3AZMD

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmD00
3TU4A 3MGPD 5B1MB 5E5AD 1P3IB 3VH6W 1P3BC 3LZ0B 2AROB 3NQJB 4YS3C 1KX4C 5B2JC 1M18A 5FUGB 3LZ1B 3AZMD 3W97D 4KGCD 5CHLB 5DNMC 3KWQD 3X1VD 5B1LD 4J8UA 1P3OA 1KX3A 3WTPE 2PYOC 3O62D 4WU9A 3W97A 3MGQB 4KGCA 5AVCB 4WU9D 4XZQA 5AV6C 1M19D 2NZDC 4Z5TD 3VH6A 4J8WB 3AZGB 1S32A 1P3BB 1U35B 4UUZA 1EQZA 5B2JB 4XUJD 3RELD 1HQ3C 5KDMA 1HQ3D 5AV6A 3MGQC 3WTPD 3UT9B 1BH9A 4WU8D 1U35D 1AOIA 3KSYA 5F99D 3LJAA 3WA9B 1P3AD 3REKC 3X1SA 3AZIA 4J8WC 4R8PA 4WU9C 4WU8B 4QLCC 3R45A 3UT9D 3AZHA 1P3PB 1KX4A 3X1SD 5B33D 3UTBC 3MGPA 5B1LC 5B33A 4J8VA 2HIOC 1M18D 3B6GA 3AZMA 3LJAC 3WTPC 3REJB 3LZ0D 2CV5A 5C3IB 3X1UD 1TZYD 5B0YA 1S32B 3V9RB 3MGQA 3W97B 4KGCB 4XUJC 2RVQD 3KXBC 4KUDC 4QLCB 4ZUXB 3WAAA 1M19A 4H9OA 1EQZC 5B31G 1HQ3A 3UTBB 5B31D 4NFTA 5BNXA 5GSUD 2AROA 1BH8B 3MNNA 3AV2A 3WKJA 2HIOB 4LD9D 3LJAB 1H3OB 1TAFA 3B0BA 5B31C 3REIB 3AZKB 5GXQB 2PYOD 5C3IC 3AZNB 4Z66C 5DNMD 4EO5C 3X1VC 1P34B 3W97C 4KGCC 3B0DC 4G92B 1P3GA 4YS3D 1B67A 5DNMA 1TZYC 4G91B 1P3MB 3REHD 4Z2MH 2F8NK 4J8UC 1P3OC 3B0CW 4E45A 1P3BA 3AYWC 3TU4C 5B2JA 3LELD 3AZFC 1F1EA 4YM6C 4Z66B 5B33B 4J8VD 4JJNC 3C1CA 3UTAA 3VH6T 1F66B 3VH5T 5KDMB 5B0YD 3AZIB 5F99C 5AV6B 3MNNB 4R8PB 1BH8A 5JA4B 3A6NA 5JRGB 5CPJD 1R4VA 3W99C 3W98A 3WA9A 5AV5C 5G49A 3W98C 1A7WA 3C1BC 3X1TA 5AV5D 4CSRB 4YM6B 3MNND 5AY8B 5CPJB 3AZMB 4E44A 4ZBJB 3AV1A 3REJA 3AZJD 2NZDD 5AV9B 1F66C 3MGPB 5B0ZC 2NQBB 5BO0B 5B32B 3MGRA 5BS7A 2F8ND 4Z5TB 1ZLAA 3MVDA 5CP6D 5B2JD 5CPIA 5AV8C 5BT1D 3KUYA 1M19B 4AWLB 3WTPB 5B0ZB 3REJC 2JSSA 2L5AA 4Z66A 3X1VA 5CP6B 3AFAA 5B40B 4Z66D 4KUDB 5DNNC 1P3KD 5CPJA 1M1AB 5B1MD 1P3ID 2AROD 5GT3B 3MGSB 3AV2D 5AVBD 5DNND 4AWLC 1ID3B 1EQZD 3WKJD 3RELA 4CSRA 2FJ7C 3KXBD 5FUGA 3REJD 3AZJA 3AZEB 3AZFA 5DNNB 3AZLB 5BT1C 1ZLAD 3W99D 5B2ID 3UTAB 3TU4B 3AZED 3UTBD 4H9SC 1P3FC 4J8WA 2FJ7B 1KU5A 3X1SC 3AFAD 1ULYA 2F8NB 3AFAC 4QLCD 5CPIB 4J8WD 1KX3D 3AZEC 4J8XA 2NQBA 3B0CT 4H9SA 5BNVB 3VH5A 5B40A 3AYWD 3MNNC 1ZLAC 3MGQD 1KX5C 1P3MD 5B24A 4WU9B 3C1BB 2HUEB 3AZHB 2BYKB 4XUJA 3B6FB 3KUYB 5B0YC 5AVBA 1M1AD 4Z5TA 3MVDB 4WNNA 1AOIB 5GT0B 3B6GC 1P3LB 2PYOA 4J8VC 4H9OB 1P3KC 3O62C 1Q9CA 3UTBA 4YS3A 4DRAA 4ZUXC 3UT9A 1AOID 3REHA 1KX4D 4QLCA 2HUEC 3A6NC 5GSUB 4H9PB 3AZHC 2IO5C 5GT3A 3MGSA 5CPKB 3REKA 4J8XB 3LZ0C 3KWQA 5BNVA 3LZ1C 1AOIC 4JJNA 3B6GB 1P3PA 5DNMB 1P34D 5B31B 1KX4B 1WWSA 1P3MA 3O62B 5GXQA 4M6BA 5AVCC 3AZNA 3C1CD 3REID 3AZKD 5GXQD 3B6GD 1TZYB 1S32D 5GSUC 4H9RA 3AZJB 3WAAD 2NZDB 1M1AC 5CPKC 5BNXB 3AYWB 3AZGC 1P3GC 1ID3C 1U35C 5B32D 3X1TD 3AV1C 4CAYA 3C1BD 3X1UC 2YFWA 1HQ3B 1KX5D 4KHAA 3AV1D 1JFIA 3LJAD 3X1TC 1M18C 1P3GD 1P3AA 3WA9C 3REKB 5JRGC 3WAAC 3MGRD 5AY8A 3NQJA 1P3PC 3LZ1A 1P3GB 4JJND 1P3PD 3W98B 3C1CC 5JRGD 5AVBB 3REKD 3LELA 2CV5C 5AY8C 3KWQC 5B1LB 4YM6A 4WNNB 3LZ0A 5GT0A 3AZMC 4J8XD 1M18B 4NE3A 4H9NA 4XZQD 3VH5W 3MGPC 3REHC 3AZLD 3O62A 3AYWA 1ZLAB 5JA4A 5B32C 4NE6A 4ZUXD 3KXBB 3AZGD 5E5AB 1P3KA 3C1CB 4Z5TC 5AVBC 3KWQB 5B32G 3W96A 5B1MC 1P3IC 1U35A 5B31A 3REIC 3AZKC 5GSUA 2F8NG 5B24C 5AVCD 5AV9A 1KX3B 4CAYB 1P3LC 5CPKA 2YFWB 4X23B 3B0DB 5AVCA 3AZNC 1JFIB 4NE5A 5B40C 3X1VB 1P34C 2RVQC 5E5AC 1P3BD 2NZDA 4J8UB 1P3OB 4KUDA 1P3MC 2IO5B 4XZQC 5AV8D 3AZHD 4J8XC 4H9QB 4H9NB 5GT3C 3MGSC 3AZFB 2CV5D 1KX3C 3AZLA 5B33C 3RELB 4X23C 5B1LA 5GT0D 1P3AB 4ZUXA 3UT9C 5B0ZD 3AN2A 1BFMA 5B2IB 1F66D 2BYMB 4R8PC 4KHAB 3AZJC 3UTAD 3AZIC 3W96B 5F99B 3WA9D 4LD9A 4WU8C 1H3OA 4HGAB 5AV5B 3X1SB 3W96D 3RELC 2FJ7A 3X1UB 3AV2B 5CPJC 1KX5A 3WKJB 3AN2C 4ZBJC 2FJ7D 5AV9D 1N1JB 2YFVB 5DNNA 5CPKD 3NQUA 4X23A 1S32C 2NQBC 4XUJB 3WAAB 4X23D 1P3FD 4HGAC 3AZEA 3V9RA 1P3FA 3TU4D 3KUYC 5E5AA 3AN2B 3MVDD 5AV8B 4YS3B 1P34A 3MVDC 3KUYD 3A6ND 3REHB 1P3LA 5CP6C 4H9PA 5B40D 2PYOB 5BS7C 3AZND 1TAFB 3REIA 3AZKA 1F66A 1P3LD 4G91C 5B1MA 1P3IA 5B24D 1HTAA 3A6NB 4H9QA 4LD9C 5AV5A 1B6WA 5B24B 5BO0A 3B6FD 3C1BA 4JJNB 2BYKA 4H9RB 3B6FA 3AZLC 4WZSB 5F99A 4UUZB 2CWEA 2HIOD 4LD9B 3W99B 3UTAC 4Z2MG 4XZQB 5AV8A 3AZID 5G49B 5AY8D 4R8PD 5B2IA 2F8NH 2BYMA 1P3FB 5CP6A 5JRGA 3AFAB 5CPIC 5CPID 3AV1B 2NQBD 3MGRC 4YM6D 2YFVA 1P3AC 3NQUB 5AV9C 3X1TB 5B0ZA 3AN2D 5B2IC 3X1UA 1TZYA 1KX5B 3W96C 4DRBA 4J8UD 1P3OD 3LELB 1N1JA 1ID3A 3W98D 3AZGA 1ID3D 1EQZB 1M1AA 3B6FC 5B32A 3MGRB 2CV5B 3AV2C 3WKJC 5B0YB 1M19C 5AV6D 2AROC 4WV4B 4J8VB 5GXQC 3KXBA 3W99A 5GT0C 1P3KB 4EO5B 3AZFD 4G92C 3LELC 2LY8A 3WTPA 5GT3D 4WU8A 3MGSD 3R45B 2F8NA 1BH9B 2HIOA 4KUDD 3LZ1D 1WWIA
