4AWLC

The nf-y transcription factor is structurally and functionally a sequence specific histone
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
VQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
publication title Sequence-Specific Transcription Factor NF-Y Displays Histone-Like DNA Binding and H2B-Like Ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4awlC00
5AV5A 4EO5C 4CSRA 3REKC 3LZ0A 3RELB 3UTBD 5CPIB 5B32C 1P3LB 3W98A 3A6ND 3WA9D 5DNMC 5AV5B 3X1VC 2HIOA 3MGPB 3AZFB 1HTAA 5BNVB 3LZ0B 1TZYC 3W98B 2BYMA 3V9RB 1WWIA 3AZHB 4H9SC 3LZ1A 3KUYB 3REKD 1KX5C 5B32D 1S32B 1B6WA 5AV8A 3REHA 5DNMD 2BYMB 1TAFB 5AVBA 3B0CT 3LZ1B 3MNNC 1TZYD 3MGRC 5E5AC 5AVCC 5GT0B 5GSUA 3AZKC 3AYWA 3AZMB 3REHB 5DNNA 3X1VA 3KXBC 3AYWB 2NZDC 5GXQB 4R8PB 3MNND 3MGRD 4KUDB 1P3PC 4JJNC 5DNNB 5CP6C 5E5AD 5AVCD 1ID3A 3AZKD 4HGAC 3LELB 1ULYA 1KX5A 5C3IB 4J8XC 1AOIB 4X23B 4NE6A 5F99C 5CPJB 3KXBD 1JFIB 1ID3B 5AV6C 1M1AC 2NZDD 4XZQA 1P3PD 4JJND 2YFWA 1P3GA 5CP6D 3AZJD 4J8WC 4E44A 3W99A 5AV9B 3LJAA 4Z66B 5B0YC 1U35B 2F8NB 5F99D 4G92C 3AZLA 5AV6D 5B1LC 3AZIB 5B0ZC 3AZNA 1M1AD 3W99B 3MVDD 3WAAC 3O62A 1M18A 1P3KA 3KWQB 3UT9A 4J8WD 3B6GC 4YM6B 4J8XA 3AZLB 3AV1B 2F8NK 3AZNB 4LD9C 2PYOB 3O62B 1M18B 3UT9B 3B0CW 5B1LD 5B0ZD 1N1JA 4WU9A 1M19C 3UTAC 3WAAD 3MGSC 4H9QB 1P3IC 3B6GD 5JRGC 5B0YA 5AY8B 1P3BC 4LD9D 1P3OC 5BO0A 3MGQC 4YS3A 1EQZC 1P34C 3NQUA 2NQBD 3B0BA 3AV2C 1M19D 3UTAD 2CV5A 4J8VB 3MGSD 3W97D 1P3MC 2AROA 1P3ID 3REJA 5G49A 4QLCB 1P3LC 3NQUB 5JRGD 1P3BD 1P3OD 4NE3A 5AV5C 5B40A 1EQZD 4KGCD 4ZUXB 3AV2D 1P3FA 3LZ0C 3REJB 3W98C 1P3AA 5BT1D 5B2IB 4ZBJB 5B31G 1H3OB 4AWLC 1P3MD 5B40B 1P3LD 2HIOC 3X1TA 1S32C 1P3FB 4XUJA 5CPKB 3MGQA 5AV5D 1P34A 3C1BA 5B31B 3LZ1C 3LZ0D 3W98D 3REIA 2BYKA 5AV8C 3REHC 3RELA 3AZGA 5CPIA 2CWEA 1F66A 2HIOD 4NE5A 3C1BB 4UUZB 5AVBC 3AZEA 3REIB 2BYKB 5B33B 5GSUC 5FUGB 3MGPA 3AYWC 3AZFA 5BNVA 3AZGB 3LZ1D 1F66B 3V9RA 5B2JA 5DNNC 3AZEB 3AZHA 3WKJB 5AV8D 3REHD 3KUYA 1HQ3B 1S32A 5AVBD 1KX3B 4H9NA 3B0DB 5B2JB 1TAFA 4WNNA 3WTPB 1ID3C 5GSUD 3AYWD 1Q9CA 5DNND 2L5AA 5GT0A 3AZMA 4H9NB 3X1VD 5B24A 4WNNB 3AN2B 4XZQC 1P3GC 1ID3D 3W99C 5GXQA 5B24B 4R8PA 1KX5D 4KUDA 3LJAC 1KU5A 2RVQC 3LELA 4J8UB 3AZLC 3AZNC 1AOIA 4XZQD 4X23A 3O62C 5CPJA 1M18C 5KDMB 1P3KC 1P3GD 1JFIA 3UT9C 4KHAA 1A7WA 3W99D 3LJAD 4NFTA 3UTBB 4M6BA 2RVQD 5AV9A 1WWSA 3AZLD 3WA9B 4Z66A 4KHAB 5B32G 3AZND 4WU9C 1U35A 2F8NA 3O62D 1M18D 1KX4A 1P3KD 3UT9D 