  3C1B A;  3X1U B;  3AZK C;  1P3B C;  5B24 D;  4J8W D;  3AZL D;  5E5A D;  3WKJ C;  3UTB C;  5FUG B;  3AV2 A;  5BT1 C;  5DNM C;  2NZD D;  3WAA A;  5B1M B;  3AZI A;  3B0C W;  3REL A;  3MGP D;  3LJA D;  4KGC C;  5B40 A;  3W99 C;  3AZE B;  3W97 A;  1P3M A;  5B32 G;  5B0Y A;  4R8P A;  5GSU C;  3REK C;  1P3P B;  1F66 D;  3X1U A;  1ZLA C;  4J8U D;  3AZG B;  5B1L A;  5FUG A;  1WWS A;  4AWL C;  4CSR A;  3TU4 B;  5B1M A;  2LY8 A;  3C1C D;  3AZF C;  3LEL C;  5CHL B;  5DNN D;  3KUY C;  2PYO A;  4E45 A;  5AV5 D;  1Q9C A;  3AZE A;  3X1S B;  5AY8 D;  4CAY B;  1M19 D;  3AZL B;  5B0Z C;  5CP6 D;  2HIO B;  3KWQ C;  5GT0 D;  1P3P A;  3AZN D;  2NQB D;  2YFW B;  4WU8 C;  3AZG A;  5AVC A;  5BO0 B;  4ZBJ C;  1JFI A;  4WV4 B;  4YM6 D;  3TU4 A;  3AV1 B;  3AFA B;  5AV9 B;  2BYM B;  1P3L C;  5BNV B;  5CPI D;  1P3G D;  1M1A C;  5B33 A;  5B2J A;  4WZS B;  3X1S A;  5BS7 A;  4CAY A;  3REI D;  3MVD A;  4Z66 A;  3X1V C;  4Z5T C;  4HGA C;  3B6G D;  3W98 D;  5B2I D;  3X1T B;  2YFW A;  4YS3 C;  5B31 C;  4DRA A;  5BO0 A;  4J8X D;  3AN2 C;  3AV1 A;  3AFA A;  5AV9 A;  2BYM A;  4EO5 C;  5AV5 B;  1P3O D;  4LD9 C;  1BH9 A;  5AV6 B;  3MGS D;  3B0C T;  5CPK A;  1EQZ C;  1HQ3 C;  4KUD C;  3O62 C;  1HTA A;  3KXB B;  3C1B D;  5GT3 B;  2NQB B;  1AOI D;  5AVB C;  4QLC C;  2F8N B;  3B6F C;  3MNN C;  3WAA D;  3AZI D;  3X1T A;  3REL D;  1A7W A;  2L5A A;  3LZ1 C;  4XUJ A;  4H9R B;  4XZQ B;  3MGQ A;  2RVQ C;  5B40 D;  3MGR C;  3B0D B;  3W97 D;  2IO5 C;  5AV6 A;  3LZ0 C;  4R8P D;  5B0Y D;  3AZJ B;  1S32 C;  1P3M D;  4NFT A;  3A6N C;  3KXB A;  3X1U D;  5AV8 B;  5GT3 A;  5B1L D;  1M18 B;  2CV5 B;  5B1M D;  5B24 C;  3VH5 A;  4J8W C;  1H3O A;  5E5A C;  3KSY A;  2PYO D;  3MGS B;  4H9R A;  4XZQ A;  2NZD C;  1B67 A;  3C1B B;  3MGP C;  3AZE D;  3LJA C;  2CWE A;  1P3K B;  3AZJ A;  1KX4 B;  5GXQ B;  3AV2 B;  1P3P D;  5AV8 A;  3AZG D;  2CV5 A;  1F66 C;  4JJN C;  4J8U C;  3TU4 D;  3W97 B;  4R8P B;  4ZUX B;  3WA9 B;  5B2J D;  3C1C C;  5DNN C;  1KX5 B;  3X1S D;  4WU9 B;  5B1L B;  1P3I A;  1P3K A;  4Z66 D;  2HIO D;  1KX4 A;  1U35 B;  5B31 G;  5GXQ A;  5AV5 C;  3KUY A;  4CSR B;  3WTP E;  5AY8 C;  1M19 C;  5CP6 C;  2PYO B;  5GT0 C;  3AZN