chains in the Genus database with same CATH superfamily
3EPKA 3TU4A 3MGPD 5B1MB 5E5AD 1P3IB 3VH6W 1P3BC 3LZ0B 2AROB 3NQJB 4YS3C 1KX4C 5B2JC 1M18A 5FUGB 3P5JB 3LZ1B 3AZMD 3W97D 4KGCD 5CHLB 5DNMC 3KWQD 3X1VD 5B1LD 4J8UA 1P3OA 1KX3A 3WTPE 2PYOC 3O62D 4WU9A 3W97A 3MGQB 4KGCA 5AVCB 4WU9D 4XZQA 5AV6C 1M19D 2F2AC 3FDDA 2NZDC 4Z5TD 3VH6A 4J8WB 3AZGB 1S32A 1P3BB 1U35B 4UUZA 1EQZA 5B2JB 4XUJD 3RELD 2ZM5A 1HQ3C 1T3UA 1HQ3D 5KDMA 5AV6A 3MGQC 3WTPD 3UT9B 1BH9A 4WU8D 1U35D 1AOIA 3KSYA 5F99D 3LJAA 3WA9B 1P3AD 3REKC 3X1SA 3AZIA 4J8WC 2Y2HA 4R8PA 4WU9C 4WU8B 4QLCC 3R45A 3F6TA 2Y2IA 3UT9D 3AZHA 1P3PB 3X1SD 1KX4A 2Y2QA 5B33D 3UTBC 3MGPA 5B1LC 5B33A 4J8VA 2HIOC 1M18D 3KFUG 3B6GA 3AZMA 3LJAC 3WTPC 3REJB 3LZ0D 2CV5A 5C3IB 3X1UD 1TZYD 5B0YA 1S32B 3V9RB 3MGQA 3W97B 4KGCB 4XUJC 2RVQD 3KXBC 4KUDC 4QLCB 4ZUXB 3WAAA 1M19A 4H9OA 1EQZC 5B31G 1HQ3A 3UTBB 5B31D 4NFTA 5BNXA 2J8PA 2AROA 2ZY2A 1BH8B 5GSUD 3MNNA 3AV2A 3WKJA 2HIOB 4LD9D 3LJAB 1H3OB 1TAFA 3B0BA 5B31C 3REIB 3AZKB 5GXQB 2PYOD 5C3IC 3AZNB 4Z66C 5DNMD 4EO5C 3X1VC 1P34B 3W97C 4KGCC 3B0DC 2Y2PA 4G92B 1P3GA 4YS3D 1B67A 5DNMA 1TZYC 4G91B 1P3MB 3REHD 4Z2MH 2F8NK 4J8UC 1P3OC 3B0CW 4E45A 4DQYB 1P3BA 2JCHA 3AYWC 3TU4C 5B2JA 3LELD 3AZFC 1F1EA 4YM6C 4Z66B 5B33B 4J8VD 4JJNC 3C1CA 3UTAA 3AL0C 3VH6T 1F66B 3VH5T 5KDMB 5B0YD 3AZIB 5F99C 5AV6B 1BH8A 4R8PB 5JA4B 5JRGB 3MNNB 3A6NA 5CPJD 1R4VA 3W99C 3EPLA 3W98A 3WA9A 5AV5C 5G49A 3W98C 1A7WA 3C1BC 3X1TA 5AV5D 4CSRB 4YM6B 3MNND 5AY8B 5CPJB 3AZMB 4E44A 4ZBJB 3AV1A 3REJA 3AZJD 2NZDD 2DQNC 5AV9B 1F66C 3MGPB 5B0ZC 2NQBB 5BO0B 5B32B 3MGRA 2W8SA 5BS7A 2F8ND 4Z5TB 1ZLAA 3MVDA 5CP6D 5B2JD 5CPIA 5AV8C 5BT1D 3A1KA 3EPJA 2Y2OA 3KUYA 4AWLB 1M19B 3WTPB 5B0ZB 3REJC 2JSSA 2L5AA 4Z66A 3X1VA 5CP6B 3AFAA 5B40B 4Z66D 4KUDB 5DNNC 3EG5B 1P3KD 5CPJA 2DF4C 1M1AB 5B1MD 1P3ID 2AROD 2Y2NA 5GT3B 3MGSB 3AV2D 5AVBD 5DNND 4AWLC 1ID3B 1EQZD 3WKJD 3RELA 4CSRA 2FJ7C 2Y2KA 3KXBD 5FUGA 3REJD 3AZJA 3AZEB 3AZFA 5DNNB 3AZLB 5BT1C 1ZLAD 2FFFB 3W99D 5B2ID 2Y2GA 3UTAB 3H0RC 3TU4B 3AZED 3UTBD 4H9SC 2VQRA 1P3FC 4J8WA 2FJ7B 1KU5A 3X1SC 3AFAD 1ULYA 2F8NB 3AFAC 4QLCD 5CPIB 4J8WD 1KX3D 3AZEC 2XD1A 4J8XA 2NQBA 3B0CT 4H9SA 5BNVB 3VH5A 5B40A 3AYWD 3MNNC 1ZLAC 3MGQD 1KX5C 1P3MD 5B24A 4WU9B 3C1BB 2HUEB 3AZHB 2BYKB 4XUJA 3B6FB 3KUYB 5B0YC 5AVBA 1M1AD 4Z5TA 3MVDB 4WNNA 1AOIB 5GT0B 3B6GC 1P3LB 2PYOA 4J8VC 2ZY3A 4H9OB 1P3KC 3O62C 1Q9CA 3UTBA 4YS3A 4DRAA 4ZUXC 3UT9A 1AOID 3REHA 1KX4D 2HUEC 4QLCA 2UWXA 3H0LC 4H9PB 5GSUB 2IO5C 3A6NC 3AZHC 5GT3A 3MGSA 5CPKB 3REKA 4J8XB 3LZ0C 3KWQA 5BNVA 3LZ1C 1AOIC 4JJNA 3B6GB 1P3PA 5DNMB 1P34D 5B31B 1KX4B 1WWSA 1P3MA 3O62B 5GXQA 4M6BA 5AVCC 3AZNA 3C1CD 3REID 3AZKD 5GXQD 3B6GD 2G5HC 1TZYB 1S32D 5GSUC 4H9RA 3AZJB 3WAAD 2NZDB 1M1AC 5CPKC 5BNXB 3AYWB 3AZGC 1P3GC 1ID3C 1U35C 5B32D 3X1TD 3AV1C 4CAYA 3C1BD 3X1UC 2YFWA 1HQ3B 1KX5D 4KHAA 3AV1D 1JFIA 3LJAD 3X1TC 1M18C 1P3GD 1P3AA 3WA9C 3REKB 5JRGC 3WAAC 3MGRD 2XD5A 5AY8A 3NQJA 1P3PC 3LZ1A 1P3GB 4JJND 1P3PD 3W98B 3C1CC 5JRGD 5AVBB 3REKD 3LELA 2CV5C 5AY8C 3KWQC 1PZRA 5B1LB 4YM6A 2BG1A 4WNNB 3LZ0A 5GT0A 3AZMC 4J8XD 1M18B 4NE3A 4H9NA 4XZQD 3VH5W 3A1IA 3MGPC 3REHC 3AZLD 3O62A 3AYWA 1ZLAB 5JA4A 5B32C 4NE6A 4ZUXD 3KXBB 3AZGD 5E5AB 1P3KA 3C1CB 4Z5TC 2Y2LA 5AVBC 2ZY4A 3KWQB 5B32G 3W96A 5B1MC 1P3IC 1U35A 5B31A 3REIC 3AZKC 5GSUA 2F8NG 5B24C 5AVCD 5AV9A 1KX3B 4CAYB 1P3LC 5CPKA 2YFWB 4X23B 3B0DB 5AVCA 3AZNC 1JFIB 4NE5A 5B40C 3X1VB 1P34C 2RVQC 5E5AC 1P3BD 2NZDA 4J8UB 1P3OB 4KUDA 1P3MC 2IO5B 4XZQC 5AV8D 3AZHD 4J8XC 4H9QB 4H9NB 5GT3C 3MGSC 3AZFB 2CV5D 1KX3C 3AZLA 5B33C 3RELB 4X23C 5B1LA 5GT0D 1P3AB 4ZUXA 3UT9C 3IP4C 5B0ZD 3AN2A 1BFMA 5B2IB 1F66D 2BYMB 4R8PC 4KHAB 3AZJC 3UTAD 3AZIC 3W96B 5F99B 3WA9D 2Y2JA 4LD9A 4WU8C 2G5IC 1H3OA 4HGAB 2ZY5A 5AV5B 3X1SB 3W96D 3RELC 2FJ7A 3X1UB 3AV2B 5CPJC 1KX5A 3WKJB 3AN2C 4ZBJC 2FJ7D 5AV9D 1N1JB 2YFVB 5DNNA 5CPKD 3NQUA 4X23A 1S32C 2NQBC 4XUJB 3WAAB 4X23D 1P3FD 4HGAC 3AZEA 3V9RA 1P3FA 3TU4D 3KUYC 5E5AA 3AN2B 3MVDD 5AV8B 4YS3B 1P34A 3MVDC 3KUYD 3A6ND 3EPHA 2RIQA 3REHB 2JE5A 1P3LA 5CP6C 4H9PA 5B40D 2PYOB 5BS7C 3AZND 1TAFB 3REIA 3AZKA 1F66A 1P3LD 4G91C 5B1MA 1P3IA 5B24D 1HTAA 3A6NB 4H9QA 4LD9C 3H0MC 5AV5A 1B6WA 5B24B 5BO0A 3B6FD 4UPKA 3C1BA 4JJNB 2BYKA 4H9RB 3B6FA 3AZLC 4WZSB 5F99A 4UUZB 2CWEA 2HIOD 4LD9B 3W99B 2Y2MA 3UTAC 4Z2MG 4XZQB 5AV8A 3AZID 5G49B 5AY8D 4R8PD 5B2IA 2F8NH 2BYMA 1P3FB 5CP6A 5JRGA 3AFAB 4WJ3C 5CPIC 5CPID 3AV1B 2NQBD 3MGRC 1Z2CB 4YM6D 2YFVA 1P3AC 3NQUB 5AV9C 3X1TB 5B0ZA 3AN2D 5B2IC 3X1UA 1TZYA 1KX5B 3W96C 4DRBA 4J8UD 1P3OD 3LELB 1N1JA 1ID3A 3W98D 3AZGA 1ID3D 1EQZB 1M1AA 3B6FC 5B32A 3MGRB 2CV5B 3AV2C 3WKJC 5B0YB 1M19C 5AV6D 2AROC 4WV4B 4J8VB 5GXQC 3KXBA 3W99A 5GT0C 1P3KB 1W2EA 4EO5B 3AZFD 4G92C 3LELC 2LY8A 3WTPA 5GT3D 4WU8A 3MGSD 3R45B 2F8NA 1BH9B 2HIOA 4KUDD 3LZ1D 1WWIA
