3AZMD

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmD00
1BH8B 5B31D 2BYKA 2NZDC 1BH9B 3X1VC 3AZJB 5GSUC 1P34C 5BNVB 5DNNB 3O62D 4J8UB 5GT0D 4YM6A 1U35D 1TAFB 2HIOD 5FUGA 3TU4D 3VH6A 3C1BA 3X1SC 1JFIB 4LD9D 5AV5B 3AYWC 3AZHA 2NZDB 3X1VB 3AV1D 5B2ID 3MGQD 3W99C 5GSUB 1M1AD 2NQBD 1P34B 5CP6C 3KXBB 3AFAD 4J8VD 4WNNA 1P3MC 5AVBD 5DNMC 5AV9C 3MNNA 4QLCA 3VH5T 5B33A 2F8NK 3X1SB 5F99D 1P3KD 3A6NB 3WAAA 3AV2C 3AYWB 4CAYB 4X23A 3REJC 5JA4A 5B0ZA 4WU8A 1HQ3D 1KU5A 1F1EA 3WA9D 3W99B 4DRAA 1ID3A 3WTPA 3AN2D 3MGPD 2AROC 3LJAA 5AV9B 3B0BA 3AZKD 3B6FD 3AZGA 1BFMA 3REKC 1KX5A 1P3OC 3LZ0A 4XUJC 3WKJA 4E45A 5B40A 4J8WA 4YM6D 5BT1C 1P3FA 4H9RB 4WU9D 2AROB 5B32B 2F8NG 5AV6C 5CPIC 3MGQC 4H9NB 3AZHD 3AZMA 5E5AD 4H9PA 1P3LC 1P3OB 1TZYA 1B67A 3X1TC 3NQUB 2HIOB 3VH5A 3C1CA 5B24A 1F66C 5AV8C 5GXQC 4QLCD 3MNND 3MVDA 5CPKA 4LD9B 5B33D 4H9SC 4J8XA 1HQ3C 5AV6B 5CPIB 5B2IB 3MGQB 3WAAD 1AOIC 4X23D 2NQBB 2PYOC 5B0ZD 4WU8D 3AN2C 5BNXA 1P3LB 1ID3D 3WTPD 3AZND 3X1TB 5AVBB 1U35A 5B1LA 1F66B 5G49A 3LJAD 4ZBJB 5GXQB 5F99B 1Q9CA 1P3KB 1P3BA 4R8PC 3AZGD 4ZUXC 3W97C 1HQ3B 3V9RA 2BYMB 4JJNA 1KX5D 1AOIB 2PYOB 3REHA 3WTPE 4HGAC 3AN2B 5BS7C 3AZLC 3AFAA 4Z2MG 5B40D 3WKJD 4Z66D 3C1BC 1P3FD 3AZHC 4KUDC 3AZMD 5B1MA 1TZYD 4HGAB 4H9OA 3AZLB 3AZIC 4KGCA 3MNNC 3C1CD 3UT9A 5B24D 3W98A 5FUGB 2YFVB 5B33C 5CPJC 3C1BB 3B6GC 5CPKD 3MVDD 3AZKA 3B6FA 3AZHB 4J8XD 4KUDB 4XZQA 4G91C 3WTPC 3KXBC 3LZ1A 1P3PC 3AZIB 5B1LD 3MNNB 4QLCB 1M18C 4WU9A 5CPJB 5B33B 3AZGC 3B6GB 4YS3C 1P3BD 3A6NC 3KSYA 1KX5C 3LZ0C 4WU8B 1KX4D 1P3GA 5E5AA 4JJND 5JRGA 4J8WC 4CSRA 4G91B 4E44A 3WTPB 5B0YA 3REHD 2RVQD 1S32A 1R4VA 3KWQA 1M19A 3REIA 2F8NA 4NFTA 3LJAB 1P3PB 3X1UC 1M18B 3AZGB 1P3AC 3AZMC 2L5AA 4YS3B 3NQJB 1KX5B 5C3IC 3LZ0B 1ZLAC 3WKJB 5B1MD 5B40B 4J8WB 3AZNA 5B24C 3MGSA 4KGCD 5B2JA 2HUEC 3UT9D 5BO0A 5BNVA 5DNNA 3W98D 3KUYD 5B32C 3X1UB 4DRBA 5B31C 4AWLC 4J8UA 1P3AB 3AZMB 2LY8A 4H9PB 3O62C 4XZQD 5C3IB 1JFIA 5GT0C 1ZLAB 1U35C 2HIOC 4Z66A 3C1CB 5B24B 3LZ1D 3TU4C 2HUEB 4LD9C 1P34A 5B31B 4J8XB 4Z5TD 4AWLB 3AV1C 5B2IC 4JJNC 1M1AC 2NQBC 1P3GD 1P3IA 5BNXB 5JRGD 3AFAC 3O62B 4J8VC 5B0YD 3X1SA 1S32D 5GT0B 1M19D 3KWQD 5AVBC 1U35B 3REID 2F8ND 5G49B 3TU4B 4UUZB 4ZBJC 3W99A 5F99C 1P3KC 5CP6A 4H9QA 1EQZD 1WWIA 3V9RB 1P3MA 3AV1B 4JJNB 3WA9C 3B0CW 5DNMA 1M1AB 5AV9A 3REHB 1H3OA 5KDMA 3UTAD 3AFAB 4J8VB 3MGPC 4M6BA 3W98C 3MGSD 3AV2A 5B2JD 3AZFA 3REJA 2YFWA 3B0DB 5DNND 3AZKC 3B6FC 4J8UD 1A7WA 1KX4A 5GT3A 5B1MB 5AVCA 3WA9B 3W96A 4H9OB 3LZ1C 5AV5D 4YM6C 3MGPB 4KGCB 4H9NA 3VH6W 4WU9C 3REKA 3W98B 3MGRA 2CV5A 4XUJA 1P34D 2FJ7A 3AZKB 3B6FB 2BYKB 5E5AC 4XZQB 1M19C 1P3ID 3X1SD 3LZ1B 5AV6A 4YM6B 5CPIA 3UTBA 4QLCC 4WU9B 3KUYA 4NE5A 3LELA 3W99D 3AZEA 3X1TA 1HTAA 3WAAC 5CP6D 4EO5C 4X23C 5B0ZC 4WU8C 5E5AB 2JSSA 1P3MD 1KX3A 1ULYA 1F66A 4CSRB 5DNMD 5B0YB 1ID3C 3AZNC 5CHLB 5AV9D 5AV8A 5GXQA 1S32B 1M19B 4KHAA 3R45A 4H9SA 4WNNB 2F8NB 3LJAC 2IO5B 5B32G 3AV2D 1AOIA 3AZFD 3REJD 4NE3A 4Z5TA 2AROD 3WAAB 4WZSB 4EO5B 4X23B 5JA4B 5B0ZB 1WWSA 5GT3D 3WKJC 5AVCD 5B40C 5AY8A 1ID3B 3AZNB 4Z66C 3W96D 3MGSB 1P3FC 5B2JB 1N1JA 4ZUXA 4R8PA 5BO0B 3W97A 3REKD 3MGRD 1P3OD 2CV5D 4XUJD 2FJ7D 5BS7A 3AZLA 1EQZA 1P3IC 2YFVA 1TZYC 5BT1D 3UTAA 3RELA 3VH5W 1BH8A 4Z66B 3C1CC 1BH9A 5AV6D 3AZJA 5CPID 1P3FB 4KUDA 3UTBD 5CPKC 3MVDC 3LELD 1P3LD 4J8XC 3AZED 3X1TD 3AZIA 1TAFA 1KX3D 1P3IB 1F66D 5CPJA 1TZYB 3B6GA 5AV8D 5GXQD 5AV5A 5B1LC 3AZFC 2NZDA 3X1VA 5CPKB 5GSUA 3MVDB 1AOID 2PYOD 1P3BC 5CP6B 3KXBA 4H9QB 1KX4C 1P3MB 5GT3C 5AVCC 1P3PA 5DNMB 3REHC 1H3OB 2RVQC 3W96C 5KDMB 1M18A 2F8NH 5AY8D 4YS3A 3MGRC 3NQJA 3A6NA 3AV2B 4R8PD 4ZUXD 5B1LB 4CAYA 3REJB 2YFWB 3B0DC 3AYWA 3AZFB 2CV5C 2FJ7C 3W97D 1P3BB 3AZLD 1KX4B 5GT3B 5B1MC 5AVCB 3C1BD 3X1UA 3RELD 3W96B 4KGCC 3UTBC 1P3AA 3UT9C 3REKB 3MGRB 3KUYC 3AZJD 4KUDD 3LELC 3AZEC 4XUJB 2CV5B 4WV4B 1ZLAA 2FJ7B 1KX3C 3B0CT 4XZQC 3AZID 4H9RA 2AROA 5CPJD 5B32A 3B6GD 5B31A 2CWEA 3UTBB 3UT9B 4G92C 3KUYB 3X1VD 2NZDD 3LELB 4Z2MH 5GSUD 4Z5TC 3O62A 3AZEB 1P3OA 5GT0A 3KXBD 3NQUA 2HIOA 1P3GC 1KX3B 5JRGC 3TU4A 5AY8C 1P3PD 5B0YC 4UUZA 1S32C 5AV8B 3KWQC 1M18D 4KHAB 4LD9A 3R45B 3REIC 3VH6T 4YS3D 3A6ND 2IO5C 5B2IA 3MGQA 3AV1A 3LZ0D 3AYWD 1M1AA 2NQBA 4G92B 4J8VA 1P3LA 4J8WD 4Z5TB 1EQZC 5AVBA 3UTAC 3RELC 1P3GB 4NE6A 5JRGB 5AY8B 3X1UD 5F99A 3KWQB 3MGSC 3AZJC 1P3KA 3REIB 5B2JC 1N1JB 4ZUXB 4R8PB 1P3AD 3W97B 5DNNC 1HQ3A 2BYMA 3WA9A 5B31G 4J8UC 2PYOA 1ZLAD 3AN2A 3MGPA 1EQZB 1B6WA 3UTAB 3RELB 5AV5C 5B32D
