5B2JD

Human nucleosome containing cpg methylated dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
total genus 36
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2jD00
5B31G 5GT0D 1Q9CA 3MGQC 1M19B 3AZGA 2PYOC 1BH9A 5GT0B 3REHA 5B24B 3MVDA 5GXQB 5DNNA 1N1JA 1P3FC 5CPID 5AV9D 2NZDC 3AZJA 5CPIB 5AV9B 5AVBC 1ID3C 3X1VA 1P3AB 3REIC 3AZGC 1U35D 3MVDC 5KDMB 3LZ0A 4KUDC 1EQZA 3O62D 1U35B 3WKJB 4KGCA 3O62B 3AN2D 3LJAC 1HTAA 3MGSB 5B31A 3AN2B 3B6GD 3X1SC 4QLCA 3AYWC 3B6GB 5B0ZC 3AFAD 3UT9C 1P3BB 5CPJC 1P3OA 3AFAB 1KX4D 4H9OB 5CPKD 5B2IC 5B33D 4UUZA 3AZLA 1EQZC 1KX4B 3W99C 2F8ND 3B6FA 3WA9A 2BYMB 5B33B 5AV6A 2F8NB 4KGCC 4J8UD 3R45B 4M6BA 3C1BA 4WV4B 1M18A 3W96D 4CSRA 3W96B 4E45A 4H9SC 5B32G 3MGRC 2HIOD 5AVCA 5JA4A 1P3MB 3AZID 4WU9D 2HIOB 1P3IC 1HQ3A 3AZLC 3W97B 4WU9B 5BNXA 5CP6A 4Z66D 1M18C 3A6NB 3AZNC 3C1CA 5AV5B 5B2JA 3B0DC 4J8WD 1KX5A 3X1TA 3KWQC 4X23C 4J8WB 1F66C 4WU8D 1P3LB 1ZLAD 3AZED 4XUJC 4XZQA 4R8PA 2NQBC 4WU8B 4H9RA 3AZEB 5B32A 5JRGD 5AV8A 3AZFA 5JRGB 4J8VA 3B0CW 1BH9B 5B1LB 3LELB 5DNND 4G92C 5DNNB 1N1JB 3REKB 3AZJD 1P3GA 3AV2A 3AZJB 3X1UC 3AZHA 3X1VD 1B6WA 5B40C 3X1VB 5BNVA 5B24C 3KUYD 3LZ0D 4YS3D 4ZUXD 5GXQC 3KUYB 3LZ0B 4YS3B 4ZUXB 2RVQC 3AV1A 5B31D 5DNMA 1P3KA 2YFWA 5E5AB 4QLCD 5B31B 4LD9A 3MNNC 1P34A 4QLCB 1P3AC 2AROC 4YM6C 1S32A 5GSUD 3B6FD 5B2IA 3WA9D 3WKJC 5AV6D 3MGQA 5GSUB 3WAAC 3B6FB 3REJC 3MGSC 3WA9B 3C1BD 5AV6B 3AN2C 4Z5TD 3C1BB 4EO5B 4Z5TB 1P3FA 4CSRB 1P3BC 4ZBJB 2NZDA 4G91B 5AVCD 3TU4B 4HGAB 1HQ3D 5AVCB 5GT3D 5AVBA 1KX4C 5BO0A 3VH6A 3RELC 1M1AD 5GT3B 3REIA 3V9RA 1M1AB 5CP6D 5G49B 4KUDA 3NQJA 3W96C 5CP6B 3C1CD 5B2JD 3LJAA 1KX5D 3X1TD 3W98C 3C1CB 1P3MC 5B2JB 3X1SA 3AYWA 4XZQD 4R8PD 5B0ZA 3UT9A 3W97C 5CPJA 1AOIC 4XZQB 2IO5B 4R8PB 1TZYA 2BYKA 2CV5C 3A6NC 3W99A 3AZFD 4AWLB 5AY8C 5AV5C 3AZFB 5BS7C 1P3PD 3UTAC 1P3PB 1P3LC 1P3GD 4H9SA 4WU8C 3AV2D 3MGRA 1P3GB 2F8NK 4NE3A 1TZYC 1P3IA 1KX3A 5C3IB 3WTPC 3AZKC 5CPKB 1R4VA 5FUGA 4JJNC 5B1LC 3LELC 2HUEB 2FJ7D 4J8UB 3AV1D 2FJ7B 3REKC 5F99A 4CAYA 3AZNA 3AV1B 5DNMD 5B0YC 1P3KD 3MGPC 4LD9D 3KWQA 5BT1D 4X23A 4KHAA 1P34D 1F66A 1KX3C 3AZMC 4XUJA 2NQBA 3AZIB 3KUYC 5B1MD 5B2ID 4DRBA 3WTPE 4YS3C 4ZUXC 3MGQD 1TAFB 5B1MB 5B2IB 2PYOD 4H9QA 4Z66B 3MGQB 5F99C 3KXBC 2PYOB 5E5AC 1P3FD 2NZDD 1JFIA 1F1EA 1BH8A 3B0CT 2NZDB 5AVBD 1ZLAB 1ID3D 3X1UA 3VH5W 5GSUC 1ID3B 5B40A 3REID 3AZGD 5BO0B 5B24A 3REHD 3LZ1C 3MVDD 3REIB 3V9RB 3AZGB 5GXQA 4KUDD 4EO5C 4Z5TC 4J8XC 3MVDB 3REHB 4KUDB 3LJAD 4ZBJC 3UTBC 3TU4C 4Z2MG 4HGAC 3LJAB 3X1SD 2F8NG 3AYWD 3MNNA 5B0ZD 3UT9D 1M19C 4WNNA 5CPJD 1P3AA 3AYWB 5B0ZB 3UT9B 5GT0C 2AROA 4YM6A 5CPJB 1EQZD 3W99D 2BYKB 3WKJA 4KGCD 1EQZB 3WAAA 3W99B 3REJA 3MGSA 5CPIC 4KGCB 3AN2A 5AV9C 4NE6A 1P3BA 3MGRD 1P3OD 3MGRB 1P3ID 1P3OB 1KX4A 3AZLD 1U35C 4AWLC 3RELA 4DRAA 1P3IB 4UUZB 3O62C 3AZLB 3VH6W 5FUGB 1M18D 1H3OA 1P3PC 3W96A 1M18B 3B6GC 3AZND 1A7WA 2L5AA 3W98A 3AZNB 3AFAC 3KWQD 1P3MA 3B0DB 4X23D 1F66D 4H9PA 5C3IC 5JA4B 2NQBD 3W97A 4XUJD 4X23B 4KHAB 5CPKC 5B33C 1F66B 4H9NA 1HQ3B 1AOIA 2NQBB 4XUJB 5BNXB 2CV5A 3A6NA 4J8UC 1KU5A 5AY8A 5AV5A 5BS7A 3UTAA 2YFVA 1KX5B 3X1TB 2HIOC 1P3LA 4G92B 3AZIC 4WU8A 4WU9C 1JFIB 1BH8B 3X1UD 5B32D 4H9RB 5B40D 5AV8D 5B32B 4Z66C 5B24D 5JRGA 3WTPA 4J8VD 3AZKA 5B40B 4JJNA 5B1LA 3NQUA 5GXQD 5AV8B 3LELA 4J8VB 4J8WC 2RVQD 4NFTA 3REKA 1B67A 5B0YA 3MGPA 1ZLAC 3AZEC 3AZHD 3MNND 3AV2B 1P3AD 3AZHB 3MNNB 5JRGC 3AZMA 2AROD 4YM6D 4WNNB 5BNVB 3REHC 3KUYA 2AROB 4YM6B 3WKJD 4YS3A 4ZUXA 3WAAD 5DNNC 3MGSD 3REJD 3WAAB 3KXBA 3REJB 5E5AA 3AZJC 1P3BD 5DNMB 3KSYA 1P3KB 2YFWB 3X1VC 4LD9B 1S32D 1P34B 3B0BA 1S32B 3RELD 3LZ0C 5GSUA 3RELB 5CHLB 3LZ1A 5B31C 4Z5TA 3VH5T 4J8XA 1H3OB 4QLCC 3UTBA 3W98D 1P3FB 2JSSA 3TU4A 1P3MD 2CWEA 3W98B 1P3OC 1TAFA 3W97D 4H9PB 1M19A 5GT3A 5AVBB 1AOID 3B6FC 3WA9C 1M1AA 5GT0A 5AV6C 4H9NB 2CV5D 3A6ND 1AOIB 5G49A 3C1BC 2CV5B 5AY8D 5AV5D 3NQJB 4G91C 3UTAD 5AY8B 4WZSB 5CPIA 5AV9A 3UTAB 2YFVB 5AVCC 1P3LD 1WWSA 4E44A 3X1SB 1HQ3C 5GT3C 1M1AC 1TZYD 5KDMA 1U35A 5CP6C 1TZYB 3WTPD 3AZKD 4JJND 3O62A 5B1LD 3LELD 3WTPB 3AZKB 3C1CC 4JJNB 5B2JC 3NQUB 1KX5C 3X1TC 1P3PA 3REKD 3B6GA 5B0YD 3MGPD 3VH5A 4R8PC 2IO5C 3VH6T 4XZQC 4H9OA 3AFAA 5B0YB 3MGPB 1KX3D 5B32C 3AZMD 5CPKA 2BYMA 5B33A 2F8NA 1KX3B 5AV8C 3AZFC 4J8VC 3AZMB 3R45A 4J8UA 2FJ7A 5F99D 3KXBD 4NE5A 5E5AD 1P3GC 5F99B 4CAYB 3KXBB 3AV2C 2HIOA 3AZHC 3KWQB 3AZIA 4WU9A 1WWIA 2HUEC 5B1MA 2FJ7C 4Z66A 3LZ1D 3AV1C 2PYOA 4Z2MH 4H9QB 4J8XD 3LZ1B 2F8NH 5DNMC 1P3KC 4J8WA 1ULYA 3UTBD 4J8XB 4LD9C 5BT1C 2LY8A 3TU4D 1P34C 3UTBB 1ZLAA 3AZEA 1S32C 1BFMA 1M19D 1ID3A 5B1MC 3X1UB