chains in the Genus database with same CATH topology
3EPKA 3TU4A 3MGPD 5B1MB 5E5AD 1P3IB 3VH6W 1P3BC 3LZ0B 2AROB 3NQJB 4YS3C 1KX4C 5B2JC 1M18A 5FUGB 3P5JB 3LZ1B 3AZMD 3W97D 4KGCD 5CHLB 5DNMC 3KWQD 3X1VD 5B1LD 4J8UA 1P3OA 1KX3A 3WTPE 2PYOC 3O62D 4WU9A 3W97A 3MGQB 4KGCA 5AVCB 4WU9D 4XZQA 5AV6C 1M19D 2F2AC 3FDDA 2NZDC 4Z5TD 3VH6A 4J8WB 3AZGB 1S32A 1P3BB 1U35B 4UUZA 1EQZA 5B2JB 4XUJD 3RELD 2ZM5A 1HQ3C 1T3UA 1HQ3D 5KDMA 5AV6A 3MGQC 3WTPD 3UT9B 1BH9A 4WU8D 1U35D 1AOIA 3KSYA 5F99D 3LJAA 3WA9B 1P3AD 3REKC 3X1SA 3AZIA 4J8WC 2Y2HA 4R8PA 4WU9C 4WU8B 4QLCC 3R45A 3F6TA 2Y2IA 3UT9D 3AZHA 1P3PB 3X1SD 1KX4A 2Y2QA 5B33D 3UTBC 3MGPA 5B1LC 5B33A 4J8VA 2HIOC 1M18D 3KFUG 3B6GA 3AZMA 3LJAC 3WTPC 3REJB 3LZ0D 2CV5A 5C3IB 3X1UD 1TZYD 5B0YA 1S32B 3V9RB 3MGQA 3W97B 4KGCB 4XUJC 2RVQD 3KXBC 4KUDC 4QLCB 4ZUXB 3WAAA 1M19A 4H9OA 1EQZC 5B31G 1HQ3A 3UTBB 5B31D 4NFTA 5BNXA 2J8PA 2AROA 2ZY2A 1BH8B 5GSUD 3MNNA 3AV2A 3WKJA 2HIOB 4LD9D 3LJAB 1H3OB 1TAFA 3B0BA 5B31C 3REIB 3AZKB 5GXQB 2PYOD 5C3IC 3AZNB 4Z66C 5DNMD 4EO5C 3X1VC 1P34B 3W97C 4KGCC 3B0DC 2Y2PA 4G92B 1P3GA 4YS3D 1B67A 5DNMA 1TZYC 4G91B 1P3MB 3REHD 4Z2MH 2F8NK 4J8UC 1P3OC 3B0CW 4E45A 4DQYB 1P3BA 2JCHA 3AYWC 3TU4C 5B2JA 3LELD 3AZFC 1F1EA 4YM6C 4Z66B 5B33B 4J8VD 4JJNC 3C1CA 3UTAA 3AL0C 3VH6T 1F66B 3VH5T 5KDMB 5B0YD 3AZIB 5F99C 5AV6B 1BH8A 4R8PB 5JA4B 5JRGB 3MNNB 3A6NA 5CPJD 1R4VA 3W99C 3EPLA 3W98A 3WA9A 5AV5C 5G49A 3W98C 1A7WA 3C1BC 3X1TA 5AV5D 4CSRB 4YM6B 3MNND 5AY8B 5CPJB 3AZMB 4E44A 4ZBJB 3AV1A 3REJA 3AZJD 2NZDD 2DQNC 5AV9B 1F66C 3MGPB 5B0ZC 2NQBB 5BO0B 5B32B 3MGRA 2W8SA 5BS7A 2F8ND 4Z5TB 1ZLAA 3MVDA 5CP6D 5B2JD 5CPIA 5AV8C 5BT1D 3A1KA 3EPJA 2Y2OA 3KUYA 4AWLB 1M19B 3WTPB 5B0ZB 3REJC 2JSSA 2L5AA 4Z66A 3X1VA 5CP6B 3AFAA 5B40B 4Z66D 4KUDB 5DNNC 3EG5B 1P3KD 5CPJA 2DF4C 1M1AB 5B1MD 1P3ID 2AROD 2Y2NA 5GT3B 3MGSB 3AV2D 5AVBD 5DNND 4AWLC 1ID3B 1EQZD 3WKJD 3RELA 4CSRA 2FJ7C 2Y2KA 3KXBD 5FUGA 3REJD 3AZJA 3AZEB 3AZFA 5DNNB 3AZLB 5BT1C 1ZLAD 2FFFB 3W99D 5B2ID 2Y2GA 3UTAB 3H0RC 3TU4B 3AZED 3UTBD 4H9SC 2VQRA 1P3FC 4J8WA 2FJ7B 1KU5A 3X1SC 3AFAD 1ULYA 2F8NB 3AFAC 4QLCD 5CPIB 4J8WD 1KX3D 3AZEC 2XD1A 4J8XA 2NQBA 3B0CT 4H9SA 5BNVB 3VH5A 5B40A 3AYWD 3MNNC 1ZLAC 3MGQD 1KX5C 1P3MD 5B24A 4WU9B 3C1BB 2HUEB 3AZHB 2BYKB 4XUJA 3B6FB 3KUYB 5B0YC 5AVBA 1M1AD 4Z5TA 3MVDB 4WNNA 1AOIB 5GT0B 3B6GC 1P3LB 2PYOA 4J8VC 2ZY3A 4H9OB 1P3KC 3O62C 1Q9CA 3UTBA 4YS3A 4DRAA 4ZUXC 3UT9A 1AOID 3REHA 1KX4D 2HUEC 4QLCA 2UWXA 3H0LC 4H9PB 5GSUB 2IO5C 3A6NC 3AZHC 5GT3A 3MGSA 5CPKB 3REKA 4J8XB 3LZ0C 3KWQA 5BNVA 3LZ1C 1AOIC 4JJNA 3B6GB 1P3PA 5DNMB 1P34D 5B31B 1KX4B 1WWSA 1P3MA 3O62B 5GXQA 4M6BA 5AVCC 3AZNA 3C1CD 3REID 3AZKD 5GXQD 3B6GD 2G5HC 1TZYB 1S32D 5GSUC 4H9RA 3AZJB 3WAAD 2NZDB 1M1AC 5CPKC 5BNXB 3AYWB 3AZGC 1P3GC 1ID3C 1U35C 5B32D 3X1TD 3AV1C 4CAYA 3C1BD 3X1UC 2YFWA 1HQ3B 1KX5D 4KHAA 3AV1D 1JFIA 3LJAD 3X1TC 1M18C 1P3GD 1P3AA 3WA9C 3REKB 5JRGC 3WAAC 3MGRD 2XD5A 5AY8A 3NQJA 1P3PC 3LZ1A 1P3GB 4JJND 1P3PD 3W98B 3C1CC 5JRGD 5AVBB 3REKD 3LELA 2CV5C 5AY8C 3KWQC 1PZRA 5B1LB 4YM6A 2BG1A 4WNNB 3LZ0A 5GT0A 3AZMC 4J8XD 1M18B 4NE3A 4H9NA 4XZQD 3VH5W 3A1IA 3MGPC 3REHC 3AZLD 3O62A 3AYWA 1ZLAB 5JA4A 5B32C 4NE6A 4ZUXD 3KXBB 3AZGD 5E5AB 1P3KA 3C1CB 4Z5TC 2Y2LA 5AVBC 2ZY4A 3KWQB 5B32G 3W96A 5B1MC 1P3IC 1U35A 5B31A 3REIC 3AZKC 5GSUA 2F8NG 5B24C 5AVCD 5AV9A 1KX3B 4CAYB 1P3LC 5CPKA 2YFWB 4X23B 3B0DB 5AVCA 3AZNC 1JFIB 4NE5A 5B40C 3X1VB 1P34C 2RVQC 5E5AC 1P3BD 2NZDA 4J8UB 1P3OB 4KUDA 1P3MC 2IO5B 4XZQC 5AV8D 3AZHD 4J8XC 4H9QB 4H9NB 5GT3C 3MGSC 3AZFB 2CV5D 1KX3C 3AZLA 5B33C 3RELB 4X23C 5B1LA 5GT0D 1P3AB 4ZUXA 3UT9C 3IP4C 5B0ZD 3AN2A 1BFMA 5B2IB 1F66D 2BYMB 4R8PC 4KHAB 3AZJC 3UTAD 3AZIC 3W96B 5F99B 3WA9D 2Y2JA 4LD9A 4WU8C 2G5IC 1H3OA 4HGAB 2ZY5A 5AV5B 3X1SB 3W96D 3RELC 2FJ7A 3X1UB 3AV2B 5CPJC 1KX5A 3WKJB 3AN2C 4ZBJC 2FJ7D 5AV9D 1N1JB 2YFVB 5DNNA 5CPKD 3NQUA 4X23A 1S32C 2NQBC 4XUJB 3WAAB 