chains in the Genus database with same CATH superfamily
1BH8B 5B31D 2BYKA 2NZDC 1BH9B 3X1VC 3AZJB 5GSUC 1P34C 5BNVB 5DNNB 3O62D 4J8UB 5GT0D 4YM6A 1U35D 1TAFB 2HIOD 3IP4C 5FUGA 3TU4D 3VH6A 3C1BA 3X1SC 1JFIB 4LD9D 5AV5B 3AYWC 3AZHA 2NZDB 3X1VB 3AV1D 5B2ID 3MGQD 3W99C 5GSUB 1M1AD 2NQBD 1P34B 5CP6C 3KXBB 3AFAD 4J8VD 4WNNA 1P3MC 3H0MC 5AVBD 5DNMC 5AV9C 3MNNA 4QLCA 3VH5T 2Y2OA 5B33A 2F8NK 3X1SB 5F99D 1P3KD 3A6NB 3WAAA 2FFFB 3AV2C 3AYWB 3H0LC 4CAYB 4X23A 5JA4A 3REJC 5B0ZA 4WU8A 1HQ3D 1KU5A 1F1EA 3WA9D 3W99B 4DRAA 1ID3A 3WTPA 3AN2D 3MGPD 2RIQA 2AROC 3LJAA 2Y2MA 5AV9B 3B0BA 3AZKD 3B6FD 3AZGA 1BFMA 3REKC 1KX5A 1P3OC 3LZ0A 4XUJC 3WKJA 4E45A 5B40A 4J8WA 4YM6D 5BT1C 1P3FA 4H9RB 4WU9D 2AROB 5B32B 2F8NG 3A1IA 5AV6C 5CPIC 3MGQC 4H9NB 3AZHD 3AZMA 5E5AD 4H9PA 1P3LC 1P3OB 1TZYA 1B67A 3X1TC 3NQUB 2HIOB 3VH5A 3C1CA 5B24A 1F66C 5AV8C 2Y2PA 4QLCD 5GXQC 1Z2CB 3MNND 3MVDA 5CPKA 4LD9B 5B33D 2ZY2A 4H9SC 4J8XA 1HQ3C 5AV6B 5CPIB 5B2IB 3MGQB 3WAAD 1AOIC 4X23D 2NQBB 2PYOC 5B0ZD 3FDDA 4WU8D 1W2EA 3AN2C 5BNXA 1P3LB 1ID3D 3WTPD 3AZND 3X1TB 2Y2JA 5AVBB 1U35A 5B1LA 3A1KA 1F66B 5G49A 3LJAD 4ZBJB 5GXQB 5F99B 1Q9CA 1P3KB 1P3BA 4R8PC 3AZGD 4ZUXC 3W97C 1HQ3B 3V9RA 2BYMB 4JJNA 1KX5D 1AOIB 2PYOB 3REHA 2UWXA 3WTPE 4HGAC 3AN2B 5BS7C 3AZLC 3AFAA 2F2AC 4Z2MG 5B40D 3WKJD 4Z66D 1T3UA 3C1BC 1P3FD 1PZRA 2BG1A 3AZHC 4KUDC 3AZMD 5B1MA 1TZYD 2Y2HA 2W8SA 4HGAB 4H9OA 3EPJA 3AZLB 3AZIC 4KGCA 3MNNC 3C1CD 3UT9A 5B24D 3W98A 5FUGB 2YFVB 5B33C 5CPJC 3C1BB 3B6GC 5CPKD 3MVDD 3AZKA 3B6FA 3AZHB 4J8XD 4KUDB 4XZQA 4G91C 3WTPC 3KXBC 3LZ1A 1P3PC 3AZIB 5B1LD 3MNNB 4QLCB 1M18C 4WU9A 5CPJB 5B33B 3AZGC 3B6GB 4YS3C 1P3BD 3A6NC 3KSYA 1KX5C 3LZ0C 4WU8B 1KX4D 1P3GA 5E5AA 4JJND 5JRGA 4J8WC 4CSRA 4G91B 4E44A 3WTPB 5B0YA 3REHD 2RVQD 1S32A 1R4VA 3KWQA 1M19A 3REIA 2F8NA 4NFTA 3LJAB 1P3PB 3X1UC 2Y2KA 1M18B 3AZGB 1P3AC 3AZMC 2L5AA 4YS3B 3NQJB 1KX5B 3EPHA 5C3IC 3LZ0B 1ZLAC 3WKJB 5B1MD 5B40B 4J8WB 3AZNA 5B24C 3MGSA 4KGCD 5B2JA 2HUEC 3UT9D 5BO0A 5BNVA 5DNNA 3W98D 3KUYD 5B32C 3X1UB 4DRBA 5B31C 4AWLC 4J8UA 1P3AB 3AZMB 2LY8A 4H9PB 3O62C 4XZQD 5C3IB 1JFIA 5GT0C 1ZLAB 1U35C 3EG5B 2HIOC 4Z66A 3C1CB 5B24B 3LZ1D 3TU4C 2JCHA 2HUEB 4LD9C 1P34A 5B31B 4J8XB 4Z5TD 4AWLB 3AV1C 5B2IC 4JJNC 1M1AC 2NQBC 1P3GD 1P3IA 5BNXB 5JRGD 3AFAC 3O62B 4J8VC 5B0YD 3X1SA 1S32D 5GT0B 1M19D 3KWQD 5AVBC 1U35B 3REID 2F8ND 5G49B 3TU4B 4UUZB 4ZBJC 3W99A 5F99C 1P3KC 5CP6A 4H9QA 1EQZD 1WWIA 3V9RB 1P3MA 3AV1B 2VQRA 4JJNB 3WA9C 3B0CW 5DNMA 1M1AB 5AV9A 3REHB 1H3OA 5KDMA 3UTAD 3AFAB 4J8VB 3MGPC 4M6BA 3W98C 3MGSD 3AV2A 5B2JD 3AZFA 3REJA 2YFWA 3B0DB 5DNND 2ZY5A 3AZKC 3B6FC 2G5IC 4J8UD 1A7WA 1KX4A 2DF4C 5GT3A 5B1MB 5AVCA 3WA9B 2DQNC 3W96A 4H9OB 3LZ1C 5AV5D 4YM6C 3MGPB 4KGCB 4H9NA 3VH6W 4WU9C 2ZY4A 3REKA 3W98B 3MGRA 3KFUG 2CV5A 4XUJA 1P34D 2FJ7A 3AZKB 3B6FB 2BYKB 5E5AC 4XZQB 1M19C 1P3ID 3X1SD 3LZ1B 5AV6A 4YM6B 5CPIA 3UTBA 4QLCC 4WU9B 3KUYA 4NE5A 3LELA 3W99D 3AZEA 2XD1A 1HTAA 3X1TA 3WAAC 5CP6D 4EO5C 4X23C 5B0ZC 4WU8C 5E5AB 2JSSA 1P3MD 1KX3A 1ULYA 1F66A 4CSRB 5DNMD 5B0YB 1ID3C 3AZNC 5CHLB 5AV9D 5AV8A 5GXQA 1S32B 1M19B 4KHAA 3R45A 4H9SA 4WNNB 2F8NB 3LJAC 2IO5B 5B32G 3AV2D 1AOIA 3AZFD 3REJD 2ZM5A 4NE3A 4Z5TA 2AROD 3WAAB 4WZSB 4EO5B 3F6TA 4X23B 5JA4B 5B0ZB 1WWSA 2JE5A 5GT3D 5AVCD 3WKJC 5B40C 5AY8A 1ID3B 3AZNB 3P5JB 4Z66C 3W96D 3MGSB 1P3FC 5B2JB 1N1JA 4ZUXA 4R8PA 5BO0B 3W97A 3REKD 3MGRD 1P3OD 2CV5D 4XUJD 2FJ7D 5BS7A 3AZLA 4UPKA 3AL0C 1EQZA 2Y2IA 1P3IC 2YFVA 1TZYC 5BT1D 3UTAA 3RELA 3VH5W 1BH8A 4Z66B 3C1CC 1BH9A 5AV6D 3AZJA 2Y2GA 5CPID 1P3FB 3UTBD 5CPKC 4KUDA 3MVDC 3LELD 1P3LD 4J8XC 3AZED 3X1TD 3AZIA 1TAFA 1KX3D 1P3IB 1F66D 5CPJA 1TZYB 4DQYB 3B6GA 5AV8D 5GXQD 5AV5A 2Y2NA 5B1LC 3AZFC 2NZDA 3X1VA 2G5HC 4WJ3C 5CPKB 5GSUA 3MVDB 1AOID 2PYOD 1P3BC 5CP6B 3KXBA 4H9QB 1KX4C 1P3MB 5GT3C 5AVCC 1P3PA 5DNMB 3REHC 1H3OB 2RVQC 3W96C 5KDMB 1M18A 2F8NH 5AY8D 4YS3A 3MGRC 3NQJA 3A6NA 3AV2B 4R8PD 4ZUXD 5B1LB 4CAYA 3REJB 2YFWB 3B0DC 3AYWA 3AZFB 2CV5C 2FJ7C 3W97D 1P3BB 3AZLD 2J8PA 1KX4B 5GT3B 5B1MC 5AVCB 3C1BD 3X1UA 3RELD 3W96B 4KGCC 2XD5A 3UTBC 1P3AA 3UT9C 3REKB 3MGRB 3KUYC 3AZJD 4KUDD 3LELC 3AZEC 4XUJB 2CV5B 4WV4B 1ZLAA 2FJ7B 1KX3C 3B0CT 4XZQC 3AZID 4H9RA 2AROA 5CPJD 5B32A 3B6GD 5B31A 2CWEA 3EPLA 3UTBB 3UT9B 4G92C 3KUYB 3X1VD 2NZDD 3LELB 4Z2MH 5GSUD 4Z5TC 3O62A 3AZEB 1P3OA 5GT0A 3KXBD 3NQUA 2HIOA 1P3GC 1KX3B 5JRGC 3TU4A 5AY8C 1P3PD 5B0YC 4UUZA 1S32C 5AV8B 3KWQC 1M18D 4KHAB 4LD9A 3R45B 3REIC 3VH6T 4YS3D 3A6ND 2IO5C 5B2IA 3MGQA 3AV1A 3LZ0D 3AYWD 1M1AA 2NQBA 4G92B 4J8VA 1P3LA 4J8WD 4Z5TB 1EQZC 5AVBA 3UTAC 3RELC 1P3GB 4NE6A 5JRGB 5AY8B 3X1UD 5F99A 3KWQB 3MGSC 3AZJC 1P3KA 3REIB 5B2JC 1N1JB 4ZUXB 3H0RC 4R8PB 1P3AD 3W97B 5DNNC 1HQ3A 2BYMA 3WA9A 5B31G 4J8UC 2PYOA 3EPKA 1ZLAD 2Y2LA 3AN2A 3MGPA 1EQZB 2ZY3A 1B6WA 3UTAB 3RELB 5AV5C 2Y2QA 5B32D