C;  3VH6 A;  3AV1 D;  3AFA D;  5AV9 D;  3REH A;  5C3I B;  4J8V B;  1KU5 A;  4YM6 C;  4KHA A;  4ZUX A;  3AZM B;  3WA9 A;  1P34 B;  5CPI C;  1KX5 A;  4WU9 A;  5BNX B;  5AVC B;  1P3G C;  1P3L A;  1JFI B;  1U35 A;  3REI C;  3X1T D;  3REJ B;  1KX3 B;  3W96 B;  5CPJ B;  4XUJ D;  5B32 B;  4X23 A;  3MGQ D;  3B6G C;  3W98 C;  1TAF B;  5B2I C;  5B33 B;  5B2J B;  3AZH C;  4J8X C;  1ULY A;  4Z2M G;  4J8V A;  5AV6 D;  3MVD B;  4Z66 B;  4H9P A;  4YS3 A;  3WTP B;  3AZM A;  3KXB D;  1P34 A;  1P3O C;  5GT3 D;  5BNX A;  2F8N D;  4DRB A;  1AOI C;  3REJ A;  4H9S A;  1KX3 A;  1BH9 B;  3W96 A;  5CPJ A;  5CPK B;  4XZQ D;  5B32 A;  3WAA C;  3AZI C;  1TAF A;  1N1J B;  1P3F A;  3REL C;  5AVB A;  3MNN A;  4H9N B;  1ID3 B;  2F8N K;  3AZJ D;  5B40 C;  3WTP A;  3LZ1 A;  5AV8 D;  3W97 C;  1P3M C;  4R8P C;  5B0Y C;  3MGR A;  1M18 D;  2CV5 D;  3UT9 B;  4XUJ B;  2ARO B;  3MGQ B;  3X1U C;  5JRG B;  4G92 B;  5B1M C;  1N1J A;  3AYW B;  3UTA B;  4G91 B;  1ID3 A;  4H9N A;  1P3I D;  1P3K D;  1R4V A;  1KX4 D;  5GXQ D;  3AV2 D;  5C3I C;  3AZE C;  1H3O B;  1TZY B;  5JA4 B;  3UT9 A; 
#chains in the Genus database with same CATH topology
 1P3P C;  3AZK B;  2ARO A;  1P3B B;  3LJA A;  2F8N G;  3VH5 W;  2HUE B;  2Y2P A;  3UTB B;  3REH D;  5F99 A;  5JRG A;  3AZG C;  2FJ7 A;  5DNM B;  3TU4 C;  4ZUX D;  3FDD A;  3WA9 D;  3AYW A;  4KGC B;  3UTA A;  2DQN C;  4JJN A;  4WU9 D;  1P3A A;  1KX5 D;  1F66 A;  3W99 B;  1P3L D;  1U35 D;  5B2J C;  1Z2C B;  3X1S C;  5BS7 C;  5GSU B;  3AZL C;  1TZY A;  3REK B;  5JA4 A;  2HIO C;  1ZLA B;  3AZK A;  1P3B A;  4X23 D;  3WKJ A;  3UTB A;  2Y2J A;  5DNM A;  4J8V D;  1P3I B;  2ZY4 A;  3AV1 C;  3AFA C;  5AV9 C;  3AZM D;  3LEL B;  3KUY B;  1P34 D;  4KGC A;  3NQU A;  5KDM B;  5AVC D;  3W99 A;  3REH B;  3REJ D;  5GSU A;  3KWQ B;  3REK A;  1KX3 D;  2JSS A;  3W96 D;  5CPJ D;  3VH6 W;  1ZLA A;  5B32 D;  4KHA B;  1P3F D;  3X1T C;  4UUZ B;  5B33 D;  4ZBJ B;  3R45 B;  4XUJ C;  3MNN D;  3MGQ C;  2Y2I A;  3MVD D;  1P3L B;  3WTP D;  3AZF A;  3LEL A;  3W98 A;  5AV6 C;  5B2I A;  4G92 C;  5KDM A;  3AZH A;  4Z2M H;  4X23 B;  3KXB C;  5GT3 C;  2NQB C;  4G91 C;  5B0Z A;  3NQJ A;  3KWQ A;  4Z5T B;  4HGA B;  