4X23D 1P3FD 4HGAC 3AZEA 3V9RA 1P3FA 3TU4D 3KUYC 5E5AA 3AN2B 3MVDD 5AV8B 4YS3B 1P34A 3MVDC 3KUYD 3A6ND 3EPHA 2RIQA 3REHB 2JE5A 1P3LA 5CP6C 4H9PA 5B40D 2PYOB 5BS7C 3AZND 1TAFB 3REIA 3AZKA 1F66A 1P3LD 4G91C 5B1MA 1P3IA 5B24D 1HTAA 3A6NB 4H9QA 4LD9C 3H0MC 5AV5A 1B6WA 5B24B 5BO0A 3B6FD 4UPKA 3C1BA 4JJNB 2BYKA 4H9RB 3B6FA 3AZLC 4WZSB 5F99A 4UUZB 2CWEA 2HIOD 4LD9B 3W99B 2Y2MA 3UTAC 4Z2MG 4XZQB 5AV8A 3AZID 5G49B 5AY8D 4R8PD 5B2IA 2F8NH 2BYMA 1P3FB 5CP6A 5JRGA 3AFAB 4WJ3C 5CPIC 5CPID 3AV1B 2NQBD 3MGRC 1Z2CB 4YM6D 2YFVA 1P3AC 3NQUB 5AV9C 3X1TB 5B0ZA 3AN2D 5B2IC 3X1UA 1TZYA 1KX5B 3W96C 4DRBA 4J8UD 1P3OD 3LELB 1N1JA 1ID3A 3W98D 3AZGA 1ID3D 1EQZB 1M1AA 3B6FC 5B32A 3MGRB 2CV5B 3AV2C 3WKJC 5B0YB 1M19C 5AV6D 2AROC 4WV4B 4J8VB 5GXQC 3KXBA 3W99A 5GT0C 1P3KB 1W2EA 4EO5B 3AZFD 4G92C 3LELC 2LY8A 3WTPA 5GT3D 4WU8A 3MGSD 3R45B 2F8NA 1BH9B 2HIOA 4KUDD 3LZ1D 1WWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 A;  3MGP D;  5B1M B;  5E5A D;  1P3I B;  3VH6 W;  1P3B C;  3LZ0 B;  2ARO B;  3NQJ B;  4YS3 C;  1KX4 C;  5B2J C;  1M18 A;  5FUG B;  3LZ1 B;  3AZM D;  3W97 D;  4KGC D;  5CHL B;  5DNM C;  3KWQ D;  3X1V D;  5B1L D;  4J8U A;  1P3O A;  1KX3 A;  3WTP E;  2PYO C;  3O62 D;  4WU9 A;  3W97 A;  3MGQ B;  4KGC A;  5AVC B;  4WU9 D;  4XZQ A;  5AV6 C;  1M19 D;  2NZD C;  4Z5T D;  3VH6 A;  4J8W B;  3AZG B;  1S32 A;  1P3B B;  1U35 B;  4UUZ A;  1EQZ A;  5B2J B;  4XUJ D;  3REL D;  1HQ3 C;  5KDM A;  1HQ3 D;  5AV6 A;  3MGQ C;  3WTP D;  3UT9 B;  1BH9 A;  4WU8 D;  1U35 D;  1AOI A;  3KSY A;  5F99 D;  3LJA A;  3WA9 B;  1P3A D;  3REK C;  3X1S A;  3AZI A;  4J8W C;  4R8P A;  4WU9 C;  4WU8 B;  4QLC C;  3R45 A;  3UT9 D;  3AZH A;  1P3P B;  1KX4 A;  3X1S D;  5B33 D;  3UTB C;  3MGP A;  5B1L C;  5B33 A;  4J8V A;  2HIO C;  1M18 D;  3B6G A;  3AZM A;  3LJA C;  3WTP C;  3REJ B;  3LZ0 D;  2CV5 A;  5C3I B;  3X1U D;  1TZY D;  5B0Y A;  1S32 B;  3V9R B;  3MGQ A;  3W97 B;  4KGC B;  4XUJ C;  2RVQ D;  3KXB C;  4KUD C;  4QLC B;  4ZUX B;  3WAA A;  1M19 A;  4H9O A;  1EQZ C;  5B31 G;  1HQ3 A;  3UTB B;  5B31 D;  4NFT A;  5BNX A;  5GSU D;  2ARO A;  1BH8 B;  3MNN A;  3AV2 A;  3WKJ A;  2HIO B;  4LD9 D;  3LJA B;  1H3O B;  1TAF A;  3B0B A;  5B31 C;  3REI B;  3AZK B;  5GXQ B;  2PYO D;  5C3I C;  3AZN B;  4Z66 C;  5DNM D;  4EO5 C;  3X1V C;  1P34 B;  3W97 C;  4KGC C;  3B0D C;  4G92 B;  1P3G A;  4YS3 D;  1B67 A;  5DNM A;  1TZY C;  4G91 B;  1P3M B;  3REH D;  4Z2M H;  2F8N K;  4J8U C;  1P3O C;  3B0C W;  4E45 A;  1P3B A;  3AYW C;  3TU4 C;  5B2J A;  3LEL D;  3AZF C;  1F1E A;  4YM6 C;  4Z66 B;  5B33 B;  4J8V D;  4JJN C;  3C1C A;  3UTA A;  3VH6 T;  1F66 B;  3VH5 T;  5KDM B;  5B0Y D;  3AZI B;  5F99 C;  5AV6 B;  3MNN B;  4R8P B;  1BH8 A;  5JA4 B;  3A6N A;  5JRG B;  5CPJ D;  1R4V A;  3W99 C;  3W98 A;  3WA9 A;  5AV5 C;  5G49 A;  3W98 C;  1A7W A;  3C1B C;  3X1T A;  5AV5 D;  4CSR B;  4YM6 B;  3MNN D;  5AY8 B;  5CPJ B;  3AZM B;  4E44 A;  4ZBJ B;  3AV1 A;  3REJ A;  3AZJ D;  2NZD D;  5AV9 B;  1F66 C;  3MGP B;  5B0Z C;  2NQB B;  5BO0 B;  5B32 B;  3MGR A;  5BS7 A;  2F8N D;  4Z5T B;  1ZLA A;  3MVD A;  5CP6 D;  5B2J D;  5CPI A;  5AV8 C;  5BT1 D;  3KUY A;  1M19 B;  4AWL B;  3WTP B;  5B0Z B;  3REJ C;  2JSS A;  2L5A A;  4Z66 A;  3X1V A;  5CP6 B;  3AFA A;  5B40 B;  4Z66 D;  4KUD B;  5DNN C;  1P3K D;  5CPJ A;  1M1A B;  5B1M D;  1P3I D;  2ARO D;  5GT3 B;  3MGS B;  3AV2 D;  5AVB D;  5DNN D;  4AWL C;  1ID3 B;  1EQZ D;  3WKJ D;  3REL A;  4CSR A;  2FJ7 C;  3KXB D;  5FUG A;  3REJ D;  3AZJ A;  3AZE B;  3AZF A;  5DNN B;  3AZL B;  5BT1 C;  1ZLA D;  3W99 D;  5B2I D;  3UTA B;  3TU4 B;  3AZE D;  3UTB D;  4H9S C;  1P3F C;  4J8W A;  2FJ7 B;  1KU5 A;  3X1S C;  3AFA D;  1ULY A;  2F8N B;  3AFA C;  4QLC D;  5CPI B;  4J8W D;  1KX3 D;  3AZE C;  4J8X A;  2NQB A;  3B0C T;  4H9S A;  5BNV B;  3VH5 A;  5B40 A;  3AYW D;  3MNN C;  1ZLA C;  3MGQ D;  1KX5 C;  1P3M D;  5B24 A;  4WU9 B;  3C1B B;  2HUE B;  3AZH B;  2BYK B;  4XUJ A;  3B6F B;  3KUY B;  5B0Y C;  5AVB A;  1M1A D;  4Z5T A;  3MVD B;  4WNN A;  1AOI B;  5GT0 B;  3B6G C;  1P3L B;  2PYO A;  4J8V C;  4H9O B;  1P3K C;  3O62 C;  1Q9C A;  3UTB A;  4YS3 A;  4DRA A;  4ZUX C;  3UT9 A;  1AOI D;  3REH A;  1KX4 D;  4QLC A;  2HUE C;  3A6N C;  5GSU B;  4H9P B;  3AZH C;  2IO5 C;  5GT3 A;  3MGS A;  5CPK B;  3REK A;  4J8X B;  3LZ0 C;  3KWQ A;  5BNV A;  3LZ1 C;  1AOI C;  4JJN