3AZIA 3X1UA 4J8XD 3KWQA 4DRAA 3REKB 4YS3C 1KX4B 2JSSA 4YM6A 3AV1A 3X1UB 5DNMB 4WU9D 2PYOA 2CV5C 3AFAA 1TZYB 2AROC 3REJC 3NQJA 3W96A 5B0YD 4H9QA 4YS3D 5B40C 3AFAB 5AY8A 1P3FC 3NQJB 2CV5D 3W96B 1P3AC 2AROD 5AVCB 3REJD 3AZKB 4J8VA 3X1TC 5JA4A 4XUJC 2YFVB 5B40D 4QLCA 3C1BC 2HUEC 1P3FD 3KXBB 3REIC 5JA4B 1P3AD 1P3PB 4ZUXA 4JJNB 2IO5B 3RELC 5CP6B 5CPIC 3AZGC 3AZJB 1F66C 4HGAB 3X1TD 4H9OB 3AZEC 4XUJD 5B2IA 1H3OA 3MGQD 1ZLAA 1P34D 3C1BD 5F99B 3MGPC 3AZFC 5CPKA 5AV6B 3B0DC 5B2JC 3R45B 3REID 3TU4A 1M1AB 3MVDB 3AZHC 5B31A 3KUYC 3RELD 3AZGD 5CPID 1F66D 1ZLAB 4J8WB 3AZED 4H9RB 3VH6T 3TU4B 4UUZA 3MGPD 3AZFD 4G92B 4Z2MH 5B1LB 5B2JD 5B0ZB 5GT0C 5B33A 3AZMC 5FUGA 3AZHD 5B24C 3KUYD 1BH9B 1S32D 3B6GB 3WKJA 4LD9B 1HQ3A 3X1SA 4Z5TA 1BFMA 1KX3A 1R4VA 4R8PC 5GXQC 4KUDC 2NQBB 5BS7A 3WTPA 1M19B 5GT0D 3UTAB 3AZMD 3LELC 3MGSB 3W97B 5B24D 5C3IC 5GT3A 4KGCA 1P3IB 3X1SB 4Z5TB 3UTBC 1AOIC 4X23C 5CPJC 1P3BB 1P3OB 3AN2A 1EQZB 5GXQD 4R8PD 4KUDD 5GT3B 4KGCB 3AV2B 3VH6A 3LELD 5AV9C 1P3MB 3B6FA 4Z66C 1AOID 2FJ7A 1U35C 1BH8B 4X23D 5CPJD 1B67A 4J8UA 1KX4C 5B1MA 3AZIC 3X1UC 4WU8A 3B6FB 5KDMA 4CSRB 3KWQC 3C1CA 2FJ7B 4YM6C 3AV1C 5B1MB 5AV9D 4AWLB 4Z66D 3UTBA 3VH6W 2HIOB 4WU8B 1U35D 2F8ND 2PYOC 1KX4D 3A6NA 3AFAC 3C1CB 3WA9A 3AZID 3X1UD 4WZSB 3W96C 3KWQD 4G91B 1F1EA 3A6NB 4YM6D 3AV1D 5AV8B 5AY8C 3REKA 5B32A 2PYOD 5AVBB 3AFAD 5DNMA 5GSUB 3KSYA 4J8VC 4EO5B 3W96D 1TZYA 5B32B 3VH5T 2IO5C 3AZJC 4QLCC 4H9PA 4H9SA 3X1VB 5AY8D 4WV4B 5CHLB 2F8NH 4ZUXC 4J8VD 4H9PB 2F8NG 3MVDC 3MNNA 1KX5B 3MGRA 5B2IC 4ZBJC 5E5AA 5AVCA 1ZLAC 4QLCD 3AZKA 4CAYA 4E45A 5CPKC 2YFVA 3TU4C 4XZQB 3MNNB 3MGRB 4ZUXD 2YFWB 5B31C 5E5AB 3KXBA 1P3GB 4CAYB 2NZDA 5B2ID 1P3PA 3LJAB 4JJNA 5CP6A 3AZJA 1ZLAD 4H9OA 5CPKD 3VH5A 2NZDB 3TU4D 5B33C 5F99A 1P3KB 5B31D 5AV6A 2NQBC 3R45A 1M1AA 3MVDA 3WKJC 4J8XB 2LY8A 3W97C 1HQ3C 4J8WA 3X1SC 4Z5TC 4H9RA 1KX3C 5BS7C 1N1JB 3WTPC 4WU9B 5B33D 5GT3C 5B1LA 4KGCC 5B0ZA 3VH5W 3WAAA 3WKJD 5B0YB 1BH9A 5BT1C 1HQ3D 3AN2C 5BO0B 4YS3B 3X1SD 3B6GA 4Z5TD 1KX3D 5BNXA 4LD9A 3WTPD 3WTPE 3WAAB 2CV5B 4Z2MG 2NQBA 3B6FC 2AROB 5GT3D 1M19A 5G49B 3UTAA 2FJ7C 3W97A 3MGSA 5BNXB 4J8UC 5B1MC 3AN2D 1P3IA 4WU8C 5JRGA 1P3BA 3C1CC 1P3OA 1EQZA 1P3AB 3B6FD 3AV2A 2FJ7D 4G91C 5JRGB 3X1TB 4J8UD 3A6NC 4XUJB 1P3MA 5B1MD 3WA9C 3MGQB 1P34B 1P3LA 4DRBA 1BH8A 4WU8D 2HUEB 3C1CD
chains in the Genus database with same CATH superfamily