5CPK D;  4H9P B;  4WU8 A;  4YS3 B;  4UUZ A;  2F2A C;  3R45 A;  3VH5 T;  1BH8 B;  4NE5 A;  4XZQ C;  3AN2 B;  1ID3 D;  1AOI A;  4EO5 B;  2HUE C;  4LD9 B;  1B6W A;  3B0D C;  1EQZ B;  3KFU G;  4NE6 A;  1HQ3 B;  1M1A A;  4KUD B;  3AZJ C;  4H9O B;  3O62 B;  3UT9 D;  2ARO D;  1P3F B;  5AV8 C;  2XD5 A;  5AVB B;  5F99 D;  5JRG D;  4QLC B;  3X1V A;  1M18 C;  2CV5 C;  2FJ7 D;  4Z5T A;  3B6F B;  2ZM5 A;  3MNN B;  2BYK B;  5B31 A;  3LZ1 B;  3AYW D;  1F1E A;  3UTA D;  4JJN D;  1BH8 A;  1P3A D;  2BG1 A;  3MGS C;  3AN2 A;  3MGR B;  2JCH A;  3B0B A;  3C1B C;  4LD9 A;  2IO5 B;  3LZ0 B;  1S32 B;  1EQZ A;  1HQ3 A;  1TZY D;  1P3I C;  1P3K C;  4KUD A;  4H9O A;  3O62 A;  3A6N B;  1KX4 C;  5GXQ C;  3AV2 C;  3AZK D;  1P3B D;  3WKJ D;  3UTB D;  4QLC A;  2ZY2 A;  3B6F A;  5BT1 D;  5DNM D;  1WWI A;  5B24 B;  4J8W B;  2BYK A;  5E5A B;  3REH C;  4NE3 A;  3VH6 T;  4KGC D;  2F8N H;  2G5I C;  2NZD B;  3W99 D;  3MGP B;  1T3U A;  4ZUX C;  3WA9 C;  3LJA B;  3LZ0 A;  1KX5 C;  4WU9 C;  1S32 A;  5F99 B;  4E44 A;  5B1L C;  5GSU D;  2FJ7 B;  3REK D;  3A6N A;  1U35 C;  1ZLA D;  4H9Q B;  1F66 B;  4JJN B;  1P3A B;  2PYO C;  4J8U B;  3A1K A;  5B24 A;  4X23 C;  4J8W A;  3AZL A;  5E5A A;  3AZF D;  2HIO A;  3LEL D;  3KUY D;  2NZD A;  4J8V C;  3AZH D;  3MGP A;  3C1C B;  3AZM C;  5DNN B;  1P34 C;  3WKJ B;  5B0Z D;  3EPK A;  5AVC C;  3KWQ D;  5AY8 B;  4H9Q A;  1M19 B;  5BNV A;  4WU8 D;  5CP6 B;  1PZR A;  3REJ C;  4H9S C;  5GT0 B;  1KX3 C;  2J8P A;  3AZN B;  3W96 C;  5CPJ C;  3NQU B;  5B32 C;  4J8U A;  1P3F C;  4DQY B;  5B33 C;  4YM6 B;  4WNN B;  1M1A D;  3MVD C;  4Z66 C;  3WTP C;  3C1C A;  5DNN A;  5CPI B;  2Y2O A;  4UPK A;  1P3G B;  3X1V D;  2Y2L A;  3EPJ A;  4Z5T D;  5AV5 A;  4AWL B;  4M6B A;  5G49 B;  5AY8 A;  3REI B;  1M19 A;  4YS3 D;  3V9R B;  5CP6 A;  5B31 D;  3AZF B;  5GT0 A;  3AZN A;  3B6G B;  3W98 B;  5B2I B;  5CPK C;  3AN2 D;  2NQB A;  2YFV B;  3AZH B;  4LD9 D;  4J8X B;  2F8N A;  5B0Z B;  1EQZ D;  4YM6 A;  4WNN A;  1HQ3 D;  3NQJ B;  1ID3 C;  4KUD D;  3O62 D;  1P3O B;  5CPI A;  4WU8 B;  1P3G A;  5AVB D;  1BFM A;  4QLC D;  3UT9 C;  3B6F D;  2ARO C;  1AOI B;  5G49 A;  3REI A;  3V9R A;  5JRG C;  5F99 C;  3LZ1 