A;  3B6G B;  1P3P A;  5DNM B;  1P34 D;  5B31 B;  1KX4 B;  1WWS A;  1P3M A;  3O62 B;  5GXQ A;  4M6B A;  5AVC C;  3AZN A;  3C1C D;  3REI D;  3AZK D;  5GXQ D;  3B6G D;  1TZY B;  1S32 D;  5GSU C;  4H9R A;  3AZJ B;  3WAA D;  2NZD B;  1M1A C;  5CPK C;  5BNX B;  3AYW B;  3AZG C;  1P3G C;  1ID3 C;  1U35 C;  5B32 D;  3X1T D;  3AV1 C;  4CAY A;  3C1B D;  3X1U C;  2YFW A;  1HQ3 B;  1KX5 D;  4KHA A;  3AV1 D;  1JFI A;  3LJA D;  3X1T C;  1M18 C;  1P3G D;  1P3A A;  3WA9 C;  3REK B;  5JRG C;  3WAA C;  3MGR D;  5AY8 A;  3NQJ A;  1P3P C;  3LZ1 A;  1P3G B;  4JJN D;  1P3P D;  3W98 B;  3C1C C;  5JRG D;  5AVB B;  3REK D;  3LEL A;  2CV5 C;  5AY8 C;  3KWQ C;  5B1L B;  4YM6 A;  4WNN B;  3LZ0 A;  5GT0 A;  3AZM C;  4J8X D;  1M18 B;  4NE3 A;  4H9N A;  4XZQ D;  3VH5 W;  3MGP C;  3REH C;  3AZL D;  3O62 A;  3AYW A;  1ZLA B;  5JA4 A;  5B32 C;  4NE6 A;  4ZUX D;  3KXB B;  3AZG D;  5E5A B;  1P3K A;  3C1C B;  4Z5T C;  5AVB C;  3KWQ B;  5B32 G;  3W96 A;  5B1M C;  1P3I C;  1U35 A;  5B31 A;  3REI C;  3AZK C;  5GSU A;  2F8N G;  5B24 C;  5AVC D;  5AV9 A;  1KX3 B;  4CAY B;  1P3L C;  5CPK A;  2YFW B;  4X23 B;  3B0D B;  5AVC A;  3AZN C;  1JFI B;  4NE5 A;  5B40 C;  3X1V B;  1P34 C;  2RVQ C;  5E5A C;  1P3B D;  2NZD A;  4J8U B;  1P3O B;  4KUD A;  1P3M C;  2IO5 B;  4XZQ C;  5AV8 D;  3AZH D;  4J8X C;  4H9Q B;  4H9N B;  5GT3 C;  3MGS C;  3AZF B;  2CV5 D;  1KX3 C;  3AZL A;  5B33 C;  3REL B;  4X23 C;  5B1L A;  5GT0 D;  1P3A B;  4ZUX A;  3UT9 C;  5B0Z D;  3AN2 A;  1BFM A;  5B2I B;  1F66 D;  2BYM B;  4R8P C;  4KHA B;  3AZJ C;  3UTA D;  3AZI C;  3W96 B;  5F99 B;  3WA9 D;  4LD9 A;  4WU8 C;  1H3O A;  4HGA B;  5AV5 B;  3X1S B;  3W96 D;  3REL C;  2FJ7 A;  3X1U B;  3AV2 B;  5CPJ C;  1KX5 A;  3WKJ B;  3AN2 C;  4ZBJ C;  2FJ7 D;  5AV9 D;  1N1J B;  2YFV B;  5DNN A;  5CPK D;  3NQU A;  4X23 A;  1S32 C;  2NQB C;  4XUJ B;  3WAA B;  4X23 D;  1P3F D;  4HGA C;  3AZE A;  3V9R A;  1P3F A;  3TU4 D;  3KUY C;  5E5A A;  3AN2 B;  3MVD D;  5AV8 B;  4YS3 B;  1P34 A;  3MVD C;  3KUY D;  3A6N D;  3REH B;  1P3L A;  5CP6 C;  4H9P A;  5B40 D;  2PYO B;  5BS7 C;  3AZN D;  1TAF B;  3REI A;  3AZK A;  1F66 A;  1P3L D;  4G91 C;  5B1M A;  1P3I A;  5B24 D;  1HTA A;  3A6N B;  4H9Q A;  4LD9 C;  5AV5 A;  1B6W A;  5B24 B;  5BO0 A;  3B6F D;  3C1B A;  4JJN B;  2BYK A;  4H9R B;  3B6F A;  3AZL C;  4WZS B;  5F99 A;  4UUZ B;  2CWE A;  2HIO D;  4LD9 B;  3W99 B;  3UTA C;  4Z2M G;  4XZQ B;  5AV8 A;  3AZI D;  5G49 B;  5AY8 D;  4R8P D;  5B2I A;  2F8N H;  2BYM A;  1P3F B;  5CP6 A;  5JRG A;  3AFA B;  5CPI C;  5CPI D;  3AV1 B;  2NQB D;  3MGR C;  4YM6 D;  2YFV A;  1P3A C;  3NQU B;  5AV9 C;  3X1T B;  5B0Z A;  3AN2 D;  5B2I C;  3X1U A;  1TZY A;  1KX5 B;  3W96 C;  4DRB A;  4J8U D;  1P3O D;  3LEL B;  1N1J A;  1ID3 A;  3W98 D;  3AZG A;  1ID3 D;  1EQZ B;  1M1A A;  3B6F C;  5B32 A;  3MGR B;  2CV5 B;  3AV2 C;  3WKJ C;  5B0Y B;  1M19 C;  5AV6 D;  2ARO C;  4WV4 B;  4J8V B;  5GXQ C;  3KXB A;  3W99 A;  5GT0 C;  1P3K B;  4EO5 B;  3AZF D;  4G92 C;  3LEL C;  2LY8 A;  3WTP A;  5GT3 D;  4WU8 A;  3MGS D;  3R45 B;  2F8N A;  1BH9 B;  2HIO A;  4KUD D;  3LZ1 D;  1WWI A; 
#chains in the Genus database with same CATH topology
 3EPK A;  3TU4 A;  3MGP D;  5B1M B;  5E5A D;  1P3I B;  3VH6 W;  1P3B C;  3LZ0 B;  2ARO B;  3NQJ B;  4YS3 C;  1KX4 C;  5B2J C;  1M18 A;  5FUG B;  3P5J B;  3LZ1 B;  3AZM D;  3W97 D;  4KGC D;  5CHL B;  5DNM C;  3KWQ D;  3X1V D;  5B1L D;  4J8U A;  1P3O A;  1KX3 A;  3WTP E;  2PYO C;  3O62 D;  4WU9 A;  3W97 A;  3MGQ B;  4KGC A;  5AVC B;  4WU9 D;  4XZQ A;  5AV6 C;  1M19 D;  2F2A C;  3FDD A;  2NZD C;  4Z5T D;  3VH6 A;  4J8W B;  3AZG B;  1S32 A;  1P3B B;  1U35 B;  4UUZ A;  1EQZ A;  5B2J B;  4XUJ D;  3REL D;  2ZM5 A;  1HQ3 C;  1T3U A;  1HQ3 D;  5KDM A;  5AV6 A;  3MGQ C;  3WTP D;  3UT9 B;  1BH9 A;  4WU8 D;  1U35 D;  1AOI A;  3KSY A;  5F99 D;  3LJA A;  3WA9 B;  1P3A D;  3REK C;  3X1S A;  3AZI A;  4J8W C;  2Y2H A;  4R8P A;  4WU9 C;  4WU8 B;  4QLC C;  3R45 A;  3F6T A;  2Y2I A;  3UT9 D;  3AZH A;  1P3P B;  3X1S D;  1KX4 A;  2Y2Q A;  5B33 D;  3UTB C;  3MGP A;  5B1L C;  5B33 A;  4J8V A;  2HIO C;  1M18 D;  3KFU G;  3B6G A;  3AZM A;  3LJA C;  3WTP C;  3REJ B;  3LZ0 D;  2CV5 A;  5C3I B;  3X1U D;  1TZY D;  5B0Y A;  1S32 B;  3V9R B;  3MGQ A;  3W97 B;  4KGC B;  4XUJ C;  2RVQ D;  3KXB C;  4KUD C;  4QLC B;  4ZUX B;  3WAA A;  