3AZMD

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmD00
5CPJC 3AV1B 3MGQA 5JA4A 5B1LA 3TU4C 5DNMA 5B24D 1F1EA 3UTBC 1P3FA 5BS7C 2NQBA 5GT3B 4YM6A 4EO5B 1M18D 4XZQB 1TZYB 3KWQC 5AV5C 5B1LD 3W98B 3AZHD 5B1MD 1P3AC 1P3BB 5DNMD 3UT9B 1P3FD 4G92B 2F8NB 5B24C 1WWIA 4NE5A 4QLCA 3MNNB 1P3OB 1ZLAA 3KUYB 1N1JB 5GT0A 5B32A 1P3IB 3AZHC 5B1MC 2PYOD 2NZDB 4J8VB 3REIB 5DNMC 4Z5TA 1P3FC 3LELD 3WA9B 4M6BA 1ZLAD 5CPKB 3AN2A 1BH8A 1M1AD 5B2IB 5F99B 4WU8A 1P3PA 2PYOC 4Z5TD 1KX5C 5B0ZB 5KDMA 4H9RB 3LELC 3UTAA 3AN2D 1ZLAC 1M1AC 4WU8D 1AOID 3MGPA 4X23B 3X1SA 1P3PD 3AZIB 4UUZB 3AZKA 3AZJB 3X1TD 1U35B 4NFTA 5E5AC 5CP6C 3W96D 4Z5TC 3UTAD 3AV1D 3O62B 4H9QB 3AZEA 3AN2C 4J8XA 1B6WA 5CHLB 3AFAB 4KUDC 3MGPD 4WU8C 2YFWB 3AZKD 1AOIC 5AV6A 4XZQD 3X1TC 5FUGB 3W96C 3LZ0A 4R8PB 3W98D 3AZED 3UTAC 4J8XD 3AV1C 2FJ7B 4CSRB 1P3BD 3B0DB 4H9PA 3UT9D 2CV5B 1R4VA 4AWLC 3B6GA 3AZKC 3W97A 5GT3C 1P3OD 3KUYD 4Z2MH 4XZQC 3MVDB 5GSUA 4KHAA 4J8WB 3W98C 3AZEC 2NZDD 5AV8A 2YFVA 1P3BC 1JFIA 3B0CT 1WWSA 3UT9C 3B6GD 4XUJB 3AYWB 3AZLB 1P3OC 5GSUD 4H9OB 3KUYC 5B33A 4JJNA 3AZNA 2AROB 4G91B 3V9RA 1M19B 1P3IC 1P3LA 1ULYA 2NZDC 5B0ZD 4YS3A 2HIOA 3VH6W 3REHB 5G49A 3C1BB 5B33D 4JJND 5B32G 5GSUC 1H3OA 4X23D 5C3IB 5B0ZC 2HIOD 1KX3A 3WTPB 4H9NB 4HGAB 3WKJB 3AFAD 1EQZA 5B40B 3AZFA 5AY8B 3B0BA 4X23C 4ZUXA 3RELA 3AZIC 5B0YA 3C1CA 5CPJA 2HIOC 5BNXB 3TU4A 3AZGD 2CV5D 4Z66B 3AFAC 3AZFD 3UTBA 3RELD 4ZUXD 5B2JB 5B0YD 3KWQA 3W99B 4R8PC 1P3AA 2FJ7C 3KXBB 5AVCA 3UTBD 1P3KB 2CV5C 3RELC 4XUJD 3R45B 4ZUXC 3AZLD 5B0YC 3KWQD 4CAYA 1P3AD 2AROD 3NQJA 3AZHA 2BYMB 3NQUA 5B1MA 3VH5T 5AVCD 4J8WC 4LD9B 1BFMA 3REHD 4XUJC 3MGRB 3AYWC 3AZLC 3LZ1B 5BNVA 2AROC 4KGCB 5AVCC 2PYOA 5B31B 5JRGA 1KX5A 5AVBA 3AZMB 4ZBJB 3LELA 3REJB 3REHC 3C1BC 1M1AA 5AV9B 4WU9A 5B40D 3X1UB 5JRGD 1KX5D 1TAFA 5E5AA 5CP6A 3WAAA 5AVBD 4Z2MG 1ID3A 3WTPC 4Z66D 4KUDA 4WU9D 3A6NB 1HQ3B 1AOIA 1P3MA 5B40C 1P3GB 5E5AD 5CP6D 3REKA 2F8NH 3AV2B 3X1TA 3KSYA 5JRGC 3MGSB 3WAAD 3W96A 5AVBC 1ID3D 3AV1A 4KUDD 2HUEB 4Z66C 4WU9C 1P3MD 3REKD 5GT3A 5B2JC 3WAAC 4XZQA 1TZYA 5CPIB 1S32B 3W99C 3B0CW 1ID3C 3W98A 1P3BA 3UT9A 1P3MC 5GT3D 2IO5B 3REKC 3MGRD 1TZYD 1P3OA 5GXQB 3KUYA 3X1VB 1N1JA 1KU5A 1P3IA 2NZDA 3B6FB 5B31D 3VH6A 5BO0B 3REIA 2F8ND 2RVQD 3AZMD 3WA9A 3MNND 2JSSA 4EO5C 5CPKA 3MGRC 1F66B 1TZYC 5B2IA 4WNNB 3X1UD 1P3ID 4J8VD 3REID 5B31C 5B0ZA 4G92C 3WA9D 4H9SC 2RVQC 3AZMC 5CPKD 3MNNC 3A6ND 5B2ID 2BYKB 1HQ3D 5F99D 5DNNB 5AV9C 4X23A 1P34B 3X1UC 3AZIA 4UUZA 3AZJA 1KX4B 3MGSD 4DRBA 4J8VC 3REIC 1U35A 3WA9C 3O62A 1Q9CA 4H9QA 5CPKC 3AFAA 3A6NC 3LJAB 5B2IC 5F99C 1HQ3C 3AZID 2YFWA 3AZJD 1U35D 3MGSC 3O62D 5FUGA 4R8PA 2FJ7A 4CSRA 3AZGB 5AV5B 2CV5A 2HUEC 1BH9B 4E45A 3AZJC 1U35C 5B24B 3VH5W 4R8PD 4J8UB 3MVDA 3X1VD 2FJ7D 3O62C 4J8WA 1M18B 3B6FD 3MGQB 5JA4B 5B1LB 4XUJA 5DNMB 3AYWA 1P3FB 3AZLA 1F66D 3MVDD 4H9OA 5GXQC 2NQBB 4YM6B 4J8WD 2AROA 3X1VC 1M19A 2F8NG 3B0DC 3B6FC 3AYWD 3REHA 2F8NK 3C1BA 1F66C 3MVDC 1M19D 4QLCB 1ZLAB 5GT0B 5B32B 3WTPA 3C1BD 4H9NA 4Z5TB 3WKJA 3LJAD 3AN2B 1BH8B 4G91C 5B40A 5AY8A 1M19C 1A7WA 4WU8B 1P3PB 3WTPD 5BNXA 3WKJD 5KDMB 4Z66A 3UTAB 5AY8D 3LJAC 5B2JA 5C3IC 4AWLB 3MGPB 3X1SB 4J8UD 3AZKB 3W99A 4HGAC 3KXBA 3MGQD 3AZGC 3WKJC 1P3KA 3W96B 3AZEB 4J8XB 5B2JD 5AY8C 3R45A 3W99D 2NQBD 4YM6D 5AV6B 4J8UC 3KXBD 2BYMA 3LZ0B 1P3KD 1M18C 4DRAA 3MGQC 1B67A 5B1LC 4LD9A 4H9PB 3MGRA 3B6GB 3LZ1A 2NQBC 3W97B 4QLCD 4YM6C 3KXBC 5GSUB 4KGCA 5GT0D 4KHAB 5B31A 5B32D 1P3KC 2F8NA 4LD9D 4H9SA 5AV8B 2YFVB 3AZMA 1JFIB 3REJA 3MNNA 4WZSB 3LZ1D 5AV9A 4QLCC 3X1UA 4KGCD 5B33B 4JJNB 3AZNB 4J8VA 3V9RB 5GT0C 5B32C 1P3LB 4LD9C 3REJD 4YS3B 2HIOB 5AV9D 3LZ1C 3A6NA 5G49B 1HQ3A 5F99A 1P3GA 1H3OB 4WV4B 4KGCC 3AV2A 3X1SD 3MGSA 2LY8A 1P3PC 4H9RA 4ZBJC 3REJC 1KX3B 1P3GD 3VH5A 5BT1D 1EQZB 3AV2D 3AZFB 3MGPC 3RELB 3X1SC 4ZUXB 5CPIA 5AV6D 1S32A 5B0YB 3C1CB 5CPJB 3LZ0D 3TU4B 4J8XC 1P3GC 5BT1C 3UTBB 3AV2C 5CPID 5GXQA 1S32D 3W97D 3X1VA 5AV6C 3KWQB 3B6FA 3LZ0C 5BO0A 1P3AB 3WTPE 1HTAA 5AV8D 5AVCB 5GXQD 5CPIC 1F66A 3B6GC 1S32C 2L5AA 3W97C 4WNNA 4NE6A 4CAYB 3AZND 3NQJB 3AZHB 5B1MB 3NQUB 1P3LD 5AV8C 4YS3D 2IO5C 2BYKA 5DNNA 5B31G 1P34A 4JJNC 5B33C 1KX4A 3AZNC 5BNVB 1P3LC 2PYOB 5JRGB 1KX5B 4YS3C 5AVBB 1KX3D 3LELB 5DNND 1P34D 3LJAA 1M1AB 1EQZD 1KX4D 3VH6T 4WU9B 4NE3A 2CWEA 5BS7A 1TAFB 5E5AB 5CP6B 3C1CD 3WAAB 5CPJD 3AZGA 5AV5A 1ID3B 1KX3C 3TU4D 1BH9A 5DNNC 1P34C 4KUDB 1EQZC 1KX4C 1AOIB 5B24A 1P3MB 3AZFC 4J8UA 3REKB 3X1TB 4E44A 3C1CC 5AV5D 1M18A
