3AZMD

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
b'KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmD00
3UTAA 3REID 3W99A 5GXQA 5AV8D 3A6ND 3C1BA 1P3MC 2HIOB 3B6FB 3UT9A 3AV2D 3AZMB 1BH8B 4XZQA 4J8VC 1P3FB 5AV5D 3B6GC 3RELC 3A6NC 2NQBA 5B31D 4EO5B 1M18B 4R8PA 5AVBA 3AV2C 1BFMA 3AV1B 3AZHD 2HIOD 3B6FD 3B0CT 4G92B 5CPJA 5AV5C 1P3FD 5B31G 3W96D 5DNMA 4LD9A 3NQJA 5B31C 3AZKA 3REHB 4AWLC 3AZHC 1M18D 2HIOC 3B6FC 1KX4B 5F99B 4KUDD 3AV1D 4Z66A 1P3FC 3W96C 5CP6A 1F1EA 3VH5A 1KU5A 3W97A 5GT3D 3KUYB 4E44A 4X23A 5B2ID 4JJNA 3R45B 4KUDC 3UT9B 1P3BC 1ID3A 3WAAC 5AV6A 1KX4D 1EQZB 5GT3C 3REKB 2HUEB 1WWIA 3B0DC 5FUGB 4QLCD 3REJB 3AZGA 1U35A 4WNNA 2NZDA 1M19A 5B32A 5B2IC 4YM6A 1P34D 1M1AA 3KXBB 4YS3A 4NE6A 4R8PB 1KX4C 4ZUXC 3TU4A 1P3IA 3LZ0A 5AV9D 5B2JA 3KSYA 3O62B 4QLCC 4NFTA 1P3PC 5AVCA 3REKD 4M6BA 3KWQB 5B1MB 1P34C 2PYOA 1ZLAC 4WU9B 3VH5W 2L5AA 2RVQD 5B1LC 1P3KD 2FJ7C 4J8WB 3KXBD 1A7WA 1P3MA 5AV9C 3X1UB 5B0YD 3MGQD 3AZFD 4J8VA 4Z5TA 2HUEC 5GT0A 3B6GA 3W97B 3RELA 5C3IC 4H9OA 3MGRB 3LZ1A 1HTAA 5E5AD 2RVQC 3KWQD 1P3KC 5B1MD 4CSRA 4X23B 3X1VB 4WU9D 1TZYB 3W98C 3AV2A 3MGQC 5B0YC 4J8WD 3AZFC 1ID3B 3MNND 4WU8B 3X1UD 5AV5A 3WTPD 3AZGB 5E5AC 5B1MC 5B32B 4YM6B 1M1AB 3AZJD 4WU9C 4HGAB 5B24B 5G49A 3MGSB 4J8WC 3X1VD 3MNNC 4KGCA 4H9PB 3X1UC 3LZ0B 3LJAD 5B2JB 3WTPC 4WU8D 5AVCB 3W96A 4H9SC 4J8UB 5JA4B 2YFVB 3AZJC 1S32A 5DNNA 4NE5A 5B40D 5BNXA 3AN2D 1P3AC 3MVDA 5B24D 1P3OD 3MGSD 2CV5D 3LJAC 1P3BA 1KX3D 4WU8C 2IO5B 3WAAA 1AOIB 1P3LC 3C1CB 5GT0B 4G91B 3AZND 5GT3A 3AZLB 1KX5B 3UTBD 4H9OB 4J8UD 2LY8A 2AROD 1P3GA 3V9RA 5B2IA 5B40C 3AN2C 1P3OC 2CV5C 1F66B 1KX3C 3VH6A 4ZUXA 4XUJB 1Q9CA 3REIC 5GSUA 3AZNC 5AV8C 1AOID 4QLCA 1P3PA 3UTBC 3C1CD 4J8UC 2AROC 1R4VA 3WA9A 5BS7C 3WKJA 4CAYA 1ZLAA 3AFAB 2YFWB 5B1LA 3AZMD 2FJ7A 1H3OA 2IO5C 4E45A 4XUJD 2F8NB 5B33A 5BNVB 3C1CC 4G91C 4J8XB 5CPIA 3AZIB 5JRGB 3MGPB 1S32B 5DNNB 1P3KA 3AZMC 3X1SB 5BNXB 1HQ3A 3W98A 5BO0A 5B0YA 3MGQA 3AZEB 3AYWA 3UTAB 4H9RA 5CPKA 3W99B 5GXQB 3VH6W 2F8ND 4EO5C 1M18C 3C1BB 3NQUA 3REHD 4J8XD 3AZID 5JRGD 3AV1C 4UUZA 4G92C 5F99D 4XZQB 3X1SD 2F8NG 1TAFA 3MNNA 4KHAA 3LELA 3AZED 3X1TA 2NQBB 4DRAA 3REHC 4J8XC 3KUYD 3UTAD 3W99D 4H9SA 5JRGC 5AVBB 3WA9B 1N1JA 3C1BD 4CAYB 5F99C 3UT9D 5CPJB 3X1SC 1EQZD 4XZQD 5DNMB 5KDMA 1P3AA 4LD9B 3WTPE 5AY8A 3NQJB 3REJD 5B0ZA 2F8NK 3AZKB 3KUYC 3UTAC 1JFIA 3VH5T 1P3LA 1B67A 2NQBD 3C1BC 4R8PD 3UT9C 5AVBD 1EQZC 4Z66B 4XZQC 1ULYA 5B40A 3REKC 5CP6B 3O62D 3B0BA 3REJC 4LD9D 4H9RB 3REIA 5CPKB 2NQBC 4JJNB 5AV8A 3A6NA 3AZKD 3NQUB 3KXBC 4R8PC 3UTBA 5BS7A 5AV6B 3O62C 4Z66D 4H9QA 4ZBJB 4NE3A 5CP6D 3KWQC 3X1TB 4WNNB 1U35B 3W97D 1M19B 2NZDB 3AZKC 5B31A 3MGRD 4YS3B 4X23D 4JJND 1N1JB 1BH9A 3AZHA 2HIOA 3B6FA 3TU4B 1TZYD 1P3IB 4Z66C 1ID3D 3AZMA 1P3FA 5KDMB 3W97C 5AY8B 3AZGD 2PYOB 5B0ZB 3MGRC 1U35D 4X23C 1M19D 5B32D 2BYKA 2NZDD 4YM6D 3X1VC 1M1AD 1M18A 4YS3D 1TZYC 1P3MB 4KUDA 1ID3C 3AV1A 3TU4D 1P3ID 3LZ0D 2F8NH 4J8VB 4Z5TB 5B2JD 5B32G 3AZGC 3B6GB 5AVCD 3RELB 1U35C 3LZ1B 1M19C 5B32C 2NZDC 4YM6C 4H9NA 4CSRB 1M1AC 2PYOD 4Z2MH 4HGAC 5B24C 3MGSC 3AV2B 3TU4C 1KX4A 2JSSA 5F99A 1P3IC 3LZ0C 5B2JC 5AV5B 5AVCC 4Z5TD 5GT0D 3B6GD 3AZLD 1KX5D 5B31B 1P34A 3LZ1D 3KUYA 4AWLB 5G49B 3R45A 1BH9B 3AZHB 4KGCB 2CWEA 1F66D 5AV9A 1AOIC 1EQZA 4Z5TC 3W96B 5GT0C 3REKA 5FUGA 3AZLC 1KX5C 3REJA 1WWSA 3LZ1C 2BYKB 3KXBA 3AFAD 1F66C 4KUDB 3MVDB 1P3BB 3AZFA 4XUJC 4WZSB 4KGCD 3WAAB 3B0CW 1B6WA 3O62A 3VH6T 5GT3B 3B0DB 5E5AA 3KWQA 4H9NB 5B1MA 3MGPD 5CHLB 3V9RB 5B2IB 1P3GB 1S32D 4WU9A 5DNND 3AFAC 4J8WA 4KGCC 4ZUXB 3MVDD 1P3BD 5GSUB 3X1UA 3WAAD 3WTPA 4QLCB 1P3PB 5GXQD 3AZIC 3WKJB 3MGPC 4Z2MG 1P34B 1S32C 3AZJA 5DNNC 3MGRA 1ZLAB 1P3GD 5B1LB 3X1VA 2FJ7B 3MVDC 4DRBA 1H3OB 1TZYA 3AZEC 5AV9B 3LJAA 4ZUXD 4WU8A 5B33B 3W99C 5GSUD 5GXQC 5CPIB 1P3PD 5C3IB 3WA9D 1P3GC 3WKJD 1P3KB 1ZLAD 5CPJD 3AN2A 1P3OA 5B1LD 1HQ3B 5B24A 3MGSA 2CV5A 2FJ7D 3W98B 5BO0B 5BT1D 5B0YB 3MGQB 3AZFB 5DNMD 1KX3A 3AYWB 4H9PA 5GSUC 3AZNA 5B33D 5CPID 5AVBC 3WA9C 4J8UA 5E5AB 2BYMA 3WKJC 2AROA 4UUZB 5JA4A 2YFVA 5CPJC 5BT1C 1TAFB 5DNMC 3MNNB 4LD9C 1HQ3D 3W98D 4KHAB 3LELB 3WTPB 4WV4B 5B33C 3AYWD 1AOIA 5CPIC 3C1CA 5CPKD 3AZLA 1KX5A 3AZJB 5AV6D 1BH8A 1HQ3C 5CP6C 1P3AB 1F66A 3LJAB 3AYWC 4XUJA 3X1TD 3LELD 5CPKC 1JFIB 1P3LB 4JJNC 5AV6C 5B40B 3AFAA 3AN2B 1P3OB 2YFWA 4ZBJC 2CV5B 1KX3B 1P3AD 3X1TC 3LELC 5AY8D 3REIB 5B0ZD 5AV8B 3A6NB 3AZNB 2F8NA 5BNVA 4YS3C 3REHA 3UTBB 1P3LD 4J8XA 2BYMB 2AROB 5JRGA 3AZIA 3MGPA 1P3MD 4H9QB 3X1SA 4J8VD 5AY8C 3AZEA 3RELD 2PYOC 5B0ZC