1M19 A;  4H9O A;  1EQZ C;  5B31 G;  1HQ3 A;  3UTB B;  5B31 D;  4NFT A;  5BNX A;  2J8P A;  2ARO A;  2ZY2 A;  1BH8 B;  5GSU D;  3MNN A;  3AV2 A;  3WKJ A;  2HIO B;  4LD9 D;  3LJA B;  1H3O B;  1TAF A;  3B0B A;  5B31 C;  3REI B;  3AZK B;  5GXQ B;  2PYO D;  5C3I C;  3AZN B;  4Z66 C;  5DNM D;  4EO5 C;  3X1V C;  1P34 B;  3W97 C;  4KGC C;  3B0D C;  2Y2P A;  4G92 B;  1P3G A;  4YS3 D;  1B67 A;  5DNM A;  1TZY C;  4G91 B;  1P3M B;  3REH D;  4Z2M H;  2F8N K;  4J8U C;  1P3O C;  3B0C W;  4E45 A;  4DQY B;  1P3B A;  2JCH A;  3AYW C;  3TU4 C;  5B2J A;  3LEL D;  3AZF C;  1F1E A;  4YM6 C;  4Z66 B;  5B33 B;  4J8V D;  4JJN C;  3C1C A;  3UTA A;  3AL0 C;  3VH6 T;  1F66 B;  3VH5 T;  5KDM B;  5B0Y D;  3AZI B;  5F99 C;  5AV6 B;  1BH8 A;  4R8P B;  5JA4 B;  5JRG B;  3MNN B;  3A6N A;  5CPJ D;  1R4V A;  3W99 C;  3EPL A;  3W98 A;  3WA9 A;  5AV5 C;  5G49 A;  3W98 C;  1A7W A;  3C1B C;  3X1T A;  5AV5 D;  4CSR B;  4YM6 B;  3MNN D;  5AY8 B;  5CPJ B;  3AZM B;  4E44 A;  4ZBJ B;  3AV1 A;  3REJ A;  3AZJ D;  2NZD D;  2DQN C;  5AV9 B;  1F66 C;  3MGP B;  5B0Z C;  2NQB B;  5BO0 B;  5B32 B;  3MGR A;  2W8S A;  5BS7 A;  2F8N D;  4Z5T B;  1ZLA A;  3MVD A;  5CP6 D;  5B2J D;  5CPI A;  5AV8 C;  5BT1 D;  3A1K A;  3EPJ A;  2Y2O A;  3KUY A;  4AWL B;  1M19 B;  3WTP B;  5B0Z B;  3REJ C;  2JSS A;  2L5A A;  4Z66 A;  3X1V A;  5CP6 B;  3AFA A;  5B40 B;  4Z66 D;  4KUD B;  5DNN C;  3EG5 B;  1P3K D;  5CPJ A;  2DF4 C;  1M1A B;  5B1M D;  1P3I D;  2ARO D;  2Y2N A;  5GT3 B;  3MGS B;  3AV2 D;  5AVB D;  5DNN D;  4AWL C;  1ID3 B;  1EQZ D;  3WKJ D;  3REL A;  4CSR A;  2FJ7 C;  2Y2K A;  3KXB D;  5FUG A;  3REJ D;  3AZJ A;  3AZE B;  3AZF A;  5DNN B;  3AZL B;  5BT1 C;  1ZLA D;  2FFF B;  3W99 D;  5B2I D;  2Y2G A;  3UTA B;  3H0R C;  3TU4 B;  3AZE D;  3UTB D;  4H9S C;  2VQR A;  1P3F C;  4J8W A;  2FJ7 B;  1KU5 A;  3X1S C;  3AFA D;  1ULY A;  2F8N B;  3AFA C;  4QLC D;  5CPI B;  4J8W D;  1KX3 D;  3AZE C;  2XD1 A;  4J8X A;  2NQB A;  3B0C T;  4H9S A;  5BNV B;  3VH5 A;  5B40 A;  3AYW D;  3MNN C;  1ZLA C;  3MGQ D;  1KX5 C;  1P3M D;  5B24 A;  4WU9 B;  3C1B B;  2HUE B;  3AZH B;  2BYK B;  4XUJ A;  3B6F B;  3KUY B;  5B0Y C;  5AVB A;  1M1A D;  4Z5T A;  3MVD B;  4WNN A;  1AOI B;  5GT0 B;  3B6G C;  1P3L B;  2PYO A;  4J8V C;  2ZY3 A;  4H9O B;  1P3K C;  3O62 C;  1Q9C A;  3UTB A;  4YS3 A;  4DRA A;  4ZUX C;  3UT9 A;  1AOI D;  3REH A;  1KX4 D;  2HUE C;  4QLC A;  2UWX A;  3H0L C;  4H9P B;  5GSU B;  2IO5 C;  3A6N C;  3AZH C;  5GT3 A;  3MGS A;  5CPK B;  3REK A;  4J8X B;  3LZ0 C;  3KWQ A;  5BNV A;  3LZ1 C;  1AOI C;  4JJN A;  3B6G B;  1P3P A;  5DNM B;  1P34 D;  5B31 B;  1KX4 B;  1WWS A;  1P3M A;  3O62 B;  5GXQ A;  4M6B A;  5AVC C;  3AZN A;  3C1C D;  3REI D;  3AZK D;  5GXQ D;  3B6G D;  2G5H C;  1TZY B;  1S32 D;  5GSU C;  4H9R A;  3AZJ B;  3WAA D;  2NZD B;  1M1A C;  5CPK C;  5BNX B;  3AYW B;  3AZG C;  1P3G C;  1ID3 C;  1U35 C;  5B32 D;  3X1T D;  3AV1 C;  4CAY A;  3C1B D;  3X1U C;  2YFW A;  1HQ3 B;  1KX5 D;  4KHA A;  3AV1 D;  1JFI A;  3LJA D;  3X1T C;  1M18 C;  1P3G D;  1P3A A;  3WA9 C;  3REK B;  5JRG C;  3WAA C;  3MGR D;  2XD5 A;  5AY8 A;  3NQJ A;  1P3P C;  3LZ1 A;  1P3G B;  4JJN D;  1P3P D;  3W98 B;  3C1C C;  5JRG D;  5AVB B;  3REK D;  3LEL A;  2CV5 C;  5AY8 C;  3KWQ C;  1PZR A;  5B1L B;  4YM6 A;  2BG1 A;  4WNN B;  3LZ0 A;  5GT0 A;  3AZM C;  4J8X D;  1M18 B;  4NE3 A;  4H9N A;  4XZQ D;  3VH5 W;  3A1I A;  3MGP C;  3REH C;  3AZL D;  3O62 A;  3AYW A;  1ZLA B;  5JA4 A;  5B32 C;  4NE6 A;  4ZUX D;  3KXB B;  3AZG D;  5E5A B;  1P3K A;  3C1C B;  4Z5T C;  2Y2L A;  5AVB C;  2ZY4 A;  3KWQ B;  5B32 G;  3W96 A;  5B1M C;  1P3I C;  1U35 A;  5B31 A;  3REI C;  3AZK C;  5GSU A;  2F8N G;  5B24 C;  5AVC D;  5AV9 A;  1KX3 B;  4CAY B;  1P3L C;  5CPK A;  2YFW B;  4X23 B;  3B0D B;  5AVC A;  3AZN C;  1JFI B;  4NE5 A;  5B40 C;  3X1V B;  1P34 C;  2RVQ C;  5E5A C;  1P3B D;  2NZD A;  4J8U B;  1P3O B;  4KUD A;  1P3M C;  2IO5 B;  4XZQ C;  5AV8 D;  3AZH D;  4J8X C;  4H9Q B;  4H9N B;  5GT3 C;  3MGS C;  3AZF B;  2CV5 D;  1KX3 C;  3AZL A;  5B33 C;  3REL B;  4X23 C;  5B1L A;  5GT0 D;  1P3A B;  4ZUX A;  3UT9 C;  3IP4 C;  5B0Z D;  3AN2 A;  1BFM A;  5B2I B;  1F66 D;  2BYM B;  4R8P C;  4KHA B;  3AZJ C;  3UTA D;  3AZI C;  3W96 B;  5F99 B;  3WA9 D;  2Y2J A;  4LD9 A;  4WU8 C;  2G5I C;  1H3O A;  4HGA B;  2ZY5 A;  5AV5 B;  3X1S B;  3W96 