chains in the Genus database with same CATH superfamily
5CPJC 3AV1B 3MGQA 5JA4A 5B1LA 2Y2JA 3TU4C 5DNMA 5B24D 1F1EA 3UTBC 1P3FA 5BS7C 2NQBA 5GT3B 4YM6A 4EO5B 1M18D 4XZQB 1TZYB 3KWQC 3A1IA 3P5JB 5AV5C 5B1LD 3W98B 3AZHD 5B1MD 1P3AC 1P3BB 5DNMD 3UT9B 1P3FD 4G92B 1W2EA 2F8NB 5B24C 3EPLA 1WWIA 3KFUG 4NE5A 4QLCA 3MNNB 1Z2CB 1P3OB 1ZLAA 3H0LC 3KUYB 1N1JB 5GT0A 5B32A 1P3IB 3AZHC 5B1MC 2PYOD 2NZDB 3EG5B 4J8VB 3REIB 5DNMC 4Z5TA 1P3FC 3LELD 3WA9B 4M6BA 1ZLAD 5CPKB 3AN2A 1BH8A 1M1AD 5B2IB 5F99B 4WU8A 1P3PA 2PYOC 4Z5TD 1KX5C 5B0ZB 5KDMA 4H9RB 3LELC 3UTAA 3AN2D 1ZLAC 1M1AC 4WU8D 1AOID 3MGPA 4X23B 3X1SA 1P3PD 3AZIB 4UUZB 3AZKA 3AZJB 3X1TD 1U35B 4NFTA 5E5AC 2J8PA 5CP6C 3W96D 4Z5TC 3UTAD 3AV1D 3O62B 2JCHA 2G5HC 4H9QB 3AZEA 3AN2C 4J8XA 1B6WA 5CHLB 2UWXA 2Y2NA 3AFAB 3MGPD 4KUDC 4WU8C 2YFWB 3AZKD 1AOIC 5AV6A 4XZQD 3X1TC 5FUGB 3W96C 3LZ0A 4R8PB 3W98D 3AZED 3EPKA 4J8XD 3UTAC 3AV1C 4CSRB 1P3BD 2FJ7B 3B0DB 4H9PA 3UT9D 2CV5B 1R4VA 4AWLC 3B6GA 4UPKA 3AZKC 3W97A 5GT3C 1P3OD 3KUYD 4Z2MH 4XZQC 3MVDB 5GSUA 4KHAA 4J8WB 3W98C 3AZEC 2NZDD 5AV8A 2YFVA 1P3BC 1JFIA 3B0CT 1WWSA 3UT9C 3B6GD 4XUJB 3AYWB 3AZLB 1P3OC 5GSUD 4H9OB 3KUYC 5B33A 4JJNA 3AZNA 2AROB 4G91B 3V9RA 3H0MC 1M19B 1P3IC 1P3LA 1ULYA 2NZDC 2ZY4A 5B0ZD 4YS3A 2HIOA 3VH6W 3REHB 5G49A 3C1BB 5B33D 4JJND 5B32G 5GSUC 1H3OA 4X23D 5C3IB 5B0ZC 2HIOD 1KX3A 3WTPB 4H9NB 4HGAB 3WKJB 3AFAD 1EQZA 5B40B 3AZFA 5AY8B 3B0BA 4X23C 4ZUXA 3RELA 3AZIC 5B0YA 3C1CA 5CPJA 2HIOC 5BNXB 3TU4A 3AZGD 2CV5D 4Z66B 3AFAC 3AZFD 3UTBA 3RELD 4ZUXD 5B2JB 5B0YD 2DF4C 3EPJA 3KWQA 3W99B 4R8PC 1P3AA 2FJ7C 3KXBB 5AVCA 3UTBD 1P3KB 2CV5C 3RELC 2VQRA 4XUJD 3R45B 4ZUXC 3AZLD 5B0YC 3KWQD 4CAYA 2Y2QA 2ZY3A 1P3AD 2AROD 3NQJA 2ZY5A 3AZHA 2BYMB 1T3UA 3NQUA 5B1MA 3VH5T 5AVCD 4J8WC 4LD9B 1BFMA 3REHD 4XUJC 3MGRB 3AYWC 3AZLC 3LZ1B 5BNVA 2AROC 4KGCB 5AVCC 2PYOA 5B31B 5JRGA 1KX5A 5AVBA 3AZMB 4ZBJB 3LELA 3REJB 3REHC 3C1BC 1M1AA 5AV9B 4WU9A 5B40D 3X1UB 4DQYB 5JRGD 1KX5D 1TAFA 5E5AA 2Y2KA 5CP6A 3WAAA 5AVBD 4Z2MG 2W8SA 1ID3A 3WTPC 4Z66D 4KUDA 4WU9D 3A6NB 1HQ3B 1AOIA 1P3MA 5B40C 1P3GB 5E5AD 5CP6D 2FFFB 2XD1A 3REKA 3AV2B 3KSYA 5JRGC 3MGSB 3X1TA 3WAAD 3W96A 5AVBC 1ID3D 3AV1A 4KUDD 2HUEB 4Z66C 4WU9C 1P3MD 3REKD 5GT3A 5B2JC 3WAAC 4XZQA 1TZYA 5CPIB 1S32B 3W99C 3B0CW 1ID3C 3W98A 1P3BA 3UT9A 1P3MC 5GT3D 2IO5B 3REKC 3MGRD 1TZYD 3F6TA 1P3OA 5GXQB 3KUYA 3X1VB 1N1JA 1KU5A 2F8NH 1P3IA 2NZDA 3B6FB 5B31D 3VH6A 5BO0B 3REIA 2F8ND 2RVQD 3AZMD 3WA9A 3MNND 2JSSA 4EO5C 5CPKA 3MGRC 1F66B 1TZYC 5B2IA 4WNNB 3X1UD 1P3ID 4J8VD 3REID 5B31C 5B0ZA 4G92C 3WA9D 4H9SC 2RVQC 3AZMC 3EPHA 5CPKD 3MNNC 3A6ND 5B2ID 2BYKB 1HQ3D 5F99D 5DNNB 5AV9C 4X23A 1P34B 3X1UC 3AZIA 4UUZA 3AZJA 1KX4B 3MGSD 4DRBA 4J8VC 3REIC 1U35A 2DQNC 3WA9C 3O62A 1Q9CA 4H9QA 5CPKC 3AFAA 3A6NC 3LJAB 5B2IC 5F99C 1HQ3C 3AZID 2YFWA 3AZJD 1U35D 3MGSC 3O62D 5FUGA 4R8PA 2FJ7A 4CSRA 3AZGB 5AV5B 2CV5A 2HUEC 1BH9B 4E45A 3AZJC 1U35C 5B24B 3VH5W 4R8PD 4J8UB 3MVDA 3X1VD 2FJ7D 3O62C 4J8WA 1M18B 3B6FD 3MGQB 5JA4B 5B1LB 4XUJA 5DNMB 3AYWA 1P3FB 3AZLA 1F66D 3MVDD 4H9OA 5GXQC 2NQBB 4YM6B 4J8WD 2AROA 3X1VC 1M19A 2F8NG 2BG1A 3B0DC 3B6FC 3AYWD 3REHA 2F8NK 3C1BA 1F66C 3MVDC 1M19D 4QLCB 1ZLAB 2Y2GA 2Y2IA 5GT0B 5B32B 3WTPA 3C1BD 4H9NA 4Z5TB 2Y2HA 3WKJA 3LJAD 3AN2B 1BH8B 4G91C 5B40A 5AY8A 1M19C 1PZRA 1A7WA 4WU8B 1P3PB 2Y2MA 3WTPD 5BNXA 3WKJD 5KDMB 4Z66A 3UTAB 5AY8D 3LJAC 5B2JA 5C3IC 4AWLB 3MGPB 3X1SB 4J8UD 3AZKB 3W99A 4HGAC 3KXBA 2RIQA 3MGQD 3AZGC 3WKJC 1P3KA 3W96B 3AZEB 4J8XB 5B2JD 5AY8C 3R45A 3W99D 2NQBD 2F2AC 4YM6D 5AV6B 4J8UC 3KXBD 2BYMA 3LZ0B 1P3KD 1M18C 4DRAA 3MGQC 1B67A 5B1LC 4LD9A 4H9PB 3MGRA 2ZY2A 3B6GB 4WJ3C 3LZ1A 2NQBC 3W97B 4QLCD 4YM6C 3H0RC 3KXBC 5GSUB 4KGCA 3FDDA 5GT0D 4KHAB 5B31A 5B32D 1P3KC 2F8NA 4LD9D 4H9SA 5AV8B 2YFVB 3AZMA 1JFIB 3REJA 3MNNA 4WZSB 3LZ1D 5AV9A 4QLCC 3X1UA 4KGCD 5B33B 4JJNB 3AZNB 4J8VA 3V9RB 5GT0C 5B32C 1P3LB 4LD9C 3REJD 4YS3B 2HIOB 5AV9D 3LZ1C 3A6NA 5G49B 1HQ3A 5F99A 1P3GA 1H3OB 4WV4B 4KGCC 3AV2A 3X1SD 3MGSA 2LY8A 1P3PC 4H9RA 4ZBJC 3REJC 2Y2PA 1KX3B 1P3GD 3VH5A 5BT1D 1EQZB 3AV2D 3AZFB 3MGPC 3RELB 3X1SC 4ZUXB 5CPIA 5AV6D 1S32A 5B0YB 3C1CB 3IP4C 3LZ0D 5CPJB 3TU4B 4J8XC 1P3GC 5BT1C 3UTBB 3AV2C 5CPID 5GXQA 1S32D 3W97D 3X1VA 5AV6C 2JE5A 3KWQB 3B6FA 3LZ0C 2G5IC 5BO0A 2ZM5A 1P3AB 3WTPE 1HTAA 3AL0C 5AV8D 2Y2OA 5AVCB 5GXQD 5CPIC 1F66A 3B6GC 1S32C 2L5AA 3W97C 4WNNA 4NE6A 4CAYB 3AZND 3NQJB 3AZHB 5B1MB 3NQUB 1P3LD 5AV8C 4YS3D 2IO5C 2BYKA 5DNNA 5B31G 1P34A 2XD5A 4JJNC 5B33C 1KX4A 3AZNC 5BNVB 3A1KA 1P3LC 2PYOB 5JRGB 1KX5B 4YS3C 5AVBB 1KX3D 3LELB 5DNND 1P34D 3LJAA 1M1AB 1EQZD 1KX4D 3VH6T 4WU9B 4NE3A 2CWEA 2Y2LA 5BS7A 1TAFB 5E5AB 5CP6B 3C1CD 3WAAB 5CPJD 3AZGA 5AV5A 1ID3B 1KX3C 3TU4D 1BH9A 5DNNC 1P34C 4KUDB 1EQZC 1KX4C 1AOIB 5B24A 1P3MB 3AZFC 4J8UA 3REKB 3X1TB 4E44A 3C1CC 5AV5D 1M18A