5AV5A 4EO5C 4CSRA 2W8SA 3REKC 3LZ0A 3RELB 3UTBD 5CPIB 5B32C 1P3LB 3W98A 3A6ND 3WA9D 5DNMC 5AV5B 3X1VC 2HIOA 3MGPB 3AZFB 1HTAA 5BNVB 2BG1A 3LZ0B 1TZYC 3W98B 2BYMA 3V9RB 1WWIA 3AZHB 4H9SC 3LZ1A 3KUYB 3REKD 1KX5C 5B32D 1S32B 1B6WA 3EPJA 5AV8A 3REHA 5DNMD 2BYMB 1TAFB 5AVBA 3B0CT 3LZ1B 3MNNC 1TZYD 3MGRC 1T3UA 5E5AC 5AVCC 5GT0B 5GSUA 3AZKC 3AYWA 3AZMB 3REHB 5DNNA 3X1VA 3KXBC 2Y2MA 3AYWB 2NZDC 5GXQB 4R8PB 3MNND 3MGRD 4KUDB 1P3PC 4JJNC 5DNNB 5CP6C 5E5AD 5AVCD 1ID3A 3AZKD 4HGAC 3LELB 1ULYA 1KX5A 5C3IB 4J8XC 1AOIB 4X23B 4NE6A 5F99C 5CPJB 3KXBD 4DQYB 1JFIB 1ID3B 5AV6C 1M1AC 2NZDD 4XZQA 1P3PD 4JJND 2YFWA 1P3GA 5CP6D 3AZJD 1Z2CB 4J8WC 4E44A 3W99A 5AV9B 3LJAA 4Z66B 5B0YC 1U35B 2F8NB 5F99D 4G92C 3AZLA 5AV6D 5B1LC 3AZIB 5B0ZC 3AZNA 1M1AD 3W99B 3MVDD 3WAAC 3O62A 1M18A 1P3KA 3KWQB 3UT9A 4J8WD 3B6GC 4YM6B 4J8XA 3AZLB 3AV1B 2F8NK 3AZNB 4LD9C 2DQNC 2PYOB 3O62B 1M18B 3UT9B 2ZM5A 3B0CW 5B1LD 5B0ZD 1N1JA 4WU9A 1M19C 3UTAC 3WAAD 3MGSC 4H9QB 1P3IC 3B6GD 5JRGC 5B0YA 5AY8B 1P3BC 4LD9D 1P3OC 5BO0A 3MGQC 4YS3A 1EQZC 1P34C 3NQUA 2NQBD 3B0BA 3AV2C 1M19D 3UTAD 2CV5A 4J8VB 3MGSD 3W97D 1P3MC 2AROA 1P3ID 3H0RC 5G49A 4QLCB 3REJA 1P3LC 3NQUB 5JRGD 1P3BD 1P3OD 4NE3A 5AV5C 5B40A 1EQZD 2JCHA 4KGCD 4ZUXB 3AV2D 1P3FA 3LZ0C 3REJB 3W98C 1P3AA 5BT1D 5B2IB 3IP4C 4ZBJB 1H3OB 5B31G 4AWLC 1P3MD 3EPHA 5B40B 2Y2KA 1P3LD 2HIOC 3X1TA 1S32C 2J8PA 1P3FB 4XUJA 5CPKB 3MGQA 5AV5D 1P34A 3C1BA 5B31B 3LZ1C 3LZ0D 3W98D 3REIA 2BYKA 5AV8C 3REHC 3RELA 3AZGA 2Y2GA 2CWEA 5CPIA 1F66A 2HIOD 4NE5A 3C1BB 4UUZB 5AVBC 3AZEA 1PZRA 3REIB 2BYKB 5B33B 5GSUC 5FUGB 3MGPA 3AYWC 3AZFA 5BNVA 3AZGB 3LZ1D 1F66B 3V9RA 5B2JA 5DNNC 3AZEB 3AZHA 3WKJB 5AV8D 3REHD 3KUYA 1HQ3B 1S32A 5AVBD 1KX3B 4H9NA 3B0DB 5B2JB 1TAFA 4WNNA 3FDDA 3WTPB 1ID3C 5GSUD 3AYWD 1Q9CA 5DNND 2L5AA 5GT0A 3AZMA 4H9NB 3X1VD 5B24A 4WNNB 3AN2B 4XZQC 2ZY3A 1P3GC 1ID3D 3W99C 5GXQA 5B24B 4R8PA 1KX5D 4KUDA 3LJAC 1KU5A 2RVQC 3LELA 4J8UB 3AZLC 4WJ3C 3AZNC 1AOIA 4XZQD 4X23A 3O62C 5CPJA 1M18C 5KDMB 1P3KC 1P3GD 1JFIA 2RIQA 3UT9C 4KHAA 1A7WA 3W99D 3LJAD 4NFTA 3UTBB 4M6BA 2RVQD 2JE5A 1WWSA 5AV9A 3AZLD 3WA9B 4Z66A 4KHAB 5B32G 3AZND 3P5JB 4WU9C 1U35A 2F8NA 2XD1A 3O62D 1M18D 1KX4A 1P3KD 2ZY4A 3UT9D 3AZIA 3X1UA 4J8XD 3KWQA 4DRAA 3REKB 2Y2IA 4YS3C 1KX4B 2JSSA 4YM6A 3AV1A 2DF4C 3X1UB 5DNMB 4WU9D 2PYOA 2CV5C 3AFAA 1TZYB 2AROC 3REJC 3EG5B 3NQJA 3W96A 5B0YD 4H9QA 4YS3D 5B40C 3AFAB 4UPKA 5AY8A 1P3FC 3NQJB 2CV5D 3W96B 1P3AC 2AROD 5AVCB 3REJD 3AZKB 4J8VA 3X1TC 5JA4A 4XUJC 2YFVB 