chains in the Genus database with same CATH topology
1BH8B 5B31D 2BYKA 2NZDC 1BH9B 3X1VC 3AZJB 5GSUC 1P34C 5BNVB 5DNNB 3O62D 4J8UB 5GT0D 4YM6A 1U35D 1TAFB 2HIOD 3IP4C 5FUGA 3TU4D 3VH6A 3C1BA 3X1SC 1JFIB 4LD9D 5AV5B 3AYWC 3AZHA 2NZDB 3X1VB 3AV1D 5B2ID 3MGQD 3W99C 5GSUB 1M1AD 2NQBD 1P34B 5CP6C 3KXBB 3AFAD 4J8VD 4WNNA 1P3MC 3H0MC 5AVBD 5DNMC 5AV9C 3MNNA 4QLCA 3VH5T 2Y2OA 5B33A 2F8NK 3X1SB 5F99D 1P3KD 3A6NB 3WAAA 2FFFB 3AV2C 3AYWB 3H0LC 4CAYB 4X23A 5JA4A 3REJC 5B0ZA 4WU8A 1HQ3D 1KU5A 1F1EA 3WA9D 3W99B 4DRAA 1ID3A 3WTPA 3AN2D 3MGPD 2RIQA 2AROC 3LJAA 2Y2MA 5AV9B 3B0BA 3AZKD 3B6FD 3AZGA 1BFMA 3REKC 1KX5A 1P3OC 3LZ0A 4XUJC 3WKJA 4E45A 5B40A 4J8WA 4YM6D 5BT1C 1P3FA 4H9RB 4WU9D 2AROB 5B32B 2F8NG 3A1IA 5AV6C 5CPIC 3MGQC 4H9NB 3AZHD 3AZMA 5E5AD 4H9PA 1P3LC 1P3OB 1TZYA 1B67A 3X1TC 3NQUB 2HIOB 3VH5A 3C1CA 5B24A 1F66C 5AV8C 2Y2PA 4QLCD 5GXQC 1Z2CB 3MNND 3MVDA 5CPKA 4LD9B 5B33D 2ZY2A 4H9SC 4J8XA 1HQ3C 5AV6B 5CPIB 5B2IB 3MGQB 3WAAD 1AOIC 4X23D 2NQBB 2PYOC 5B0ZD 3FDDA 4WU8D 1W2EA 3AN2C 5BNXA 1P3LB 1ID3D 3WTPD 3AZND 3X1TB 2Y2JA 5AVBB 1U35A 5B1LA 3A1KA 1F66B 5G49A 3LJAD 4ZBJB 5GXQB 5F99B 1Q9CA 1P3KB 1P3BA 4R8PC 3AZGD 4ZUXC 3W97C 1HQ3B 3V9RA 2BYMB 4JJNA 1KX5D 1AOIB 2PYOB 3REHA 2UWXA 3WTPE 4HGAC 3AN2B 5BS7C 3AZLC 3AFAA 2F2AC 4Z2MG 5B40D 3WKJD 4Z66D 1T3UA 3C1BC 1P3FD 1PZRA 2BG1A 3AZHC 4KUDC 3AZMD 5B1MA 1TZYD 2Y2HA 2W8SA 4HGAB 4H9OA 3EPJA 3AZLB 3AZIC 4KGCA 3MNNC 3C1CD 3UT9A 5B24D 3W98A 5FUGB 2YFVB 5B33C 5CPJC 3C1BB 3B6GC 5CPKD 3MVDD 3AZKA 3B6FA 3AZHB 4J8XD 4KUDB 4XZQA 4G91C 3WTPC 3KXBC 3LZ1A 1P3PC 3AZIB 5B1LD 3MNNB 4QLCB 1M18C 4WU9A 5CPJB 5B33B 3AZGC 3B6GB 4YS3C 1P3BD 3A6NC 3KSYA 1KX5C 3LZ0C 4WU8B 1KX4D 1P3GA 5E5AA 4JJND 5JRGA 4J8WC 4CSRA 4G91B 4E44A 3WTPB 5B0YA 3REHD 2RVQD 1S32A 1R4VA 3KWQA 1M19A 3REIA 2F8NA 4NFTA 3LJAB 1P3PB 3X1UC 2Y2KA 1M18B 3AZGB 1P3AC 3AZMC 2L5AA 4YS3B 3NQJB 1KX5B 3EPHA 5C3IC 3LZ0B 1ZLAC 3WKJB 5B1MD 5B40B 4J8WB 3AZNA 5B24C 3MGSA 4KGCD 5B2JA 2HUEC 3UT9D 5BO0A 5BNVA 5DNNA 3W98D 3KUYD 5B32C 3X1UB 4DRBA 5B31C 4AWLC 4J8UA 1P3AB 3AZMB 2LY8A 4H9PB 3O62C 4XZQD 5C3IB 1JFIA 5GT0C 1ZLAB 1U35C 3EG5B 2HIOC 4Z66A 3C1CB 5B24B 3LZ1D 3TU4C 2JCHA 2HUEB 4LD9C 1P34A 5B31B 4J8XB 4Z5TD 4AWLB 3AV1C 5B2IC 4JJNC 1M1AC 2NQBC 1P3GD 1P3IA 5BNXB 5JRGD 3AFAC 3O62B 4J8VC 5B0YD 3X1SA 1S32D 5GT0B 1M19D 3KWQD 5AVBC 1U35B 3REID 2F8ND 5G49B 3TU4B 4UUZB 4ZBJC 3W99A 5F99C 1P3KC 5CP6A 4H9QA 1EQZD 1WWIA 3V9RB 1P3MA 3AV1B 2VQRA 4JJNB 3WA9C 3B0CW 5DNMA 1M1AB 5AV9A 3REHB 1H3OA 5KDMA 3UTAD 3AFAB 4J8VB 3MGPC 4M6BA 3W98C 3MGSD 3AV2A 5B2JD 3AZFA 3REJA 2YFWA 3B0DB 5DNND 2ZY5A 3AZKC 3B6FC 2G5IC 4J8UD 1A7WA 1KX4A 2DF4C 5GT3A 5B1MB 5AVCA 3WA9B 2DQNC 3W96A 4H9OB 3LZ1C 5AV5D 4YM6C 3MGPB 4KGCB 4H9NA 3VH6W 4WU9C 2ZY4A 3REKA 3W98B 3MGRA 3KFUG 2CV5A 4XUJA 1P34D 2FJ7A 3AZKB 3B6FB 2BYKB 5E5AC 4XZQB 1M19C 1P3ID 3X1SD 3LZ1B 5AV6A 4YM6B 5CPIA 3UTBA 4QLCC 4WU9B 3KUYA 4NE5A 3LELA 3W99D 3AZEA 2XD1A 1HTAA 3X1TA 3WAAC 5CP6D 4EO5C 4X23C 5B0ZC 4WU8C 5E5AB 2JSSA 1P3MD 1KX3A 1ULYA 1F66A 4CSRB 5DNMD 5B0YB 1ID3C 3AZNC 5CHLB 5AV9D 5AV8A 5GXQA 1S32B 1M19B 4KHAA 3R45A 4H9SA 4WNNB 2F8NB 3LJAC 2IO5B 5B32G 3AV2D 1AOIA 3AZFD 3REJD 2ZM5A 4NE3A 4Z5TA 2AROD 3WAAB 4WZSB 4EO5B 3F6TA 4X23B 5JA4B 5B0ZB 1WWSA 2JE5A 5GT3D 5AVCD 3WKJC 5B40C 5AY8A 1ID3B 3AZNB 3P5JB 4Z66C 3W96D 3MGSB 1P3FC 5B2JB 1N1JA 4ZUXA 4R8PA 5BO0B 3W97A 3REKD 3MGRD 1P3OD 2CV5D 4XUJD 2FJ7D 5BS7A 3AZLA 4UPKA 3AL0C 1EQZA 2Y2IA 1P3IC 2YFVA 1TZYC 5BT1D 3UTAA 3RELA 3VH5W 1BH8A 4Z66B 3C1CC 1BH9A 5AV6D 3AZJA 2Y2GA 5CPID 1P3FB 3UTBD 5CPKC 4KUDA 3MVDC 3LELD 1P3LD 4J8XC 3AZED 3X1TD 3AZIA 1TAFA 1KX3D 1P3IB 1F66D 5CPJA 1TZYB 4DQYB 3B6GA 5AV8D 5GXQD 5AV5A 2Y2NA 5B1LC 3AZFC 2NZDA 3X1VA 2G5HC 4WJ3C 5CPKB 5GSUA 3MVDB 1AOID 2PYOD 1P3BC 5CP6B 3KXBA 4H9QB 1KX4C 1P3MB 5GT3C 5AVCC 1P3PA 5DNMB 3REHC 1H3OB 2RVQC 3W96C 5KDMB 1M18A 2F8NH 5AY8D 4YS3A 3MGRC 3NQJA 3A6NA 3AV2B 4R8PD 