chains in the Genus database with same CATH topology
5CPJC 3AV1B 3MGQA 5JA4A 5B1LA 2Y2JA 3TU4C 5DNMA 5B24D 1F1EA 3UTBC 1P3FA 5BS7C 2NQBA 5GT3B 4YM6A 4EO5B 1M18D 4XZQB 1TZYB 3KWQC 3A1IA 3P5JB 5AV5C 5B1LD 3W98B 3AZHD 5B1MD 1P3AC 1P3BB 5DNMD 3UT9B 1P3FD 4G92B 1W2EA 2F8NB 5B24C 3EPLA 1WWIA 3KFUG 4NE5A 4QLCA 3MNNB 1Z2CB 1P3OB 1ZLAA 3H0LC 3KUYB 1N1JB 5GT0A 5B32A 1P3IB 3AZHC 5B1MC 2PYOD 2NZDB 3EG5B 4J8VB 3REIB 5DNMC 4Z5TA 1P3FC 3LELD 3WA9B 4M6BA 1ZLAD 5CPKB 3AN2A 1BH8A 1M1AD 5B2IB 5F99B 4WU8A 1P3PA 2PYOC 4Z5TD 1KX5C 5B0ZB 5KDMA 4H9RB 3LELC 3UTAA 3AN2D 1ZLAC 1M1AC 4WU8D 1AOID 3MGPA 4X23B 3X1SA 1P3PD 3AZIB 4UUZB 3AZKA 3AZJB 3X1TD 1U35B 4NFTA 5E5AC 2J8PA 5CP6C 3W96D 4Z5TC 3UTAD 3AV1D 3O62B 2JCHA 2G5HC 4H9QB 3AZEA 3AN2C 4J8XA 1B6WA 5CHLB 2UWXA 2Y2NA 3AFAB 3MGPD 4KUDC 4WU8C 2YFWB 3AZKD 1AOIC 5AV6A 4XZQD 3X1TC 5FUGB 3W96C 3LZ0A 4R8PB 3W98D 3AZED 3EPKA 4J8XD 3UTAC 3AV1C 4CSRB 1P3BD 2FJ7B 3B0DB 4H9PA 3UT9D 2CV5B 1R4VA 4AWLC 3B6GA 4UPKA 3AZKC 3W97A 5GT3C 1P3OD 3KUYD 4Z2MH 4XZQC 3MVDB 5GSUA 4KHAA 4J8WB 3W98C 3AZEC 2NZDD 5AV8A 2YFVA 1P3BC 1JFIA 3B0CT 1WWSA 3UT9C 3B6GD 4XUJB 3AYWB 3AZLB 1P3OC 5GSUD 4H9OB 3KUYC 5B33A 4JJNA 3AZNA 2AROB 4G91B 3V9RA 3H0MC 1M19B 1P3IC 1P3LA 1ULYA 2NZDC 2ZY4A 5B0ZD 4YS3A 2HIOA 3VH6W 3REHB 5G49A 3C1BB 5B33D 4JJND 5B32G 5GSUC 1H3OA 4X23D 5C3IB 5B0ZC 2HIOD 1KX3A 3WTPB 4H9NB 4HGAB 3WKJB 3AFAD 1EQZA 5B40B 3AZFA 5AY8B 3B0BA 4X23C 4ZUXA 3RELA 3AZIC 5B0YA 3C1CA 5CPJA 2HIOC 5BNXB 3TU4A 3AZGD 2CV5D 4Z66B 3AFAC 3AZFD 3UTBA 3RELD 4ZUXD 5B2JB 5B0YD 2DF4C 3EPJA 3KWQA 3W99B 4R8PC 1P3AA 2FJ7C 3KXBB 5AVCA 3UTBD 1P3KB 2CV5C 3RELC 2VQRA 4XUJD 3R45B 4ZUXC 3AZLD 5B0YC 3KWQD 4CAYA 2Y2QA 2ZY3A 1P3AD 2AROD 3NQJA 2ZY5A 3AZHA 2BYMB 1T3UA 3NQUA 5B1MA 3VH5T 5AVCD 4J8WC 4LD9B 1BFMA 3REHD 4XUJC 3MGRB 3AYWC 3AZLC 3LZ1B 5BNVA 2AROC 4KGCB 5AVCC 2PYOA 5B31B 5JRGA 1KX5A 5AVBA 3AZMB 4ZBJB 3LELA 3REJB 3REHC 3C1BC 1M1AA 5AV9B 4WU9A 5B40D 3X1UB 4DQYB 5JRGD 1KX5D 1TAFA 5E5AA 2Y2KA 5CP6A 3WAAA 5AVBD 4Z2MG 2W8SA 1ID3A 3WTPC 4Z66D 4KUDA 4WU9D 3A6NB 1HQ3B 1AOIA 1P3MA 5B40C 1P3GB 5E5AD 5CP6D 2FFFB 2XD1A 3REKA 3AV2B 3KSYA 5JRGC 3MGSB 3X1TA 3WAAD 3W96A 5AVBC 1ID3D 3AV1A 4KUDD 2HUEB 4Z66C 4WU9C 1P3MD 3REKD 5GT3A 5B2JC 3WAAC 4XZQA 1TZYA 5CPIB 1S32B 3W99C 3B0CW 1ID3C 3W98A 1P3BA 3UT9A 1P3MC 5GT3D 2IO5B 3REKC 3MGRD 1TZYD 3F6TA 1P3OA 5GXQB 3KUYA 3X1VB 1N1JA 1KU5A 2F8NH 1P3IA 2NZDA 3B6FB 5B31D 3VH6A 5BO0B 3REIA 2F8ND 2RVQD 3AZMD 3WA9A 3MNND 2JSSA 4EO5C 5CPKA 3MGRC 1F66B 1TZYC 5B2IA 4WNNB 3X1UD 1P3ID 4J8VD 3REID 5B31C 5B0ZA 4G92C 3WA9D 4H9SC 2RVQC 3AZMC 3EPHA 5CPKD 3MNNC 3A6ND 5B2ID 2BYKB 1HQ3D 5F99D 5DNNB 5AV9C 4X23A 1P34B 3X1UC 3AZIA 4UUZA 3AZJA 1KX4B 3MGSD 4DRBA 4J8VC 3REIC 1U35A 2DQNC 3WA9C 3O62A 1Q9CA 4H9QA 5CPKC 3AFAA 3A6NC 3LJAB 5B2IC 5F99C 1HQ3C 3AZID 2YFWA 3AZJD 1U35D 3MGSC 3O62D 5FUGA 4R8PA 2FJ7A 4CSRA 3AZGB 5AV5B 2CV5A 2HUEC 1BH9B 4E45A 3AZJC 1U35C 5B24B 3VH5W 4R8PD 4J8UB 3MVDA 3X1VD 2FJ7D 3O62C 4J8WA 1M18B 3B6FD 3MGQB 5JA4B 5B1LB 4XUJA 5DNMB 3AYWA 1P3FB 3AZLA 1F66D 3MVDD 4H9OA 5GXQC 2NQBB 4YM6B 4J8WD 2AROA 3X1VC 1M19A 2F8NG 2BG1A 3B0DC 3B6FC 3AYWD 3REHA 2F8NK 3C1BA 1F66C 3MVDC 1M19D 4QLCB 1ZLAB 2Y2GA 2Y2IA 5GT0B 5B32B 3WTPA 3C1BD 4H9NA 4Z5TB 2Y2HA 3WKJA 3LJAD 3AN2B 1BH8B 4G91C 5B40A 5AY8A 1M19C 1PZRA 1A7WA 4WU8B 1P3PB 2Y2MA 3WTPD 5BNXA 3WKJD 5KDMB 4Z66A 3UTAB 5AY8D 3LJAC 5B2JA 5C3IC 4AWLB 3MGPB 3X1SB 4J8UD 3AZKB 3W99A 4HGAC 3KXBA 2RIQA 3MGQD 3AZGC 3WKJC 1P3KA 3W96B 3AZEB 4J8XB 5B2JD 5AY8C 3R45A 3W99D 2NQBD 2F2AC 4YM6D 5AV6B 4J8UC 3KXBD 2BYMA 3LZ0B 1P3KD 1M18C 4DRAA 3MGQC 1B67A 5B1LC 4LD9A 4H9PB 3MGRA 2ZY2A 3B6GB 4WJ3C 3LZ1A 2NQBC 3W97B 4QLCD 4YM6C 3H0RC 3KXBC 5GSUB 4KGCA 3FDDA 5GT0D 4KHAB 5B31A 5B32D 1P3KC 2F8NA 4LD9D 4H9SA 5AV8B 2YFVB 3AZMA 1JFIB 3REJA 3MNNA 4WZSB 3LZ1D 5AV9A 4QLCC 3X1UA 4KGCD 5B33B 4JJNB 3AZNB 4J8VA 3V9RB 5GT0C 5B32C 1P3LB 4LD9C 3REJD 4YS3B 2HIOB 