D;  2FJ7 C;  3B6G A;  1M1A B;  3WAA B;  3AZI B;  2RVQ D;  3MGR D;  3REL B;  2YFV A;  1M18 A;  3AYW C;  4J8X A;  3UTA C;  3LZ0 D;  1P3A C;  2RIQ A;  1S32 D;  5B40 B;  3X1V B;  3A6N D;  1P3O A;  1P3M B;  3MGS A;  5B0Y B;  5B31 B;  1TZY C;  3C1B A;  3X1U B;  3AZK C;  1P3B C;  5B24 D;  4J8W D;  3H0L C;  3AZL D;  5E5A D;  3WKJ C;  3UTB C;  5FUG B;  3AV2 A;  5BT1 C;  5DNM C;  2NZD D;  3WAA A;  5B1M B;  3AZI A;  3B0C W;  3REL A;  3MGP D;  3LJA D;  4KGC C;  5B40 A;  3W99 C;  3AZE B;  3W97 A;  1P3M A;  5B32 G;  5B0Y A;  4R8P A;  5GSU C;  3REK C;  1P3P B;  1F66 D;  3X1U A;  1ZLA C;  4J8U D;  3AZG B;  5B1L A;  5FUG A;  1WWS A;  3A1I A;  4AWL C;  4CSR A;  3TU4 B;  5B1M A;  2LY8 A;  3C1C D;  3AZF C;  3LEL C;  5CHL B;  5DNN D;  3KUY C;  2PYO A;  3H0R C;  4E45 A;  5AV5 D;  1Q9C A;  3AZE A;  3X1S B;  5AY8 D;  4CAY B;  1M19 D;  3AZL B;  5B0Z C;  5CP6 D;  2HIO B;  3KWQ C;  5GT0 D;  1P3P A;  3AZN D;  1W2E A;  2Y2K A;  2NQB D;  2YFW B;  4WU8 C;  3AZG A;  5AVC A;  2VQR A;  5BO0 B;  4ZBJ C;  2W8S A;  1JFI A;  4WV4 B;  4YM6 D;  3TU4 A;  3AV1 B;  3AFA B;  5AV9 B;  2BYM B;  1P3L C;  5BNV B;  5CPI D;  1P3G D;  1M1A C;  5B33 A;  5B2J A;  4WZS B;  3X1S A;  5BS7 A;  4CAY A;  3REI D;  3MVD A;  4Z66 A;  3X1V C;  4Z5T C;  4HGA C;  3B6G D;  3W98 D;  5B2I D;  3X1T B;  2YFW A;  4YS3 C;  5B31 C;  4DRA A;  5BO0 A;  2XD1 A;  4J8X D;  2Y2N A;  3AN2 C;  3AV1 A;  3AFA A;  5AV9 A;  2BYM A;  3P5J B;  4EO5 C;  5AV5 B;  1P3O D;  4LD9 C;  1BH9 A;  5AV6 B;  3MGS D;  3B0C T;  5CPK A;  1EQZ C;  1HQ3 C;  4KUD C;  3O62 C;  1HTA A;  3KXB B;  3C1B D;  5GT3 B;  2NQB B;  1AOI D;  5AVB C;  4QLC C;  2F8N B;  3B6F C;  3MNN C;  3WAA D;  3AZI D;  3X1T A;  3REL D;  1A7W A;  2L5A A;  3LZ1 C;  4XUJ A;  4H9R B;  4XZQ B;  3MGQ A;  2RVQ C;  5B40 D;  3MGR C;  3B0D B;  3W97 D;  2IO5 C;  5AV6 A;  3LZ0 C;  4R8P D;  5B0Y D;  3AZJ B;  1S32 C;  1P3M D;  4NFT A;  3A6N C;  3KXB A;  3X1U D;  5AV8 B;  5GT3 A;  5B1L D;  1M18 B;  2CV5 B;  2JE5 A;  5B1M D;  5B24 C;  3VH5 A;  4J8W C;  1H3O A;  5E5A C;  3KSY A;  2PYO D;  3MGS B;  4H9R A;  4XZQ A;  2NZD C;  1B67 A;  3C1B B;  3MGP C;  3AZE D;  3LJA C;  2CWE A;  1P3K B;  3AZJ A;  1KX4 B;  2UWX A;  