4ZUXD 5B1LB 4CAYA 3REJB 2YFWB 3B0DC 3AYWA 3AZFB 2CV5C 2FJ7C 3W97D 1P3BB 3AZLD 2J8PA 1KX4B 5GT3B 5B1MC 5AVCB 3C1BD 3X1UA 3RELD 3W96B 4KGCC 2XD5A 3UTBC 1P3AA 3UT9C 3REKB 3MGRB 3KUYC 3AZJD 4KUDD 3LELC 3AZEC 4XUJB 2CV5B 4WV4B 1ZLAA 2FJ7B 1KX3C 3B0CT 4XZQC 3AZID 4H9RA 2AROA 5CPJD 5B32A 3B6GD 5B31A 2CWEA 3EPLA 3UTBB 3UT9B 4G92C 3KUYB 3X1VD 2NZDD 3LELB 4Z2MH 5GSUD 4Z5TC 3O62A 3AZEB 1P3OA 5GT0A 3KXBD 3NQUA 2HIOA 1P3GC 1KX3B 5JRGC 3TU4A 5AY8C 1P3PD 5B0YC 4UUZA 1S32C 5AV8B 3KWQC 1M18D 4KHAB 4LD9A 3R45B 3REIC 3VH6T 4YS3D 3A6ND 2IO5C 5B2IA 3MGQA 3AV1A 3LZ0D 3AYWD 1M1AA 2NQBA 4G92B 4J8VA 1P3LA 4J8WD 4Z5TB 1EQZC 5AVBA 3UTAC 3RELC 1P3GB 4NE6A 5JRGB 5AY8B 3X1UD 5F99A 3KWQB 3MGSC 3AZJC 1P3KA 3REIB 5B2JC 1N1JB 4ZUXB 3H0RC 4R8PB 1P3AD 3W97B 5DNNC 1HQ3A 2BYMA 3WA9A 5B31G 4J8UC 2PYOA 3EPKA 1ZLAD 2Y2LA 3AN2A 3MGPA 1EQZB 2ZY3A 1B6WA 3UTAB 3RELB 5AV5C 2Y2QA 5B32D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 B;  5B31 D;  2BYK A;  2NZD C;  1BH9 B;  3X1V C;  3AZJ B;  5GSU C;  1P34 C;  5BNV B;  5DNN B;  3O62 D;  4J8U B;  5GT0 D;  4YM6 A;  1U35 D;  1TAF B;  2HIO D;  5FUG A;  3TU4 D;  3VH6 A;  3C1B A;  3X1S C;  1JFI B;  4LD9 D;  5AV5 B;  3AYW C;  3AZH A;  2NZD B;  3X1V B;  3AV1 D;  5B2I D;  3MGQ D;  3W99 C;  5GSU B;  1M1A D;  2NQB D;  1P34 B;  5CP6 C;  3KXB B;  3AFA D;  4J8V D;  4WNN A;  1P3M C;  5AVB D;  5DNM C;  5AV9 C;  3MNN A;  4QLC A;  3VH5 T;  5B33 A;  2F8N K;  3X1S B;  5F99 D;  1P3K D;  3A6N B;  3WAA A;  3AV2 C;  3AYW B;  4CAY B;  4X23 A;  3REJ C;  5JA4 A;  5B0Z A;  4WU8 A;  1HQ3 D;  1KU5 A;  1F1E A;  3WA9 D;  3W99 B;  4DRA A;  1ID3 A;  3WTP A;  3AN2 D;  3MGP D;  2ARO C;  3LJA A;  5AV9 B;  3B0B A;  3AZK D;  3B6F D;  3AZG A;  1BFM A;  3REK C;  1KX5 A;  1P3O C;  3LZ0 A;  4XUJ C;  3WKJ A;  4E45 A;  5B40 A;  4J8W A;  4YM6 D;  5BT1 C;  1P3F A;  4H9R B;  4WU9 D;  2ARO B;  5B32 B;  2F8N G;  5AV6 C;  5CPI C;  3MGQ C;  4H9N B;  3AZH D;  3AZM A;  5E5A D;  4H9P A;  1P3L C;  1P3O B;  1TZY A;  1B67 A;  3X1T C;  3NQU B;  2HIO B;  3VH5 A;  3C1C A;  5B24 A;  1F66 C;  5AV8 C;  5GXQ C;  4QLC D;  3MNN D;  3MVD A;  5CPK A;  4LD9 B;  5B33 D;  4H9S C;  4J8X A;  1HQ3 C;  5AV6 B;  5CPI B;  5B2I B;  3MGQ B;  3WAA D;  1AOI C;  4X23 D;  2NQB B;  2PYO C;  5B0Z D;  4WU8 D;  3AN2 C;  5BNX A;  1P3L B;  1ID3 D;  3WTP D;  3AZN D;  3X1T B;  5AVB B;  1U35 A;  5B1L A;  1F66 B;  5G49 A;  3LJA D;  4ZBJ B;  5GXQ B;  5F99 B;  1Q9C A;  1P3K B;  1P3B A;  4R8P C;  3AZG D;  4ZUX C;  3W97 C;  1HQ3 B;  3V9R A;  2BYM B;  4JJN A;  1KX5 D;  1AOI B;  2PYO B;  3REH A;  3WTP E;  4HGA C;  3AN2 B;  5BS7 C;  3AZL C;  3AFA A;  4Z2M G;  5B40 D;  3WKJ D;  4Z66 D;  3C1B C;  1P3F D;  3AZH C;  4KUD C;  3AZM D;  5B1M A;  1TZY D;  4HGA B;  4H9O A;  3AZL B;  3AZI C;  4KGC A;  3MNN C;  3C1C D;  3UT9 A;  5B24 D;  3W98 A;  5FUG B;  2YFV B;  5B33 C;  5CPJ C;  3C1B B;  3B6G C;  5CPK D;  3MVD D;  3AZK A;  3B6F A;  3AZH B;  4J8X D;  4KUD B;  4XZQ A;  4G91 C;  3WTP C;  3KXB C;  3LZ1 A;  1P3P C;  3AZI B;  5B1L D;  3MNN B;  4QLC B;  1M18 C;  4WU9 A;  5CPJ B;  5B33 B;  3AZG C;  3B6G B;  4YS3 C;  1P3B D;  3A6N C;  3KSY A;  1KX5 C;  3LZ0 C;  4WU8 B;  1KX4 D;  1P3G A;  5E5A A;  4JJN D;  5JRG A;  4J8W C;  4CSR A;  4G91 B;  4E44 A;  3WTP B;  5B0Y A;  3REH D;  2RVQ D;  1S32 A;  1R4V A;  3KWQ A;  1M19 A;  3REI A;  2F8N A;  4NFT A;  3LJA B;  1P3P B;  3X1U C;  1M18 B;  3AZG B;  1P3A C;  3AZM C;  2L5A A;  4YS3 B;  3NQJ B;  1KX5 B;  5C3I C;  3LZ0 B;  1ZLA C;  3WKJ B;  5B1M D;  5B40 B;  4J8W B;  3AZN A;  5B24 C;  3MGS A;  4KGC D;  5B2J A;  2HUE C;  3UT9 D;  5BO0 A;  5BNV A;  5DNN A;  3W98 D;  3KUY D;  5B32 C;  3X1U B;  4DRB A;  5B31 C;  4AWL C;  4J8U A;  1P3A B;  3AZM B;  2LY8 A;  4H9P B;  3O62 C;  4XZQ D;  5C3I B;  1JFI A;  5GT0 C;  1ZLA B;  1U35 C;  2HIO C;  4Z66 A;  3C1C B;  5B24 B;  3LZ1 D;  3TU4 C;  2HUE B;  4LD9 C;  1P34 A;  5B31 B;  4J8X B;  4Z5T D;  4AWL B;  3AV1 C;  5B2I C;  4JJN C;  1M1A C;  2NQB C;  1P3G D;  1P3I A;  5BNX B;  5JRG D;  3AFA C;  3O62 B;  4J8V C;  5B0Y D;  3X1S A;  1S32 D;  5GT0 B;  1M19 D;  3KWQ D;  5AVB C;  1U35 B;  3REI D;  2F8N D;  5G49 B;  3TU4 B;  4UUZ B;  4ZBJ C;  3W99 A;  5F99 C;  1P3K C;  5CP6 A;  4H9Q A;  1EQZ D;  1WWI A;  3V9R B;  1P3M A;  3AV1 B;  4JJN B;  3WA9 C;  3B0C W;  5DNM A;  1M1A B;  5AV9 A;  3REH B;  1H3O A;  5KDM A;  3UTA D;  3AFA B;  4J8V