chains in the Genus database with same CATH superfamily
5B31G 5GT0D 1Q9CA 3MGQC 1M19B 3AZGA 2PYOC 1BH9A 5GT0B 3REHA 5B24B 3MVDA 5GXQB 3EPJA 5DNNA 1N1JA 1P3FC 5CPID 5AV9D 2NZDC 3AZJA 5CPIB 5AV9B 5AVBC 1ID3C 3X1VA 3H0LC 1P3AB 3REIC 3AZGC 1U35D 3MVDC 5KDMB 2ZY5A 3LZ0A 4KUDC 1EQZA 1W2EA 3O62D 1U35B 3WKJB 2FFFB 4KGCA 3O62B 3AN2D 3LJAC 1HTAA 3MGSB 5B31A 3AN2B 3B6GD 3X1SC 4QLCA 3AYWC 3B6GB 5B0ZC 3AFAD 3UT9C 1P3BB 3FDDA 5CPJC 2Y2OA 1P3OA 3AFAB 1KX4D 4H9OB 5CPKD 3X1UB 5B33D 4UUZA 3AZLA 1EQZC 1KX4B 3W99C 2F8ND 3B6FA 3WA9A 2BYMB 5B33B 5AV6A 2F8NB 4KGCC 4J8UD 2JE5A 3R45B 4M6BA 3C1BA 4WV4B 1M18A 3W96D 4CSRA 3W96B 4E45A 4H9SC 5B32G 3MGRC 2HIOD 5AVCA 5JA4A 1P3MB 3AZID 4WU9D 2HIOB 1P3IC 1HQ3A 3AZLC 3W97B 4WU9B 5BNXA 5CP6A 4Z66D 1M18C 3A6NB 3AZNC 3C1CA 5AV5B 5B2JA 3B0DC 4J8WD 1KX5A 3X1TA 3KWQC 4X23C 4J8WB 1F66C 4WU8D 1P3LB 1ZLAD 3AZED 4XUJC 4XZQA 4R8PA 2NQBC 4WU8B 4H9RA 3AZEB 5B32A 5JRGD 5AV8A 4UPKA 3AZFA 5JRGB 4J8VA 3B0CW 3KFUG 1BH9B 5B1LB 3LELB 5DNND 4G92C 5DNNB 1N1JB 3REKB 3AZJD 1P3GA 3AV2A 3AZJB 3X1UC 3AZHA 3X1VD 1B6WA 2XD1A 5B40C 3X1VB 5BNVA 5B24C 3KUYD 3LZ0D 4YS3D 4ZUXD 5GXQC 2RIQA 3KUYB 3A1IA 3LZ0B 4YS3B 4ZUXB 2RVQC 3AV1A 5B31D 5DNMA 1P3KA 2YFWA 5E5AB 4QLCD 5B31B 4LD9A 3MNNC 2G5HC 4QLCB 1P3AC 1P34A 2AROC 4YM6C 1S32A 1T3UA 5GSUD 3B6FD 5B2IA 3WA9D 3WKJC 5AV6D 3MGQA 5GSUB 3WAAC 3B6FB 3REJC 3MGSC 3WA9B 3C1BD 5AV6B 3AN2C 4Z5TD 3C1BB 4EO5B 4Z5TB 1P3FA 4CSRB 1P3BC 4ZBJB 2NZDA 4G91B 5AVCD 2Y2IA 3TU4B 4HGAB 1HQ3D 5AVCB 5GT3D 5AVBA 1KX4C 5BO0A 3VH6A 3RELC 1M1AD 5GT3B 3REIA 3V9RA 1M1AB 2Y2GA 5CP6D 3H0RC 5G49B 4KUDA 3NQJA 3W96C 5CP6B 3C1CD 5B2JD 3LJAA 1KX5D 3X1TD 3W98C 3C1CB 1P3MC 5B2JB 3X1SA 1PZRA 3AYWA 4XZQD 4R8PD 5B0ZA 3UT9A 3W97C 5CPJA 1AOIC 4XZQB 2IO5B 4R8PB 1TZYA 2BYKA 2CV5C 3A6NC 3W99A 3AZFD 4AWLB 5AY8C 5AV5C 3EPKA 3AZFB 5BS7C 1P3PD 3UTAC 1P3PB 1P3LC 1P3GD 4H9SA 4WU8C 2XD5A 3AV2D 3MGRA 1P3GB 2F8NK 2ZY2A 4NE3A 1TZYC 2Y2QA 1P3IA 1KX3A 3EPHA 5C3IB 3WTPC 3AZKC 5CPKB 1R4VA 5FUGA 4JJNC 5B1LC 3LELC 2HUEB 2FJ7D 4J8UB 3AV1D 2FJ7B 3REKC 5F99A 4CAYA 3AZNA 3AV1B 5DNMD 5B0YC 1P3KD 3MGPC 4LD9D 3KWQA 5BT1D 4X23A 4KHAA 1P34D 1F66A 1KX3C 3AZMC 4XUJA 2NQBA 3AZIB 3KUYC 5B1MD 5B2ID 4DRBA 3WTPE 4YS3C 4ZUXC 3MGQD 1TAFB 5B1MB 5B2IB 2PYOD 4H9QA 4Z66B 3MGQB 5F99C 3KXBC 3EG5B 2PYOB 5E5AC 1P3FD 2NZDD 1JFIA 1F1EA 1BH8A 2G5IC 3B0CT 2NZDB 5AVBD 1ZLAB 1ID3D 2DQNC 3X1UA 3VH5W 5GSUC 1ID3B 5B40A 3REID 3AZGD 5BO0B 5B24A 3REHD 3LZ1C 3MVDD 3REIB 3V9RB 3AZGB 5GXQA 4KUDD 4EO5C 3AL0C 4Z5TC 4J8XC 2ZY4A 3MVDB 3REHB 3F6TA 4KUDB 3LJAD 4ZBJC 3UTBC 3TU4C 4Z2MG 4HGAC 3LJAB 3X1SD 2F8NG 2Y2HA 3AYWD 3MNNA 5B0ZD 3UT9D 1M19C 4WNNA 5CPJD 2Y2LA 1P3AA 3AYWB 5B0ZB 3UT9B 5GT0C 2AROA 4YM6A 5CPJB 1EQZD 3W99D 2BYKB 3WKJA 4KGCD 1EQZB 3WAAA 3W99B 3REJA 3MGSA 5CPIC 4KGCB 3AN2A 2Y2PA 5AV9C 4NE6A 1P3BA 2Y2MA 3MGRD 2J8PA 1P3OD 3A1KA 3MGRB 1P3ID 1P3OB 1KX4A 3AZLD 1U35C 4AWLC 3RELA 4DRAA 1P3IB 4UUZB 3O62C 3AZLB 3VH6W 5FUGB 1M18D 1H3OA 1P3PC 3W96A 1M18B 3B6GC 3AZND 1A7WA 2L5AA 3W98A 3AZNB 3AFAC 3KWQD 1P3MA 3B0DB 4X23D 1F66D 4H9PA 5C3IC 5JA4B 2NQBD 3W97A 2UWXA 4XUJD 4KHAB 4X23B 5B33C 5CPKC 1F66B 4H9NA 1HQ3B 1AOIA 2NQBB 4XUJB 5BNXB 2CV5A 3A6NA 4J8UC 4WJ3C 1KU5A 5AY8A 5AV5A 5BS7A 3UTAA 2YFVA 1KX5B 3X1TB 2HIOC 1P3LA 4G92B 3AZIC 4WU8A 4WU9C 1JFIB 1BH8B 3X1UD 2JCHA 5B32D 4H9RB 5B40D 5AV8D 5B32B 4Z66C 5B24D 5JRGA 3WTPA 4J8VD 3AZKA 5B40B 4JJNA 3H0MC 5B1LA 3NQUA 5GXQD 5AV8B 3LELA 4J8VB 2W8SA 4J8WC 2RVQD 4NFTA 3REKA 1B67A 5B0YA 3MGPA 1ZLAC 3AZEC 3AZHD 3MNND 3AV2B 1P3AD 3AZHB 3MNNB 5JRGC 3AZMA 2AROD 4YM6D 4WNNB 5BNVB 3REHC 3KUYA 2AROB 2ZY3A 4YM6B 3WKJD 4YS3A 4ZUXA 3WAAD 2VQRA 5DNNC 3MGSD 3REJD 3WAAB 3KXBA 3REJB 5E5AA 3AZJC 1Z2CB 3IP4C 3P5JB 1P3BD 5DNMB 2Y2NA 3KSYA 1P3KB 2YFWB 3X1VC 4LD9B 2Y2KA 1S32D 1P34B 3B0BA 1S32B 3RELD 3LZ0C 5GSUA 3RELB 5CHLB 3LZ1A 5B31C 4Z5TA 3VH5T 4J8XA 1H3OB 4QLCC 3UTBA 3W98D 1P3FB 2JSSA 3TU4A 1P3MD 2CWEA 3W98B 1P3OC 1TAFA 3W97D 4H9PB 1M19A 5GT3A 2Y2JA 5AVBB 1AOID 3B6FC 3WA9C 1M1AA 5GT0A 5AV6C 4H9NB 2CV5D 3A6ND 1AOIB 5G49A 3C1BC 2F2AC 2CV5B 5AY8D 5AV5D 3NQJB 4G91C 3UTAD 5AY8B 4WZSB 5CPIA 5AV9A 2DF4C 3UTAB 2YFVB 5AVCC 1P3LD 1WWSA 4E44A 3X1SB 1HQ3C 5GT3C 1M1AC 1TZYD 5KDMA 1U35A 5CP6C 1TZYB 3WTPD 3AZKD 4JJND 3O62A 5B1LD 3LELD 3WTPB 3AZKB 3C1CC 4JJNB 5B2JC 3NQUB 1KX5C 3X1TC 1P3PA 3REKD 3B6GA 5B0YD 3MGPD 3VH5A 4R8PC 2IO5C 3VH6T 4XZQC 4H9OA 3AFAA 5B0YB 3MGPB 1KX3D 5B32C 2ZM5A 3EPLA 3AZMD 5CPKA 2BYMA 5B33A 2F8NA 1KX3B 5AV8C 3AZFC 4J8VC 3AZMB 3R45A 4J8UA 2FJ7A 2BG1A 5F99D 3KXBD 4NE5A 5E5AD 1P3GC 5F99B 4CAYB 3KXBB 3AV2C 2HIOA 3AZHC 3KWQB 3AZIA 4WU9A 1WWIA 2HUEC 5B1MA 2FJ7C 4Z66A 3LZ1D 3AV1C 2PYOA 4Z2MH 4H9QB 4J8XD 3LZ1B 2F8NH 5DNMC 1P3KC 4J8WA 1ULYA 3UTBD 4J8XB 4LD9C 5BT1C 2LY8A 3TU4D 1P34C 3UTBB 1ZLAA 3AZEA 1S32C 4DQYB 1BFMA 1M19D 1ID3A 5B1MC 5B2IC