5AV9D 3LZ1C 3A6NA 5G49B 1HQ3A 5F99A 1P3GA 1H3OB 4WV4B 4KGCC 3AV2A 3X1SD 3MGSA 2LY8A 1P3PC 4H9RA 4ZBJC 3REJC 2Y2PA 1KX3B 1P3GD 3VH5A 5BT1D 1EQZB 3AV2D 3AZFB 3MGPC 3RELB 3X1SC 4ZUXB 5CPIA 5AV6D 1S32A 5B0YB 3C1CB 3IP4C 3LZ0D 5CPJB 3TU4B 4J8XC 1P3GC 5BT1C 3UTBB 3AV2C 5CPID 5GXQA 1S32D 3W97D 3X1VA 5AV6C 2JE5A 3KWQB 3B6FA 3LZ0C 2G5IC 5BO0A 2ZM5A 1P3AB 3WTPE 1HTAA 3AL0C 5AV8D 2Y2OA 5AVCB 5GXQD 5CPIC 1F66A 3B6GC 1S32C 2L5AA 3W97C 4WNNA 4NE6A 4CAYB 3AZND 3NQJB 3AZHB 5B1MB 3NQUB 1P3LD 5AV8C 4YS3D 2IO5C 2BYKA 5DNNA 5B31G 1P34A 2XD5A 4JJNC 5B33C 1KX4A 3AZNC 5BNVB 3A1KA 1P3LC 2PYOB 5JRGB 1KX5B 4YS3C 5AVBB 1KX3D 3LELB 5DNND 1P34D 3LJAA 1M1AB 1EQZD 1KX4D 3VH6T 4WU9B 4NE3A 2CWEA 2Y2LA 5BS7A 1TAFB 5E5AB 5CP6B 3C1CD 3WAAB 5CPJD 3AZGA 5AV5A 1ID3B 1KX3C 3TU4D 1BH9A 5DNNC 1P34C 4KUDB 1EQZC 1KX4C 1AOIB 5B24A 1P3MB 3AZFC 4J8UA 3REKB 3X1TB 4E44A 3C1CC 5AV5D 1M18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ C;  3AV1 B;  3MGQ A;  5JA4 A;  5B1L A;  3TU4 C;  5DNM A;  5B24 D;  1F1E A;  3UTB C;  1P3F A;  5BS7 C;  2NQB A;  5GT3 B;  4YM6 A;  4EO5 B;  1M18 D;  4XZQ B;  1TZY B;  3KWQ C;  5AV5 C;  5B1L D;  3W98 B;  3AZH D;  5B1M D;  1P3A C;  1P3B B;  5DNM D;  3UT9 B;  1P3F D;  4G92 B;  2F8N B;  5B24 C;  1WWI A;  4NE5 A;  4QLC A;  3MNN B;  1P3O B;  1ZLA A;  3KUY B;  1N1J B;  5GT0 A;  5B32 A;  1P3I B;  3AZH C;  5B1M C;  2PYO D;  2NZD B;  4J8V B;  3REI B;  5DNM C;  4Z5T A;  1P3F C;  3LEL D;  3WA9 B;  4M6B A;  1ZLA D;  5CPK B;  3AN2 A;  1BH8 A;  1M1A D;  5B2I B;  5F99 B;  4WU8 A;  1P3P A;  2PYO C;  4Z5T D;  1KX5 C;  5B0Z B;  5KDM A;  4H9R B;  3LEL C;  3UTA A;  3AN2 D;  1ZLA C;  1M1A C;  4WU8 D;  1AOI D;  3MGP A;  4X23 B;  3X1S A;  1P3P D;  3AZI B;  4UUZ B;  3AZK A;  3AZJ B;  3X1T D;  1U35 B;  4NFT A;  5E5A C;  5CP6 C;  3W96 D;  4Z5T C;  3UTA D;  3AV1 D;  3O62 B;  4H9Q B;  3AZE A;  3AN2 C;  4J8X A;  1B6W A;  5CHL B;  3AFA B;  4KUD C;  3MGP D;  4WU8 C;  2YFW B;  3AZK D;  1AOI C;  5AV6 A;  4XZQ D;  3X1T C;  5FUG B;  3W96 C;  3LZ0 A;  4R8P B;  3W98 D;  3AZE D;  3UTA C;  4J8X D;  3AV1 C;  2FJ7 B;  4CSR B;  1P3B D;  3B0D B;  4H9P A;  3UT9 D;  2CV5 B;  1R4V A;  4AWL C;  3B6G A;  3AZK C;  3W97 A;  5GT3 C;  1P3O D;  3KUY D;  4Z2M H;  4XZQ C;  3MVD B;  5GSU A;  4KHA A;  4J8W B;  3W98 C;  3AZE C;  2NZD D;  5AV8 A;  2YFV A;  1P3B C;  1JFI A;  3B0C T;  1WWS A;  3UT9 C;  3B6G D;  4XUJ B;  3AYW B;  3AZL B;  1P3O C;  5GSU D;  4H9O B;  3KUY C;  5B33 A;  4JJN A;  3AZN A;  2ARO B;  4G91 B;  3V9R A;  1M19 B;  1P3I C;  1P3L A;  1ULY A;  2NZD C;  5B0Z D;  4YS3 A;  2HIO A;  3VH6 W;  3REH B;  5G49 A;  3C1B B;  5B33 D;  4JJN D;  5B32 G;  5GSU C;  1H3O A;  4X23 D;  5C3I B;  5B0Z C;  2HIO D;  1KX3 A;  3WTP B;  4H9N B;  4HGA B;  3WKJ B;  3AFA D;  1EQZ A;  5B40 B;  3AZF A;  5AY8 B;  3B0B A;  4X23 C;  4ZUX A;  3REL A;  3AZI C;  5B0Y A;  3C1C A;  5CPJ A;  2HIO C;  5BNX B;  3TU4 A;  3AZG D;  2CV5 D;  4Z66 B;  3AFA C;  3AZF D;  3UTB A;  3REL D;  4ZUX D;  5B2J B;  5B0Y D;  3KWQ A;  3W99 B;  4R8P C;  1P3A A;  2FJ7 C;  3KXB B;  5AVC A;  3UTB D;  1P3K B;  2CV5 C;  3REL C;  4XUJ D;  3R45 B;  4ZUX C;  3AZL D;  5B0Y C;  3KWQ D;  4CAY A;  1P3A D;  2ARO D;  3NQJ A;  3AZH A;  2BYM B;  3NQU A;  5B1M A;  3VH5 T;  5AVC D;  4J8W C;  4LD9 B;  1BFM A;  3REH D;  4XUJ C;  3MGR B;  3AYW C;  3AZL C;  3LZ1 B;  5BNV A;  2ARO C;  4KGC B;  5AVC C;  2PYO A;  5B31 B;  5JRG A;  1KX5 A;  5AVB A;  3AZM B;  4ZBJ B;  3LEL A;  3REJ B;  3REH C;  3C1B C;  1M1A A;  5AV9 B;  4WU9 A;  5B40 D;  3X1U B;  5JRG D;  1KX5 D;  1TAF A;  5E5A A;  5CP6 A;  3WAA A;  5AVB D;  4Z2M G;  1ID3 A;  3WTP C;  4Z66 D;  4KUD A;  4WU9 D;  3A6N B;  1HQ3 B;  1AOI A;  1P3M A;  5B40 C;  1P3G B;  5E5A D;  5CP6 D;  3REK A;  2F8N H;  3AV2 B;  3X1T A;  3KSY A;  5JRG C;  3MGS B;  3WAA D;  3W96 A;  5AVB C;  1ID3 D;  3AV1 A;  4KUD D;  2HUE B;  4Z66 C;  4WU9 C;  1P3M D;  3REK D;  5GT3 A;  5B2J C;  3WAA C;  4XZQ A;  1TZY A;  5CPI B;  1S32 B;  3W99 C;  3B0C W;  1ID3 C;  3W98 A;  1P3B A;  3UT9 A;  1P3M C;  5GT3 D;  2IO5 B;  3REK C;  3MGR D;  1TZY D;  1P3O A;  5GXQ B;  3KUY A;  3X1V B;  1N1J A;  1KU5 A;  1P3I A;  2NZD A;  3B6F B;  5B31 D;  3VH6 A;  5BO0 B;  3REI A;  2F8N D;  2RVQ D;  3AZM D;  3WA9 A;  3MNN D;  2JSS A;  4EO5 C;  5CPK A;  3MGR C;  1F66 B;  1TZY C;  5B2I A;  4WNN B;  3X1U D;  1P3I D;  4J8V D;  3REI D;  5B31 