B;  3MGP C;  4M6B A;  3W98 C;  3MGS D;  3AV2 A;  5B2J D;  3AZF A;  3REJ A;  2YFW A;  3B0D B;  5DNN D;  3AZK C;  3B6F C;  4J8U D;  1A7W A;  1KX4 A;  5GT3 A;  5B1M B;  5AVC A;  3WA9 B;  3W96 A;  4H9O B;  3LZ1 C;  5AV5 D;  4YM6 C;  3MGP B;  4KGC B;  4H9N A;  3VH6 W;  4WU9 C;  3REK A;  3W98 B;  3MGR A;  2CV5 A;  4XUJ A;  1P34 D;  2FJ7 A;  3AZK B;  3B6F B;  2BYK B;  5E5A C;  4XZQ B;  1M19 C;  1P3I D;  3X1S D;  3LZ1 B;  5AV6 A;  4YM6 B;  5CPI A;  3UTB A;  4QLC C;  4WU9 B;  3KUY A;  4NE5 A;  3LEL A;  3W99 D;  3AZE A;  3X1T A;  1HTA A;  3WAA C;  5CP6 D;  4EO5 C;  4X23 C;  5B0Z C;  4WU8 C;  5E5A B;  2JSS A;  1P3M D;  1KX3 A;  1ULY A;  1F66 A;  4CSR B;  5DNM D;  5B0Y B;  1ID3 C;  3AZN C;  5CHL B;  5AV9 D;  5AV8 A;  5GXQ A;  1S32 B;  1M19 B;  4KHA A;  3R45 A;  4H9S A;  4WNN B;  2F8N B;  3LJA C;  2IO5 B;  5B32 G;  3AV2 D;  1AOI A;  3AZF D;  3REJ D;  4NE3 A;  4Z5T A;  2ARO D;  3WAA B;  4WZS B;  4EO5 B;  4X23 B;  5JA4 B;  5B0Z B;  1WWS A;  5GT3 D;  3WKJ C;  5AVC D;  5B40 C;  5AY8 A;  1ID3 B;  3AZN B;  4Z66 C;  3W96 D;  3MGS B;  1P3F C;  5B2J B;  1N1J A;  4ZUX A;  4R8P A;  5BO0 B;  3W97 A;  3REK D;  3MGR D;  1P3O D;  2CV5 D;  4XUJ D;  2FJ7 D;  5BS7 A;  3AZL A;  1EQZ A;  1P3I C;  2YFV A;  1TZY C;  5BT1 D;  3UTA A;  3REL A;  3VH5 W;  1BH8 A;  4Z66 B;  3C1C C;  1BH9 A;  5AV6 D;  3AZJ A;  5CPI D;  1P3F B;  4KUD A;  3UTB D;  5CPK C;  3MVD C;  3LEL D;  1P3L D;  4J8X C;  3AZE D;  3X1T D;  3AZI A;  1TAF A;  1KX3 D;  1P3I B;  1F66 D;  5CPJ A;  1TZY B;  3B6G A;  5AV8 D;  5GXQ D;  5AV5 A;  5B1L C;  3AZF C;  2NZD A;  3X1V A;  5CPK B;  5GSU A;  3MVD B;  1AOI D;  2PYO D;  1P3B C;  5CP6 B;  3KXB A;  4H9Q B;  1KX4 C;  1P3M B;  5GT3 C;  5AVC C;  1P3P A;  5DNM B;  3REH C;  1H3O B;  2RVQ C;  3W96 C;  5KDM B;  1M18 A;  2F8N H;  5AY8 D;  4YS3 A;  3MGR C;  3NQJ A;  3A6N A;  3AV2 B;  4R8P D;  4ZUX D;  5B1L B;  4CAY A;  3REJ B;  2YFW B;  3B0D C;  3AYW A;  3AZF B;  2CV5 C;  2FJ7 C;  3W97 D;  1P3B B;  3AZL D;  1KX4 B;  5GT3 B;  5B1M C;  5AVC B;  3C1B D;  3X1U A;  3REL D;  3W96 B;  4KGC C;  3UTB C;  1P3A A;  3UT9 C;  3REK B;  3MGR B;  3KUY C;  3AZJ D;  4KUD D;  3LEL C;  3AZE C;  4XUJ B;  2CV5 B;  4WV4 B;  1ZLA A;  2FJ7 B;  1KX3 C;  3B0C T;  4XZQ C;  3AZI D;  4H9R A;  2ARO A;  5CPJ D;  5B32 A;  3B6G D;  5B31 A;  2CWE A;  3UTB B;  3UT9 B;  4G92 C;  3KUY B;  3X1V D;  2NZD D;  3LEL B;  4Z2M H;  5GSU D;  4Z5T C;  3O62 A;  3AZE B;  1P3O A;  5GT0 A;  3KXB D;  3NQU A;  2HIO A;  1P3G C;  1KX3 B;  5JRG C;  3TU4 A;  5AY8 C;  1P3P D;  5B0Y C;  4UUZ A;  1S32 C;  5AV8 B;  3KWQ C;  1M18 D;  4KHA B;  4LD9 A;  3R45 B;  3REI C;  3VH6 T;  4YS3 D;  3A6N D;  2IO5 C;  5B2I A;  3MGQ A;  3AV1 A;  3LZ0 D;  3AYW D;  1M1A A;  2NQB A;  4G92 B;  4J8V A;  1P3L A;  4J8W D;  4Z5T B;  1EQZ C;  5AVB A;  3UTA C;  3REL C;  1P3G B;  4NE6 A;  5JRG B;  5AY8 B;  3X1U D;  5F99 A;  3KWQ B;  3MGS C;  3AZJ C;  1P3K A;  3REI B;  5B2J C;  1N1J B;  4ZUX B;  4R8P B;  1P3A D;  3W97 B;  5DNN C;  1HQ3 A;  2BYM A;  3WA9 A;  5B31 G;  4J8U C;  2PYO A;  1ZLA D;  3AN2 A;  3MGP A;  1EQZ B;  1B6W A;  3UTA B;  3REL B;  5AV5 C;  5B32 D; 
#chains in the Genus database with same CATH topology
 1BH8 B;  5B31 D;  2BYK A;  2NZD C;  1BH9 B;  3X1V C;  3AZJ B;  5GSU C;  1P34 C;  5BNV B;  5DNN B;  3O62 D;  4J8U B;  5GT0 D;  4YM6 A;  1U35 D;  1TAF B;  2HIO D;  3IP4 C;  5FUG A;  3TU4 D;  3VH6 A;  3C1B A;  3X1S C;  1JFI B;  4LD9 D;  5AV5 B;  3AYW C;  3AZH A;  2NZD B;  3X1V B;  3AV1 D;  5B2I D;  3MGQ D;  3W99 C;  5GSU B;  1M1A D;  2NQB D;  1P34 B;  5CP6 C;  3KXB B;  3AFA D;  4J8V D;  4WNN A;  1P3M C;  3H0M C;  5AVB D;  5DNM C;  5AV9 C;  3MNN A;  4QLC A;  3VH5 T;  2Y2O A;  5B33 A;  2F8N K;  3X1S B;  5F99 D;  1P3K D;  3A6N B;  3WAA A;  2FFF B;  3AV2 C;  3AYW B;  3H0L C;  4CAY B;  4X23 A;  5JA4 A;  3REJ C;  5B0Z A;  4WU8 A;  1HQ3 D;  1KU5 A;  1F1E A;  3WA9 D;  3W99 B;  4DRA A;  1ID3 A;  3WTP A;  3AN2 D;  3MGP D;  2RIQ A;  2ARO C;  3LJA A;  2Y2M A;  5AV9 B;  3B0B A;  3AZK D;  3B6F D;  3AZG A;  1BFM A;  3REK C;  1KX5 A;  1P3O C;  3LZ0 A;  4XUJ C;  3WKJ A;  4E45 A;  5B40 A;  4J8W A;  4YM6 D;  5BT1 C;  1P3F A;  4H9R B;  4WU9 D;  2ARO B;  5B32 B;  2F8N G;  3A1I A;  5AV6 C;  5CPI C;  3MGQ C;  4H9N B;  3AZH D;  3AZM A;  5E5A D;  4H9P A;  1P3L C;  1P3O B;  1TZY A;  1B67 A;  3X1T C;  3NQU B;  2HIO B;  3VH5 A;  