chains in the Genus database with same CATH superfamily
3EG5B 3UTAA 3REID 3W99A 5GXQA 5AV8D 3A6ND 3C1BA 1P3MC 2HIOB 3B6FB 3UT9A 3AV2D 3AZMB 1BH8B 4XZQA 4J8VC 1P3FB 2Y2QA 5AV5D 3B6GC 2ZM5A 3RELC 3A6NC 2NQBA 5B31D 4EO5B 1M18B 3KFUG 4R8PA 5AVBA 3AV2C 3F6TA 1BFMA 3AV1B 3AZHD 2HIOD 3B6FD 3B0CT 2Y2PA 4G92B 1PZRA 5CPJA 5AV5C 1P3FD 5B31G 3W96D 5DNMA 4LD9A 3A1KA 2UWXA 3NQJA 5B31C 3AZKA 3REHB 4AWLC 2RIQA 3AZHC 2HIOC 1M18D 3B6FC 1KX4B 5F99B 4KUDD 3AV1D 4Z66A 1P3FC 3W96C 2G5IC 5CP6A 1F1EA 3VH5A 1KU5A 3W97A 5GT3D 5B0ZC 2XD1A 3KUYB 4E44A 4X23A 5B2ID 4JJNA 3R45B 4KUDC 2Y2NA 3UT9B 1P3BC 1ID3A 3WAAC 5AV6A 1KX4D 1EQZB 5GT3C 3REKB 2HUEB 1WWIA 3B0DC 5FUGB 4QLCD 3REJB 3AZGA 1U35A 4WNNA 2NZDA 1M19A 5B32A 5B2IC 2Y2MA 4YM6A 1P34D 1M1AA 3KXBB 4YS3A 4NE6A 4R8PB 1KX4C 4ZUXC 3TU4A 1P3IA 3LZ0A 5AV9D 5B2JA 3KSYA 3O62B 2FFFB 4NFTA 4QLCC 1P3PC 5AVCA 3REKD 4M6BA 3KWQB 5B1MB 1P34C 2PYOA 1ZLAC 4WU9B 3VH5W 2L5AA 2RVQD 5B1LC 1P3KD 2FJ7C 4J8WB 3KXBD 1A7WA 1P3MA 5AV9C 3X1UB 5B0YD 3MGQD 3AZFD 4J8VA 4Z5TA 2HUEC 5GT0A 3B6GA 3W97B 3RELA 5C3IC 2JCHA 4H9OA 3LZ1A 3MGRB 1HTAA 5E5AD 2RVQC 3KWQD 1P3KC 5B1MD 4CSRA 4X23B 3X1VB 4WU9D 3AL0C 1TZYB 3W98C 3AV2A 3MGQC 5B0YC 4J8WD 3AZFC 1ID3B 3MNND 4WU8B 3X1UD 5AV5A 3WTPD 3AZGB 2XD5A 5E5AC 5B1MC 5B32B 4YM6B 1M1AB 3AZJD 4WU9C 4HGAB 5B24B 5G49A 3MGSB 4J8WC 3X1VD 3MNNC 4KGCA 4H9PB 3X1UC 3LZ0B 3LJAD 5B2JB 3WTPC 4WU8D 5AVCB 3W96A 4H9SC 4J8UB 5JA4B 2YFVB 3AZJC 1S32A 5DNNA 4NE5A 5B40D 5BNXA 3AN2D 1P3AC 3MVDA 5B24D 1P3OD 3MGSD 2CV5D 3LJAC 1P3BA 1KX3D 4WU8C 2IO5B 3WAAA 1AOIB 1W2EA 1P3LC 3C1CB 5GT0B 4G91B 3AZND 5GT3A 3AZLB 1KX5B 3EPHA 3UTBD 4H9OB 4J8UD 2LY8A 2AROD 1P3GA 3V9RA 5B2IA 5B40C 3AN2C 1P3OC 2CV5C 1F66B 1KX3C 3VH6A 4ZUXA 4XUJB 1Q9CA 3REIC 5GSUA 3AZNC 5AV8C 2Y2JA 1AOID 4QLCA 1P3PA 3UTBC 3C1CD 4J8UC 2AROC 1R4VA 3WA9A 5BS7C 3WKJA 4CAYA 1ZLAA 3AFAB 2YFWB 5B1LA 3AZMD 2FJ7A 2W8SA 1H3OA 2IO5C 4E45A 4XUJD 2F8NB 5B33A 5BNVB 3C1CC 4G91C 4J8XB 5CPIA 3AZIB 2ZY4A 5JRGB 3MGPB 1S32B 5DNNB 1P3KA 3AZMC 2Y2OA 3X1SB 5BNXB 1HQ3A 3W98A 5BO0A 5B0YA 3MGQA 3AZEB 3AYWA 3UTAB 4H9RA 5CPKA 3W99B 5GXQB 3VH6W 2F8ND 4EO5C 1M18C 3C1BB 3NQUA 2ZY3A 3REHD 4J8XD 3AZID 5JRGD 3AV1C 4UUZA 4G92C 5F99D 4XZQB 3X1SD 2F8NG 1TAFA 3MNNA 4KHAA 3LELA 3AZED 3X1TA 2NQBB 4DRAA 3REHC 2F2AC 4J8XC 3KUYD 3UTAD 3W99D 4H9SA 5JRGC 5AVBB 3WA9B 1N1JA 3C1BD 4CAYB 5F99C 3UT9D 5CPJB 3X1SC 1EQZD 4XZQD 5DNMB 5KDMA 1P3AA 4LD9B 3WTPE 5AY8A 3NQJB 3REJD 5B0ZA 2F8NK 3AZKB 3KUYC 3UTAC 1JFIA 3VH5T 1P3LA 1B67A 2NQBD 3C1BC 4R8PD 3UT9C 5AVBD 1EQZC 4Z66B 4XZQC 1ULYA 5B40A 3REKC 5CP6B 3O62D 3B0BA 3REJC 4LD9D 4H9RB 3IP4C 3REIA 5CPKB 2NQBC 4JJNB 5AV8A 3A6NA 3AZKD 4WJ3C 3NQUB 3KXBC 4R8PC 3UTBA 5BS7A 5AV6B 3O62C 4Z66D 4H9QA 4ZBJB 4NE3A 5CP6D 3KWQC 3X1TB 4WNNB 1U35B 3W97D 1M19B 2NZDB 3AZKC 5B31A 3MGRD 4YS3B 4X23D 4JJND 1N1JB 1BH9A 3AZHA 2HIOA 3H0RC 3TU4B 3B6FA 1TZYD 1P3IB 4Z66C 3EPJA 1ID3D 3AZMA 3P5JB 1P3FA 5KDMB 3W97C 5AY8B 3AZGD 2PYOB 5B0ZB 3MGRC 1U35D 4X23C 1M19D 5B32D 2BYKA 2NZDD 4YM6D 3X1VC 2VQRA 1M1AD 1M18A 4YS3D 1TZYC 2ZY5A 1P3MB 4KUDA 1ID3C 2J8PA 3AV1A 3TU4D 2Y2IA 1T3UA 1P3ID 3LZ0D 2F8NH 4J8VB 4Z5TB 5B2JD 2Y2GA 5B32G 3AZGC 3B6GB 5AVCD 3RELB 1U35C 3LZ1B 1M19C 5B32C 2NZDC 4YM6C 4H9NA 4CSRB 1M1AC 2PYOD 4Z2MH 4HGAC 5B24C 3MGSC 3AV2B 3TU4C 1KX4A 2JSSA 5F99A 1P3IC 3LZ0C 5B2JC 5AV5B 5AVCC 4Z5TD 3EPKA 5GT0D 3B6GD 3AZLD 1KX5D 2DF4C 5B31B 1P34A 3LZ1D 3KUYA 4AWLB 5G49B 3R45A 1BH9B 3AZHB 4KGCB 2CWEA 1F66D 3H0MC 2ZY2A 5AV9A 1AOIC 1EQZA 4Z5TC 3W96B 5GT0C 4UPKA 3REKA 5FUGA 3AZLC 1KX5C 3REJA 1WWSA 3LZ1C 2BYKB 3KXBA 3AFAD 1F66C 4KUDB 3MVDB 1P3BB 3AZFA 4XUJC 4WZSB 4KGCD 3WAAB 3B0CW 1B6WA 3O62A 3VH6T 5GT3B 3B0DB 2Y2HA 1Z2CB 5E5AA 3KWQA 4H9NB 5B1MA 3MGPD 5CHLB 3V9RB 5B2IB 1P3GB 1S32D 4WU9A 5DNND 2Y2KA 3AFAC 2Y2LA 4J8WA 4KGCC 4ZUXB 3MVDD 1P3BD 5GSUB 3X1UA 3WAAD 3WTPA 2DQNC 4QLCB 1P3PB 5GXQD 3AZIC 3WKJB 3MGPC 4Z2MG 1P34B 1S32C 3AZJA 5DNNC 3MGRA 1ZLAB 3H0LC 1P3GD 5B1LB 3X1VA 2FJ7B 3MVDC 4DRBA 1H3OB 1TZYA 3AZEC 5AV9B 3LJAA 4ZUXD 4WU8A 5B33B 3W99C 5GSUD 5GXQC 5CPIB 1P3PD 5C3IB 3WA9D 1P3GC 3WKJD 1P3KB 1ZLAD 4DQYB 5CPJD 3AN2A 1P3OA 5B1LD 1HQ3B 5B24A 3MGSA 2CV5A 2FJ7D 3W98B 5BO0B 5BT1D 5B0YB 3MGQB 3AZFB 5DNMD 1KX3A 3AYWB 4H9PA 5GSUC 2JE5A 3AZNA 5B33D 5CPID 5AVBC 3WA9C 3EPLA 5E5AB 2BYMA 4J8UA 2AROA 3WKJC 4UUZB 5JA4A 2YFVA 2G5HC 5CPJC 5BT1C 1TAFB 5DNMC 3MNNB 4LD9C 1HQ3D 3W98D 4KHAB 3LELB 3WTPB 4WV4B 5B33C 3AYWD 1AOIA 5CPIC 3C1CA 5CPKD 3AZLA 1KX5A 3AZJB 5AV6D 1BH8A 1HQ3C 5CP6C 1P3AB 1F66A 2BG1A 3LJAB 3AYWC 4XUJA 3X1TD 3LELD 5CPKC 1JFIB 1P3LB 3A1IA 4JJNC 5AV6C 5B40B 3AFAA 3AN2B 1P3OB 2YFWA 4ZBJC 2CV5B 1KX3B 1P3AD 3X1TC 3LELC 5AY8D 3REIB 5B0ZD 5AV8B 3A6NB 3AZNB 2F8NA 5BNVA 4YS3C 3REHA 3UTBB 1P3LD 4J8XA 2BYMB 2AROB 5JRGA 3AZIA 3MGPA 1P3MD 4H9QB 3X1SA 4J8VD 5AY8C 3AZEA 3RELD 2PYOC 3FDDA