C;  5B0Z A;  4G92 C;  3WA9 D;  4H9S C;  2RVQ C;  3AZM C;  5CPK D;  3MNN C;  3A6N D;  5B2I D;  2BYK B;  1HQ3 D;  5F99 D;  5DNN B;  5AV9 C;  4X23 A;  1P34 B;  3X1U C;  3AZI A;  4UUZ A;  3AZJ A;  1KX4 B;  3MGS D;  4DRB A;  4J8V C;  3REI C;  1U35 A;  3WA9 C;  3O62 A;  1Q9C A;  4H9Q A;  5CPK C;  3AFA A;  3A6N C;  3LJA B;  5B2I C;  5F99 C;  1HQ3 C;  3AZI D;  2YFW A;  3AZJ D;  1U35 D;  3MGS C;  3O62 D;  5FUG A;  4R8P A;  2FJ7 A;  4CSR A;  3AZG B;  5AV5 B;  2CV5 A;  2HUE C;  1BH9 B;  4E45 A;  3AZJ C;  1U35 C;  5B24 B;  3VH5 W;  4R8P D;  4J8U B;  3MVD A;  3X1V D;  2FJ7 D;  3O62 C;  4J8W A;  1M18 B;  3B6F D;  3MGQ B;  5JA4 B;  5B1L B;  4XUJ A;  5DNM B;  3AYW A;  1P3F B;  3AZL A;  1F66 D;  3MVD D;  4H9O A;  5GXQ C;  2NQB B;  4YM6 B;  4J8W D;  2ARO A;  3X1V C;  1M19 A;  2F8N G;  3B0D C;  3B6F C;  3AYW D;  3REH A;  2F8N K;  3C1B A;  1F66 C;  3MVD C;  1M19 D;  4QLC B;  1ZLA B;  5GT0 B;  5B32 B;  3WTP A;  3C1B D;  4H9N A;  4Z5T B;  3WKJ A;  3LJA D;  3AN2 B;  1BH8 B;  4G91 C;  5B40 A;  5AY8 A;  1M19 C;  1A7W A;  4WU8 B;  1P3P B;  3WTP D;  5BNX A;  3WKJ D;  5KDM B;  4Z66 A;  3UTA B;  5AY8 D;  3LJA C;  5B2J A;  5C3I C;  4AWL B;  3MGP B;  3X1S B;  4J8U D;  3AZK B;  3W99 A;  4HGA C;  3KXB A;  3MGQ D;  3AZG C;  3WKJ C;  1P3K A;  3W96 B;  3AZE B;  4J8X B;  5B2J D;  5AY8 C;  3R45 A;  3W99 D;  2NQB D;  4YM6 D;  5AV6 B;  4J8U C;  3KXB D;  2BYM A;  3LZ0 B;  1P3K D;  1M18 C;  4DRA A;  3MGQ C;  1B67 A;  5B1L C;  4LD9 A;  4H9P B;  3MGR A;  3B6G B;  3LZ1 A;  2NQB C;  3W97 B;  4QLC D;  4YM6 C;  3KXB C;  5GSU B;  4KGC A;  5GT0 D;  4KHA B;  5B31 A;  5B32 D;  1P3K C;  2F8N A;  4LD9 D;  4H9S A;  5AV8 B;  2YFV B;  3AZM A;  1JFI B;  3REJ A;  3MNN A;  4WZS B;  3LZ1 D;  5AV9 A;  4QLC C;  3X1U A;  4KGC D;  5B33 B;  4JJN B;  3AZN B;  4J8V A;  3V9R B;  5GT0 C;  5B32 C;  1P3L B;  4LD9 C;  3REJ D;  4YS3 B;  2HIO B;  5AV9 D;  3LZ1 C;  3A6N A;  5G49 B;  1HQ3 A;  5F99 A;  1P3G A;  1H3O B;  4WV4 B;  4KGC C;  3AV2 A;  3X1S D;  3MGS A;  2LY8 A;  1P3P C;  4H9R A;  4ZBJ C;  3REJ C;  1KX3 B;  1P3G D;  3VH5 A;  5BT1 D;  1EQZ B;  3AV2 D;  3AZF B;  3MGP C;  3REL B;  3X1S C;  4ZUX B;  5CPI A;  5AV6 D;  1S32 A;  5B0Y B;  3C1C B;  5CPJ B;  3LZ0 D;  3TU4 B;  4J8X C;  1P3G C;  5BT1 C;  3UTB B;  3AV2 C;  5CPI D;  5GXQ A;  1S32 D;  3W97 D;  3X1V A;  5AV6 C;  3KWQ B;  3B6F A;  3LZ0 C;  5BO0 A;  1P3A B;  3WTP E;  1HTA A;  5AV8 D;  5AVC B;  5GXQ D;  5CPI C;  1F66 A;  3B6G C;  1S32 C;  2L5A A;  3W97 C;  4WNN A;  4NE6 A;  4CAY B;  3AZN D;  3NQJ B;  3AZH B;  5B1M B;  3NQU B;  1P3L D;  5AV8 C;  4YS3 D;  2IO5 C;  2BYK A;  5DNN A;  5B31 G;  1P34 A;  4JJN C;  5B33 C;  1KX4 A;  3AZN C;  5BNV B;  1P3L C;  2PYO B;  5JRG B;  1KX5 B;  4YS3 C;  5AVB B;  1KX3 D;  3LEL B;  5DNN D;  1P34 D;  3LJA A;  1M1A B;  1EQZ D;  1KX4 D;  3VH6 T;  4WU9 B;  4NE3 A;  2CWE A;  5BS7 A;  1TAF B;  5E5A B;  5CP6 B;  3C1C D;  3WAA B;  5CPJ D;  3AZG A;  5AV5 A;  1ID3 B;  1KX3 C;  3TU4 D;  1BH9 A;  5DNN C;  1P34 C;  4KUD B;  1EQZ C;  1KX4 C;  1AOI B;  5B24 A;  1P3M B;  3AZF C;  4J8U A;  3REK B;  3X1T B;  4E44 A;  3C1C C;  5AV5 D;  1M18 A; 
#chains in the Genus database with same CATH topology
 5CPJ C;  3AV1 B;  3MGQ A;  5JA4 A;  5B1L A;  2Y2J A;  3TU4 C;  5DNM A;  5B24 D;  1F1E A;  3UTB C;  1P3F A;  5BS7 C;  2NQB A;  5GT3 B;  4YM6 A;  4EO5 B;  1M18 D;  4XZQ B;  1TZY B;  3KWQ C;  3A1I A;  3P5J B;  5AV5 C;  5B1L D;  3W98 B;  3AZH D;  5B1M D;  1P3A C;  1P3B B;  5DNM D;  3UT9 B;  1P3F D;  4G92 B;  1W2E A;  2F8N B;  5B24 C;  3EPL A;  1WWI A;  3KFU G;  4NE5 A;  4QLC A;  3MNN B;  1Z2C B;  1P3O B;  1ZLA A;  3H0L C;  3KUY B;  1N1J B;  5GT0 A;  5B32 A;  1P3I B;  3AZH C;  5B1M C;  2PYO D;  2NZD B;  3EG5 B;  4J8V B;  3REI B;  5DNM C;  4Z5T A;  1P3F C;  3LEL D;  3WA9 B;  4M6B A;  1ZLA D;  5CPK B;  3AN2 A;  1BH8 A;  1M1A D;  5B2I B;  5F99 B;  4WU8 A;  1P3P A;  2PYO C;  4Z5T D;  1KX5 C;  5B0Z B;  5KDM A;  4H9R B;  3LEL C;  3UTA A;  3AN2 D;  1ZLA C;  1M1A C;  4WU8 D;  1AOI D;  3MGP A;  4X23 B;  3X1S A;  1P3P D;  3AZI B;  4UUZ B;  3AZK A;  3AZJ B;  3X1T D;  1U35 B;  4NFT A;  5E5A C;  2J8P A;  5CP6 C;  3W96 D;  4Z5T C;  3UTA D;  3AV1 D;  3O62 B;  2JCH A;  2G5H C;  4H9Q B;  3AZE A;  3AN2 C;  4J8X A;  1B6W A;  5CHL B;  2UWX A;  2Y2N A;  3AFA B;  3MGP D;  4KUD C;  4WU8 C;  2YFW B;  3AZK D;  1AOI C;  5AV6 A;  