3C1C A;  5B24 A;  1F66 C;  5AV8 C;  2Y2P A;  4QLC D;  5GXQ C;  1Z2C B;  3MNN D;  3MVD A;  5CPK A;  4LD9 B;  5B33 D;  2ZY2 A;  4H9S C;  4J8X A;  1HQ3 C;  5AV6 B;  5CPI B;  5B2I B;  3MGQ B;  3WAA D;  1AOI C;  4X23 D;  2NQB B;  2PYO C;  5B0Z D;  3FDD A;  4WU8 D;  1W2E A;  3AN2 C;  5BNX A;  1P3L B;  1ID3 D;  3WTP D;  3AZN D;  3X1T B;  2Y2J A;  5AVB B;  1U35 A;  5B1L A;  3A1K A;  1F66 B;  5G49 A;  3LJA D;  4ZBJ B;  5GXQ B;  5F99 B;  1Q9C A;  1P3K B;  1P3B A;  4R8P C;  3AZG D;  4ZUX C;  3W97 C;  1HQ3 B;  3V9R A;  2BYM B;  4JJN A;  1KX5 D;  1AOI B;  2PYO B;  3REH A;  2UWX A;  3WTP E;  4HGA C;  3AN2 B;  5BS7 C;  3AZL C;  3AFA A;  2F2A C;  4Z2M G;  5B40 D;  3WKJ D;  4Z66 D;  1T3U A;  3C1B C;  1P3F D;  1PZR A;  2BG1 A;  3AZH C;  4KUD C;  3AZM D;  5B1M A;  1TZY D;  2Y2H A;  2W8S A;  4HGA B;  4H9O A;  3EPJ A;  3AZL B;  3AZI C;  4KGC A;  3MNN C;  3C1C D;  3UT9 A;  5B24 D;  3W98 A;  5FUG B;  2YFV B;  5B33 C;  5CPJ C;  3C1B B;  3B6G C;  5CPK D;  3MVD D;  3AZK A;  3B6F A;  3AZH B;  4J8X D;  4KUD B;  4XZQ A;  4G91 C;  3WTP C;  3KXB C;  3LZ1 A;  1P3P C;  3AZI B;  5B1L D;  3MNN B;  4QLC B;  1M18 C;  4WU9 A;  5CPJ B;  5B33 B;  3AZG C;  3B6G B;  4YS3 C;  1P3B D;  3A6N C;  3KSY A;  1KX5 C;  3LZ0 C;  4WU8 B;  1KX4 D;  1P3G A;  5E5A A;  4JJN D;  5JRG A;  4J8W C;  4CSR A;  4G91 B;  4E44 A;  3WTP B;  5B0Y A;  3REH D;  2RVQ D;  1S32 A;  1R4V A;  3KWQ A;  1M19 A;  3REI A;  2F8N A;  4NFT A;  3LJA B;  1P3P B;  3X1U C;  2Y2K A;  1M18 B;  3AZG B;  1P3A C;  3AZM C;  2L5A A;  4YS3 B;  3NQJ B;  1KX5 B;  3EPH A;  5C3I C;  3LZ0 B;  1ZLA C;  3WKJ B;  5B1M D;  5B40 B;  4J8W B;  3AZN A;  5B24 C;  3MGS A;  4KGC D;  5B2J A;  2HUE C;  3UT9 D;  5BO0 A;  5BNV A;  5DNN A;  3W98 D;  3KUY D;  5B32 C;  3X1U B;  4DRB A;  5B31 C;  4AWL C;  4J8U A;  1P3A B;  3AZM B;  2LY8 A;  4H9P B;  3O62 C;  4XZQ D;  5C3I B;  1JFI A;  5GT0 C;  1ZLA B;  1U35 C;  3EG5 B;  2HIO C;  4Z66 A;  3C1C B;  5B24 B;  3LZ1 D;  3TU4 C;  2JCH A;  2HUE B;  4LD9 C;  1P34 A;  5B31 B;  4J8X B;  4Z5T D;  4AWL B;  3AV1 C;  5B2I C;  4JJN C;  1M1A C;  2NQB C;  1P3G D;  1P3I A;  5BNX B;  5JRG D;  3AFA C;  3O62 B;  4J8V C;  5B0Y D;  3X1S A;  1S32 D;  5GT0 B;  1M19 D;  3KWQ D;  5AVB C;  1U35 B;  3REI D;  2F8N D;  5G49 B;  3TU4 B;  4UUZ B;  4ZBJ C;  3W99 A;  5F99 C;  1P3K C;  5CP6 A;  4H9Q A;  1EQZ D;  1WWI A;  3V9R B;  1P3M A;  3AV1 B;  2VQR A;  4JJN B;  3WA9 C;  3B0C W;  5DNM A;  1M1A B;  5AV9 A;  3REH B;  1H3O A;  5KDM A;  3UTA D;  3AFA B;  4J8V B;  3MGP C;  4M6B A;  3W98 C;  3MGS D;  3AV2 A;  5B2J D;  3AZF A;  3REJ A;  2YFW A;  3B0D B;  5DNN D;  2ZY5 A;  3AZK C;  3B6F C;  2G5I C;  4J8U D;  1A7W A;  1KX4 A;  2DF4 C;  5GT3 A;  5B1M B;  5AVC A;  3WA9 B;  2DQN C;  3W96 A;  4H9O B;  3LZ1 C;  5AV5 D;  4YM6 C;  3MGP B;  4KGC B;  4H9N A;  3VH6 W;  4WU9 C;  2ZY4 A;  3REK A;  3W98 B;  3MGR A;  3KFU G;  2CV5 A;  4XUJ A;  1P34 D;  2FJ7 A;  3AZK B;  3B6F B;  2BYK B;  5E5A C;  4XZQ B;  1M19 C;  1P3I D;  3X1S D;  3LZ1 B;  5AV6 A;  4YM6 B;  5CPI A;  3UTB A;  4QLC C;  4WU9 B;  3KUY A;  4NE5 A;  3LEL A;  3W99 D;  3AZE A;  2XD1 A;  1HTA A;  3X1T A;  3WAA C;  5CP6 D;  4EO5 C;  4X23 C;  5B0Z C;  4WU8 C;  5E5A B;  2JSS A;  1P3M D;  1KX3 A;  1ULY A;  1F66 A;  4CSR B;  5DNM D;  5B0Y B;  1ID3 C;  3AZN C;  5CHL B;  5AV9 D;  5AV8 A;  5GXQ A;  1S32 B;  1M19 B;  4KHA A;  3R45 A;  4H9S A;  4WNN B;  2F8N B;  3LJA C;  2IO5 B;  5B32 G;  3AV2 D;  1AOI A;  3AZF D;  3REJ D;  2ZM5 A;  4NE3 A;  4Z5T A;  2ARO D;  3WAA B;  4WZS B;  4EO5 B;  3F6T A;  4X23 B;  5JA4 B;  5B0Z B;  1WWS A;  2JE5 A;  5GT3 D;  5AVC D;  3WKJ C;  5B40 C;  5AY8 A;  1ID3 B;  3AZN B;  3P5J B;  4Z66 C;  3W96 D;  3MGS B;  1P3F C;  5B2J B;  1N1J A;  4ZUX A;  4R8P A;  5BO0 B;  3W97 A;  3REK D;  3MGR D;  1P3O D;  2CV5 D;  4XUJ D;  2FJ7 D;  5BS7 A;  3AZL A;  4UPK A;  3AL0 C;  1EQZ A;  2Y2I A;  1P3I C;  2YFV A;  1TZY C;  5BT1 D;  3UTA A;  3REL A;  3VH5 W;  1BH8 A;  4Z66 B;  3C1C C;  1BH9 A;  5AV6 D;  3AZJ A;  2Y2G A;  5CPI D;  1P3F B;  3UTB D;  5CPK C;  4KUD A;  3MVD C;  3LEL D;  1P3L D;  4J8X C;  3AZE D;  3X1T D;  3AZI A;  1TAF A;  1KX3 D;  1P3I B;  1F66 D;  5CPJ A;  1TZY B;  4DQY B;  3B6G A;  5AV8 D;  5GXQ D;  5AV5 A;  2Y2N A;  5B1L C;  3AZF C;  2NZD A;  3X1V A;  2G5H C;  4WJ3 C;  5CPK B;  5GSU A;  3MVD B;  1AOI D;  2PYO D;  1P3B C;  5CP6 B;  3KXB