chains in the Genus database with same CATH topology
3EG5B 3UTAA 3REID 3W99A 5GXQA 5AV8D 3A6ND 3C1BA 1P3MC 2HIOB 3B6FB 3UT9A 3AV2D 3AZMB 1BH8B 4XZQA 4J8VC 1P3FB 2Y2QA 5AV5D 3B6GC 2ZM5A 3RELC 3A6NC 2NQBA 5B31D 4EO5B 1M18B 3KFUG 4R8PA 5AVBA 3AV2C 3F6TA 1BFMA 3AV1B 3AZHD 2HIOD 3B6FD 3B0CT 2Y2PA 4G92B 1PZRA 5CPJA 5AV5C 1P3FD 5B31G 3W96D 5DNMA 4LD9A 3A1KA 2UWXA 3NQJA 5B31C 3AZKA 3REHB 4AWLC 2RIQA 3AZHC 2HIOC 1M18D 3B6FC 1KX4B 5F99B 4KUDD 3AV1D 4Z66A 1P3FC 3W96C 2G5IC 5CP6A 1F1EA 3VH5A 1KU5A 3W97A 5GT3D 5B0ZC 2XD1A 3KUYB 4E44A 4X23A 5B2ID 4JJNA 3R45B 4KUDC 2Y2NA 3UT9B 1P3BC 1ID3A 3WAAC 5AV6A 1KX4D 1EQZB 5GT3C 3REKB 2HUEB 1WWIA 3B0DC 5FUGB 4QLCD 3REJB 3AZGA 1U35A 4WNNA 2NZDA 1M19A 5B32A 5B2IC 2Y2MA 4YM6A 1P34D 1M1AA 3KXBB 4YS3A 4NE6A 4R8PB 1KX4C 4ZUXC 3TU4A 1P3IA 3LZ0A 5AV9D 5B2JA 3KSYA 3O62B 2FFFB 4NFTA 4QLCC 1P3PC 5AVCA 3REKD 4M6BA 3KWQB 5B1MB 1P34C 2PYOA 1ZLAC 4WU9B 3VH5W 2L5AA 2RVQD 5B1LC 1P3KD 2FJ7C 4J8WB 3KXBD 1A7WA 1P3MA 5AV9C 3X1UB 5B0YD 3MGQD 3AZFD 4J8VA 4Z5TA 2HUEC 5GT0A 3B6GA 3W97B 3RELA 5C3IC 2JCHA 4H9OA 3LZ1A 3MGRB 1HTAA 5E5AD 2RVQC 3KWQD 1P3KC 5B1MD 4CSRA 4X23B 3X1VB 4WU9D 3AL0C 1TZYB 3W98C 3AV2A 3MGQC 5B0YC 4J8WD 3AZFC 1ID3B 3MNND 4WU8B 3X1UD 5AV5A 3WTPD 3AZGB 2XD5A 5E5AC 5B1MC 5B32B 4YM6B 1M1AB 3AZJD 4WU9C 4HGAB 5B24B 5G49A 3MGSB 4J8WC 3X1VD 3MNNC 4KGCA 4H9PB 3X1UC 3LZ0B 3LJAD 5B2JB 3WTPC 4WU8D 5AVCB 3W96A 4H9SC 4J8UB 5JA4B 2YFVB 3AZJC 1S32A 5DNNA 4NE5A 5B40D 5BNXA 3AN2D 1P3AC 3MVDA 5B24D 1P3OD 3MGSD 2CV5D 3LJAC 1P3BA 1KX3D 4WU8C 2IO5B 3WAAA 1AOIB 1W2EA 1P3LC 3C1CB 5GT0B 4G91B 3AZND 5GT3A 3AZLB 1KX5B 3EPHA 3UTBD 4H9OB 4J8UD 2LY8A 2AROD 1P3GA 3V9RA 5B2IA 5B40C 3AN2C 1P3OC 2CV5C 1F66B 1KX3C 3VH6A 4ZUXA 4XUJB 1Q9CA 3REIC 5GSUA 3AZNC 5AV8C 2Y2JA 1AOID 4QLCA 1P3PA 3UTBC 3C1CD 4J8UC 2AROC 1R4VA 3WA9A 5BS7C 3WKJA 4CAYA 1ZLAA 3AFAB 2YFWB 5B1LA 3AZMD 2FJ7A 2W8SA 1H3OA 2IO5C 4E45A 4XUJD 2F8NB 5B33A 5BNVB 3C1CC 4G91C 4J8XB 5CPIA 3AZIB 2ZY4A 5JRGB 3MGPB 1S32B 5DNNB 1P3KA 3AZMC 2Y2OA 3X1SB 5BNXB 1HQ3A 3W98A 5BO0A 5B0YA 3MGQA 3AZEB 3AYWA 3UTAB 4H9RA 5CPKA 3W99B 5GXQB 3VH6W 2F8ND 4EO5C 1M18C 3C1BB 3NQUA 2ZY3A 3REHD 4J8XD 3AZID 5JRGD 3AV1C 4UUZA 4G92C 5F99D 4XZQB 3X1SD 2F8NG 1TAFA 3MNNA 4KHAA 3LELA 3AZED 3X1TA 2NQBB 4DRAA 3REHC 2F2AC 4J8XC 3KUYD 3UTAD 3W99D 4H9SA 5JRGC 5AVBB 3WA9B 1N1JA 3C1BD 4CAYB 5F99C 3UT9D 5CPJB 3X1SC 1EQZD 4XZQD 5DNMB 5KDMA 1P3AA 4LD9B 3WTPE 5AY8A 3NQJB 3REJD 5B0ZA 2F8NK 3AZKB 3KUYC 3UTAC 1JFIA 3VH5T 1P3LA 1B67A 2NQBD 3C1BC 4R8PD 3UT9C 5AVBD 1EQZC 4Z66B 4XZQC 1ULYA 5B40A 3REKC 5CP6B 3O62D 3B0BA 3REJC 4LD9D 4H9RB 3IP4C 3REIA 5CPKB 2NQBC 4JJNB 5AV8A 3A6NA 3AZKD 4WJ3C 3NQUB 3KXBC 4R8PC 3UTBA 5BS7A 5AV6B 3O62C 4Z66D 4H9QA 4ZBJB 4NE3A 5CP6D 3KWQC 3X1TB 4WNNB 1U35B 3W97D 1M19B 2NZDB 3AZKC 5B31A 3MGRD 4YS3B 4X23D 4JJND 1N1JB 1BH9A 3AZHA 2HIOA 3H0RC 3TU4B 3B6FA 1TZYD 1P3IB 4Z66C 3EPJA 1ID3D 3AZMA 3P5JB 1P3FA 5KDMB 3W97C 5AY8B 3AZGD 2PYOB 5B0ZB 3MGRC 1U35D 4X23C 1M19D 5B32D 2BYKA 2NZDD 4YM6D 3X1VC 2VQRA 1M1AD 1M18A 4YS3D 1TZYC 2ZY5A 1P3MB 4KUDA 1ID3C 2J8PA 3AV1A 3TU4D 2Y2IA 1T3UA 1P3ID 3LZ0D 2F8NH 4J8VB 4Z5TB 5B2JD 2Y2GA 5B32G 3AZGC 3B6GB 5AVCD 3RELB 1U35C 3LZ1B 1M19C 5B32C 2NZDC 4YM6C 4H9NA 4CSRB 1M1AC 2PYOD 4Z2MH 4HGAC 5B24C 3MGSC 3AV2B 3TU4C 1KX4A 2JSSA 5F99A 1P3IC 3LZ0C 5B2JC 5AV5B 5AVCC 4Z5TD 3EPKA 5GT0D 3B6GD 3AZLD 1KX5D 2DF4C 5B31B 1P34A 3LZ1D 3KUYA 4AWLB 5G49B 3R45A 1BH9B 3AZHB 4KGCB 2CWEA 1F66D 3H0MC 2ZY2A 5AV9A 1AOIC 1EQZA 4Z5TC 3W96B 5GT0C 4UPKA 3REKA 5FUGA 3AZLC 1KX5C 3REJA 1WWSA 3LZ1C 2BYKB 3KXBA 3AFAD 1F66C 4KUDB 3MVDB 1P3BB 3AZFA 4XUJC 4WZSB 4KGCD 3WAAB 3B0CW 1B6WA 3O62A 3VH6T 5GT3B 3B0DB 2Y2HA 1Z2CB 5E5AA 3KWQA 4H9NB 5B1MA 3MGPD 5CHLB 3V9RB 5B2IB 1P3GB 1S32D 4WU9A 5DNND 2Y2KA 3AFAC 2Y2LA 4J8WA 4KGCC 4ZUXB 3MVDD 1P3BD 5GSUB 3X1UA 3WAAD 3WTPA 2DQNC 4QLCB 1P3PB 5GXQD 3AZIC 3WKJB 