4XZQ D;  3X1T C;  5FUG B;  3W96 C;  3LZ0 A;  4R8P B;  3W98 D;  3AZE D;  3EPK A;  4J8X D;  3UTA C;  3AV1 C;  4CSR B;  1P3B D;  2FJ7 B;  3B0D B;  4H9P A;  3UT9 D;  2CV5 B;  1R4V A;  4AWL C;  3B6G A;  4UPK A;  3AZK C;  3W97 A;  5GT3 C;  1P3O D;  3KUY D;  4Z2M H;  4XZQ C;  3MVD B;  5GSU A;  4KHA A;  4J8W B;  3W98 C;  3AZE C;  2NZD D;  5AV8 A;  2YFV A;  1P3B C;  1JFI A;  3B0C T;  1WWS A;  3UT9 C;  3B6G D;  4XUJ B;  3AYW B;  3AZL B;  1P3O C;  5GSU D;  4H9O B;  3KUY C;  5B33 A;  4JJN A;  3AZN A;  2ARO B;  4G91 B;  3V9R A;  3H0M C;  1M19 B;  1P3I C;  1P3L A;  1ULY A;  2NZD C;  2ZY4 A;  5B0Z D;  4YS3 A;  2HIO A;  3VH6 W;  3REH B;  5G49 A;  3C1B B;  5B33 D;  4JJN D;  5B32 G;  5GSU C;  1H3O A;  4X23 D;  5C3I B;  5B0Z C;  2HIO D;  1KX3 A;  3WTP B;  4H9N B;  4HGA B;  3WKJ B;  3AFA D;  1EQZ A;  5B40 B;  3AZF A;  5AY8 B;  3B0B A;  4X23 C;  4ZUX A;  3REL A;  3AZI C;  5B0Y A;  3C1C A;  5CPJ A;  2HIO C;  5BNX B;  3TU4 A;  3AZG D;  2CV5 D;  4Z66 B;  3AFA C;  3AZF D;  3UTB A;  3REL D;  4ZUX D;  5B2J B;  5B0Y D;  2DF4 C;  3EPJ A;  3KWQ A;  3W99 B;  4R8P C;  1P3A A;  2FJ7 C;  3KXB B;  5AVC A;  3UTB D;  1P3K B;  2CV5 C;  3REL C;  2VQR A;  4XUJ D;  3R45 B;  4ZUX C;  3AZL D;  5B0Y C;  3KWQ D;  4CAY A;  2Y2Q A;  2ZY3 A;  1P3A D;  2ARO D;  3NQJ A;  2ZY5 A;  3AZH A;  2BYM B;  1T3U A;  3NQU A;  5B1M A;  3VH5 T;  5AVC D;  4J8W C;  4LD9 B;  1BFM A;  3REH D;  4XUJ C;  3MGR B;  3AYW C;  3AZL C;  3LZ1 B;  5BNV A;  2ARO C;  4KGC B;  5AVC C;  2PYO A;  5B31 B;  5JRG A;  1KX5 A;  5AVB A;  3AZM B;  4ZBJ B;  3LEL A;  3REJ B;  3REH C;  3C1B C;  1M1A A;  5AV9 B;  4WU9 A;  5B40 D;  3X1U B;  4DQY B;  5JRG D;  1KX5 D;  1TAF A;  5E5A A;  2Y2K A;  5CP6 A;  3WAA A;  5AVB D;  4Z2M G;  2W8S A;  1ID3 A;  3WTP C;  4Z66 D;  4KUD A;  4WU9 D;  3A6N B;  1HQ3 B;  1AOI A;  1P3M A;  5B40 C;  1P3G B;  5E5A D;  5CP6 D;  2FFF B;  2XD1 A;  3REK A;  3AV2 B;  3KSY A;  5JRG C;  3MGS B;  3X1T A;  3WAA D;  3W96 A;  5AVB C;  1ID3 D;  3AV1 A;  4KUD D;  2HUE B;  4Z66 C;  4WU9 C;  1P3M D;  3REK D;  5GT3 A;  5B2J C;  3WAA C;  4XZQ A;  1TZY A;  5CPI B;  1S32 B;  3W99 C;  3B0C W;  1ID3 C;  3W98 A;  1P3B A;  3UT9 A;  1P3M C;  5GT3 D;  2IO5 B;  3REK C;  3MGR D;  1TZY D;  3F6T A;  1P3O A;  5GXQ B;  3KUY A;  3X1V B;  1N1J A;  1KU5 A;  2F8N H;  1P3I A;  2NZD A;  3B6F B;  5B31 D;  3VH6 A;  5BO0 B;  3REI A;  2F8N D;  2RVQ D;  3AZM D;  3WA9 A;  3MNN D;  2JSS A;  4EO5 C;  5CPK A;  3MGR C;  1F66 B;  1TZY C;  5B2I A;  4WNN B;  3X1U D;  1P3I D;  4J8V D;  3REI D;  5B31 C;  5B0Z A;  4G92 C;  3WA9 D;  4H9S C;  2RVQ C;  3AZM C;  3EPH A;  5CPK D;  3MNN C;  3A6N D;  5B2I D;  2BYK B;  1HQ3 D;  5F99 D;  5DNN B;  5AV9 C;  4X23 A;  1P34 B;  3X1U C;  3AZI A;  4UUZ A;  3AZJ A;  1KX4 B;  3MGS D;  4DRB A;  4J8V C;  3REI C;  1U35 A;  2DQN C;  3WA9 C;  3O62 A;  1Q9C A;  4H9Q A;  5CPK C;  3AFA A;  3A6N C;  3LJA B;  5B2I C;  5F99 C;  1HQ3 C;  3AZI D;  2YFW A;  3AZJ D;  1U35 D;  3MGS C;  3O62 D;  5FUG A;  4R8P A;  2FJ7 A;  4CSR A;  3AZG B;  5AV5 B;  2CV5 A;  2HUE C;  1BH9 B;  4E45 A;  3AZJ C;  1U35 C;  5B24 B;  3VH5 W;  4R8P D;  4J8U B;  3MVD A;  3X1V D;  2FJ7 D;  3O62 C;  4J8W A;  1M18 B;  3B6F D;  3MGQ B;  5JA4 B;  5B1L B;  4XUJ A;  5DNM B;  3AYW A;  1P3F B;  3AZL A;  1F66 D;  3MVD D;  4H9O A;  5GXQ C;  2NQB B;  4YM6 B;  4J8W D;  2ARO A;  3X1V C;  1M19 A;  2F8N G;  2BG1 A;  3B0D C;  3B6F C;  3AYW D;  3REH A;  2F8N K;  3C1B A;  1F66 C;  3MVD C;  1M19 D;  4QLC B;  1ZLA B;  2Y2G A;  2Y2I A;  5GT0 B;  5B32 B;  3WTP A;  3C1B D;  4H9N A;  4Z5T B;  2Y2H A;  3WKJ A;  3LJA D;  3AN2 B;  1BH8 B;  4G91 C;  5B40 A;  5AY8 A;  1M19 C;  1PZR A;  1A7W A;  4WU8 B;  1P3P B;  2Y2M A;  3WTP D;  5BNX A;  3WKJ D;  5KDM B;  4Z66 A;  3UTA B;  5AY8 D;  3LJA C;  5B2J A;  5C3I C;  4AWL B;  3MGP B;  3X1S B;  4J8U D;  3AZK B;  3W99 A;  4HGA C;  3KXB A;  2RIQ A;  3MGQ D;  3AZG C;  3WKJ C;  1P3K A;  3W96 B;  3AZE B;  4J8X B;  5B2J D;  5AY8 C;  3R45 A;  3W99 D;  2NQB D;  2F2A C;  4YM6 D;  5AV6 B;  4J8U C;  3KXB D;  2BYM A;  3LZ0 B;  1P3K D;  1M18 C;  4DRA A;  3MGQ C;  1B67 A;  5B1L C;  4LD9 A;  4H9P B;  3MGR A;  2ZY2 A;  3B6G B;  4WJ3 C;  3LZ1 A;  2NQB C;  3W97 B;  4QLC D;  4YM6 C;  3H0R C;  3KXB C;  5GSU B;  4KGC A;  3FDD A;  5GT0 D;  4KHA B;  5B31 A;  5B32 D;  1P3K C;  2F8N A;  4LD9 D;  4H9S A;  5AV8 B;  2YFV B;  3AZM