chains in the Genus database with same CATH topology
5B31G 5GT0D 1Q9CA 3MGQC 1M19B 3AZGA 2PYOC 1BH9A 5GT0B 3REHA 5B24B 3MVDA 5GXQB 3EPJA 5DNNA 1N1JA 1P3FC 5CPID 5AV9D 2NZDC 3AZJA 5CPIB 5AV9B 5AVBC 1ID3C 3X1VA 3H0LC 1P3AB 3REIC 3AZGC 1U35D 3MVDC 5KDMB 2ZY5A 3LZ0A 4KUDC 1EQZA 1W2EA 3O62D 1U35B 3WKJB 2FFFB 4KGCA 3O62B 3AN2D 3LJAC 1HTAA 3MGSB 5B31A 3AN2B 3B6GD 3X1SC 4QLCA 3AYWC 3B6GB 5B0ZC 3AFAD 3UT9C 1P3BB 3FDDA 5CPJC 2Y2OA 1P3OA 3AFAB 1KX4D 4H9OB 5CPKD 3X1UB 5B33D 4UUZA 3AZLA 1EQZC 1KX4B 3W99C 2F8ND 3B6FA 3WA9A 2BYMB 5B33B 5AV6A 2F8NB 4KGCC 4J8UD 2JE5A 3R45B 4M6BA 3C1BA 4WV4B 1M18A 3W96D 4CSRA 3W96B 4E45A 4H9SC 5B32G 3MGRC 2HIOD 5AVCA 5JA4A 1P3MB 3AZID 4WU9D 2HIOB 1P3IC 1HQ3A 3AZLC 3W97B 4WU9B 5BNXA 5CP6A 4Z66D 1M18C 3A6NB 3AZNC 3C1CA 5AV5B 5B2JA 3B0DC 4J8WD 1KX5A 3X1TA 3KWQC 4X23C 4J8WB 1F66C 4WU8D 1P3LB 1ZLAD 3AZED 4XUJC 4XZQA 4R8PA 2NQBC 4WU8B 4H9RA 3AZEB 5B32A 5JRGD 5AV8A 4UPKA 3AZFA 5JRGB 4J8VA 3B0CW 3KFUG 1BH9B 5B1LB 3LELB 5DNND 4G92C 5DNNB 1N1JB 3REKB 3AZJD 1P3GA 3AV2A 3AZJB 3X1UC 3AZHA 3X1VD 1B6WA 2XD1A 5B40C 3X1VB 5BNVA 5B24C 3KUYD 3LZ0D 4YS3D 4ZUXD 5GXQC 2RIQA 3KUYB 3A1IA 3LZ0B 4YS3B 4ZUXB 2RVQC 3AV1A 5B31D 5DNMA 1P3KA 2YFWA 5E5AB 4QLCD 5B31B 4LD9A 3MNNC 2G5HC 4QLCB 1P3AC 1P34A 2AROC 4YM6C 1S32A 1T3UA 5GSUD 3B6FD 5B2IA 3WA9D 3WKJC 5AV6D 3MGQA 5GSUB 3WAAC 3B6FB 3REJC 3MGSC 3WA9B 3C1BD 5AV6B 3AN2C 4Z5TD 3C1BB 4EO5B 4Z5TB 1P3FA 4CSRB 1P3BC 4ZBJB 2NZDA 4G91B 5AVCD 2Y2IA 3TU4B 4HGAB 1HQ3D 5AVCB 5GT3D 5AVBA 1KX4C 5BO0A 3VH6A 3RELC 1M1AD 5GT3B 3REIA 3V9RA 1M1AB 2Y2GA 5CP6D 3H0RC 5G49B 4KUDA 3NQJA 3W96C 5CP6B 3C1CD 5B2JD 3LJAA 1KX5D 3X1TD 3W98C 3C1CB 1P3MC 5B2JB 3X1SA 1PZRA 3AYWA 4XZQD 4R8PD 5B0ZA 3UT9A 3W97C 5CPJA 1AOIC 4XZQB 2IO5B 4R8PB 1TZYA 2BYKA 2CV5C 3A6NC 3W99A 3AZFD 4AWLB 5AY8C 5AV5C 3EPKA 3AZFB 5BS7C 1P3PD 3UTAC 1P3PB 1P3LC 1P3GD 4H9SA 4WU8C 2XD5A 3AV2D 3MGRA 1P3GB 2F8NK 2ZY2A 4NE3A 1TZYC 2Y2QA 1P3IA 1KX3A 3EPHA 5C3IB 3WTPC 3AZKC 5CPKB 1R4VA 5FUGA 4JJNC 5B1LC 3LELC 2HUEB 2FJ7D 4J8UB 3AV1D 2FJ7B 3REKC 5F99A 4CAYA 3AZNA 3AV1B 5DNMD 5B0YC 1P3KD 3MGPC 4LD9D 3KWQA 5BT1D 4X23A 4KHAA 1P34D 1F66A 1KX3C 3AZMC 4XUJA 2NQBA 3AZIB 3KUYC 5B1MD 5B2ID 4DRBA 3WTPE 4YS3C 4ZUXC 3MGQD 1TAFB 5B1MB 5B2IB 2PYOD 4H9QA 4Z66B 3MGQB 5F99C 3KXBC 3EG5B 2PYOB 5E5AC 1P3FD 2NZDD 1JFIA 1F1EA 1BH8A 2G5IC 3B0CT 2NZDB 5AVBD 1ZLAB 1ID3D 2DQNC 3X1UA 3VH5W 5GSUC 1ID3B 5B40A 3REID 3AZGD 5BO0B 5B24A 3REHD 3LZ1C 3MVDD 3REIB 3V9RB 3AZGB 5GXQA 4KUDD 4EO5C 3AL0C 4Z5TC 4J8XC 2ZY4A 3MVDB 3REHB 3F6TA 4KUDB 3LJAD 4ZBJC 3UTBC 3TU4C 4Z2MG 4HGAC 3LJAB 3X1SD 2F8NG 2Y2HA 3AYWD 3MNNA 5B0ZD 3UT9D 1M19C 4WNNA 5CPJD 2Y2LA 1P3AA 3AYWB 5B0ZB 3UT9B 5GT0C 2AROA 4YM6A 5CPJB 1EQZD 3W99D 2BYKB 3WKJA 4KGCD 1EQZB 3WAAA 3W99B 3REJA 3MGSA 5CPIC 4KGCB 3AN2A 2Y2PA 5AV9C 4NE6A 1P3BA 2Y2MA 3MGRD 2J8PA 1P3OD 3A1KA 3MGRB 1P3ID 1P3OB 1KX4A 3AZLD 1U35C 4AWLC 3RELA 4DRAA 1P3IB 4UUZB 3O62C 3AZLB 3VH6W 5FUGB 1M18D 1H3OA 1P3PC 3W96A 1M18B 3B6GC 3AZND 1A7WA 2L5AA 3W98A 3AZNB 3AFAC 3KWQD 1P3MA 3B0DB 4X23D 1F66D 4H9PA 5C3IC 5JA4B 2NQBD 3W97A 2UWXA 4XUJD 4KHAB 4X23B 5B33C 5CPKC 1F66B 4H9NA 1HQ3B 1AOIA 2NQBB 4XUJB 5BNXB 2CV5A 3A6NA 4J8UC 4WJ3C 1KU5A 5AY8A 5AV5A 5BS7A 3UTAA 2YFVA 1KX5B 3X1TB 2HIOC 1P3LA 4G92B 3AZIC 4WU8A 4WU9C 1JFIB 1BH8B 3X1UD 2JCHA 5B32D 4H9RB 5B40D 5AV8D 5B32B 4Z66C 5B24D 5JRGA 3WTPA 4J8VD 3AZKA 5B40B 4JJNA 3H0MC 5B1LA 3NQUA 5GXQD 5AV8B 3LELA 4J8VB 2W8SA 4J8WC 2RVQD 4NFTA 3REKA 1B67A 5B0YA 3MGPA 1ZLAC 3AZEC 3AZHD 3MNND 3AV2B 1P3AD 3AZHB 3MNNB 5JRGC 3AZMA 2AROD 4YM6D 4WNNB 5BNVB 3REHC 3KUYA 2AROB 2ZY3A 4YM6B 3WKJD 4YS3A 4ZUXA 3WAAD 2VQRA 5DNNC 3MGSD 3REJD 3WAAB 3KXBA 3REJB 5E5AA 3AZJC 1Z2CB 3IP4C 3P5JB 1P3BD 5DNMB 2Y2NA 3KSYA 1P3KB 2YFWB 3X1VC 4LD9B 2Y2KA 1S32D 1P34B 3B0BA 1S32B 3RELD 3LZ0C 5GSUA 3RELB 5CHLB 3LZ1A 5B31C 