2ZY5 A;  5GXQ B;  3AV2 B;  1P3P D;  5AV8 A;  3H0M C;  3AZG D;  2CV5 A;  1F66 C;  4JJN C;  4J8U C;  3TU4 D;  3EG5 B;  3W97 B;  4R8P B;  4ZUX B;  3WA9 B;  5B2J D;  3C1C C;  5DNN C;  1KX5 B;  3X1S D;  4WU9 B;  5B1L B;  3F6T A;  1P3I A;  1P3K A;  4Z66 D;  2HIO D;  1KX4 A;  1U35 B;  5B31 G;  5GXQ A;  5AV5 C;  3KUY A;  4CSR B;  3WTP E;  5AY8 C;  2FFF B;  1M19 C;  5CP6 C;  2PYO B;  5GT0 C;  3AZN C;  3VH6 A;  3AV1 D;  3AFA D;  5AV9 D;  3REH A;  5C3I B;  4J8V B;  3AL0 C;  1KU5 A;  4YM6 C;  4KHA A;  4ZUX A;  3AZM B;  3WA9 A;  1P34 B;  3EPL A;  5CPI C;  1KX5 A;  4WU9 A;  5BNX B;  5AVC B;  1P3G C;  1P3L A;  1JFI B;  1U35 A;  3EPH A;  3REI C;  3X1T D;  3REJ B;  1KX3 B;  3W96 B;  5CPJ B;  2ZY3 A;  4XUJ D;  5B32 B;  4X23 A;  3MGQ D;  3B6G C;  3W98 C;  1TAF B;  5B2I C;  5B33 B;  5B2J B;  3AZH C;  3IP4 C;  4J8X C;  1ULY A;  4Z2M G;  4J8V A;  5AV6 D;  2Y2G A;  3MVD B;  4Z66 B;  4H9P A;  4YS3 A;  3WTP B;  3AZM A;  3KXB D;  1P34 A;  1P3O C;  5GT3 D;  5BNX A;  2F8N D;  4DRB A;  1AOI C;  3REJ A;  4H9S A;  1KX3 A;  2Y2Q A;  1BH9 B;  3W96 A;  5CPJ A;  5CPK B;  4XZQ D;  5B32 A;  3WAA C;  3AZI C;  1TAF A;  1N1J B;  1P3F A;  3REL C;  5AVB A;  3MNN A;  4H9N B;  1ID3 B;  2F8N K;  2G5H C;  3AZJ D;  5B40 C;  3WTP A;  3LZ1 A;  5AV8 D;  3W97 C;  1P3M C;  4R8P C;  5B0Y C;  3MGR A;  1M18 D;  2CV5 D;  3UT9 B;  4XUJ B;  2ARO B;  2Y2M A;  3MGQ B;  3X1U C;  2DF4 C;  5JRG B;  2Y2H A;  4G92 B;  5B1M C;  1N1J A;  3AYW B;  3UTA B;  4G91 B;  1ID3 A;  4H9N A;  1P3I D;  1P3K D;  1R4V A;  1KX4 D;  4WJ3 C;  5GXQ D;  3AV2 D;  5C3I C;  3AZE C;  1H3O B;  1TZY B;  5JA4 B;  3UT9 A; 
#chains in the Genus database with same CATH homology
 1P3P C;  3AZK B;  2ARO A;  1P3B B;  3LJA A;  2F8N G;  3VH5 W;  2HUE B;  2Y2P A;  3UTB B;  3REH D;  5F99 A;  5JRG A;  3AZG C;  2FJ7 A;  5DNM B;  3TU4 C;  4ZUX D;  3FDD A;  3WA9 D;  3AYW A;  4KGC B;  3UTA A;  2DQN C;  4JJN A;  4WU9 D;  1P3A A;  1KX5 D;  1F66 A;  3W99 B;  1P3L D;  1U35 D;  5B2J C;  1Z2C B;  3X1S C;  5BS7 C;  5GSU B;  3AZL C;  1TZY A;  3REK B;  5JA4 A;  2HIO C;  1ZLA B;  3AZK A;  1P3B A;  4X23 D;  3WKJ A;  3UTB A;  2Y2J A;  5DNM A;  4J8V D;  1P3I B;  2ZY4 A;  3AV1 C;  3AFA