A;  1JFI B;  3REJ A;  3MNN A;  4WZS B;  3LZ1 D;  5AV9 A;  4QLC C;  3X1U A;  4KGC D;  5B33 B;  4JJN B;  3AZN B;  4J8V A;  3V9R B;  5GT0 C;  5B32 C;  1P3L B;  4LD9 C;  3REJ D;  4YS3 B;  2HIO B;  5AV9 D;  3LZ1 C;  3A6N A;  5G49 B;  1HQ3 A;  5F99 A;  1P3G A;  1H3O B;  4WV4 B;  4KGC C;  3AV2 A;  3X1S D;  3MGS A;  2LY8 A;  1P3P C;  4H9R A;  4ZBJ C;  3REJ C;  2Y2P A;  1KX3 B;  1P3G D;  3VH5 A;  5BT1 D;  1EQZ B;  3AV2 D;  3AZF B;  3MGP C;  3REL B;  3X1S C;  4ZUX B;  5CPI A;  5AV6 D;  1S32 A;  5B0Y B;  3C1C B;  3IP4 C;  3LZ0 D;  5CPJ B;  3TU4 B;  4J8X C;  1P3G C;  5BT1 C;  3UTB B;  3AV2 C;  5CPI D;  5GXQ A;  1S32 D;  3W97 D;  3X1V A;  5AV6 C;  2JE5 A;  3KWQ B;  3B6F A;  3LZ0 C;  2G5I C;  5BO0 A;  2ZM5 A;  1P3A B;  3WTP E;  1HTA A;  3AL0 C;  5AV8 D;  2Y2O A;  5AVC B;  5GXQ D;  5CPI C;  1F66 A;  3B6G C;  1S32 C;  2L5A A;  3W97 C;  4WNN A;  4NE6 A;  4CAY B;  3AZN D;  3NQJ B;  3AZH B;  5B1M B;  3NQU B;  1P3L D;  5AV8 C;  4YS3 D;  2IO5 C;  2BYK A;  5DNN A;  5B31 G;  1P34 A;  2XD5 A;  4JJN C;  5B33 C;  1KX4 A;  3AZN C;  5BNV B;  3A1K A;  1P3L C;  2PYO B;  5JRG B;  1KX5 B;  4YS3 C;  5AVB B;  1KX3 D;  3LEL B;  5DNN D;  1P34 D;  3LJA A;  1M1A B;  1EQZ D;  1KX4 D;  3VH6 T;  4WU9 B;  4NE3 A;  2CWE A;  2Y2L A;  5BS7 A;  1TAF B;  5E5A B;  5CP6 B;  3C1C D;  3WAA B;  5CPJ D;  3AZG A;  5AV5 A;  1ID3 B;  1KX3 C;  3TU4 D;  1BH9 A;  5DNN C;  1P34 C;  4KUD B;  1EQZ C;  1KX4 C;  1AOI B;  5B24 A;  1P3M B;  3AZF C;  4J8U A;  3REK B;  3X1T B;  4E44 A;  3C1C C;  5AV5 D;  1M18 A; 
#chains in the Genus database with same CATH homology
 5CPJ C;  3AV1 B;  3MGQ A;  5JA4 A;  5B1L A;  2Y2J A;  3TU4 C;  5DNM A;  5B24 D;  1F1E A;  3UTB C;  1P3F A;  5BS7 C;  2NQB A;  5GT3 B;  4YM6 A;  4EO5 B;  1M18 D;  4XZQ B;  1TZY B;  3KWQ C;  3A1I A;  3P5J B;  5AV5 C;  5B1L D;  3W98 B;  3AZH D;  5B1M D;  1P3A C;  1P3B B;  5DNM D;  3UT9 B;  1P3F D;  4G92 B;  1W2E A;  2F8N B;  5B24 C;  3EPL A;  1WWI A;  3KFU G;  4NE5 A;  4QLC A;  3MNN B;  1Z2C B;  1P3O B;  1ZLA A;  3H0L C;  3KUY B;  1N1J B;  5GT0 A;  5B32 A;  1P3I B;  3AZH C;  5B1M C;  2PYO D;  2NZD B;  3EG5 B;  4J8V B;  3REI B;  5DNM C;  4Z5T A;  1P3F C;  3LEL D;  3WA9 B;  4M6B A;  1ZLA D;  5CPK B;  3AN2 A;  1BH8 A;  1M1A D;  5B2I B;  5F99 B;  4WU8 A;  1P3P A;  2PYO C;  4Z5T D;  1KX5 C;  5B0Z B;  5KDM A;  4H9R B;  3LEL C;  3UTA A;  3AN2 D;  1ZLA C;  1M1A C;  4WU8 D;  1AOI D;  3MGP A;  4X23 B;  3X1S A;  1P3P D;  3AZI B;  4UUZ B;  3AZK A;  3AZJ B;  3X1T D;  1U35 B;  4NFT A;  5E5A C;  2J8P A;  5CP6 C;  3W96 D;  4Z5T C;  3UTA D;  3AV1 D;  3O62 B;  2JCH A;  2G5H C;  4H9Q B;  3AZE A;  3AN2 C;  4J8X A;  1B6W A;  5CHL B;  2UWX A;  2Y2N A;  3AFA B;  3MGP D;  4KUD C;  4WU8 C;  2YFW B;  3AZK D;  1AOI C;  5AV6 A;  4XZQ D;  3X1T C;  5FUG B;  3W96 C;  3LZ0 A;  4R8P B;  3W98 D;  3AZE D;  3EPK A;  4J8X D;  3UTA C;  3AV1 C;  4CSR B;  1P3B D;  2FJ7 B;  3B0D B;  4H9P A;  3UT9 D;  2CV5 B;  1R4V A;  4AWL C;  3B6G A;  4UPK A;  3AZK C;  3W97 A;  5GT3 C;  1P3O D;  3KUY D;  4Z2M H;  4XZQ C;  3MVD B;  5GSU A;  4KHA A;  4J8W B;  3W98 C;  3AZE C;  2NZD D;  5AV8 A;  2YFV A;  1P3B C;  1JFI A;  3B0C T;  1WWS A;  3UT9 C;  3B6G D;  4XUJ B;  3AYW B;  3AZL B;  1P3O C;  5GSU D;  4H9O B;  3KUY C;  5B33 A;  4JJN A;  3AZN A;  2ARO B;  4G91 B;  3V9R A;  3H0M C;  1M19 B;  1P3I C;  1P3L A;  1ULY A;  2NZD C;  2ZY4 A;  5B0Z D;  4YS3 A;  2HIO A;  3VH6 W;  3REH B;  5G49 A;  3C1B B;  5B33 D;  4JJN D;  5B32 G;  5GSU C;  1H3O A;  4X23 D;  5C3I B;  5B0Z C;  2HIO D;  1KX3 A;  3WTP B;  4H9N B;  4HGA B;  3WKJ B;  3AFA D;  1EQZ A;  5B40 B;  3AZF A;  5AY8 B;  3B0B A;  4X23 C;  4ZUX A;  3REL A;  3AZI C;  5B0Y A;  3C1C A;  5CPJ A;  2HIO C;  5BNX B;  3TU4 A;  3AZG D;  2CV5 D;  4Z66 B;  3AFA C;  3AZF D;  3UTB A;  3REL D;  4ZUX D;  5B2J B;  5B0Y D;  2DF4 C;  3EPJ A;  3KWQ A;  3W99 B;  4R8P C;  1P3A A;  2FJ7 C;  3KXB B;  5AVC A;  3UTB D;  1P3K B;  2CV5 C;  3REL C;  2VQR A;  4XUJ D;  3R45 B;  4ZUX C;  3AZL D;  5B0Y C;  3KWQ D;  4CAY A;  2Y2Q A;  2ZY3 A;  1P3A D;  2ARO D;  3NQJ A;  2ZY5 A;  3AZH A;  2BYM B;  1T3U A;  3NQU A;  5B1M A;  3VH5 T;  5AVC D;  4J8W C;  4LD9 B;  1BFM A;  3REH D;  4XUJ C;  3MGR B;  3AYW C;  3AZL C;  3LZ1 B;  5BNV A;  2ARO C;  4KGC B;  5AVC C;  2PYO A;  5B31 B;  5JRG A;  1KX5 A;  5AVB A;  3AZM B;  4ZBJ B;  3LEL A;  3REJ B;  3REH C;  