3MGPC 4Z2MG 1P34B 1S32C 3AZJA 5DNNC 3MGRA 1ZLAB 3H0LC 1P3GD 5B1LB 3X1VA 2FJ7B 3MVDC 4DRBA 1H3OB 1TZYA 3AZEC 5AV9B 3LJAA 4ZUXD 4WU8A 5B33B 3W99C 5GSUD 5GXQC 5CPIB 1P3PD 5C3IB 3WA9D 1P3GC 3WKJD 1P3KB 1ZLAD 4DQYB 5CPJD 3AN2A 1P3OA 5B1LD 1HQ3B 5B24A 3MGSA 2CV5A 2FJ7D 3W98B 5BO0B 5BT1D 5B0YB 3MGQB 3AZFB 5DNMD 1KX3A 3AYWB 4H9PA 5GSUC 2JE5A 3AZNA 5B33D 5CPID 5AVBC 3WA9C 3EPLA 5E5AB 2BYMA 4J8UA 2AROA 3WKJC 4UUZB 5JA4A 2YFVA 2G5HC 5CPJC 5BT1C 1TAFB 5DNMC 3MNNB 4LD9C 1HQ3D 3W98D 4KHAB 3LELB 3WTPB 4WV4B 5B33C 3AYWD 1AOIA 5CPIC 3C1CA 5CPKD 3AZLA 1KX5A 3AZJB 5AV6D 1BH8A 1HQ3C 5CP6C 1P3AB 1F66A 2BG1A 3LJAB 3AYWC 4XUJA 3X1TD 3LELD 5CPKC 1JFIB 1P3LB 3A1IA 4JJNC 5AV6C 5B40B 3AFAA 3AN2B 1P3OB 2YFWA 4ZBJC 2CV5B 1KX3B 1P3AD 3X1TC 3LELC 5AY8D 3REIB 5B0ZD 5AV8B 3A6NB 3AZNB 2F8NA 5BNVA 4YS3C 3REHA 3UTBB 1P3LD 4J8XA 2BYMB 2AROB 5JRGA 3AZIA 3MGPA 1P3MD 4H9QB 3X1SA 4J8VD 5AY8C 3AZEA 3RELD 2PYOC 3FDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTA A;  3REI D;  3W99 A;  5GXQ A;  5AV8 D;  3A6N D;  3C1B A;  1P3M C;  2HIO B;  3B6F B;  3UT9 A;  3AV2 D;  3AZM B;  1BH8 B;  4XZQ A;  4J8V C;  1P3F B;  5AV5 D;  3B6G C;  3REL C;  3A6N C;  2NQB A;  5B31 D;  4EO5 B;  1M18 B;  4R8P A;  5AVB A;  3AV2 C;  1BFM A;  3AV1 B;  3AZH D;  2HIO D;  3B6F D;  3B0C T;  4G92 B;  5CPJ A;  5AV5 C;  1P3F D;  5B31 G;  3W96 D;  5DNM A;  4LD9 A;  3NQJ A;  5B31 C;  3AZK A;  3REH B;  4AWL C;  3AZH C;  1M18 D;  2HIO C;  3B6F C;  1KX4 B;  5F99 B;  4KUD D;  3AV1 D;  4Z66 A;  1P3F C;  3W96 C;  5CP6 A;  1F1E A;  3VH5 A;  1KU5 A;  3W97 A;  5GT3 D;  3KUY B;  4E44 A;  4X23 A;  5B2I D;  4JJN A;  3R45 B;  4KUD C;  3UT9 B;  1P3B C;  1ID3 A;  3WAA C;  5AV6 A;  1KX4 D;  1EQZ B;  5GT3 C;  3REK B;  2HUE B;  1WWI A;  3B0D C;  5FUG B;  4QLC D;  3REJ B;  3AZG A;  1U35 A;  4WNN A;  2NZD A;  1M19 A;  5B32 A;  5B2I C;  4YM6 A;  1P34 D;  1M1A A;  3KXB B;  4YS3 A;  4NE6 A;  4R8P B;  1KX4 C;  4ZUX C;  3TU4 A;  1P3I A;  3LZ0 A;  5AV9 D;  5B2J A;  3KSY A;  3O62 B;  4QLC C;  4NFT A;  1P3P C;  5AVC A;  3REK D;  4M6B A;  3KWQ B;  5B1M B;  1P34 C;  2PYO A;  1ZLA C;  4WU9 B;  3VH5 W;  2L5A A;  2RVQ D;  5B1L C;  1P3K D;  2FJ7 C;  4J8W B;  3KXB D;  1A7W A;  1P3M A;  5AV9 C;  3X1U B;  5B0Y D;  3MGQ D;  3AZF D;  4J8V A;  4Z5T A;  2HUE C;  5GT0 A;  3B6G A;  3W97 B;  3REL A;  5C3I C;  4H9O A;  3MGR B;  3LZ1 A;  1HTA A;  5E5A D;  2RVQ C;  3KWQ D;  1P3K C;  5B1M D;  4CSR A;  4X23 B;  3X1V B;  4WU9 D;  1TZY B;  3W98 C;  3AV2 A;  3MGQ C;  5B0Y C;  4J8W D;  3AZF C;  1ID3 B;  3MNN D;  4WU8 B;  3X1U D;  5AV5 A;  3WTP D;  3AZG B;  5E5A C;  5B1M C;  5B32 B;  4YM6 B;  1M1A B;  3AZJ D;  4WU9 C;  4HGA B;  5B24 B;  5G49 A;  3MGS B;  4J8W C;  3X1V D;  3MNN C;  4KGC A;  4H9P B;  3X1U C;  3LZ0 B;  3LJA D;  5B2J B;  3WTP C;  4WU8 D;  5AVC B;  3W96 A;  4H9S C;  4J8U B;  5JA4 B;  2YFV B;  3AZJ C;  1S32 A;  5DNN A;  4NE5 A;  5B40 D;  5BNX A;  3AN2 D;  1P3A C;  3MVD A;  5B24 D;  1P3O D;  3MGS D;  2CV5 D;  3LJA C;  1P3B A;  1KX3 D;  4WU8 C;  2IO5 B;  3WAA A;  1AOI B;  1P3L C;  3C1C B;  5GT0 B;  4G91 B;  3AZN D;  5GT3 A;  3AZL B;  1KX5 B;  3UTB D;  4H9O B;  4J8U D;  2LY8 A;  2ARO D;  1P3G A;  3V9R A;  5B2I A;  5B40 C;  3AN2 C;  1P3O C;  2CV5 C;  1F66 B;  1KX3 C;  3VH6 A;  4ZUX A;  4XUJ B;  1Q9C A;  3REI C;  5GSU A;  3AZN C;  5AV8 C;  1AOI D;  4QLC A;  1P3P A;  3UTB C;  3C1C D;  4J8U C;  2ARO C;  1R4V A;  3WA9 A;  5BS7 C;  3WKJ A;  4CAY A;  1ZLA A;  3AFA B;  2YFW B;  5B1L A;  3AZM D;  2FJ7 A;  1H3O A;  2IO5 C;  4E45 A;  4XUJ D;  2F8N B;  5B33 A;  5BNV B;  3C1C C;  4G91 C;  4J8X B;  5CPI A;  3AZI B;  5JRG B;  3MGP B;  1S32 B;  5DNN B;  1P3K A;  3AZM C;  3X1S B;  5BNX B;  1HQ3 A;  3W98 A;  5BO0 A;  5B0Y A;  3MGQ A;  3AZE B;  3AYW A;  3UTA B;  4H9R A;  5CPK A;  3W99 B;  5GXQ B;  3VH6 W;  2F8N D;  4EO5 C;  1M18 C;  3C1B B;  3NQU A;  3REH D;  4J8X D;  3AZI D;  5JRG D;  3AV1 C;  4UUZ A;  4G92 C;  5F99 D;  4XZQ B;  3X1S D;  2F8N G;  1TAF A;  3MNN A;  4KHA A;  3LEL A;  3AZE D;  3X1T A;  2NQB B;  4DRA A;  3REH C;  4J8X C;  3KUY D;  3UTA D;  3W99 D;  4H9S A;  5JRG C;  5AVB B;  3WA9 B;  1N1J A;  3C1B D;  4CAY B;  5F99 C;  3UT9 D;  5CPJ B;  3X1S C;  1EQZ D;  4XZQ D;  5DNM B;  5KDM A;  1P3A A;  4LD9 B;  3WTP E;  5AY8 A;  3NQJ B;  3REJ D;  5B0Z A;  2F8N K;  3AZK B;  3KUY C;  3UTA C;  1JFI A;  3VH5 T;  1P3L A;  1B67 A;  