C;  5AV9 C;  3AZM D;  3LEL B;  3KUY B;  1P34 D;  4KGC A;  3NQU A;  5KDM B;  5AVC D;  3W99 A;  3REH B;  3REJ D;  5GSU A;  3KWQ B;  3REK A;  1KX3 D;  2JSS A;  3W96 D;  5CPJ D;  3VH6 W;  1ZLA A;  5B32 D;  4KHA B;  1P3F D;  3X1T C;  4UUZ B;  5B33 D;  4ZBJ B;  3R45 B;  4XUJ C;  3MNN D;  3MGQ C;  2Y2I A;  3MVD D;  1P3L B;  3WTP D;  3AZF A;  3LEL A;  3W98 A;  5AV6 C;  5B2I A;  4G92 C;  5KDM A;  3AZH A;  4Z2M H;  4X23 B;  3KXB C;  5GT3 C;  2NQB C;  4G91 C;  5B0Z A;  3NQJ A;  3KWQ A;  4Z5T B;  4HGA B;  5CPK D;  4H9P B;  4WU8 A;  4YS3 B;  4UUZ A;  2F2A C;  3R45 A;  3VH5 T;  1BH8 B;  4NE5 A;  4XZQ C;  3AN2 B;  1ID3 D;  1AOI A;  4EO5 B;  2HUE C;  4LD9 B;  1B6W A;  3B0D C;  1EQZ B;  3KFU G;  4NE6 A;  1HQ3 B;  1M1A A;  4KUD B;  3AZJ C;  4H9O B;  3O62 B;  3UT9 D;  2ARO D;  1P3F B;  5AV8 C;  2XD5 A;  5AVB B;  5F99 D;  5JRG D;  4QLC B;  3X1V A;  1M18 C;  2CV5 C;  2FJ7 D;  4Z5T A;  3B6F B;  2ZM5 A;  3MNN B;  2BYK B;  5B31 A;  3LZ1 B;  3AYW D;  1F1E A;  3UTA D;  4JJN D;  1BH8 A;  1P3A D;  2BG1 A;  3MGS C;  3AN2 A;  3MGR B;  2JCH A;  3B0B A;  3C1B C;  4LD9 A;  2IO5 B;  3LZ0 B;  1S32 B;  1EQZ A;  1HQ3 A;  1TZY D;  1P3I C;  1P3K C;  4KUD A;  4H9O A;  3O62 A;  3A6N B;  1KX4 C;  5GXQ C;  3AV2 C;  3AZK D;  1P3B D;  3WKJ D;  3UTB D;  4QLC A;  2ZY2 A;  3B6F A;  5BT1 D;  5DNM D;  1WWI A;  5B24 B;  4J8W B;  2BYK A;  5E5A B;  3REH C;  4NE3 A;  3VH6 T;  4KGC D;  2F8N H;  2G5I C;  2NZD B;  3W99 D;  3MGP B;  1T3U A;  4ZUX C;  3WA9 C;  3LJA B;  3LZ0 A;  1KX5 C;  4WU9 C;  1S32 A;  5F99 B;  4E44 A;  5B1L C;  5GSU D;  2FJ7 B;  3REK D;  3A6N A;  1U35 C;  1ZLA D;  4H9Q B;  1F66 B;  4JJN B;  1P3A B;  2PYO C;  4J8U B;  3A1K A;  5B24 A;  4X23 C;  4J8W A;  3AZL A;  5E5A A;  3AZF D;  2HIO A;  3LEL D;  3KUY D;  2NZD A;  4J8V C;  3AZH D;  3MGP A;  3C1C B;  3AZM C;  5DNN B;  1P34 C;  3WKJ B;  5B0Z D;  3EPK A;  5AVC C;  3KWQ D;  5AY8 B;  4H9Q A;  1M19 B;  5BNV A;  4WU8 D;  5CP6 B;  1PZR A;  3REJ C;  4H9S C;  5GT0 B;  1KX3 C;  2J8P A;  3AZN B;  3W96 C;  5CPJ C;  3NQU B;  5B32 C;  4J8U A;  1P3F C;  4DQY B;  5B33 C;  4YM6 B;  4WNN B;  1M1A D;  3MVD C;  4Z66 C;  3WTP C;  3C1C A;  5DNN A;  5CPI B;  2Y2O A;  4UPK A;  1P3G