3C1B C;  1M1A A;  5AV9 B;  4WU9 A;  5B40 D;  3X1U B;  4DQY B;  5JRG D;  1KX5 D;  1TAF A;  5E5A A;  2Y2K A;  5CP6 A;  3WAA A;  5AVB D;  4Z2M G;  2W8S A;  1ID3 A;  3WTP C;  4Z66 D;  4KUD A;  4WU9 D;  3A6N B;  1HQ3 B;  1AOI A;  1P3M A;  5B40 C;  1P3G B;  5E5A D;  5CP6 D;  2FFF B;  2XD1 A;  3REK A;  3AV2 B;  3KSY A;  5JRG C;  3MGS B;  3X1T A;  3WAA D;  3W96 A;  5AVB C;  1ID3 D;  3AV1 A;  4KUD D;  2HUE B;  4Z66 C;  4WU9 C;  1P3M D;  3REK D;  5GT3 A;  5B2J C;  3WAA C;  4XZQ A;  1TZY A;  5CPI B;  1S32 B;  3W99 C;  3B0C W;  1ID3 C;  3W98 A;  1P3B A;  3UT9 A;  1P3M C;  5GT3 D;  2IO5 B;  3REK C;  3MGR D;  1TZY D;  3F6T A;  1P3O A;  5GXQ B;  3KUY A;  3X1V B;  1N1J A;  1KU5 A;  2F8N H;  1P3I A;  2NZD A;  3B6F B;  5B31 D;  3VH6 A;  5BO0 B;  3REI A;  2F8N D;  2RVQ D;  3AZM D;  3WA9 A;  3MNN D;  2JSS A;  4EO5 C;  5CPK A;  3MGR C;  1F66 B;  1TZY C;  5B2I A;  4WNN B;  3X1U D;  1P3I D;  4J8V D;  3REI D;  5B31 C;  5B0Z A;  4G92 C;  3WA9 D;  4H9S C;  2RVQ C;  3AZM C;  3EPH A;  5CPK D;  3MNN C;  3A6N D;  5B2I D;  2BYK B;  1HQ3 D;  5F99 D;  5DNN B;  5AV9 C;  4X23 A;  1P34 B;  3X1U C;  3AZI A;  4UUZ A;  3AZJ A;  1KX4 B;  3MGS D;  4DRB A;  4J8V C;  3REI C;  1U35 A;  2DQN C;  3WA9 C;  3O62 A;  1Q9C A;  4H9Q A;  5CPK C;  3AFA A;  3A6N C;  3LJA B;  5B2I C;  5F99 C;  1HQ3 C;  3AZI D;  2YFW A;  3AZJ D;  1U35 D;  3MGS C;  3O62 D;  5FUG A;  4R8P A;  2FJ7 A;  4CSR A;  3AZG B;  5AV5 B;  2CV5 A;  2HUE C;  1BH9 B;  4E45 A;  3AZJ C;  1U35 C;  5B24 B;  3VH5 W;  4R8P D;  4J8U B;  3MVD A;  3X1V D;  2FJ7 D;  3O62 C;  4J8W A;  1M18 B;  3B6F D;  3MGQ B;  5JA4 B;  5B1L B;  4XUJ A;  5DNM B;  3AYW A;  1P3F B;  3AZL A;  1F66 D;  3MVD D;  4H9O A;  5GXQ C;  2NQB B;  4YM6 B;  4J8W D;  2ARO A;  3X1V C;  1M19 A;  2F8N G;  2BG1 A;  3B0D C;  3B6F C;  3AYW D;  3REH A;  2F8N K;  3C1B A;  1F66 C;  3MVD C;  1M19 D;  4QLC B;  1ZLA B;  2Y2G A;  2Y2I A;  5GT0 B;  5B32 B;  3WTP A;  3C1B D;  4H9N A;  4Z5T B;  2Y2H A;  3WKJ A;  3LJA D;  3AN2 B;  1BH8 B;  4G91 C;  5B40 A;  5AY8 A;  1M19 C;  1PZR A;  1A7W A;  4WU8 B;  1P3P B;  2Y2M A;  3WTP D;  5BNX A;  3WKJ D;  5KDM B;  4Z66 A;  3UTA B;  5AY8 D;  3LJA C;  5B2J A;  5C3I C;  4AWL B;  3MGP B;  3X1S B;  4J8U D;  3AZK B;  3W99 A;  4HGA C;  3KXB A;  2RIQ A;  3MGQ D;  3AZG C;  3WKJ C;  1P3K A;  3W96 B;  3AZE B;  4J8X B;  5B2J D;  5AY8 C;  3R45 A;  3W99 D;  2NQB D;  2F2A C;  4YM6 D;  5AV6 B;  4J8U C;  3KXB D;  2BYM A;  3LZ0 B;  1P3K D;  1M18 C;  4DRA A;  3MGQ C;  1B67 A;  5B1L C;  4LD9 A;  4H9P B;  3MGR A;  2ZY2 A;  3B6G B;  4WJ3 C;  3LZ1 A;  2NQB C;  3W97 B;  4QLC D;  4YM6 C;  3H0R C;  3KXB C;  5GSU B;  4KGC A;  3FDD A;  5GT0 D;  4KHA B;  5B31 A;  5B32 D;  1P3K C;  2F8N A;  4LD9 D;  4H9S A;  5AV8 B;  2YFV B;  3AZM A;  1JFI B;  3REJ A;  3MNN A;  4WZS B;  3LZ1 D;  5AV9 A;  4QLC C;  3X1U A;  4KGC D;  5B33 B;  4JJN B;  3AZN B;  4J8V A;  3V9R B;  5GT0 C;  5B32 C;  1P3L B;  4LD9 C;  3REJ D;  4YS3 B;  2HIO B;  5AV9 D;  3LZ1 C;  3A6N A;  5G49 B;  1HQ3 A;  5F99 A;  1P3G A;  1H3O B;  4WV4 B;  4KGC C;  3AV2 A;  3X1S D;  3MGS A;  2LY8 A;  1P3P C;  4H9R A;  4ZBJ C;  3REJ C;  2Y2P A;  1KX3 B;  1P3G D;  3VH5 A;  5BT1 D;  1EQZ B;  3AV2 D;  3AZF B;  3MGP C;  3REL B;  3X1S C;  4ZUX B;  5CPI A;  5AV6 D;  1S32 A;  5B0Y B;  3C1C B;  3IP4 C;  3LZ0 D;  5CPJ B;  3TU4 B;  4J8X C;  1P3G C;  5BT1 C;  3UTB B;  3AV2 C;  5CPI D;  5GXQ A;  1S32 D;  3W97 D;  3X1V A;  5AV6 C;  2JE5 A;  3KWQ B;  3B6F A;  3LZ0 C;  2G5I C;  5BO0 A;  2ZM5 A;  1P3A B;  3WTP E;  1HTA A;  3AL0 C;  5AV8 D;  2Y2O A;  5AVC B;  5GXQ D;  5CPI C;  1F66 A;  3B6G C;  1S32 C;  2L5A A;  3W97 C;  4WNN A;  4NE6 A;  4CAY B;  3AZN D;  3NQJ B;  3AZH B;  5B1M B;  3NQU B;  1P3L D;  5AV8 C;  4YS3 D;  2IO5 C;  2BYK A;  5DNN A;  5B31 G;  1P34 A;  2XD5 A;  4JJN C;  5B33 C;  1KX4 A;  3AZN C;  5BNV B;  3A1K A;  1P3L C;  2PYO B;  5JRG B;  1KX5 B;  4YS3 C;  5AVB B;  1KX3 D;  3LEL B;  5DNN D;  1P34 D;  3LJA A;  1M1A B;  1EQZ D;  1KX4 D;  3VH6 T;  4WU9 B;  4NE3 A;  2CWE A;  2Y2L A;  5BS7 A;  1TAF B;  5E5A B;  5CP6 B;  3C1C D;  3WAA B;  5CPJ D;  3AZG A;  5AV5 A;  1ID3 B;  1KX3 C;  3TU4 D;  1BH9 A;  5DNN C;  1P34 C;  4KUD B;  1EQZ C;  1KX4 C;  1AOI B;  5B24 A;  1P3M B;  3AZF C;  4J8U A;  3REK B;  3X1T B;  4E44 A;  3C1C C;  5AV5 D;  1M18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...