D;  3REL C;  2FJ7 A;  3X1U B;  3AV2 B;  5CPJ C;  1KX5 A;  3WKJ B;  3AN2 C;  4ZBJ C;  2FJ7 D;  5AV9 D;  1N1J B;  2YFV B;  5DNN A;  5CPK D;  3NQU A;  4X23 A;  1S32 C;  2NQB C;  4XUJ B;  3WAA B;  4X23 D;  1P3F D;  4HGA C;  3AZE A;  3V9R A;  1P3F A;  3TU4 D;  3KUY C;  5E5A A;  3AN2 B;  3MVD D;  5AV8 B;  4YS3 B;  1P34 A;  3MVD C;  3KUY D;  3A6N D;  3EPH A;  2RIQ A;  3REH B;  2JE5 A;  1P3L A;  5CP6 C;  4H9P A;  5B40 D;  2PYO B;  5BS7 C;  3AZN D;  1TAF B;  3REI A;  3AZK A;  1F66 A;  1P3L D;  4G91 C;  5B1M A;  1P3I A;  5B24 D;  1HTA A;  3A6N B;  4H9Q A;  4LD9 C;  3H0M C;  5AV5 A;  1B6W A;  5B24 B;  5BO0 A;  3B6F D;  4UPK A;  3C1B A;  4JJN B;  2BYK A;  4H9R B;  3B6F A;  3AZL C;  4WZS B;  5F99 A;  4UUZ B;  2CWE A;  2HIO D;  4LD9 B;  3W99 B;  2Y2M A;  3UTA C;  4Z2M G;  4XZQ B;  5AV8 A;  3AZI D;  5G49 B;  5AY8 D;  4R8P D;  5B2I A;  2F8N H;  2BYM A;  1P3F B;  5CP6 A;  5JRG A;  3AFA B;  4WJ3 C;  5CPI C;  5CPI D;  3AV1 B;  2NQB D;  3MGR C;  1Z2C B;  4YM6 D;  2YFV A;  1P3A C;  3NQU B;  5AV9 C;  3X1T B;  5B0Z A;  3AN2 D;  5B2I C;  3X1U A;  1TZY A;  1KX5 B;  3W96 C;  4DRB A;  4J8U D;  1P3O D;  3LEL B;  1N1J A;  1ID3 A;  3W98 D;  3AZG A;  1ID3 D;  1EQZ B;  1M1A A;  3B6F C;  5B32 A;  3MGR B;  2CV5 B;  3AV2 C;  3WKJ C;  5B0Y B;  1M19 C;  5AV6 D;  2ARO C;  4WV4 B;  4J8V B;  5GXQ C;  3KXB A;  3W99 A;  5GT0 C;  1P3K B;  1W2E A;  4EO5 B;  3AZF D;  4G92 C;  3LEL C;  2LY8 A;  3WTP A;  5GT3 D;  4WU8 A;  3MGS D;  3R45 B;  2F8N A;  1BH9 B;  2HIO A;  4KUD D;  3LZ1 D;  1WWI A; 
#chains in the Genus database with same CATH homology
 3EPK A;  3TU4 A;  3MGP D;  5B1M B;  5E5A D;  1P3I B;  3VH6 W;  1P3B C;  3LZ0 B;  2ARO B;  3NQJ B;  4YS3 C;  1KX4 C;  5B2J C;  1M18 A;  5FUG B;  3P5J B;  3LZ1 B;  3AZM D;  3W97 D;  4KGC D;  5CHL B;  5DNM C;  3KWQ D;  3X1V D;  5B1L D;  4J8U A;  1P3O A;  1KX3 A;  3WTP E;  2PYO C;  3O62 D;  4WU9 A;  3W97 A;  3MGQ B;  4KGC A;  5AVC B;  4WU9 D;  4XZQ A;  5AV6 C;  1M19 D;  2F2A C;  3FDD A;  2NZD C;  4Z5T D;  3VH6 A;  4J8W B;  3AZG B;  1S32 A;  1P3B B;  1U35 B;  4UUZ A;  1EQZ A;  5B2J B;  4XUJ D;  3REL D;  2ZM5 A;  1HQ3 C;  1T3U A;  1HQ3 D;  5KDM A;  5AV6 A;  3MGQ C;  3WTP D;  3UT9 B;  1BH9 A;  4WU8 D;  1U35 D;  1AOI A;  3KSY A;  5F99 D;  3LJA A;  3WA9 B;  1P3A D;  3REK C;  3X1S A;  3AZI A;  4J8W C;  2Y2H A;  4R8P A;  4WU9 C;  4WU8 B;  4QLC C;  3R45 A;  3F6T A;  2Y2I A;  3UT9 D;  3AZH A;  1P3P B;  3X1S D;  1KX4 A;  2Y2Q A;  5B33 D;  3UTB C;  3MGP A;  5B1L C;  5B33 A;  4J8V A;  2HIO C;  1M18 D;  3KFU G;  3B6G A;  3AZM A;  3LJA C;  3WTP C;  3REJ B;  3LZ0 D;  2CV5 A;  5C3I B;  3X1U D;  1TZY D;  5B0Y A;  1S32 B;  3V9R B;  3MGQ A;  3W97 B;  4KGC B;  4XUJ C;  2RVQ D;  3KXB C;  4KUD C;  4QLC B;  4ZUX B;  3WAA A;  1M19 A;  4H9O A;  1EQZ C;  5B31 G;  1HQ3 A;  3UTB B;  5B31 D;  4NFT A;  5BNX A;  2J8P A;  2ARO A;  2ZY2 A;  1BH8 B;  5GSU D;  3MNN A;  3AV2 A;  3WKJ A;  2HIO B;  4LD9 D;  3LJA B;  1H3O B;  1TAF A;  3B0B A;  5B31 C;  3REI B;  3AZK B;  5GXQ B;  2PYO D;  5C3I C;  3AZN B;  4Z66 C;  5DNM D;  4EO5 C;  3X1V C;  1P34 B;  3W97 C;  4KGC C;  3B0D C;  2Y2P A;  4G92 B;  1P3G A;  4YS3 D;  1B67 A;  5DNM A;  1TZY C;  4G91 B;  1P3M B;  3REH D;  4Z2M H;  2F8N K;  4J8U C;  1P3O C;  3B0C W;  4E45 A;  4DQY B;  1P3B A;  2JCH A;  3AYW C;  3TU4 C;  5B2J A;  3LEL D;  3AZF C;  1F1E A;  4YM6 C;  4Z66 B;  5B33 B;  4J8V D;  4JJN C;  3C1C A;  3UTA A;  3AL0 C;  3VH6 T;  1F66 B;  3VH5 T;  5KDM B;  5B0Y D;  3AZI B;  5F99 C;  5AV6 B;  1BH8 A;  4R8P B;  5JA4 B;  5JRG B;  3MNN B;  3A6N A;  5CPJ D;  1R4V A;  3W99 C;  3EPL A;  3W98 A;  3WA9 A;  5AV5 C;  5G49 A;  3W98 C;  1A7W A;  3C1B C;  3X1T A;  5AV5 D;  4CSR B;  4YM6 B;  3MNN D;  5AY8 B;  5CPJ B;  3AZM B;  4E44 A;  4ZBJ B;  3AV1 A;  3REJ A;  3AZJ D;  2NZD D;  2DQN C;  5AV9 B;  1F66 C;  3MGP B;  5B0Z C;  2NQB B;  5BO0 B;  5B32 B;  3MGR A;  2W8S A;  5BS7 A;  2F8N D;  4Z5T B;  1ZLA A;  3MVD A;  5CP6 D;  5B2J D;  5CPI A;  5AV8 C;  5BT1 D;  3A1K A;  3EPJ A;  2Y2O A;  3KUY A;  4AWL B;  1M19 B;  3WTP B;  5B0Z B;  3REJ C;  2JSS A;  2L5A A;  4Z66 A;  3X1V A;  5CP6 B;  3AFA A;  5B40 B;  4Z66 D;  4KUD B;  5DNN C;  3EG5 B;  1P3K D;  5CPJ A;  2DF4 C;  1M1A B;  5B1M D;  1P3I D;  2ARO D;  2Y2N A;  5GT3 B;  3MGS B;  3AV2 D;  5AVB D;  5DNN D;  4AWL C;  1ID3 B;  1EQZ D;  3WKJ D;  3REL A;  4CSR A;  