B;  3X1V D;  2Y2L A;  3EPJ A;  4Z5T D;  5AV5 A;  4AWL B;  4M6B A;  5G49 B;  5AY8 A;  3REI B;  1M19 A;  4YS3 D;  3V9R B;  5CP6 A;  5B31 D;  3AZF B;  5GT0 A;  3AZN A;  3B6G B;  3W98 B;  5B2I B;  5CPK C;  3AN2 D;  2NQB A;  2YFV B;  3AZH B;  4LD9 D;  4J8X B;  2F8N A;  5B0Z B;  1EQZ D;  4YM6 A;  4WNN A;  1HQ3 D;  3NQJ B;  1ID3 C;  4KUD D;  3O62 D;  1P3O B;  5CPI A;  4WU8 B;  1P3G A;  5AVB D;  1BFM A;  4QLC D;  3UT9 C;  3B6F D;  2ARO C;  1AOI B;  5G49 A;  3REI A;  3V9R A;  5JRG C;  5F99 C;  3LZ1 D;  2FJ7 C;  3B6G A;  1M1A B;  3WAA B;  3AZI B;  2RVQ D;  3MGR D;  3REL B;  2YFV A;  1M18 A;  3AYW C;  4J8X A;  3UTA C;  3LZ0 D;  1P3A C;  2RIQ A;  1S32 D;  5B40 B;  3X1V B;  3A6N D;  1P3O A;  1P3M B;  3MGS A;  5B0Y B;  5B31 B;  1TZY C;  3C1B A;  3X1U B;  3AZK C;  1P3B C;  5B24 D;  4J8W D;  3H0L C;  3AZL D;  5E5A D;  3WKJ C;  3UTB C;  5FUG B;  3AV2 A;  5BT1 C;  5DNM C;  2NZD D;  3WAA A;  5B1M B;  3AZI A;  3B0C W;  3REL A;  3MGP D;  3LJA D;  4KGC C;  5B40 A;  3W99 C;  3AZE B;  3W97 A;  1P3M A;  5B32 G;  5B0Y A;  4R8P A;  5GSU C;  3REK C;  1P3P B;  1F66 D;  3X1U A;  1ZLA C;  4J8U D;  3AZG B;  5B1L A;  5FUG A;  1WWS A;  3A1I A;  4AWL C;  4CSR A;  3TU4 B;  5B1M A;  2LY8 A;  3C1C D;  3AZF C;  3LEL C;  5CHL B;  5DNN D;  3KUY C;  2PYO A;  3H0R C;  4E45 A;  5AV5 D;  1Q9C A;  3AZE A;  3X1S B;  5AY8 D;  4CAY B;  1M19 D;  3AZL B;  5B0Z C;  5CP6 D;  2HIO B;  3KWQ C;  5GT0 D;  1P3P A;  3AZN D;  1W2E A;  2Y2K A;  2NQB D;  2YFW B;  4WU8 C;  3AZG A;  5AVC A;  2VQR A;  5BO0 B;  4ZBJ C;  2W8S A;  1JFI A;  4WV4 B;  4YM6 D;  3TU4 A;  3AV1 B;  3AFA B;  5AV9 B;  2BYM B;  1P3L C;  5BNV B;  5CPI D;  1P3G D;  1M1A C;  5B33 A;  5B2J A;  4WZS B;  3X1S A;  5BS7 A;  4CAY A;  3REI D;  3MVD A;  4Z66 A;  3X1V C;  4Z5T C;  4HGA C;  3B6G D;  3W98 D;  5B2I D;  3X1T B;  2YFW A;  4YS3 C;  5B31 C;  4DRA A;  5BO0 A;  2XD1 A;  4J8X D;  2Y2N A;  3AN2 C;  3AV1 A;  3AFA A;  5AV9 A;  2BYM A;  3P5J B;  4EO5 C;  5AV5 B;  1P3O D;  4LD9 C;  1BH9 A;  5AV6 B;  3MGS D;  3B0C T;  5CPK A;  1EQZ C;  1HQ3 C;  4KUD C;  3O62 C;  1HTA A;  3KXB B;  3C1B D;  5GT3 B;  2NQB B;  1AOI D;  5AVB C;  4QLC C;  2F8N B;  3B6F C;  3MNN C;  3WAA D;  