5B40D 4QLCA 3C1BC 2HUEC 1P3FD 3KXBB 3REIC 5JA4B 1P3AD 2Y2HA 4ZUXA 4JJNB 2IO5B 1P3PB 3RELC 5CP6B 5CPIC 3AZGC 3AZJB 1F66C 4HGAB 3X1TD 4H9OB 3AZEC 4XUJD 5B2IA 1H3OA 3MGQD 1ZLAA 1P34D 3C1BD 5F99B 3MGPC 3AZFC 5CPKA 5AV6B 3B0DC 5B2JC 3R45B 3REID 3TU4A 1M1AB 3MVDB 3AZHC 5B31A 3KUYC 3RELD 3AZGD 5CPID 1F66D 1ZLAB 4J8WB 3AZED 4H9RB 3VH6T 3TU4B 4UUZA 3MGPD 3AZFD 4G92B 4Z2MH 5B1LB 5B2JD 5B0ZB 5GT0C 5B33A 3AZMC 5FUGA 3AZHD 2Y2OA 5B24C 3KUYD 1BH9B 1S32D 3B6GB 3WKJA 4LD9B 1HQ3A 3X1SA 4Z5TA 1BFMA 2ZY2A 1KX3A 1R4VA 3H0MC 4R8PC 5GXQC 4KUDC 2NQBB 5BS7A 3WTPA 1M19B 5GT0D 3UTAB 3AZMD 3LELC 3MGSB 3W97B 5B24D 5C3IC 5GT3A 4KGCA 1P3IB 3X1SB 4Z5TB 3UTBC 1AOIC 1W2EA 4X23C 5CPJC 2Y2JA 1P3BB 1P3OB 3AN2A 1EQZB 5GXQD 4R8PD 4KUDD 5GT3B 4KGCB 3AV2B 3VH6A 3LELD 5AV9C 1P3MB 3B6FA 4Z66C 2ZY5A 1AOID 2FJ7A 1U35C 1BH8B 4X23D 5CPJD 1B67A 4J8UA 1KX4C 5B1MA 3KFUG 3AZIC 3X1UC 2UWXA 4WU8A 3B6FB 5KDMA 4CSRB 3KWQC 3C1CA 2G5HC 2FJ7B 4YM6C 3AV1C 5B1MB 5AV9D 4AWLB 4Z66D 3UTBA 3VH6W 2HIOB 4WU8B 2Y2LA 1U35D 2F8ND 1KX4D 2PYOC 3A6NA 3AFAC 3C1CB 3WA9A 3AZID 3X1UD 3H0LC 4WZSB 3W96C 3KWQD 4G91B 1F1EA 3A6NB 4YM6D 3AV1D 5AV8B 5AY8C 3REKA 5B32A 2PYOD 5AVBB 3AFAD 5DNMA 3EPLA 5GSUB 3KSYA 4J8VC 4EO5B 3W96D 1TZYA 5B32B 3VH5T 2IO5C 3AZJC 4QLCC 4H9PA 4H9SA 3X1VB 5AY8D 4WV4B 5CHLB 2F8NH 4ZUXC 3A1IA 4J8VD 4H9PB 2F8NG 3MVDC 3MNNA 1KX5B 3MGRA 5B2IC 4ZBJC 5E5AA 5AVCA 1ZLAC 4QLCD 3AZKA 4CAYA 4E45A 3EPKA 5CPKC 2Y2PA 2YFVA 3TU4C 4XZQB 3MNNB 2G5IC 3MGRB 4ZUXD 3AL0C 2YFWB 5B31C 5E5AB 3KXBA 1P3GB 4CAYB 2NZDA 5B2ID 1P3PA 3LJAB 3A1KA 4JJNA 5CP6A 3AZJA 1ZLAD 4H9OA 5CPKD 3VH5A 2NZDB 3TU4D 5B33C 5F99A 1P3KB 5B31D 5AV6A 2NQBC 3R45A 1M1AA 3MVDA 2F2AC 3WKJC 4J8XB 2LY8A 3W97C 1HQ3C 4J8WA 3X1SC 4Z5TC 4H9RA 1KX3C 2XD5A 5BS7C 1N1JB 3WTPC 4WU9B 5B33D 2VQRA 5GT3C 5B1LA 4KGCC 5B0ZA 3VH5W 3WAAA 3WKJD 5B0YB 1BH9A 2Y2QA 1HQ3D 5BT1C 3AN2C 5BO0B 4YS3B 3X1SD 3B6GA 4Z5TD 1KX3D 5BNXA 4LD9A 3WTPD 3WTPE 3WAAB 2CV5B 4Z2MG 2NQBA 3B6FC 2AROB 5GT3D 1M19A 5G49B 3UTAA 2FJ7C 3W97A 3MGSA 5BNXB 4J8UC 5B1MC 3AN2D 1P3IA 4WU8C 5JRGA 1P3BA 3C1CC 1P3OA 3F6TA 1EQZA 1P3AB 2FFFB 3B6FD 3AV2A 2FJ7D 4G91C 5JRGB 3X1TB 4J8UD 3A6NC 4XUJB 1P3MA 5B1MD 3WA9C 2Y2NA 3MGQB 1P34B 1P3LA 4DRBA 1BH8A 4WU8D 2HUEB 3C1CD
chains in the Genus database with same CATH topology