4Z5TA 3VH5T 4J8XA 1H3OB 4QLCC 3UTBA 3W98D 1P3FB 2JSSA 3TU4A 1P3MD 2CWEA 3W98B 1P3OC 1TAFA 3W97D 4H9PB 1M19A 5GT3A 2Y2JA 5AVBB 1AOID 3B6FC 3WA9C 1M1AA 5GT0A 5AV6C 4H9NB 2CV5D 3A6ND 1AOIB 5G49A 3C1BC 2F2AC 2CV5B 5AY8D 5AV5D 3NQJB 4G91C 3UTAD 5AY8B 4WZSB 5CPIA 5AV9A 2DF4C 3UTAB 2YFVB 5AVCC 1P3LD 1WWSA 4E44A 3X1SB 1HQ3C 5GT3C 1M1AC 1TZYD 5KDMA 1U35A 5CP6C 1TZYB 3WTPD 3AZKD 4JJND 3O62A 5B1LD 3LELD 3WTPB 3AZKB 3C1CC 4JJNB 5B2JC 3NQUB 1KX5C 3X1TC 1P3PA 3REKD 3B6GA 5B0YD 3MGPD 3VH5A 4R8PC 2IO5C 3VH6T 4XZQC 4H9OA 3AFAA 5B0YB 3MGPB 1KX3D 5B32C 2ZM5A 3EPLA 3AZMD 5CPKA 2BYMA 5B33A 2F8NA 1KX3B 5AV8C 3AZFC 4J8VC 3AZMB 3R45A 4J8UA 2FJ7A 2BG1A 5F99D 3KXBD 4NE5A 5E5AD 1P3GC 5F99B 4CAYB 3KXBB 3AV2C 2HIOA 3AZHC 3KWQB 3AZIA 4WU9A 1WWIA 2HUEC 5B1MA 2FJ7C 4Z66A 3LZ1D 3AV1C 2PYOA 4Z2MH 4H9QB 4J8XD 3LZ1B 2F8NH 5DNMC 1P3KC 4J8WA 1ULYA 3UTBD 4J8XB 4LD9C 5BT1C 2LY8A 3TU4D 1P34C 3UTBB 1ZLAA 3AZEA 1S32C 4DQYB 1BFMA 1M19D 1ID3A 5B1MC 5B2IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 G;  5GT0 D;  1Q9C A;  3MGQ C;  1M19 B;  3AZG A;  2PYO C;  1BH9 A;  5GT0 B;  3REH A;  5B24 B;  3MVD A;  5GXQ B;  5DNN A;  1N1J A;  1P3F C;  5CPI D;  5AV9 D;  2NZD C;  3AZJ A;  5CPI B;  5AV9 B;  5AVB C;  1ID3 C;  3X1V A;  1P3A B;  3REI C;  3AZG C;  1U35 D;  3MVD C;  5KDM B;  3LZ0 A;  4KUD C;  1EQZ A;  3O62 D;  1U35 B;  3WKJ B;  4KGC A;  3O62 B;  3AN2 D;  3LJA C;  1HTA A;  3MGS B;  5B31 A;  3AN2 B;  3B6G D;  3X1S C;  4QLC A;  3AYW C;  3B6G B;  5B0Z C;  3AFA D;  3UT9 C;  1P3B B;  5CPJ C;  1P3O A;  3AFA B;  1KX4 D;  4H9O B;  5CPK D;  5B2I C;  5B33 D;  4UUZ A;  3AZL A;  1EQZ C;  1KX4 B;  3W99 C;  2F8N D;  3B6F A;  3WA9 A;  2BYM B;  5B33 B;  5AV6 A;  2F8N B;  4KGC C;  4J8U D;  3R45 B;  4M6B A;  3C1B A;  4WV4 B;  1M18 A;  3W96 D;  4CSR A;  3W96 B;  4E45 A;  4H9S C;  5B32 G;  3MGR C;  2HIO D;  5AVC A;  5JA4 A;  1P3M B;  3AZI D;  4WU9 D;  2HIO B;  1P3I C;  1HQ3 A;  3AZL C;  3W97 B;  4WU9 B;  5BNX A;  5CP6 A;  4Z66 D;  1M18 C;  3A6N B;  3AZN C;  3C1C A;  5AV5 B;  5B2J A;  3B0D C;  4J8W D;  1KX5 A;  3X1T A;  3KWQ C;  4X23 C;  4J8W B;  1F66 C;  4WU8 D;  1P3L B;  1ZLA D;  3AZE D;  4XUJ C;  4XZQ A;  4R8P A;  2NQB C;  4WU8 B;  4H9R A;  3AZE B;  5B32 A;  5JRG D;  5AV8 A;  3AZF A;  5JRG B;  4J8V A;  3B0C W;  1BH9 B;  5B1L B;  3LEL B;  5DNN D;  4G92 C;  5DNN B;  1N1J B;  3REK B;  3AZJ D;  1P3G A;  3AV2 A;  3AZJ B;  3X1U C;  3AZH A;  3X1V D;  1B6W A;  5B40 C;  3X1V B;  5BNV A;  5B24 C;  3KUY D;  3LZ0 D;  4YS3 D;  4ZUX D;  5GXQ C;  3KUY B;  3LZ0 B;  4YS3 B;  4ZUX B;  2RVQ C;  3AV1 A;  5B31 D;  5DNM A;  1P3K A;  2YFW A;  5E5A B;  4QLC D;  5B31 B;  4LD9 A;  3MNN C;  1P34 A;  4QLC B;  1P3A C;  2ARO C;  4YM6 C;  1S32 A;  5GSU D;  3B6F D;  5B2I A;  3WA9 D;  3WKJ C;  5AV6 D;  3MGQ A;  5GSU B;  3WAA C;  3B6F B;  3REJ C;  3MGS C;  3WA9 B;  3C1B D;  5AV6 B;  3AN2 C;  4Z5T D;  3C1B B;  4EO5 B;  4Z5T B;  1P3F A;  4CSR B;  1P3B C;  4ZBJ B;  2NZD A;  4G91 B;  5AVC D;  3TU4 B;  4HGA B;  1HQ3 D;  5AVC B;  5GT3 D;  5AVB A;  1KX4 C;  5BO0 A;  3VH6 A;  3REL C;  1M1A D;  5GT3 B;  3REI A;  3V9R A;  1M1A B;  5CP6 D;  5G49 B;  4KUD A;  3NQJ A;  3W96 C;  5CP6 B;  3C1C D;  5B2J D;  3LJA A;  1KX5 D;  3X1T D;  3W98 C;  3C1C B;  1P3M C;  5B2J B;  3X1S A;  3AYW A;  4XZQ D;  4R8P D;  5B0Z A;  3UT9 A;  3W97 C;  5CPJ A;  1AOI C;  4XZQ B;  2IO5 B;  4R8P B;  1TZY A;  2BYK A;  2CV5 C;  3A6N C;  3W99 A;  3AZF D;  4AWL B;  5AY8 C;  5AV5 C;  3AZF B;  5BS7 C;  1P3P D;  3UTA C;  1P3P B;  1P3L C;  1P3G D;  4H9S A;  4WU8 C;  3AV2 D;  3MGR A;  1P3G B;  2F8N K;  4NE3 A;  1TZY C;  1P3I A;  1KX3 A;  5C3I B;  3WTP C;  3AZK C;  5CPK B;  1R4V A;  5FUG A;  4JJN C;  5B1L C;  3LEL C;  2HUE B;  2FJ7 D;  4J8U B;  3AV1 D;  2FJ7 B;  3REK C;  5F99 A;  4CAY A;  3AZN A;  3AV1 B;  5DNM D;  5B0Y C;  1P3K D;  3MGP C;  4LD9 D;  3KWQ A;  5BT1 D;  4X23 A;  4KHA A;  1P34 D;  1F66 A;  1KX3 C;  3AZM C;  4XUJ A;  2NQB A;  3AZI B;  3KUY C;  5B1M D;  5B2I D;  4DRB A;  3WTP E;  4YS3 C;  4ZUX C;  3MGQ D;  1TAF B;  5B1M B;  5B2I B;  2PYO D;  4H9Q A;  4Z66 B;  3MGQ B;  5F99 C;  3KXB C;  2PYO B;  5E5A C;  1P3F D;  2NZD D;  1JFI A;  1F1E A;  1BH8 A;  3B0C T;  2NZD B;  5AVB D;  1ZLA B;  1ID3 D;  3X1U A;  3VH5 W;  5GSU C;  1ID3 B;  5B40 A;  3REI D;  3AZG D;  5BO0 B;  5B24 A;  3REH D;  3LZ1 C;  3MVD D;  3REI B;  3V9R B;  3AZG B;  5GXQ A;  