3AZI D;  3X1T A;  3REL D;  1A7W A;  2L5A A;  3LZ1 C;  4XUJ A;  4H9R B;  4XZQ B;  3MGQ A;  2RVQ C;  5B40 D;  3MGR C;  3B0D B;  3W97 D;  2IO5 C;  5AV6 A;  3LZ0 C;  4R8P D;  5B0Y D;  3AZJ B;  1S32 C;  1P3M D;  4NFT A;  3A6N C;  3KXB A;  3X1U D;  5AV8 B;  5GT3 A;  5B1L D;  1M18 B;  2CV5 B;  2JE5 A;  5B1M D;  5B24 C;  3VH5 A;  4J8W C;  1H3O A;  5E5A C;  3KSY A;  2PYO D;  3MGS B;  4H9R A;  4XZQ A;  2NZD C;  1B67 A;  3C1B B;  3MGP C;  3AZE D;  3LJA C;  2CWE A;  1P3K B;  3AZJ A;  1KX4 B;  2UWX A;  2ZY5 A;  5GXQ B;  3AV2 B;  1P3P D;  5AV8 A;  3H0M C;  3AZG D;  2CV5 A;  1F66 C;  4JJN C;  4J8U C;  3TU4 D;  3EG5 B;  3W97 B;  4R8P B;  4ZUX B;  3WA9 B;  5B2J D;  3C1C C;  5DNN C;  1KX5 B;  3X1S D;  4WU9 B;  5B1L B;  3F6T A;  1P3I A;  1P3K A;  4Z66 D;  2HIO D;  1KX4 A;  1U35 B;  5B31 G;  5GXQ A;  5AV5 C;  3KUY A;  4CSR B;  3WTP E;  5AY8 C;  2FFF B;  1M19 C;  5CP6 C;  2PYO B;  5GT0 C;  3AZN C;  3VH6 A;  3AV1 D;  3AFA D;  5AV9 D;  3REH A;  5C3I B;  4J8V B;  3AL0 C;  1KU5 A;  4YM6 C;  4KHA A;  4ZUX A;  3AZM B;  3WA9 A;  1P34 B;  3EPL A;  5CPI C;  1KX5 A;  4WU9 A;  5BNX B;  5AVC B;  1P3G C;  1P3L A;  1JFI B;  1U35 A;  3EPH A;  3REI C;  3X1T D;  3REJ B;  1KX3 B;  3W96 B;  5CPJ B;  2ZY3 A;  4XUJ D;  5B32 B;  4X23 A;  3MGQ D;  3B6G C;  3W98 C;  1TAF B;  5B2I C;  5B33 B;  5B2J B;  3AZH C;  3IP4 C;  4J8X C;  1ULY A;  4Z2M G;  4J8V A;  5AV6 D;  2Y2G A;  3MVD B;  4Z66 B;  4H9P A;  4YS3 A;  3WTP B;  3AZM A;  3KXB D;  1P34 A;  1P3O C;  5GT3 D;  5BNX A;  2F8N D;  4DRB A;  1AOI C;  3REJ A;  4H9S A;  1KX3 A;  2Y2Q A;  1BH9 B;  3W96 A;  5CPJ A;  5CPK B;  4XZQ D;  5B32 A;  3WAA C;  3AZI C;  1TAF A;  1N1J B;  1P3F A;  3REL C;  5AVB A;  3MNN A;  4H9N B;  1ID3 B;  2F8N K;  2G5H C;  3AZJ D;  5B40 C;  3WTP A;  3LZ1 A;  5AV8 D;  3W97 C;  1P3M C;  4R8P C;  5B0Y C;  3MGR A;  1M18 D;  2CV5 D;  3UT9 B;  4XUJ B;  2ARO B;  2Y2M A;  3MGQ B;  3X1U C;  2DF4 C;  5JRG B;  2Y2H A;  4G92 B;  5B1M C;  1N1J A;  3AYW B;  3UTA B;  4G91 B;  1ID3 A;  4H9N A;  1P3I D;  1P3K D;  1R4V A;  1KX4 D;  4WJ3 C;  5GXQ D;  3AV2 D;  5C3I C;  3AZE C;  1H3O B;  1TZY B;  5JA4 B;  3UT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...