5AV5A 4EO5C 4CSRA 2W8SA 3REKC 3LZ0A 3RELB 3UTBD 5CPIB 5B32C 1P3LB 3W98A 3A6ND 3WA9D 5DNMC 5AV5B 3X1VC 2HIOA 3MGPB 3AZFB 1HTAA 5BNVB 2BG1A 3LZ0B 1TZYC 3W98B 2BYMA 3V9RB 1WWIA 3AZHB 4H9SC 3LZ1A 3KUYB 3REKD 1KX5C 5B32D 1S32B 1B6WA 3EPJA 5AV8A 3REHA 5DNMD 2BYMB 1TAFB 5AVBA 3B0CT 3LZ1B 3MNNC 1TZYD 3MGRC 1T3UA 5E5AC 5AVCC 5GT0B 5GSUA 3AZKC 3AYWA 3AZMB 3REHB 5DNNA 3X1VA 3KXBC 2Y2MA 3AYWB 2NZDC 5GXQB 4R8PB 3MNND 3MGRD 4KUDB 1P3PC 4JJNC 5DNNB 5CP6C 5E5AD 5AVCD 1ID3A 3AZKD 4HGAC 3LELB 1ULYA 1KX5A 5C3IB 4J8XC 1AOIB 4X23B 4NE6A 5F99C 5CPJB 3KXBD 4DQYB 1JFIB 1ID3B 5AV6C 1M1AC 2NZDD 4XZQA 1P3PD 4JJND 2YFWA 1P3GA 5CP6D 3AZJD 1Z2CB 4J8WC 4E44A 3W99A 5AV9B 3LJAA 4Z66B 5B0YC 1U35B 2F8NB 5F99D 4G92C 3AZLA 5AV6D 5B1LC 3AZIB 5B0ZC 3AZNA 1M1AD 3W99B 3MVDD 3WAAC 3O62A 1M18A 1P3KA 3KWQB 3UT9A 4J8WD 3B6GC 4YM6B 4J8XA 3AZLB 3AV1B 2F8NK 3AZNB 4LD9C 2DQNC 2PYOB 3O62B 1M18B 3UT9B 2ZM5A 3B0CW 5B1LD 5B0ZD 1N1JA 4WU9A 1M19C 3UTAC 3WAAD 3MGSC 4H9QB 1P3IC 3B6GD 5JRGC 5B0YA 5AY8B 1P3BC 4LD9D 1P3OC 5BO0A 3MGQC 4YS3A 1EQZC 1P34C 3NQUA 2NQBD 3B0BA 3AV2C 1M19D 3UTAD 2CV5A 4J8VB 3MGSD 3W97D 1P3MC 2AROA 1P3ID 3H0RC 5G49A 4QLCB 3REJA 1P3LC 3NQUB 5JRGD 1P3BD 1P3OD 4NE3A 5AV5C 5B40A 1EQZD 2JCHA 4KGCD 4ZUXB 3AV2D 1P3FA 3LZ0C 3REJB 3W98C 1P3AA 5BT1D 5B2IB 3IP4C 4ZBJB 1H3OB 5B31G 4AWLC 1P3MD 3EPHA 5B40B 2Y2KA 1P3LD 2HIOC 3X1TA 1S32C 2J8PA 1P3FB 4XUJA 5CPKB 3MGQA 5AV5D 1P34A 3C1BA 5B31B 3LZ1C 3LZ0D 3W98D 3REIA 2BYKA 5AV8C 3REHC 3RELA 3AZGA 2Y2GA 2CWEA 5CPIA 1F66A 2HIOD 4NE5A 3C1BB 4UUZB 5AVBC 3AZEA 1PZRA 3REIB 2BYKB 5B33B 5GSUC 5FUGB 3MGPA 3AYWC 3AZFA 5BNVA 3AZGB 3LZ1D 1F66B 3V9RA 5B2JA 5DNNC 3AZEB 3AZHA 3WKJB 5AV8D 3REHD 3KUYA 1HQ3B 1S32A 5AVBD 1KX3B 4H9NA 3B0DB 5B2JB 1TAFA 4WNNA 3FDDA 3WTPB 1ID3C 5GSUD 3AYWD 1Q9CA 5DNND 2L5AA 5GT0A 3AZMA 4H9NB 3X1VD 5B24A 4WNNB 3AN2B 4XZQC 2ZY3A 1P3GC 1ID3D 3W99C 5GXQA 5B24B 4R8PA 1KX5D 4KUDA 3LJAC 1KU5A 2RVQC 3LELA 4J8UB 3AZLC 4WJ3C 3AZNC 1AOIA 4XZQD 4X23A 3O62C 5CPJA 1M18C 5KDMB 1P3KC 1P3GD 1JFIA 2RIQA 3UT9C 4KHAA 1A7WA 3W99D 3LJAD 4NFTA 3UTBB 4M6BA 2RVQD 2JE5A 1WWSA 5AV9A 3AZLD 3WA9B 4Z66A 4KHAB 5B32G 3AZND 3P5JB 4WU9C 1U35A 2F8NA 2XD1A 3O62D 1M18D 1KX4A 1P3KD 2ZY4A 3UT9D 3AZIA 3X1UA 4J8XD 3KWQA 4DRAA 3REKB 2Y2IA 4YS3C 1KX4B 2JSSA 4YM6A 3AV1A 2DF4C 3X1UB 5DNMB 4WU9D 2PYOA 2CV5C 3AFAA 1TZYB 2AROC 3REJC 3EG5B 3NQJA 3W96A 5B0YD 4H9QA 4YS3D 5B40C 3AFAB 4UPKA 5AY8A 1P3FC 3NQJB 2CV5D 3W96B 1P3AC 2AROD 5AVCB 3REJD 3AZKB 4J8VA 3X1TC 5JA4A 4XUJC 2YFVB 5B40D 4QLCA 3C1BC 2HUEC 1P3FD 3KXBB 3REIC 5JA4B 1P3AD 2Y2HA 4ZUXA 4JJNB 2IO5B 1P3PB 3RELC 5CP6B 