4KUD D;  4EO5 C;  4Z5T C;  4J8X C;  3MVD B;  3REH B;  4KUD B;  3LJA D;  4ZBJ C;  3UTB C;  3TU4 C;  4Z2M G;  4HGA C;  3LJA B;  3X1S D;  2F8N G;  3AYW D;  3MNN A;  5B0Z D;  3UT9 D;  1M19 C;  4WNN A;  5CPJ D;  1P3A A;  3AYW B;  5B0Z B;  3UT9 B;  5GT0 C;  2ARO A;  4YM6 A;  5CPJ B;  1EQZ D;  3W99 D;  2BYK B;  3WKJ A;  4KGC D;  1EQZ B;  3WAA A;  3W99 B;  3REJ A;  3MGS A;  5CPI C;  4KGC B;  3AN2 A;  5AV9 C;  4NE6 A;  1P3B A;  3MGR D;  1P3O D;  3MGR B;  1P3I D;  1P3O B;  1KX4 A;  3AZL D;  1U35 C;  4AWL C;  3REL A;  4DRA A;  1P3I B;  4UUZ B;  3O62 C;  3AZL B;  3VH6 W;  5FUG B;  1M18 D;  1H3O A;  1P3P C;  3W96 A;  1M18 B;  3B6G C;  3AZN D;  1A7W A;  2L5A A;  3W98 A;  3AZN B;  3AFA C;  3KWQ D;  1P3M A;  3B0D B;  4X23 D;  1F66 D;  4H9P A;  5C3I C;  5JA4 B;  2NQB D;  3W97 A;  4XUJ D;  4X23 B;  4KHA B;  5CPK C;  5B33 C;  1F66 B;  4H9N A;  1HQ3 B;  1AOI A;  2NQB B;  4XUJ B;  5BNX B;  2CV5 A;  3A6N A;  4J8U C;  1KU5 A;  5AY8 A;  5AV5 A;  5BS7 A;  3UTA A;  2YFV A;  1KX5 B;  3X1T B;  2HIO C;  1P3L A;  4G92 B;  3AZI C;  4WU8 A;  4WU9 C;  1JFI B;  1BH8 B;  3X1U D;  5B32 D;  4H9R B;  5B40 D;  5AV8 D;  5B32 B;  4Z66 C;  5B24 D;  5JRG A;  3WTP A;  4J8V D;  3AZK A;  5B40 B;  4JJN A;  5B1L A;  3NQU A;  5GXQ D;  5AV8 B;  3LEL A;  4J8V B;  4J8W C;  2RVQ D;  4NFT A;  3REK A;  1B67 A;  5B0Y A;  3MGP A;  1ZLA C;  3AZE C;  3AZH D;  3MNN D;  3AV2 B;  1P3A D;  3AZH B;  3MNN B;  5JRG C;  3AZM A;  2ARO D;  4YM6 D;  4WNN B;  5BNV B;  3REH C;  3KUY A;  2ARO B;  4YM6 B;  3WKJ D;  4YS3 A;  4ZUX A;  3WAA D;  5DNN C;  3MGS D;  3REJ D;  3WAA B;  3KXB A;  3REJ B;  5E5A A;  3AZJ C;  1P3B D;  5DNM B;  3KSY A;  1P3K B;  2YFW B;  3X1V C;  4LD9 B;  1S32 D;  1P34 B;  3B0B A;  1S32 B;  3REL D;  3LZ0 C;  5GSU A;  3REL B;  5CHL B;  3LZ1 A;  5B31 C;  4Z5T A;  3VH5 T;  4J8X A;  1H3O B;  4QLC C;  3UTB A;  3W98 D;  1P3F B;  2JSS A;  3TU4 A;  1P3M D;  2CWE A;  3W98 B;  1P3O C;  1TAF A;  3W97 D;  4H9P B;  1M19 A;  5GT3 A;  5AVB B;  1AOI D;  3B6F C;  3WA9 C;  1M1A A;  5GT0 A;  5AV6 C;  4H9N B;  2CV5 D;  3A6N D;  1AOI B;  5G49 A;  3C1B C;  2CV5 B;  5AY8 D;  5AV5 D;  3NQJ B;  4G91 C;  3UTA D;  5AY8 B;  4WZS B;  5CPI A;  5AV9 A;  3UTA B;  2YFV B;  5AVC C;  1P3L D;  1WWS A;  4E44 A;  3X1S B;  1HQ3 C;  5GT3 C;  1M1A C;  1TZY D;  5KDM A;  1U35 A;  5CP6 C;  1TZY B;  3WTP D;  3AZK D;  4JJN D;  3O62 A;  5B1L D;  3LEL D;  3WTP B;  3AZK B;  3C1C C;  4JJN B;  5B2J C;  3NQU B;  1KX5 C;  3X1T C;  1P3P A;  3REK D;  3B6G A;  5B0Y D;  3MGP D;  3VH5 A;  4R8P C;  2IO5 C;  3VH6 T;  4XZQ C;  4H9O A;  3AFA A;  5B0Y B;  3MGP B;  1KX3 D;  5B32 C;  3AZM D;  5CPK A;  2BYM A;  5B33 A;  2F8N A;  1KX3 B;  5AV8 C;  3AZF C;  4J8V C;  3AZM B;  3R45 A;  4J8U A;  2FJ7 A;  5F99 D;  3KXB D;  4NE5 A;  5E5A D;  1P3G C;  5F99 B;  4CAY B;  3KXB B;  3AV2 C;  2HIO A;  3AZH C;  3KWQ B;  3AZI A;  4WU9 A;  1WWI A;  2HUE C;  5B1M A;  2FJ7 C;  4Z66 A;  3LZ1 D;  3AV1 C;  2PYO A;  4Z2M H;  4H9Q B;  4J8X D;  3LZ1 B;  2F8N H;  5DNM C;  1P3K C;  4J8W A;  1ULY A;  3UTB D;  4J8X B;  4LD9 C;  5BT1 C;  2LY8 A;  3TU4 D;  1P34 C;  3UTB B;  1ZLA A;  3AZE A;  1S32 C;  1BFM A;  1M19 D;  1ID3 A;  5B1M C;  3X1U B; 
#chains in the Genus database with same CATH topology
 5B31 G;  5GT0 D;  1Q9C A;  3MGQ C;  1M19 B;  3AZG A;  2PYO C;  1BH9 A;  5GT0 B;  3REH A;  5B24 B;  3MVD A;  5GXQ B;  3EPJ A;  5DNN A;  1N1J A;  1P3F C;  5CPI D;  5AV9 D;  2NZD C;  3AZJ A;  5CPI B;  5AV9 B;  5AVB C;  1ID3 C;  3X1V A;  3H0L C;  1P3A B;  3REI C;  3AZG C;  1U35 D;  3MVD C;  5KDM B;  2ZY5 A;  3LZ0 A;  4KUD C;  1EQZ A;  1W2E A;  3O62 D;  1U35 B;  3WKJ B;  2FFF B;  4KGC A;  3O62 B;  3AN2 D;  3LJA C;  1HTA A;  3MGS B;  5B31 A;  3AN2 B;  3B6G D;  3X1S C;  4QLC A;  3AYW C;  3B6G B;  5B0Z C;  3AFA D;  3UT9 C;  1P3B B;  3FDD A;  5CPJ C;  2Y2O A;  1P3O A;  3AFA B;  1KX4 D;  4H9O B;  5CPK D;  3X1U B;  5B33 D;  4UUZ A;  3AZL A;  1EQZ C;  1KX4 B;  3W99 C;  2F8N D;  3B6F A;  3WA9 A;  2BYM B;  5B33 B;  5AV6 A;  2F8N B;  4KGC C;  4J8U D;  2JE5 A;  3R45 B;  4M6B A;  3C1B A;  4WV4 B;  1M18 A;  3W96 D;  4CSR A;  3W96 B;  4E45 A;  4H9S C;  5B32 G;  3MGR C;  2HIO D;  5AVC A;  5JA4 A;  1P3M B;  3AZI D;  4WU9 D;  2HIO B;  1P3I C;  1HQ3 A;  3AZL C;  3W97 B;  4WU9 B;  5BNX A;  5CP6 A;  4Z66 D;  1M18 C;  3A6N B;  3AZN C;  3C1C A;  5AV5 B;  5B2J A;  3B0D C;  4J8W D;  