A;  4H9Q B;  1KX4 C;  1P3M B;  5GT3 C;  5AVC C;  1P3P A;  5DNM B;  3REH C;  1H3O B;  2RVQ C;  3W96 C;  5KDM B;  1M18 A;  2F8N H;  5AY8 D;  4YS3 A;  3MGR C;  3NQJ A;  3A6N A;  3AV2 B;  4R8P D;  4ZUX D;  5B1L B;  4CAY A;  3REJ B;  2YFW B;  3B0D C;  3AYW A;  3AZF B;  2CV5 C;  2FJ7 C;  3W97 D;  1P3B B;  3AZL D;  2J8P A;  1KX4 B;  5GT3 B;  5B1M C;  5AVC B;  3C1B D;  3X1U A;  3REL D;  3W96 B;  4KGC C;  2XD5 A;  3UTB C;  1P3A A;  3UT9 C;  3REK B;  3MGR B;  3KUY C;  3AZJ D;  4KUD D;  3LEL C;  3AZE C;  4XUJ B;  2CV5 B;  4WV4 B;  1ZLA A;  2FJ7 B;  1KX3 C;  3B0C T;  4XZQ C;  3AZI D;  4H9R A;  2ARO A;  5CPJ D;  5B32 A;  3B6G D;  5B31 A;  2CWE A;  3EPL A;  3UTB B;  3UT9 B;  4G92 C;  3KUY B;  3X1V D;  2NZD D;  3LEL B;  4Z2M H;  5GSU D;  4Z5T C;  3O62 A;  3AZE B;  1P3O A;  5GT0 A;  3KXB D;  3NQU A;  2HIO A;  1P3G C;  1KX3 B;  5JRG C;  3TU4 A;  5AY8 C;  1P3P D;  5B0Y C;  4UUZ A;  1S32 C;  5AV8 B;  3KWQ C;  1M18 D;  4KHA B;  4LD9 A;  3R45 B;  3REI C;  3VH6 T;  4YS3 D;  3A6N D;  2IO5 C;  5B2I A;  3MGQ A;  3AV1 A;  3LZ0 D;  3AYW D;  1M1A A;  2NQB A;  4G92 B;  4J8V A;  1P3L A;  4J8W D;  4Z5T B;  1EQZ C;  5AVB A;  3UTA C;  3REL C;  1P3G B;  4NE6 A;  5JRG B;  5AY8 B;  3X1U D;  5F99 A;  3KWQ B;  3MGS C;  3AZJ C;  1P3K A;  3REI B;  5B2J C;  1N1J B;  4ZUX B;  3H0R C;  4R8P B;  1P3A D;  3W97 B;  5DNN C;  1HQ3 A;  2BYM A;  3WA9 A;  5B31 G;  4J8U C;  2PYO A;  3EPK A;  1ZLA D;  2Y2L A;  3AN2 A;  3MGP A;  1EQZ B;  2ZY3 A;  1B6W A;  3UTA B;  3REL B;  5AV5 C;  2Y2Q A;  5B32 D; 
#chains in the Genus database with same CATH homology
 1BH8 B;  5B31 D;  2BYK A;  2NZD C;  1BH9 B;  3X1V C;  3AZJ B;  5GSU C;  1P34 C;  5BNV B;  5DNN B;  3O62 D;  4J8U B;  5GT0 D;  4YM6 A;  1U35 D;  1TAF B;  2HIO D;  3IP4 C;  5FUG A;  3TU4 D;  3VH6 A;  3C1B A;  3X1S C;  1JFI B;  4LD9 D;  5AV5 B;  3AYW C;  3AZH A;  2NZD B;  3X1V B;  3AV1 D;  5B2I D;  3MGQ D;  3W99 C;  5GSU B;  1M1A D;  2NQB D;  1P34 B;  5CP6 C;  3KXB B;  3AFA D;  4J8V D;  4WNN A;  1P3M C;  3H0M C;  5AVB D;  5DNM C;  5AV9 C;  3MNN A;  4QLC A;  3VH5 T;  2Y2O A;  5B33 A;  2F8N K;  3X1S B;  5F99 D;  1P3K D;  3A6N B;  3WAA A;  2FFF B;  3AV2 C;  3AYW B;  3H0L C;  4CAY B;  4X23 A;  5JA4 A;  3REJ C;  5B0Z A;  4WU8 A;  1HQ3 D;  1KU5 A;  1F1E A;  3WA9 D;  3W99 B;  4DRA A;  1ID3 A;  3WTP A;  3AN2 D;  3MGP D;  2RIQ A;  2ARO C;  3LJA A;  2Y2M A;  5AV9 B;  3B0B A;  3AZK D;  3B6F D;  3AZG A;  1BFM A;  3REK C;  1KX5 A;  1P3O C;  3LZ0 A;  4XUJ C;  3WKJ A;  4E45 A;  5B40 A;  4J8W A;  4YM6 D;  5BT1 C;  1P3F A;  4H9R B;  4WU9 D;  2ARO B;  5B32 B;  2F8N G;  3A1I A;  5AV6 C;  5CPI C;  3MGQ C;  4H9N B;  3AZH D;  3AZM A;  5E5A D;  4H9P A;  1P3L C;  1P3O B;  1TZY A;  1B67 A;  3X1T C;  3NQU B;  2HIO B;  3VH5 A;  3C1C A;  5B24 A;  1F66 C;  5AV8 C;  2Y2P A;  4QLC D;  5GXQ C;  1Z2C B;  3MNN D;  3MVD A;  5CPK A;  4LD9 B;  5B33 D;  2ZY2 A;  4H9S C;  4J8X A;  1HQ3 C;  5AV6 B;  5CPI B;  5B2I B;  3MGQ B;  3WAA D;  1AOI C;  4X23 D;  2NQB B;  2PYO C;  5B0Z D;  3FDD A;  4WU8 D;  1W2E A;  3AN2 C;  5BNX A;  1P3L B;  1ID3 D;  3WTP D;  3AZN D;  3X1T B;  2Y2J A;  5AVB B;  1U35 A;  5B1L A;  3A1K A;  1F66 B;  5G49 A;  3LJA D;  4ZBJ B;  5GXQ B;  5F99 B;  1Q9C A;  1P3K B;  1P3B A;  4R8P C;  3AZG D;  4ZUX C;  3W97 C;  1HQ3 B;  3V9R A;  2BYM B;  4JJN A;  1KX5 D;  1AOI B;  2PYO B;  3REH A;  2UWX A;  3WTP E;  4HGA C;  3AN2 B;  5BS7 C;  3AZL C;  3AFA A;  2F2A C;  4Z2M G;  5B40 D;  3WKJ D;  4Z66 D;  1T3U A;  3C1B C;  1P3F D;  1PZR A;  2BG1 A;  3AZH C;  4KUD C;  3AZM D;  5B1M A;  1TZY D;  2Y2H A;  2W8S A;  4HGA B;  4H9O A;  3EPJ A;  3AZL B;  3AZI C;  4KGC A;  3MNN C;  3C1C D;  3UT9 A;  5B24 D;  3W98 A;  5FUG B;  2YFV B;  5B33 C;  5CPJ C;  3C1B B;  3B6G C;  5CPK D;  3MVD D;  3AZK A;  3B6F A;  3AZH B;  4J8X D;  4KUD B;  4XZQ A;  4G91 C;  3WTP C;  3KXB C;  3LZ1 A;  1P3P C;  3AZI B;  5B1L D;  3MNN B;  4QLC B;  1M18 C;  4WU9 A;  5CPJ B;  5B33 B;  3AZG C;  3B6G B;  4YS3 C;  1P3B D;  3A6N C;  3KSY A;  1KX5 C;  3LZ0 C;  4WU8 B;  1KX4 D;  1P3G A;  5E5A A;  4JJN D;  5JRG A;  4J8W C;  4CSR A;  4G91 B;  4E44 A;  3WTP B;  5B0Y A;  3REH D;  2RVQ D;  1S32 A;  1R4V A;  3KWQ A;  1M19 A;  3REI A;  2F8N A;  4NFT A;  3LJA B;  1P3P B;  3X1U C;  2Y2K A;  1M18 B;  3AZG B;  1P3A C;  3AZM C;  2L5A A;  4YS3 B;  3NQJ B;  1KX5 B;  3EPH A;  5C3I C;  3LZ0 B;  