5CPIC 3AZGC 3AZJB 1F66C 4HGAB 3X1TD 4H9OB 3AZEC 4XUJD 5B2IA 1H3OA 3MGQD 1ZLAA 1P34D 3C1BD 5F99B 3MGPC 3AZFC 5CPKA 5AV6B 3B0DC 5B2JC 3R45B 3REID 3TU4A 1M1AB 3MVDB 3AZHC 5B31A 3KUYC 3RELD 3AZGD 5CPID 1F66D 1ZLAB 4J8WB 3AZED 4H9RB 3VH6T 3TU4B 4UUZA 3MGPD 3AZFD 4G92B 4Z2MH 5B1LB 5B2JD 5B0ZB 5GT0C 5B33A 3AZMC 5FUGA 3AZHD 2Y2OA 5B24C 3KUYD 1BH9B 1S32D 3B6GB 3WKJA 4LD9B 1HQ3A 3X1SA 4Z5TA 1BFMA 2ZY2A 1KX3A 1R4VA 3H0MC 4R8PC 5GXQC 4KUDC 2NQBB 5BS7A 3WTPA 1M19B 5GT0D 3UTAB 3AZMD 3LELC 3MGSB 3W97B 5B24D 5C3IC 5GT3A 4KGCA 1P3IB 3X1SB 4Z5TB 3UTBC 1AOIC 1W2EA 4X23C 5CPJC 2Y2JA 1P3BB 1P3OB 3AN2A 1EQZB 5GXQD 4R8PD 4KUDD 5GT3B 4KGCB 3AV2B 3VH6A 3LELD 5AV9C 1P3MB 3B6FA 4Z66C 2ZY5A 1AOID 2FJ7A 1U35C 1BH8B 4X23D 5CPJD 1B67A 4J8UA 1KX4C 5B1MA 3KFUG 3AZIC 3X1UC 2UWXA 4WU8A 3B6FB 5KDMA 4CSRB 3KWQC 3C1CA 2G5HC 2FJ7B 4YM6C 3AV1C 5B1MB 5AV9D 4AWLB 4Z66D 3UTBA 3VH6W 2HIOB 4WU8B 2Y2LA 1U35D 2F8ND 1KX4D 2PYOC 3A6NA 3AFAC 3C1CB 3WA9A 3AZID 3X1UD 3H0LC 4WZSB 3W96C 3KWQD 4G91B 1F1EA 3A6NB 4YM6D 3AV1D 5AV8B 5AY8C 3REKA 5B32A 2PYOD 5AVBB 3AFAD 5DNMA 3EPLA 5GSUB 3KSYA 4J8VC 4EO5B 3W96D 1TZYA 5B32B 3VH5T 2IO5C 3AZJC 4QLCC 4H9PA 4H9SA 3X1VB 5AY8D 4WV4B 5CHLB 2F8NH 4ZUXC 3A1IA 4J8VD 4H9PB 2F8NG 3MVDC 3MNNA 1KX5B 3MGRA 5B2IC 4ZBJC 5E5AA 5AVCA 1ZLAC 4QLCD 3AZKA 4CAYA 4E45A 3EPKA 5CPKC 2Y2PA 2YFVA 3TU4C 4XZQB 3MNNB 2G5IC 3MGRB 4ZUXD 3AL0C 2YFWB 5B31C 5E5AB 3KXBA 1P3GB 4CAYB 2NZDA 5B2ID 1P3PA 3LJAB 3A1KA 4JJNA 5CP6A 3AZJA 1ZLAD 4H9OA 5CPKD 3VH5A 2NZDB 3TU4D 5B33C 5F99A 1P3KB 5B31D 5AV6A 2NQBC 3R45A 1M1AA 3MVDA 2F2AC 3WKJC 4J8XB 2LY8A 3W97C 1HQ3C 4J8WA 3X1SC 4Z5TC 4H9RA 1KX3C 2XD5A 5BS7C 1N1JB 3WTPC 4WU9B 5B33D 2VQRA 5GT3C 5B1LA 4KGCC 5B0ZA 3VH5W 3WAAA 3WKJD 5B0YB 1BH9A 2Y2QA 1HQ3D 5BT1C 3AN2C 5BO0B 4YS3B 3X1SD 3B6GA 4Z5TD 1KX3D 5BNXA 4LD9A 3WTPD 3WTPE 3WAAB 2CV5B 4Z2MG 2NQBA 3B6FC 2AROB 5GT3D 1M19A 5G49B 3UTAA 2FJ7C 3W97A 3MGSA 5BNXB 4J8UC 5B1MC 3AN2D 1P3IA 4WU8C 5JRGA 1P3BA 3C1CC 1P3OA 3F6TA 1EQZA 1P3AB 2FFFB 3B6FD 3AV2A 2FJ7D 4G91C 5JRGB 3X1TB 4J8UD 3A6NC 4XUJB 1P3MA 5B1MD 3WA9C 2Y2NA 3MGQB 1P34B 1P3LA 4DRBA 1BH8A 4WU8D 2HUEB 3C1CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 A;  4EO5 C;  4CSR A;  3REK C;  3LZ0 A;  3REL B;  3UTB D;  5CPI B;  5B32 C;  1P3L B;  3W98 A;  3A6N D;  3WA9 D;  5DNM C;  5AV5 B;  3X1V C;  2HIO A;  3MGP B;  3AZF B;  1HTA A;  5BNV B;  3LZ0 B;  1TZY C;  3W98 B;  2BYM A;  3V9R B;  1WWI A;  3AZH B;  