2NQB D;  3C1B C;  4R8P D;  3UT9 C;  5AVB D;  1EQZ C;  4Z66 B;  4XZQ C;  1ULY A;  5B40 A;  3REK C;  5CP6 B;  3O62 D;  3B0B A;  3REJ C;  4LD9 D;  4H9R B;  3REI A;  5CPK B;  2NQB C;  4JJN B;  5AV8 A;  3A6N A;  3AZK D;  3NQU B;  3KXB C;  4R8P C;  3UTB A;  5BS7 A;  5AV6 B;  3O62 C;  4Z66 D;  4H9Q A;  4ZBJ B;  4NE3 A;  5CP6 D;  3KWQ C;  3X1T B;  4WNN B;  1U35 B;  3W97 D;  1M19 B;  2NZD B;  3AZK C;  5B31 A;  3MGR D;  4YS3 B;  4X23 D;  4JJN D;  1N1J B;  1BH9 A;  3AZH A;  2HIO A;  3B6F A;  3TU4 B;  1TZY D;  1P3I B;  4Z66 C;  1ID3 D;  3AZM A;  1P3F A;  5KDM B;  3W97 C;  5AY8 B;  3AZG D;  2PYO B;  5B0Z B;  3MGR C;  1U35 D;  4X23 C;  1M19 D;  5B32 D;  2BYK A;  2NZD D;  4YM6 D;  3X1V C;  1M1A D;  1M18 A;  4YS3 D;  1TZY C;  1P3M B;  4KUD A;  1ID3 C;  3AV1 A;  3TU4 D;  1P3I D;  3LZ0 D;  2F8N H;  4J8V B;  4Z5T B;  5B2J D;  5B32 G;  3AZG C;  3B6G B;  5AVC D;  3REL B;  1U35 C;  3LZ1 B;  1M19 C;  5B32 C;  2NZD C;  4YM6 C;  4H9N A;  4CSR B;  1M1A C;  2PYO D;  4Z2M H;  4HGA C;  5B24 C;  3MGS C;  3AV2 B;  3TU4 C;  1KX4 A;  2JSS A;  5F99 A;  1P3I C;  3LZ0 C;  5B2J C;  5AV5 B;  5AVC C;  4Z5T D;  5GT0 D;  3B6G D;  3AZL D;  1KX5 D;  5B31 B;  1P34 A;  3LZ1 D;  3KUY A;  4AWL B;  5G49 B;  3R45 A;  1BH9 B;  3AZH B;  4KGC B;  2CWE A;  1F66 D;  5AV9 A;  1AOI C;  1EQZ A;  4Z5T C;  3W96 B;  5GT0 C;  3REK A;  5FUG A;  3AZL C;  1KX5 C;  3REJ A;  1WWS A;  3LZ1 C;  2BYK B;  3KXB A;  3AFA D;  1F66 C;  4KUD B;  3MVD B;  1P3B B;  3AZF A;  4XUJ C;  4WZS B;  4KGC D;  3WAA B;  3B0C W;  1B6W A;  3O62 A;  3VH6 T;  5GT3 B;  3B0D B;  5E5A A;  3KWQ A;  4H9N B;  5B1M A;  3MGP D;  5CHL B;  3V9R B;  5B2I B;  1P3G B;  1S32 D;  4WU9 A;  5DNN D;  3AFA C;  4J8W A;  4KGC C;  4ZUX B;  3MVD D;  1P3B D;  5GSU B;  3X1U A;  3WAA D;  3WTP A;  4QLC B;  1P3P B;  5GXQ D;  3AZI C;  3WKJ B;  3MGP C;  4Z2M G;  1P34 B;  1S32 C;  3AZJ A;  5DNN C;  3MGR A;  1ZLA B;  1P3G D;  5B1L B;  3X1V A;  2FJ7 B;  3MVD C;  4DRB A;  1H3O B;  1TZY A;  3AZE C;  5AV9 B;  3LJA A;  4ZUX D;  4WU8 A;  5B33 B;  3W99 C;  5GSU D;  5GXQ C;  5CPI B;  1P3P D;  5C3I B;  3WA9 D;  1P3G C;  3WKJ D;  1P3K B;  1ZLA D;  5CPJ D;  3AN2 A;  1P3O A;  5B1L D;  1HQ3 B;  5B24 A;  3MGS A;  2CV5 A;  2FJ7 D;  3W98 B;  5BO0 B;  5BT1 D;  5B0Y B;  3MGQ B;  3AZF B;  5DNM D;  1KX3 A;  3AYW B;  4H9P A;  5GSU C;  3AZN A;  5B33 D;  5CPI D;  5AVB C;  3WA9 C;  4J8U A;  5E5A B;  2BYM A;  3WKJ C;  2ARO A;  4UUZ B;  5JA4 A;  2YFV A;  5CPJ C;  5BT1 C;  1TAF B;  5DNM C;  3MNN B;  4LD9 C;  1HQ3 D;  3W98 D;  4KHA B;  3LEL B;  3WTP B;  4WV4 B;  5B33 C;  3AYW D;  1AOI A;  5CPI C;  3C1C A;  5CPK D;  3AZL A;  1KX5 A;  3AZJ B;  5AV6 D;  1BH8 A;  1HQ3 C;  5CP6 C;  1P3A B;  1F66 A;  3LJA B;  3AYW C;  4XUJ A;  3X1T D;  3LEL D;  5CPK C;  1JFI B;  1P3L B;  4JJN C;  5AV6 C;  5B40 B;  3AFA A;  3AN2 B;  1P3O B;  2YFW A;  4ZBJ C;  2CV5 B;  1KX3 B;  1P3A D;  3X1T C;  3LEL C;  5AY8 D;  3REI B;  5B0Z D;  5AV8 B;  3A6N B;  3AZN B;  2F8N A;  5BNV A;  4YS3 C;  3REH A;  3UTB B;  1P3L D;  4J8X A;  2BYM B;  2ARO B;  5JRG A;  3AZI A;  3MGP A;  1P3M D;  4H9Q B;  3X1S A;  4J8V D;  5AY8 C;  3AZE A;  3REL D;  2PYO C;  5B0Z C; 
#chains in the Genus database with same CATH topology
 3EG5 B;  3UTA A;  3REI D;  3W99 A;  5GXQ A;  5AV8 D;  3A6N D;  3C1B A;  1P3M C;  2HIO B;  3B6F B;  3UT9 A;  3AV2 D;  3AZM B;  1BH8 B;  4XZQ A;  4J8V C;  1P3F B;  2Y2Q A;  5AV5 D;  3B6G C;  2ZM5 A;  3REL C;  3A6N C;  2NQB A;  5B31 D;  4EO5 B;  1M18 B;  3KFU G;  4R8P A;  5AVB A;  3AV2 C;  3F6T A;  1BFM A;  3AV1 B;  3AZH D;  2HIO D;  3B6F D;  3B0C T;  2Y2P A;  4G92 B;  1PZR A;  5CPJ A;  5AV5 C;  1P3F D;  5B31 G;  3W96 D;  5DNM A;  4LD9 A;  3A1K A;  2UWX A;  3NQJ A;  5B31 C;  3AZK A;  3REH B;  4AWL C;  2RIQ A;  3AZH C;  2HIO C;  1M18 D;  3B6F C;  1KX4 B;  5F99 B;  4KUD D;  3AV1 D;  4Z66 A;  1P3F C;  3W96 C;  2G5I C;  5CP6 A;  1F1E A;  3VH5 A;  1KU5 A;  3W97 A;  5GT3 D;  5B0Z C;  2XD1 A;  3KUY B;  4E44 A;  4X23 A;  5B2I D;  4JJN A;  3R45 B;  4KUD C;  2Y2N A;  3UT9 B;  1P3B C;  1ID3 A;  3WAA C;  5AV6 A;  1KX4 D;  1EQZ B;  5GT3 C;  3REK B;  2HUE B;  1WWI A;  3B0D C;  5FUG B;  4QLC D;  3REJ B;  3AZG A;  1U35 A;  4WNN A;  2NZD A;  1M19 A;  5B32 A;  5B2I C;  2Y2M A;  4YM6 A;  1P34 D;  1M1A A;  3KXB B;  4YS3 A;  4NE6 A;  4R8P B;  1KX4 C;  4ZUX C;  3TU4 A;  1P3I A;  3LZ0 A;  5AV9 D;  5B2J