1KX5 A;  3X1T A;  3KWQ C;  4X23 C;  4J8W B;  1F66 C;  4WU8 D;  1P3L B;  1ZLA D;  3AZE D;  4XUJ C;  4XZQ A;  4R8P A;  2NQB C;  4WU8 B;  4H9R A;  3AZE B;  5B32 A;  5JRG D;  5AV8 A;  4UPK A;  3AZF A;  5JRG B;  4J8V A;  3B0C W;  3KFU G;  1BH9 B;  5B1L B;  3LEL B;  5DNN D;  4G92 C;  5DNN B;  1N1J B;  3REK B;  3AZJ D;  1P3G A;  3AV2 A;  3AZJ B;  3X1U C;  3AZH A;  3X1V D;  1B6W A;  2XD1 A;  5B40 C;  3X1V B;  5BNV A;  5B24 C;  3KUY D;  3LZ0 D;  4YS3 D;  4ZUX D;  5GXQ C;  2RIQ A;  3KUY B;  3A1I A;  3LZ0 B;  4YS3 B;  4ZUX B;  2RVQ C;  3AV1 A;  5B31 D;  5DNM A;  1P3K A;  2YFW A;  5E5A B;  4QLC D;  5B31 B;  4LD9 A;  3MNN C;  2G5H C;  4QLC B;  1P3A C;  1P34 A;  2ARO C;  4YM6 C;  1S32 A;  1T3U A;  5GSU D;  3B6F D;  5B2I A;  3WA9 D;  3WKJ C;  5AV6 D;  3MGQ A;  5GSU B;  3WAA C;  3B6F B;  3REJ C;  3MGS C;  3WA9 B;  3C1B D;  5AV6 B;  3AN2 C;  4Z5T D;  3C1B B;  4EO5 B;  4Z5T B;  1P3F A;  4CSR B;  1P3B C;  4ZBJ B;  2NZD A;  4G91 B;  5AVC D;  2Y2I A;  3TU4 B;  4HGA B;  1HQ3 D;  5AVC B;  5GT3 D;  5AVB A;  1KX4 C;  5BO0 A;  3VH6 A;  3REL C;  1M1A D;  5GT3 B;  3REI A;  3V9R A;  1M1A B;  2Y2G A;  5CP6 D;  3H0R C;  5G49 B;  4KUD A;  3NQJ A;  3W96 C;  5CP6 B;  3C1C D;  5B2J D;  3LJA A;  1KX5 D;  3X1T D;  3W98 C;  3C1C B;  1P3M C;  5B2J B;  3X1S A;  1PZR A;  3AYW A;  4XZQ D;  4R8P D;  5B0Z A;  3UT9 A;  3W97 C;  5CPJ A;  1AOI C;  4XZQ B;  2IO5 B;  4R8P B;  1TZY A;  2BYK A;  2CV5 C;  3A6N C;  3W99 A;  3AZF D;  4AWL B;  5AY8 C;  5AV5 C;  3EPK A;  3AZF B;  5BS7 C;  1P3P D;  3UTA C;  1P3P B;  1P3L C;  1P3G D;  4H9S A;  4WU8 C;  2XD5 A;  3AV2 D;  3MGR A;  1P3G B;  2F8N K;  2ZY2 A;  4NE3 A;  1TZY C;  2Y2Q A;  1P3I A;  1KX3 A;  3EPH A;  5C3I B;  3WTP C;  3AZK C;  5CPK B;  1R4V A;  5FUG A;  4JJN C;  5B1L C;  3LEL C;  2HUE B;  2FJ7 D;  4J8U B;  3AV1 D;  2FJ7 B;  3REK C;  5F99 A;  4CAY A;  3AZN A;  3AV1 B;  5DNM D;  5B0Y C;  1P3K D;  3MGP C;  4LD9 D;  3KWQ A;  5BT1 D;  4X23 A;  4KHA A;  1P34 D;  1F66 A;  1KX3 C;  3AZM C;  4XUJ A;  2NQB A;  3AZI B;  3KUY C;  5B1M D;  5B2I D;  4DRB A;  3WTP E;  4YS3 C;  4ZUX C;  3MGQ D;  1TAF B;  5B1M B;  5B2I B;  2PYO D;  4H9Q A;  4Z66 B;  3MGQ B;  5F99 C;  3KXB C;  3EG5 B;  2PYO B;  5E5A C;  1P3F D;  2NZD D;  1JFI A;  1F1E A;  1BH8 A;  2G5I C;  3B0C T;  2NZD B;  5AVB D;  1ZLA B;  1ID3 D;  2DQN C;  3X1U A;  3VH5 W;  5GSU C;  1ID3 B;  5B40 A;  3REI D;  3AZG D;  5BO0 B;  5B24 A;  3REH D;  3LZ1 C;  3MVD D;  3REI B;  3V9R B;  3AZG B;  5GXQ A;  4KUD D;  4EO5 C;  3AL0 C;  4Z5T C;  4J8X C;  2ZY4 A;  3MVD B;  3REH B;  3F6T A;  4KUD B;  3LJA D;  4ZBJ C;  3UTB C;  3TU4 C;  4Z2M G;  4HGA C;  3LJA B;  3X1S D;  2F8N G;  2Y2H A;  3AYW D;  3MNN A;  5B0Z D;  3UT9 D;  1M19 C;  4WNN A;  5CPJ D;  2Y2L A;  1P3A A;  3AYW B;  5B0Z B;  3UT9 B;  5GT0 C;  2ARO A;  4YM6 A;  5CPJ B;  1EQZ D;  3W99 D;  2BYK B;  3WKJ A;  4KGC D;  1EQZ B;  3WAA A;  3W99 B;  3REJ A;  3MGS A;  5CPI C;  4KGC B;  3AN2 A;  2Y2P A;  5AV9 C;  4NE6 A;  1P3B A;  2Y2M A;  3MGR D;  2J8P A;  1P3O D;  3A1K A;  3MGR B;  1P3I D;  1P3O B;  1KX4 A;  3AZL D;  1U35 C;  4AWL C;  3REL A;  4DRA A;  1P3I B;  4UUZ B;  3O62 C;  3AZL B;  3VH6 W;  5FUG B;  1M18 D;  1H3O A;  1P3P C;  3W96 A;  1M18 B;  3B6G C;  3AZN D;  1A7W A;  2L5A A;  3W98 A;  3AZN B;  3AFA C;  3KWQ D;  1P3M A;  3B0D B;  4X23 D;  1F66 D;  4H9P A;  5C3I C;  5JA4 B;  2NQB D;  3W97 A;  2UWX A;  4XUJ D;  4KHA B;  4X23 B;  5B33 C;  5CPK C;  1F66 B;  4H9N A;  1HQ3 B;  1AOI A;  2NQB B;  4XUJ B;  5BNX B;  2CV5 A;  3A6N A;  4J8U C;  4WJ3 C;  1KU5 A;  5AY8 A;  5AV5 A;  5BS7 A;  3UTA A;  2YFV A;  1KX5 B;  3X1T B;  2HIO C;  1P3L A;  4G92 B;  3AZI C;  4WU8 A;  4WU9 C;  1JFI B;  1BH8 B;  3X1U D;  2JCH A;  5B32 D;  4H9R B;  5B40 D;  5AV8 D;  5B32 B;  4Z66 C;  5B24 D;  5JRG A;  3WTP A;  4J8V D;  3AZK A;  5B40 B;  4JJN A;  3H0M C;  5B1L A;  3NQU A;  5GXQ D;  5AV8 B;  3LEL A;  4J8V B;  2W8S A;  4J8W C;  2RVQ D;  4NFT A;  3REK A;  1B67 A;  5B0Y A;  3MGP A;  1ZLA C;  3AZE C;  3AZH D;  3MNN D;  3AV2 B;  1P3A D;  3AZH B;  3MNN B;  5JRG C;  3AZM A;  2ARO D;  4YM6 D;  4WNN B;  5BNV B;  3REH C;  3KUY A;  2ARO B;  2ZY3 A;  4YM6 B;  3WKJ D;  4YS3 A;  4ZUX A;  3WAA D;  2VQR A;  5DNN C;  3MGS D;  3REJ D;  3WAA B;  3KXB A;  3REJ B;  5E5A A;  3AZJ C;  1Z2C B;  3IP4 C;  3P5J B;  1P3B D;  5DNM B;  2Y2N A;  3KSY A;  1P3K B;  2YFW B;  3X1V C;  4LD9 