4H9S C;  3LZ1 A;  3KUY B;  3REK D;  1KX5 C;  5B32 D;  1S32 B;  1B6W A;  5AV8 A;  3REH A;  5DNM D;  2BYM B;  1TAF B;  5AVB A;  3B0C T;  3LZ1 B;  3MNN C;  1TZY D;  3MGR C;  5E5A C;  5AVC C;  5GT0 B;  5GSU A;  3AZK C;  3AYW A;  3AZM B;  3REH B;  5DNN A;  3X1V A;  3KXB C;  3AYW B;  2NZD C;  5GXQ B;  4R8P B;  3MNN D;  3MGR D;  4KUD B;  1P3P C;  4JJN C;  5DNN B;  5CP6 C;  5E5A D;  5AVC D;  1ID3 A;  3AZK D;  4HGA C;  3LEL B;  1ULY A;  1KX5 A;  5C3I B;  4J8X C;  1AOI B;  4X23 B;  4NE6 A;  5F99 C;  5CPJ B;  3KXB D;  1JFI B;  1ID3 B;  5AV6 C;  1M1A C;  2NZD D;  4XZQ A;  1P3P D;  4JJN D;  2YFW A;  1P3G A;  5CP6 D;  3AZJ D;  4J8W C;  4E44 A;  3W99 A;  5AV9 B;  3LJA A;  4Z66 B;  5B0Y C;  1U35 B;  2F8N B;  5F99 D;  4G92 C;  3AZL A;  5AV6 D;  5B1L C;  3AZI B;  5B0Z C;  3AZN A;  1M1A D;  3W99 B;  3MVD D;  3WAA C;  3O62 A;  1M18 A;  1P3K A;  3KWQ B;  3UT9 A;  4J8W D;  3B6G C;  4YM6 B;  4J8X A;  3AZL B;  3AV1 B;  2F8N K;  3AZN B;  4LD9 C;  2PYO B;  3O62 B;  1M18 B;  3UT9 B;  3B0C W;  5B1L D;  5B0Z D;  1N1J A;  4WU9 A;  1M19 C;  3UTA C;  3WAA D;  3MGS C;  4H9Q B;  1P3I C;  3B6G D;  5JRG C;  5B0Y A;  5AY8 B;  1P3B C;  4LD9 D;  1P3O C;  5BO0 A;  3MGQ C;  4YS3 A;  1EQZ C;  1P34 C;  3NQU A;  2NQB D;  3B0B A;  3AV2 C;  1M19 D;  3UTA D;  2CV5 A;  4J8V B;  3MGS D;  3W97 D;  1P3M C;  2ARO A;  1P3I D;  3REJ A;  5G49 A;  4QLC B;  1P3L C;  3NQU B;  5JRG D;  1P3B D;  1P3O D;  4NE3 A;  5AV5 C;  5B40 A;  1EQZ D;  4KGC D;  4ZUX B;  3AV2 D;  1P3F A;  3LZ0 C;  3REJ B;  3W98 C;  1P3A A;  5BT1 D;  5B2I B;  4ZBJ B;  5B31 G;  1H3O B;  4AWL C;  1P3M D;  5B40 B;  1P3L D;  2HIO C;  3X1T A;  1S32 C;  1P3F B;  4XUJ A;  5CPK B;  3MGQ A;  5AV5 D;  1P34 A;  3C1B A;  5B31 B;  3LZ1 C;  3LZ0 D;  3W98 D;  3REI A;  2BYK A;  5AV8 C;  3REH C;  3REL A;  3AZG A;  5CPI A;  2CWE A;  1F66 A;  2HIO D;  4NE5 A;  3C1B B;  4UUZ B;  5AVB C;  3AZE A;  3REI B;  2BYK B;  5B33 B;  5GSU C;  5FUG B;  3MGP A;  3AYW C;  3AZF A;  5BNV A;  3AZG B;  3LZ1 D;  1F66 B;  3V9R A;  5B2J A;  5DNN C;  3AZE B;  3AZH A;  3WKJ B;  5AV8 D;  3REH D;  3KUY A;  1HQ3 B;  1S32 A;  5AVB D;  1KX3 B;  4H9N A;  3B0D B;  5B2J B;  1TAF A;  4WNN A;  3WTP B;  1ID3 C;  5GSU D;  3AYW D;  1Q9C A;  5DNN D;  2L5A A;  5GT0 A;  3AZM A;  4H9N B;  3X1V D;  5B24 A;  4WNN B;  3AN2 B;  4XZQ C;  1P3G C;  1ID3 D;  3W99 C;  5GXQ A;  5B24 B;  4R8P A;  1KX5 D;  4KUD A;  3LJA C;  1KU5 A;  2RVQ C;  3LEL