A;  3KSY A;  3O62 B;  2FFF B;  4NFT A;  4QLC C;  1P3P C;  5AVC A;  3REK D;  4M6B A;  3KWQ B;  5B1M B;  1P34 C;  2PYO A;  1ZLA C;  4WU9 B;  3VH5 W;  2L5A A;  2RVQ D;  5B1L C;  1P3K D;  2FJ7 C;  4J8W B;  3KXB D;  1A7W A;  1P3M A;  5AV9 C;  3X1U B;  5B0Y D;  3MGQ D;  3AZF D;  4J8V A;  4Z5T A;  2HUE C;  5GT0 A;  3B6G A;  3W97 B;  3REL A;  5C3I C;  2JCH A;  4H9O A;  3LZ1 A;  3MGR B;  1HTA A;  5E5A D;  2RVQ C;  3KWQ D;  1P3K C;  5B1M D;  4CSR A;  4X23 B;  3X1V B;  4WU9 D;  3AL0 C;  1TZY B;  3W98 C;  3AV2 A;  3MGQ C;  5B0Y C;  4J8W D;  3AZF C;  1ID3 B;  3MNN D;  4WU8 B;  3X1U D;  5AV5 A;  3WTP D;  3AZG B;  2XD5 A;  5E5A C;  5B1M C;  5B32 B;  4YM6 B;  1M1A B;  3AZJ D;  4WU9 C;  4HGA B;  5B24 B;  5G49 A;  3MGS B;  4J8W C;  3X1V D;  3MNN C;  4KGC A;  4H9P B;  3X1U C;  3LZ0 B;  3LJA D;  5B2J B;  3WTP C;  4WU8 D;  5AVC B;  3W96 A;  4H9S C;  4J8U B;  5JA4 B;  2YFV B;  3AZJ C;  1S32 A;  5DNN A;  4NE5 A;  5B40 D;  5BNX A;  3AN2 D;  1P3A C;  3MVD A;  5B24 D;  1P3O D;  3MGS D;  2CV5 D;  3LJA C;  1P3B A;  1KX3 D;  4WU8 C;  2IO5 B;  3WAA A;  1AOI B;  1W2E A;  1P3L C;  3C1C B;  5GT0 B;  4G91 B;  3AZN D;  5GT3 A;  3AZL B;  1KX5 B;  3EPH A;  3UTB D;  4H9O B;  4J8U D;  2LY8 A;  2ARO D;  1P3G A;  3V9R A;  5B2I A;  5B40 C;  3AN2 C;  1P3O C;  2CV5 C;  1F66 B;  1KX3 C;  3VH6 A;  4ZUX A;  4XUJ B;  1Q9C A;  3REI C;  5GSU A;  3AZN C;  5AV8 C;  2Y2J A;  1AOI D;  4QLC A;  1P3P A;  3UTB C;  3C1C D;  4J8U C;  2ARO C;  1R4V A;  3WA9 A;  5BS7 C;  3WKJ A;  4CAY A;  1ZLA A;  3AFA B;  2YFW B;  5B1L A;  3AZM D;  2FJ7 A;  2W8S A;  1H3O A;  2IO5 C;  4E45 A;  4XUJ D;  2F8N B;  5B33 A;  5BNV B;  3C1C C;  4G91 C;  4J8X B;  5CPI A;  3AZI B;  2ZY4 A;  5JRG B;  3MGP B;  1S32 B;  5DNN B;  1P3K A;  3AZM C;  2Y2O A;  3X1S B;  5BNX B;  1HQ3 A;  3W98 A;  5BO0 A;  5B0Y A;  3MGQ A;  3AZE B;  3AYW A;  3UTA B;  4H9R A;  5CPK A;  3W99 B;  5GXQ B;  3VH6 W;  2F8N D;  4EO5 C;  1M18 C;  3C1B B;  3NQU A;  2ZY3 A;  3REH D;  4J8X D;  3AZI D;  5JRG D;  3AV1 C;  4UUZ A;  4G92 C;  5F99 D;  4XZQ B;  3X1S D;  2F8N G;  1TAF A;  3MNN A;  4KHA A;  3LEL A;  3AZE D;  3X1T A;  2NQB B;  4DRA A;  3REH C;  2F2A C;  4J8X C;  3KUY D;  3UTA D;  3W99 D;  4H9S A;  5JRG C;  5AVB B;  3WA9 B;  1N1J A;  3C1B D;  4CAY B;  5F99 C;  3UT9 D;  5CPJ B;  3X1S C;  1EQZ D;  4XZQ D;  5DNM B;  5KDM A;  1P3A A;  4LD9 B;  3WTP E;  5AY8 A;  3NQJ B;  3REJ D;  5B0Z A;  2F8N K;  3AZK B;  3KUY C;  3UTA C;  1JFI A;  3VH5 T;  1P3L A;  1B67 A;  2NQB D;  3C1B C;  4R8P D;  3UT9 C;  5AVB D;  1EQZ C;  4Z66 B;  4XZQ C;  1ULY A;  5B40 A;  3REK C;  5CP6 B;  3O62 D;  3B0B A;  3REJ C;  4LD9 D;  4H9R B;  3IP4 C;  3REI A;  5CPK B;  2NQB C;  4JJN B;  5AV8 A;  3A6N A;  3AZK D;  4WJ3 C;  3NQU B;  3KXB C;  4R8P C;  3UTB A;  5BS7 A;  5AV6 B;  3O62 C;  4Z66 D;  4H9Q A;  4ZBJ B;  4NE3 A;  5CP6 D;  3KWQ C;  3X1T B;  4WNN B;  1U35 B;  3W97 D;  1M19 B;  2NZD B;  3AZK C;  5B31 A;  3MGR D;  4YS3 B;  4X23 D;  4JJN D;  1N1J B;  1BH9 A;  3AZH A;  2HIO A;  3H0R C;  3TU4 B;  3B6F A;  1TZY D;  1P3I B;  4Z66 C;  3EPJ A;  1ID3 D;  3AZM A;  3P5J B;  1P3F A;  5KDM B;  3W97 C;  5AY8 B;  3AZG D;  2PYO B;  5B0Z B;  3MGR C;  1U35 D;  4X23 C;  1M19 D;  5B32 D;  2BYK A;  2NZD D;  4YM6 D;  3X1V C;  2VQR A;  1M1A D;  1M18 A;  4YS3 D;  1TZY C;  2ZY5 A;  1P3M B;  4KUD A;  1ID3 C;  2J8P A;  3AV1 A;  3TU4 D;  2Y2I A;  1T3U A;  1P3I D;  3LZ0 D;  2F8N H;  4J8V B;  4Z5T B;  5B2J D;  2Y2G A;  5B32 G;  3AZG C;  3B6G B;  5AVC D;  3REL B;  1U35 C;  3LZ1 B;  1M19 C;  5B32 C;  2NZD C;  4YM6 C;  4H9N A;  4CSR B;  1M1A C;  2PYO D;  4Z2M H;  4HGA C;  5B24 C;  3MGS C;  3AV2 B;  3TU4 C;  1KX4 A;  2JSS A;  5F99 A;  1P3I C;  3LZ0 C;  5B2J C;  5AV5 B;  5AVC C;  4Z5T D;  3EPK A;  5GT0 D;  3B6G D;  3AZL D;  1KX5 D;  2DF4 C;  5B31 B;  1P34 A;  3LZ1 D;  3KUY A;  4AWL B;  5G49 B;  3R45 A;  1BH9 B;  3AZH B;  4KGC B;  2CWE A;  1F66 D;  3H0M C;  2ZY2 A;  5AV9 A;  1AOI C;  1EQZ A;  4Z5T C;  3W96 B;  5GT0 C;  4UPK A;  3REK A;  5FUG A;  3AZL C;  1KX5 C;  3REJ A;  1WWS A;  3LZ1 C;  2BYK B;  3KXB A;  3AFA D;  1F66 C;  4KUD B;  3MVD B;  1P3B B;  3AZF A;  4XUJ C;  4WZS B;  4KGC D;  3WAA B;  3B0C W;  1B6W A;  3O62 A;  3VH6 T;  5GT3 B;  3B0D B;  2Y2H A;  1Z2C B;  5E5A A;  3KWQ A;  4H9N B;  5B1M A;  3MGP D;  5CHL B;  3V9R B;  5B2I B;  1P3G B;  1S32 D;  4WU9 A;  5DNN D;  2Y2K A;  