2FJ7 C;  2Y2K A;  3KXB D;  5FUG A;  3REJ D;  3AZJ A;  3AZE B;  3AZF A;  5DNN B;  3AZL B;  5BT1 C;  1ZLA D;  2FFF B;  3W99 D;  5B2I D;  2Y2G A;  3UTA B;  3H0R C;  3TU4 B;  3AZE D;  3UTB D;  4H9S C;  2VQR A;  1P3F C;  4J8W A;  2FJ7 B;  1KU5 A;  3X1S C;  3AFA D;  1ULY A;  2F8N B;  3AFA C;  4QLC D;  5CPI B;  4J8W D;  1KX3 D;  3AZE C;  2XD1 A;  4J8X A;  2NQB A;  3B0C T;  4H9S A;  5BNV B;  3VH5 A;  5B40 A;  3AYW D;  3MNN C;  1ZLA C;  3MGQ D;  1KX5 C;  1P3M D;  5B24 A;  4WU9 B;  3C1B B;  2HUE B;  3AZH B;  2BYK B;  4XUJ A;  3B6F B;  3KUY B;  5B0Y C;  5AVB A;  1M1A D;  4Z5T A;  3MVD B;  4WNN A;  1AOI B;  5GT0 B;  3B6G C;  1P3L B;  2PYO A;  4J8V C;  2ZY3 A;  4H9O B;  1P3K C;  3O62 C;  1Q9C A;  3UTB A;  4YS3 A;  4DRA A;  4ZUX C;  3UT9 A;  1AOI D;  3REH A;  1KX4 D;  2HUE C;  4QLC A;  2UWX A;  3H0L C;  4H9P B;  5GSU B;  2IO5 C;  3A6N C;  3AZH C;  5GT3 A;  3MGS A;  5CPK B;  3REK A;  4J8X B;  3LZ0 C;  3KWQ A;  5BNV A;  3LZ1 C;  1AOI C;  4JJN A;  3B6G B;  1P3P A;  5DNM B;  1P34 D;  5B31 B;  1KX4 B;  1WWS A;  1P3M A;  3O62 B;  5GXQ A;  4M6B A;  5AVC C;  3AZN A;  3C1C D;  3REI D;  3AZK D;  5GXQ D;  3B6G D;  2G5H C;  1TZY B;  1S32 D;  5GSU C;  4H9R A;  3AZJ B;  3WAA D;  2NZD B;  1M1A C;  5CPK C;  5BNX B;  3AYW B;  3AZG C;  1P3G C;  1ID3 C;  1U35 C;  5B32 D;  3X1T D;  3AV1 C;  4CAY A;  3C1B D;  3X1U C;  2YFW A;  1HQ3 B;  1KX5 D;  4KHA A;  3AV1 D;  1JFI A;  3LJA D;  3X1T C;  1M18 C;  1P3G D;  1P3A A;  3WA9 C;  3REK B;  5JRG C;  3WAA C;  3MGR D;  2XD5 A;  5AY8 A;  3NQJ A;  1P3P C;  3LZ1 A;  1P3G B;  4JJN D;  1P3P D;  3W98 B;  3C1C C;  5JRG D;  5AVB B;  3REK D;  3LEL A;  2CV5 C;  5AY8 C;  3KWQ C;  1PZR A;  5B1L B;  4YM6 A;  2BG1 A;  4WNN B;  3LZ0 A;  5GT0 A;  3AZM C;  4J8X D;  1M18 B;  4NE3 A;  4H9N A;  4XZQ D;  3VH5 W;  3A1I A;  3MGP C;  3REH C;  3AZL D;  3O62 A;  3AYW A;  1ZLA B;  5JA4 A;  5B32 C;  4NE6 A;  4ZUX D;  3KXB B;  3AZG D;  5E5A B;  1P3K A;  3C1C B;  4Z5T C;  2Y2L A;  5AVB C;  2ZY4 A;  3KWQ B;  5B32 G;  3W96 A;  5B1M C;  1P3I C;  1U35 A;  5B31 A;  3REI C;  3AZK C;  5GSU A;  2F8N G;  5B24 C;  5AVC D;  5AV9 A;  1KX3 B;  4CAY B;  1P3L C;  5CPK A;  2YFW B;  4X23 B;  3B0D B;  5AVC A;  3AZN C;  1JFI B;  4NE5 A;  5B40 C;  3X1V B;  1P34 C;  2RVQ C;  5E5A C;  1P3B D;  2NZD A;  4J8U B;  1P3O B;  4KUD A;  1P3M C;  2IO5 B;  4XZQ C;  5AV8 D;  3AZH D;  4J8X C;  4H9Q B;  4H9N B;  5GT3 C;  3MGS C;  3AZF B;  2CV5 D;  1KX3 C;  3AZL A;  5B33 C;  3REL B;  4X23 C;  5B1L A;  5GT0 D;  1P3A B;  4ZUX A;  3UT9 C;  3IP4 C;  5B0Z D;  3AN2 A;  1BFM A;  5B2I B;  1F66 D;  2BYM B;  4R8P C;  4KHA B;  3AZJ C;  3UTA D;  3AZI C;  3W96 B;  5F99 B;  3WA9 D;  2Y2J A;  4LD9 A;  4WU8 C;  2G5I C;  1H3O A;  4HGA B;  2ZY5 A;  5AV5 B;  3X1S B;  3W96 D;  3REL C;  2FJ7 A;  3X1U B;  3AV2 B;  5CPJ C;  1KX5 A;  3WKJ B;  3AN2 C;  4ZBJ C;  2FJ7 D;  5AV9 D;  1N1J B;  2YFV B;  5DNN A;  5CPK D;  3NQU A;  4X23 A;  1S32 C;  2NQB C;  4XUJ B;  3WAA B;  4X23 D;  1P3F D;  4HGA C;  3AZE A;  3V9R A;  1P3F A;  3TU4 D;  3KUY C;  5E5A A;  3AN2 B;  3MVD D;  5AV8 B;  4YS3 B;  1P34 A;  3MVD C;  3KUY D;  3A6N D;  3EPH A;  2RIQ A;  3REH B;  2JE5 A;  1P3L A;  5CP6 C;  4H9P A;  5B40 D;  2PYO B;  5BS7 C;  3AZN D;  1TAF B;  3REI A;  3AZK A;  1F66 A;  1P3L D;  4G91 C;  5B1M A;  1P3I A;  5B24 D;  1HTA A;  3A6N B;  4H9Q A;  4LD9 C;  3H0M C;  5AV5 A;  1B6W A;  5B24 B;  5BO0 A;  3B6F D;  4UPK A;  3C1B A;  4JJN B;  2BYK A;  4H9R B;  3B6F A;  3AZL C;  4WZS B;  5F99 A;  4UUZ B;  2CWE A;  2HIO D;  4LD9 B;  3W99 B;  2Y2M A;  3UTA C;  4Z2M G;  4XZQ B;  5AV8 A;  3AZI D;  5G49 B;  5AY8 D;  4R8P D;  5B2I A;  2F8N H;  2BYM A;  1P3F B;  5CP6 A;  5JRG A;  3AFA B;  4WJ3 C;  5CPI C;  5CPI D;  3AV1 B;  2NQB D;  3MGR C;  1Z2C B;  4YM6 D;  2YFV A;  1P3A C;  3NQU B;  5AV9 C;  3X1T B;  5B0Z A;  3AN2 D;  5B2I C;  3X1U A;  1TZY A;  1KX5 B;  3W96 C;  4DRB A;  4J8U D;  1P3O D;  3LEL B;  1N1J A;  1ID3 A;  3W98 D;  3AZG A;  1ID3 D;  1EQZ B;  1M1A A;  3B6F C;  5B32 A;  3MGR B;  2CV5 B;  3AV2 C;  3WKJ C;  5B0Y B;  1M19 C;  5AV6 D;  2ARO C;  4WV4 B;  4J8V B;  5GXQ C;  3KXB A;  3W99 A;  5GT0 C;  1P3K B;  1W2E A;  4EO5 B;  3AZF D;  4G92 C;  3LEL C;  2LY8 A;  3WTP A;  5GT3 D;  4WU8 A;  3MGS D;  3R45 B;  2F8N A;  1BH9 B;  2HIO A;  4KUD D;  3LZ1 D;  1WWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...