B;  2Y2K A;  1S32 D;  1P34 B;  3B0B A;  1S32 B;  3REL D;  3LZ0 C;  5GSU A;  3REL B;  5CHL B;  3LZ1 A;  5B31 C;  4Z5T A;  3VH5 T;  4J8X A;  1H3O B;  4QLC C;  3UTB A;  3W98 D;  1P3F B;  2JSS A;  3TU4 A;  1P3M D;  2CWE A;  3W98 B;  1P3O C;  1TAF A;  3W97 D;  4H9P B;  1M19 A;  5GT3 A;  2Y2J A;  5AVB B;  1AOI D;  3B6F C;  3WA9 C;  1M1A A;  5GT0 A;  5AV6 C;  4H9N B;  2CV5 D;  3A6N D;  1AOI B;  5G49 A;  3C1B C;  2F2A C;  2CV5 B;  5AY8 D;  5AV5 D;  3NQJ B;  4G91 C;  3UTA D;  5AY8 B;  4WZS B;  5CPI A;  5AV9 A;  2DF4 C;  3UTA B;  2YFV B;  5AVC C;  1P3L D;  1WWS A;  4E44 A;  3X1S B;  1HQ3 C;  5GT3 C;  1M1A C;  1TZY D;  5KDM A;  1U35 A;  5CP6 C;  1TZY B;  3WTP D;  3AZK D;  4JJN D;  3O62 A;  5B1L D;  3LEL D;  3WTP B;  3AZK B;  3C1C C;  4JJN B;  5B2J C;  3NQU B;  1KX5 C;  3X1T C;  1P3P A;  3REK D;  3B6G A;  5B0Y D;  3MGP D;  3VH5 A;  4R8P C;  2IO5 C;  3VH6 T;  4XZQ C;  4H9O A;  3AFA A;  5B0Y B;  3MGP B;  1KX3 D;  5B32 C;  2ZM5 A;  3EPL A;  3AZM D;  5CPK A;  2BYM A;  5B33 A;  2F8N A;  1KX3 B;  5AV8 C;  3AZF C;  4J8V C;  3AZM B;  3R45 A;  4J8U A;  2FJ7 A;  2BG1 A;  5F99 D;  3KXB D;  4NE5 A;  5E5A D;  1P3G C;  5F99 B;  4CAY B;  3KXB B;  3AV2 C;  2HIO A;  3AZH C;  3KWQ B;  3AZI A;  4WU9 A;  1WWI A;  2HUE C;  5B1M A;  2FJ7 C;  4Z66 A;  3LZ1 D;  3AV1 C;  2PYO A;  4Z2M H;  4H9Q B;  4J8X D;  3LZ1 B;  2F8N H;  5DNM C;  1P3K C;  4J8W A;  1ULY A;  3UTB D;  4J8X B;  4LD9 C;  5BT1 C;  2LY8 A;  3TU4 D;  1P34 C;  3UTB B;  1ZLA A;  3AZE A;  1S32 C;  4DQY B;  1BFM A;  1M19 D;  1ID3 A;  5B1M C;  5B2I C; 
#chains in the Genus database with same CATH homology
 5B31 G;  5GT0 D;  1Q9C A;  3MGQ C;  1M19 B;  3AZG A;  2PYO C;  1BH9 A;  5GT0 B;  3REH A;  5B24 B;  3MVD A;  5GXQ B;  3EPJ A;  5DNN A;  1N1J A;  1P3F C;  5CPI D;  5AV9 D;  2NZD C;  3AZJ A;  5CPI B;  5AV9 B;  5AVB C;  1ID3 C;  3X1V A;  3H0L C;  1P3A B;  3REI C;  3AZG C;  1U35 D;  3MVD C;  5KDM B;  2ZY5 A;  3LZ0 A;  4KUD C;  1EQZ A;  1W2E A;  3O62 D;  1U35 B;  3WKJ B;  2FFF B;  4KGC A;  3O62 B;  3AN2 D;  3LJA C;  1HTA A;  3MGS B;  5B31 A;  3AN2 B;  3B6G D;  3X1S C;  4QLC A;  3AYW C;  3B6G B;  5B0Z C;  3AFA D;  3UT9 C;  1P3B B;  3FDD A;  5CPJ C;  2Y2O A;  1P3O A;  3AFA B;  1KX4 D;  4H9O B;  5CPK D;  3X1U B;  5B33 D;  4UUZ A;  3AZL A;  1EQZ C;  1KX4 B;  3W99 C;  2F8N D;  3B6F A;  3WA9 A;  2BYM B;  5B33 B;  5AV6 A;  2F8N B;  4KGC C;  4J8U D;  2JE5 A;  3R45 B;  4M6B A;  3C1B A;  4WV4 B;  1M18 A;  3W96 D;  4CSR A;  3W96 B;  4E45 A;  4H9S C;  5B32 G;  3MGR C;  2HIO D;  5AVC A;  5JA4 A;  1P3M B;  3AZI D;  4WU9 D;  2HIO B;  1P3I C;  1HQ3 A;  3AZL C;  3W97 B;  4WU9 B;  5BNX A;  5CP6 A;  4Z66 D;  1M18 C;  3A6N B;  3AZN C;  3C1C A;  5AV5 B;  5B2J A;  3B0D C;  4J8W D;  1KX5 A;  3X1T A;  3KWQ C;  4X23 C;  4J8W B;  1F66 C;  4WU8 D;  1P3L B;  1ZLA D;  3AZE D;  4XUJ C;  4XZQ A;  4R8P A;  2NQB C;  4WU8 B;  4H9R A;  3AZE B;  5B32 A;  5JRG D;  5AV8 A;  4UPK A;  3AZF A;  5JRG B;  4J8V A;  3B0C W;  3KFU G;  1BH9 B;  5B1L B;  3LEL B;  5DNN D;  4G92 C;  5DNN B;  1N1J B;  3REK B;  3AZJ D;  1P3G A;  3AV2 A;  3AZJ B;  3X1U C;  3AZH A;  3X1V D;  1B6W A;  2XD1 A;  5B40 C;  3X1V B;  5BNV A;  5B24 C;  3KUY D;  3LZ0 D;  4YS3 D;  4ZUX D;  5GXQ C;  2RIQ A;  3KUY B;  3A1I A;  3LZ0 B;  4YS3 B;  4ZUX B;  2RVQ C;  3AV1 A;  5B31 D;  5DNM A;  1P3K A;  2YFW A;  5E5A B;  4QLC D;  5B31 B;  4LD9 A;  3MNN C;  2G5H C;  4QLC B;  1P3A C;  1P34 A;  2ARO C;  4YM6 C;  1S32 A;  1T3U A;  5GSU D;  3B6F D;  5B2I A;  3WA9 D;  3WKJ C;  5AV6 D;  3MGQ A;  5GSU B;  3WAA C;  3B6F B;  3REJ C;  3MGS C;  3WA9 B;  3C1B D;  5AV6 B;  3AN2 C;  4Z5T D;  3C1B B;  4EO5 B;  4Z5T B;  1P3F A;  4CSR B;  1P3B C;  4ZBJ B;  2NZD A;  4G91 B;  5AVC D;  2Y2I A;  3TU4 B;  4HGA B;  1HQ3 D;  5AVC B;  5GT3 D;  5AVB A;  1KX4 C;  5BO0 A;  3VH6 A;  3REL C;  1M1A D;  5GT3 B;  3REI A;  3V9R A;  1M1A B;  2Y2G A;  5CP6 D;  3H0R C;  5G49 B;  4KUD A;  3NQJ A;  3W96 C;  5CP6 B;  3C1C D;  5B2J D;  3LJA A;  1KX5 D;  3X1T D;  3W98 C;  3C1C B;  1P3M C;  5B2J B;  3X1S A;  1PZR A;  3AYW A;  4XZQ D;  4R8P D;  5B0Z A;  3UT9 A;  3W97 C;  5CPJ A;  1AOI C;  4XZQ B;  2IO5 B;  4R8P B;  1TZY A;  2BYK A;  2CV5 C;  3A6N C;  3W99 A;  3AZF D;  4AWL B;  5AY8 C;  5AV5 C;  3EPK A;  3AZF B;  5BS7 C;  1P3P D;  3UTA C;  1P3P B;  1P3L C;  1P3G D;  4H9S A;  4WU8 C;  2XD5 A;  3AV2 D;  3MGR A;  1P3G