3AFA C;  2Y2L A;  4J8W A;  4KGC C;  4ZUX B;  3MVD D;  1P3B D;  5GSU B;  3X1U A;  3WAA D;  3WTP A;  2DQN C;  4QLC B;  1P3P B;  5GXQ D;  3AZI C;  3WKJ B;  3MGP C;  4Z2M G;  1P34 B;  1S32 C;  3AZJ A;  5DNN C;  3MGR A;  1ZLA B;  3H0L C;  1P3G D;  5B1L B;  3X1V A;  2FJ7 B;  3MVD C;  4DRB A;  1H3O B;  1TZY A;  3AZE C;  5AV9 B;  3LJA A;  4ZUX D;  4WU8 A;  5B33 B;  3W99 C;  5GSU D;  5GXQ C;  5CPI B;  1P3P D;  5C3I B;  3WA9 D;  1P3G C;  3WKJ D;  1P3K B;  1ZLA D;  4DQY B;  5CPJ D;  3AN2 A;  1P3O A;  5B1L D;  1HQ3 B;  5B24 A;  3MGS A;  2CV5 A;  2FJ7 D;  3W98 B;  5BO0 B;  5BT1 D;  5B0Y B;  3MGQ B;  3AZF B;  5DNM D;  1KX3 A;  3AYW B;  4H9P A;  5GSU C;  2JE5 A;  3AZN A;  5B33 D;  5CPI D;  5AVB C;  3WA9 C;  3EPL A;  5E5A B;  2BYM A;  4J8U A;  2ARO A;  3WKJ C;  4UUZ B;  5JA4 A;  2YFV A;  2G5H C;  5CPJ C;  5BT1 C;  1TAF B;  5DNM C;  3MNN B;  4LD9 C;  1HQ3 D;  3W98 D;  4KHA B;  3LEL B;  3WTP B;  4WV4 B;  5B33 C;  3AYW D;  1AOI A;  5CPI C;  3C1C A;  5CPK D;  3AZL A;  1KX5 A;  3AZJ B;  5AV6 D;  1BH8 A;  1HQ3 C;  5CP6 C;  1P3A B;  1F66 A;  2BG1 A;  3LJA B;  3AYW C;  4XUJ A;  3X1T D;  3LEL D;  5CPK C;  1JFI B;  1P3L B;  3A1I A;  4JJN C;  5AV6 C;  5B40 B;  3AFA A;  3AN2 B;  1P3O B;  2YFW A;  4ZBJ C;  2CV5 B;  1KX3 B;  1P3A D;  3X1T C;  3LEL C;  5AY8 D;  3REI B;  5B0Z D;  5AV8 B;  3A6N B;  3AZN B;  2F8N A;  5BNV A;  4YS3 C;  3REH A;  3UTB B;  1P3L D;  4J8X A;  2BYM B;  2ARO B;  5JRG A;  3AZI A;  3MGP A;  1P3M D;  4H9Q B;  3X1S A;  4J8V D;  5AY8 C;  3AZE A;  3REL D;  2PYO C;  3FDD A; 
#chains in the Genus database with same CATH homology
 3EG5 B;  3UTA A;  3REI D;  3W99 A;  5GXQ A;  5AV8 D;  3A6N D;  3C1B A;  1P3M C;  2HIO B;  3B6F B;  3UT9 A;  3AV2 D;  3AZM B;  1BH8 B;  4XZQ A;  4J8V C;  1P3F B;  2Y2Q A;  5AV5 D;  3B6G C;  2ZM5 A;  3REL C;  3A6N C;  2NQB A;  5B31 D;  4EO5 B;  1M18 B;  3KFU G;  4R8P A;  5AVB A;  3AV2 C;  3F6T A;  1BFM A;  3AV1 B;  3AZH D;  2HIO D;  3B6F D;  3B0C T;  2Y2P A;  4G92 B;  1PZR A;  5CPJ A;  5AV5 C;  1P3F D;  5B31 G;  3W96 D;  5DNM A;  4LD9 A;  3A1K A;  2UWX A;  3NQJ A;  5B31 C;  3AZK A;  3REH B;  4AWL C;  2RIQ A;  3AZH C;  2HIO C;  1M18 D;  3B6F C;  1KX4 B;  5F99 B;  4KUD D;  3AV1 D;  4Z66 A;  1P3F C;  3W96 C;  2G5I C;  5CP6 A;  1F1E A;  3VH5 A;  1KU5 A;  3W97 A;  5GT3 D;  5B0Z C;  2XD1 A;  3KUY B;  4E44 A;  4X23 A;  5B2I D;  4JJN A;  3R45 B;  4KUD C;  2Y2N A;  3UT9 B;  1P3B C;  1ID3 A;  3WAA C;  5AV6 A;  1KX4 D;  1EQZ B;  5GT3 C;  3REK B;  2HUE B;  1WWI A;  3B0D C;  5FUG B;  4QLC D;  3REJ B;  3AZG A;  1U35 A;  4WNN A;  2NZD A;  1M19 A;  5B32 A;  5B2I C;  2Y2M A;  4YM6 A;  1P34 D;  1M1A A;  3KXB B;  4YS3 A;  4NE6 A;  4R8P B;  1KX4 C;  4ZUX C;  3TU4 A;  1P3I A;  3LZ0 A;  5AV9 D;  5B2J A;  3KSY A;  3O62 B;  2FFF B;  4NFT A;  4QLC C;  1P3P C;  5AVC A;  3REK D;  4M6B A;  3KWQ B;  5B1M B;  1P34 C;  2PYO A;  1ZLA C;  4WU9 B;  3VH5 W;  2L5A A;  2RVQ D;  5B1L C;  1P3K D;  2FJ7 C;  4J8W B;  3KXB D;  1A7W A;  1P3M A;  5AV9 C;  3X1U B;  5B0Y D;  3MGQ D;  3AZF D;  4J8V A;  4Z5T A;  2HUE C;  5GT0 A;  3B6G A;  3W97 B;  3REL A;  5C3I C;  2JCH A;  4H9O A;  3LZ1 A;  3MGR B;  1HTA A;  5E5A D;  2RVQ C;  3KWQ D;  1P3K C;  5B1M D;  4CSR A;  4X23 B;  3X1V B;  4WU9 D;  3AL0 C;  1TZY B;  3W98 C;  3AV2 A;  3MGQ C;  5B0Y C;  4J8W D;  3AZF C;  1ID3 B;  3MNN D;  4WU8 B;  3X1U D;  5AV5 A;  3WTP D;  3AZG B;  2XD5 A;  5E5A C;  5B1M C;  5B32 B;  4YM6 B;  1M1A B;  3AZJ D;  4WU9 C;  4HGA B;  5B24 B;  5G49 A;  3MGS B;  4J8W C;  3X1V D;  3MNN C;  4KGC A;  4H9P B;  3X1U C;  3LZ0 B;  3LJA D;  5B2J B;  3WTP C;  4WU8 D;  5AVC B;  3W96 A;  4H9S C;  4J8U B;  5JA4 B;  2YFV B;  3AZJ C;  1S32 A;  5DNN A;  4NE5 A;  5B40 D;  5BNX A;  3AN2 D;  1P3A C;  3MVD A;  5B24 D;  1P3O D;  3MGS D;  2CV5 D;  3LJA C;  1P3B A;  1KX3 D;  4WU8 C;  2IO5 B;  3WAA A;  1AOI B;  1W2E A;  1P3L C;  3C1C B;  5GT0 B;  4G91 B;  3AZN D;  5GT3 A;  3AZL B;  1KX5 B;  3EPH A;  3UTB D;  4H9O B;  4J8U D;  2LY8 A;  2ARO D;  1P3G A;  3V9R A;  5B2I A;  5B40 C;  3AN2 C;  1P3O C;  2CV5 C;  1F66 B;  1KX3 C;  3VH6 A;  4ZUX A;  4XUJ B;  1Q9C A;  3REI C;  5GSU A;  3AZN C;  5AV8 C;  2Y2J A;  1AOI D;  4QLC A;  1P3P A;  3UTB C;  3C1C D;  4J8U C;  2ARO C;  1R4V A;  3WA9 A;  5BS7 C;  3WKJ A;  4CAY A;  1ZLA A;  3AFA B;  2YFW B;  5B1L A;  3AZM D;  2FJ7 A;  2W8S A;  1H3O A;  2IO5 C;  