1ZLA C;  3WKJ B;  5B1M D;  5B40 B;  4J8W B;  3AZN A;  5B24 C;  3MGS A;  4KGC D;  5B2J A;  2HUE C;  3UT9 D;  5BO0 A;  5BNV A;  5DNN A;  3W98 D;  3KUY D;  5B32 C;  3X1U B;  4DRB A;  5B31 C;  4AWL C;  4J8U A;  1P3A B;  3AZM B;  2LY8 A;  4H9P B;  3O62 C;  4XZQ D;  5C3I B;  1JFI A;  5GT0 C;  1ZLA B;  1U35 C;  3EG5 B;  2HIO C;  4Z66 A;  3C1C B;  5B24 B;  3LZ1 D;  3TU4 C;  2JCH A;  2HUE B;  4LD9 C;  1P34 A;  5B31 B;  4J8X B;  4Z5T D;  4AWL B;  3AV1 C;  5B2I C;  4JJN C;  1M1A C;  2NQB C;  1P3G D;  1P3I A;  5BNX B;  5JRG D;  3AFA C;  3O62 B;  4J8V C;  5B0Y D;  3X1S A;  1S32 D;  5GT0 B;  1M19 D;  3KWQ D;  5AVB C;  1U35 B;  3REI D;  2F8N D;  5G49 B;  3TU4 B;  4UUZ B;  4ZBJ C;  3W99 A;  5F99 C;  1P3K C;  5CP6 A;  4H9Q A;  1EQZ D;  1WWI A;  3V9R B;  1P3M A;  3AV1 B;  2VQR A;  4JJN B;  3WA9 C;  3B0C W;  5DNM A;  1M1A B;  5AV9 A;  3REH B;  1H3O A;  5KDM A;  3UTA D;  3AFA B;  4J8V B;  3MGP C;  4M6B A;  3W98 C;  3MGS D;  3AV2 A;  5B2J D;  3AZF A;  3REJ A;  2YFW A;  3B0D B;  5DNN D;  2ZY5 A;  3AZK C;  3B6F C;  2G5I C;  4J8U D;  1A7W A;  1KX4 A;  2DF4 C;  5GT3 A;  5B1M B;  5AVC A;  3WA9 B;  2DQN C;  3W96 A;  4H9O B;  3LZ1 C;  5AV5 D;  4YM6 C;  3MGP B;  4KGC B;  4H9N A;  3VH6 W;  4WU9 C;  2ZY4 A;  3REK A;  3W98 B;  3MGR A;  3KFU G;  2CV5 A;  4XUJ A;  1P34 D;  2FJ7 A;  3AZK B;  3B6F B;  2BYK B;  5E5A C;  4XZQ B;  1M19 C;  1P3I D;  3X1S D;  3LZ1 B;  5AV6 A;  4YM6 B;  5CPI A;  3UTB A;  4QLC C;  4WU9 B;  3KUY A;  4NE5 A;  3LEL A;  3W99 D;  3AZE A;  2XD1 A;  1HTA A;  3X1T A;  3WAA C;  5CP6 D;  4EO5 C;  4X23 C;  5B0Z C;  4WU8 C;  5E5A B;  2JSS A;  1P3M D;  1KX3 A;  1ULY A;  1F66 A;  4CSR B;  5DNM D;  5B0Y B;  1ID3 C;  3AZN C;  5CHL B;  5AV9 D;  5AV8 A;  5GXQ A;  1S32 B;  1M19 B;  4KHA A;  3R45 A;  4H9S A;  4WNN B;  2F8N B;  3LJA C;  2IO5 B;  5B32 G;  3AV2 D;  1AOI A;  3AZF D;  3REJ D;  2ZM5 A;  4NE3 A;  4Z5T A;  2ARO D;  3WAA B;  4WZS B;  4EO5 B;  3F6T A;  4X23 B;  5JA4 B;  5B0Z B;  1WWS A;  2JE5 A;  5GT3 D;  5AVC D;  3WKJ C;  5B40 C;  5AY8 A;  1ID3 B;  3AZN B;  3P5J B;  4Z66 C;  3W96 D;  3MGS B;  1P3F C;  5B2J B;  1N1J A;  4ZUX A;  4R8P A;  5BO0 B;  3W97 A;  3REK D;  3MGR D;  1P3O D;  2CV5 D;  4XUJ D;  2FJ7 D;  5BS7 A;  3AZL A;  4UPK A;  3AL0 C;  1EQZ A;  2Y2I A;  1P3I C;  2YFV A;  1TZY C;  5BT1 D;  3UTA A;  3REL A;  3VH5 W;  1BH8 A;  4Z66 B;  3C1C C;  1BH9 A;  5AV6 D;  3AZJ A;  2Y2G A;  5CPI D;  1P3F B;  3UTB D;  5CPK C;  4KUD A;  3MVD C;  3LEL D;  1P3L D;  4J8X C;  3AZE D;  3X1T D;  3AZI A;  1TAF A;  1KX3 D;  1P3I B;  1F66 D;  5CPJ A;  1TZY B;  4DQY B;  3B6G A;  5AV8 D;  5GXQ D;  5AV5 A;  2Y2N A;  5B1L C;  3AZF C;  2NZD A;  3X1V A;  2G5H C;  4WJ3 C;  5CPK B;  5GSU A;  3MVD B;  1AOI D;  2PYO D;  1P3B C;  5CP6 B;  3KXB A;  4H9Q B;  1KX4 C;  1P3M B;  5GT3 C;  5AVC C;  1P3P A;  5DNM B;  3REH C;  1H3O B;  2RVQ C;  3W96 C;  5KDM B;  1M18 A;  2F8N H;  5AY8 D;  4YS3 A;  3MGR C;  3NQJ A;  3A6N A;  3AV2 B;  4R8P D;  4ZUX D;  5B1L B;  4CAY A;  3REJ B;  2YFW B;  3B0D C;  3AYW A;  3AZF B;  2CV5 C;  2FJ7 C;  3W97 D;  1P3B B;  3AZL D;  2J8P A;  1KX4 B;  5GT3 B;  5B1M C;  5AVC B;  3C1B D;  3X1U A;  3REL D;  3W96 B;  4KGC C;  2XD5 A;  3UTB C;  1P3A A;  3UT9 C;  3REK B;  3MGR B;  3KUY C;  3AZJ D;  4KUD D;  3LEL C;  3AZE C;  4XUJ B;  2CV5 B;  4WV4 B;  1ZLA A;  2FJ7 B;  1KX3 C;  3B0C T;  4XZQ C;  3AZI D;  4H9R A;  2ARO A;  5CPJ D;  5B32 A;  3B6G D;  5B31 A;  2CWE A;  3EPL A;  3UTB B;  3UT9 B;  4G92 C;  3KUY B;  3X1V D;  2NZD D;  3LEL B;  4Z2M H;  5GSU D;  4Z5T C;  3O62 A;  3AZE B;  1P3O A;  5GT0 A;  3KXB D;  3NQU A;  2HIO A;  1P3G C;  1KX3 B;  5JRG C;  3TU4 A;  5AY8 C;  1P3P D;  5B0Y C;  4UUZ A;  1S32 C;  5AV8 B;  3KWQ C;  1M18 D;  4KHA B;  4LD9 A;  3R45 B;  3REI C;  3VH6 T;  4YS3 D;  3A6N D;  2IO5 C;  5B2I A;  3MGQ A;  3AV1 A;  3LZ0 D;  3AYW D;  1M1A A;  2NQB A;  4G92 B;  4J8V A;  1P3L A;  4J8W D;  4Z5T B;  1EQZ C;  5AVB A;  3UTA C;  3REL C;  1P3G B;  4NE6 A;  5JRG B;  5AY8 B;  3X1U D;  5F99 A;  3KWQ B;  3MGS C;  3AZJ C;  1P3K A;  3REI B;  5B2J C;  1N1J B;  4ZUX B;  3H0R C;  4R8P B;  1P3A D;  3W97 B;  5DNN C;  1HQ3 A;  2BYM A;  3WA9 A;  5B31 G;  4J8U C;  2PYO A;  3EPK A;  1ZLA D;  2Y2L A;  3AN2 A;  3MGP A;  1EQZ B;  2ZY3 A;  1B6W A;  3UTA B;  3REL B;  5AV5 C;  2Y2Q A;  5B32 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...