B;  2F8N K;  2ZY2 A;  4NE3 A;  1TZY C;  2Y2Q A;  1P3I A;  1KX3 A;  3EPH A;  5C3I B;  3WTP C;  3AZK C;  5CPK B;  1R4V A;  5FUG A;  4JJN C;  5B1L C;  3LEL C;  2HUE B;  2FJ7 D;  4J8U B;  3AV1 D;  2FJ7 B;  3REK C;  5F99 A;  4CAY A;  3AZN A;  3AV1 B;  5DNM D;  5B0Y C;  1P3K D;  3MGP C;  4LD9 D;  3KWQ A;  5BT1 D;  4X23 A;  4KHA A;  1P34 D;  1F66 A;  1KX3 C;  3AZM C;  4XUJ A;  2NQB A;  3AZI B;  3KUY C;  5B1M D;  5B2I D;  4DRB A;  3WTP E;  4YS3 C;  4ZUX C;  3MGQ D;  1TAF B;  5B1M B;  5B2I B;  2PYO D;  4H9Q A;  4Z66 B;  3MGQ B;  5F99 C;  3KXB C;  3EG5 B;  2PYO B;  5E5A C;  1P3F D;  2NZD D;  1JFI A;  1F1E A;  1BH8 A;  2G5I C;  3B0C T;  2NZD B;  5AVB D;  1ZLA B;  1ID3 D;  2DQN C;  3X1U A;  3VH5 W;  5GSU C;  1ID3 B;  5B40 A;  3REI D;  3AZG D;  5BO0 B;  5B24 A;  3REH D;  3LZ1 C;  3MVD D;  3REI B;  3V9R B;  3AZG B;  5GXQ A;  4KUD D;  4EO5 C;  3AL0 C;  4Z5T C;  4J8X C;  2ZY4 A;  3MVD B;  3REH B;  3F6T A;  4KUD B;  3LJA D;  4ZBJ C;  3UTB C;  3TU4 C;  4Z2M G;  4HGA C;  3LJA B;  3X1S D;  2F8N G;  2Y2H A;  3AYW D;  3MNN A;  5B0Z D;  3UT9 D;  1M19 C;  4WNN A;  5CPJ D;  2Y2L A;  1P3A A;  3AYW B;  5B0Z B;  3UT9 B;  5GT0 C;  2ARO A;  4YM6 A;  5CPJ B;  1EQZ D;  3W99 D;  2BYK B;  3WKJ A;  4KGC D;  1EQZ B;  3WAA A;  3W99 B;  3REJ A;  3MGS A;  5CPI C;  4KGC B;  3AN2 A;  2Y2P A;  5AV9 C;  4NE6 A;  1P3B A;  2Y2M A;  3MGR D;  2J8P A;  1P3O D;  3A1K A;  3MGR B;  1P3I D;  1P3O B;  1KX4 A;  3AZL D;  1U35 C;  4AWL C;  3REL A;  4DRA A;  1P3I B;  4UUZ B;  3O62 C;  3AZL B;  3VH6 W;  5FUG B;  1M18 D;  1H3O A;  1P3P C;  3W96 A;  1M18 B;  3B6G C;  3AZN D;  1A7W A;  2L5A A;  3W98 A;  3AZN B;  3AFA C;  3KWQ D;  1P3M A;  3B0D B;  4X23 D;  1F66 D;  4H9P A;  5C3I C;  5JA4 B;  2NQB D;  3W97 A;  2UWX A;  4XUJ D;  4KHA B;  4X23 B;  5B33 C;  5CPK C;  1F66 B;  4H9N A;  1HQ3 B;  1AOI A;  2NQB B;  4XUJ B;  5BNX B;  2CV5 A;  3A6N A;  4J8U C;  4WJ3 C;  1KU5 A;  5AY8 A;  5AV5 A;  5BS7 A;  3UTA A;  2YFV A;  1KX5 B;  3X1T B;  2HIO C;  1P3L A;  4G92 B;  3AZI C;  4WU8 A;  4WU9 C;  1JFI B;  1BH8 B;  3X1U D;  2JCH A;  5B32 D;  4H9R B;  5B40 D;  5AV8 D;  5B32 B;  4Z66 C;  5B24 D;  5JRG A;  3WTP A;  4J8V D;  3AZK A;  5B40 B;  4JJN A;  3H0M C;  5B1L A;  3NQU A;  5GXQ D;  5AV8 B;  3LEL A;  4J8V B;  2W8S A;  4J8W C;  2RVQ D;  4NFT A;  3REK A;  1B67 A;  5B0Y A;  3MGP A;  1ZLA C;  3AZE C;  3AZH D;  3MNN D;  3AV2 B;  1P3A D;  3AZH B;  3MNN B;  5JRG C;  3AZM A;  2ARO D;  4YM6 D;  4WNN B;  5BNV B;  3REH C;  3KUY A;  2ARO B;  2ZY3 A;  4YM6 B;  3WKJ D;  4YS3 A;  4ZUX A;  3WAA D;  2VQR A;  5DNN C;  3MGS D;  3REJ D;  3WAA B;  3KXB A;  3REJ B;  5E5A A;  3AZJ C;  1Z2C B;  3IP4 C;  3P5J B;  1P3B D;  5DNM B;  2Y2N A;  3KSY A;  1P3K B;  2YFW B;  3X1V C;  4LD9 B;  2Y2K A;  1S32 D;  1P34 B;  3B0B A;  1S32 B;  3REL D;  3LZ0 C;  5GSU A;  3REL B;  5CHL B;  3LZ1 A;  5B31 C;  4Z5T A;  3VH5 T;  4J8X A;  1H3O B;  4QLC C;  3UTB A;  3W98 D;  1P3F B;  2JSS A;  3TU4 A;  1P3M D;  2CWE A;  3W98 B;  1P3O C;  1TAF A;  3W97 D;  4H9P B;  1M19 A;  5GT3 A;  2Y2J A;  5AVB B;  1AOI D;  3B6F C;  3WA9 C;  1M1A A;  5GT0 A;  5AV6 C;  4H9N B;  2CV5 D;  3A6N D;  1AOI B;  5G49 A;  3C1B C;  2F2A C;  2CV5 B;  5AY8 D;  5AV5 D;  3NQJ B;  4G91 C;  3UTA D;  5AY8 B;  4WZS B;  5CPI A;  5AV9 A;  2DF4 C;  3UTA B;  2YFV B;  5AVC C;  1P3L D;  1WWS A;  4E44 A;  3X1S B;  1HQ3 C;  5GT3 C;  1M1A C;  1TZY D;  5KDM A;  1U35 A;  5CP6 C;  1TZY B;  3WTP D;  3AZK D;  4JJN D;  3O62 A;  5B1L D;  3LEL D;  3WTP B;  3AZK B;  3C1C C;  4JJN B;  5B2J C;  3NQU B;  1KX5 C;  3X1T C;  1P3P A;  3REK D;  3B6G A;  5B0Y D;  3MGP D;  3VH5 A;  4R8P C;  2IO5 C;  3VH6 T;  4XZQ C;  4H9O A;  3AFA A;  5B0Y B;  3MGP B;  1KX3 D;  5B32 C;  2ZM5 A;  3EPL A;  3AZM D;  5CPK A;  2BYM A;  5B33 A;  2F8N A;  1KX3 B;  5AV8 C;  3AZF C;  4J8V C;  3AZM B;  3R45 A;  4J8U A;  2FJ7 A;  2BG1 A;  5F99 D;  3KXB D;  4NE5 A;  5E5A D;  1P3G C;  5F99 B;  4CAY B;  3KXB B;  3AV2 C;  2HIO A;  3AZH C;  3KWQ B;  3AZI A;  4WU9 A;  1WWI A;  2HUE C;  5B1M A;  2FJ7 C;  4Z66 A;  3LZ1 D;  3AV1 C;  2PYO A;  4Z2M H;  4H9Q B;  4J8X D;  3LZ1 B;  2F8N H;  5DNM C;  1P3K C;  4J8W A;  1ULY A;  3UTB D;  4J8X B;  4LD9 C;  5BT1 C;  2LY8 A;  3TU4 D;  1P34 C;  3UTB B;  1ZLA A;  3AZE A;  1S32 C;  4DQY B;  1BFM A;  1M19 D;  1ID3 A;  5B1M C;  5B2I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...