4E45 A;  4XUJ D;  2F8N B;  5B33 A;  5BNV B;  3C1C C;  4G91 C;  4J8X B;  5CPI A;  3AZI B;  2ZY4 A;  5JRG B;  3MGP B;  1S32 B;  5DNN B;  1P3K A;  3AZM C;  2Y2O A;  3X1S B;  5BNX B;  1HQ3 A;  3W98 A;  5BO0 A;  5B0Y A;  3MGQ A;  3AZE B;  3AYW A;  3UTA B;  4H9R A;  5CPK A;  3W99 B;  5GXQ B;  3VH6 W;  2F8N D;  4EO5 C;  1M18 C;  3C1B B;  3NQU A;  2ZY3 A;  3REH D;  4J8X D;  3AZI D;  5JRG D;  3AV1 C;  4UUZ A;  4G92 C;  5F99 D;  4XZQ B;  3X1S D;  2F8N G;  1TAF A;  3MNN A;  4KHA A;  3LEL A;  3AZE D;  3X1T A;  2NQB B;  4DRA A;  3REH C;  2F2A C;  4J8X C;  3KUY D;  3UTA D;  3W99 D;  4H9S A;  5JRG C;  5AVB B;  3WA9 B;  1N1J A;  3C1B D;  4CAY B;  5F99 C;  3UT9 D;  5CPJ B;  3X1S C;  1EQZ D;  4XZQ D;  5DNM B;  5KDM A;  1P3A A;  4LD9 B;  3WTP E;  5AY8 A;  3NQJ B;  3REJ D;  5B0Z A;  2F8N K;  3AZK B;  3KUY C;  3UTA C;  1JFI A;  3VH5 T;  1P3L A;  1B67 A;  2NQB D;  3C1B C;  4R8P D;  3UT9 C;  5AVB D;  1EQZ C;  4Z66 B;  4XZQ C;  1ULY A;  5B40 A;  3REK C;  5CP6 B;  3O62 D;  3B0B A;  3REJ C;  4LD9 D;  4H9R B;  3IP4 C;  3REI A;  5CPK B;  2NQB C;  4JJN B;  5AV8 A;  3A6N A;  3AZK D;  4WJ3 C;  3NQU B;  3KXB C;  4R8P C;  3UTB A;  5BS7 A;  5AV6 B;  3O62 C;  4Z66 D;  4H9Q A;  4ZBJ B;  4NE3 A;  5CP6 D;  3KWQ C;  3X1T B;  4WNN B;  1U35 B;  3W97 D;  1M19 B;  2NZD B;  3AZK C;  5B31 A;  3MGR D;  4YS3 B;  4X23 D;  4JJN D;  1N1J B;  1BH9 A;  3AZH A;  2HIO A;  3H0R C;  3TU4 B;  3B6F A;  1TZY D;  1P3I B;  4Z66 C;  3EPJ A;  1ID3 D;  3AZM A;  3P5J B;  1P3F A;  5KDM B;  3W97 C;  5AY8 B;  3AZG D;  2PYO B;  5B0Z B;  3MGR C;  1U35 D;  4X23 C;  1M19 D;  5B32 D;  2BYK A;  2NZD D;  4YM6 D;  3X1V C;  2VQR A;  1M1A D;  1M18 A;  4YS3 D;  1TZY C;  2ZY5 A;  1P3M B;  4KUD A;  1ID3 C;  2J8P A;  3AV1 A;  3TU4 D;  2Y2I A;  1T3U A;  1P3I D;  3LZ0 D;  2F8N H;  4J8V B;  4Z5T B;  5B2J D;  2Y2G A;  5B32 G;  3AZG C;  3B6G B;  5AVC D;  3REL B;  1U35 C;  3LZ1 B;  1M19 C;  5B32 C;  2NZD C;  4YM6 C;  4H9N A;  4CSR B;  1M1A C;  2PYO D;  4Z2M H;  4HGA C;  5B24 C;  3MGS C;  3AV2 B;  3TU4 C;  1KX4 A;  2JSS A;  5F99 A;  1P3I C;  3LZ0 C;  5B2J C;  5AV5 B;  5AVC C;  4Z5T D;  3EPK A;  5GT0 D;  3B6G D;  3AZL D;  1KX5 D;  2DF4 C;  5B31 B;  1P34 A;  3LZ1 D;  3KUY A;  4AWL B;  5G49 B;  3R45 A;  1BH9 B;  3AZH B;  4KGC B;  2CWE A;  1F66 D;  3H0M C;  2ZY2 A;  5AV9 A;  1AOI C;  1EQZ A;  4Z5T C;  3W96 B;  5GT0 C;  4UPK A;  3REK A;  5FUG A;  3AZL C;  1KX5 C;  3REJ A;  1WWS A;  3LZ1 C;  2BYK B;  3KXB A;  3AFA D;  1F66 C;  4KUD B;  3MVD B;  1P3B B;  3AZF A;  4XUJ C;  4WZS B;  4KGC D;  3WAA B;  3B0C W;  1B6W A;  3O62 A;  3VH6 T;  5GT3 B;  3B0D B;  2Y2H A;  1Z2C B;  5E5A A;  3KWQ A;  4H9N B;  5B1M A;  3MGP D;  5CHL B;  3V9R B;  5B2I B;  1P3G B;  1S32 D;  4WU9 A;  5DNN D;  2Y2K A;  3AFA C;  2Y2L A;  4J8W A;  4KGC C;  4ZUX B;  3MVD D;  1P3B D;  5GSU B;  3X1U A;  3WAA D;  3WTP A;  2DQN C;  4QLC B;  1P3P B;  5GXQ D;  3AZI C;  3WKJ B;  3MGP C;  4Z2M G;  1P34 B;  1S32 C;  3AZJ A;  5DNN C;  3MGR A;  1ZLA B;  3H0L C;  1P3G D;  5B1L B;  3X1V A;  2FJ7 B;  3MVD C;  4DRB A;  1H3O B;  1TZY A;  3AZE C;  5AV9 B;  3LJA A;  4ZUX D;  4WU8 A;  5B33 B;  3W99 C;  5GSU D;  5GXQ C;  5CPI B;  1P3P D;  5C3I B;  3WA9 D;  1P3G C;  3WKJ D;  1P3K B;  1ZLA D;  4DQY B;  5CPJ D;  3AN2 A;  1P3O A;  5B1L D;  1HQ3 B;  5B24 A;  3MGS A;  2CV5 A;  2FJ7 D;  3W98 B;  5BO0 B;  5BT1 D;  5B0Y B;  3MGQ B;  3AZF B;  5DNM D;  1KX3 A;  3AYW B;  4H9P A;  5GSU C;  2JE5 A;  3AZN A;  5B33 D;  5CPI D;  5AVB C;  3WA9 C;  3EPL A;  5E5A B;  2BYM A;  4J8U A;  2ARO A;  3WKJ C;  4UUZ B;  5JA4 A;  2YFV A;  2G5H C;  5CPJ C;  5BT1 C;  1TAF B;  5DNM C;  3MNN B;  4LD9 C;  1HQ3 D;  3W98 D;  4KHA B;  3LEL B;  3WTP B;  4WV4 B;  5B33 C;  3AYW D;  1AOI A;  5CPI C;  3C1C A;  5CPK D;  3AZL A;  1KX5 A;  3AZJ B;  5AV6 D;  1BH8 A;  1HQ3 C;  5CP6 C;  1P3A B;  1F66 A;  2BG1 A;  3LJA B;  3AYW C;  4XUJ A;  3X1T D;  3LEL D;  5CPK C;  1JFI B;  1P3L B;  3A1I A;  4JJN C;  5AV6 C;  5B40 B;  3AFA A;  3AN2 B;  1P3O B;  2YFW A;  4ZBJ C;  2CV5 B;  1KX3 B;  1P3A D;  3X1T C;  3LEL C;  5AY8 D;  3REI B;  5B0Z D;  5AV8 B;  3A6N B;  3AZN B;  2F8N A;  5BNV A;  4YS3 C;  3REH A;  3UTB B;  1P3L D;  4J8X A;  2BYM B;  2ARO B;  5JRG A;  3AZI A;  3MGP A;  1P3M D;  4H9Q B;  3X1S A;  4J8V D;  5AY8 C;  3AZE A;  3REL D;  2PYO C;  3FDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...