A;  4J8U B;  3AZL C;  3AZN C;  1AOI A;  4XZQ D;  4X23 A;  3O62 C;  5CPJ A;  1M18 C;  5KDM B;  1P3K C;  1P3G D;  1JFI A;  3UT9 C;  4KHA A;  1A7W A;  3W99 D;  3LJA D;  4NFT A;  3UTB B;  4M6B A;  2RVQ D;  5AV9 A;  1WWS A;  3AZL D;  3WA9 B;  4Z66 A;  4KHA B;  5B32 G;  3AZN D;  4WU9 C;  1U35 A;  2F8N A;  3O62 D;  1M18 D;  1KX4 A;  1P3K D;  3UT9 D;  3AZI A;  3X1U A;  4J8X D;  3KWQ A;  4DRA A;  3REK B;  4YS3 C;  1KX4 B;  2JSS A;  4YM6 A;  3AV1 A;  3X1U B;  5DNM B;  4WU9 D;  2PYO A;  2CV5 C;  3AFA A;  1TZY B;  2ARO C;  3REJ C;  3NQJ A;  3W96 A;  5B0Y D;  4H9Q A;  4YS3 D;  5B40 C;  3AFA B;  5AY8 A;  1P3F C;  3NQJ B;  2CV5 D;  3W96 B;  1P3A C;  2ARO D;  5AVC B;  3REJ D;  3AZK B;  4J8V A;  3X1T C;  5JA4 A;  4XUJ C;  2YFV B;  5B40 D;  4QLC A;  3C1B C;  2HUE C;  1P3F D;  3KXB B;  3REI C;  5JA4 B;  1P3A D;  1P3P B;  4ZUX A;  4JJN B;  2IO5 B;  3REL C;  5CP6 B;  5CPI C;  3AZG C;  3AZJ B;  1F66 C;  4HGA B;  3X1T D;  4H9O B;  3AZE C;  4XUJ D;  5B2I A;  1H3O A;  3MGQ D;  1ZLA A;  1P34 D;  3C1B D;  5F99 B;  3MGP C;  3AZF C;  5CPK A;  5AV6 B;  3B0D C;  5B2J C;  3R45 B;  3REI D;  3TU4 A;  1M1A B;  3MVD B;  3AZH C;  5B31 A;  3KUY C;  3REL D;  3AZG D;  5CPI D;  1F66 D;  1ZLA B;  4J8W B;  3AZE D;  4H9R B;  3VH6 T;  3TU4 B;  4UUZ A;  3MGP D;  3AZF D;  4G92 B;  4Z2M H;  5B1L B;  5B2J D;  5B0Z B;  5GT0 C;  5B33 A;  3AZM C;  5FUG A;  3AZH D;  5B24 C;  3KUY D;  1BH9 B;  1S32 D;  3B6G B;  3WKJ A;  4LD9 B;  1HQ3 A;  3X1S A;  4Z5T A;  1BFM A;  1KX3 A;  1R4V A;  4R8P C;  5GXQ C;  4KUD C;  2NQB B;  5BS7 A;  3WTP A;  1M19 B;  5GT0 D;  3UTA B;  3AZM D;  3LEL C;  3MGS B;  3W97 B;  5B24 D;  5C3I C;  5GT3 A;  4KGC A;  1P3I B;  3X1S B;  4Z5T B;  3UTB C;  1AOI C;  4X23 C;  5CPJ C;  1P3B B;  1P3O B;  3AN2 A;  1EQZ B;  5GXQ D;  4R8P D;  4KUD D;  5GT3 B;  4KGC B;  3AV2 B;  3VH6 A;  3LEL D;  5AV9 C;  1P3M B;  3B6F A;  4Z66 C;  1AOI D;  2FJ7 A;  1U35 C;  1BH8 B;  4X23 D;  5CPJ D;  1B67 A;  4J8U A;  1KX4 C;  5B1M A;  3AZI C;  3X1U C;  4WU8 A;  3B6F B;  5KDM A;  4CSR B;  3KWQ C;  3C1C A;  2FJ7 B;  4YM6 C;  3AV1 C;  5B1M B;  5AV9 D;  4AWL B;  4Z66 D;  3UTB A;  3VH6 W;  2HIO B;  4WU8 B;  1U35 D;  2F8N D;  2PYO C;  1KX4 D;  3A6N A;  3AFA C;  3C1C B;  3WA9 A;  3AZI D;  3X1U D;  4WZS B;  3W96 C;  3KWQ D;  4G91 B;  1F1E A;  3A6N B;  4YM6 D;  3AV1 D;  5AV8 B;  5AY8 C;  3REK A;  5B32 A;  2PYO D;  5AVB B;  3AFA D;  5DNM A;  5GSU B;  3KSY A;  4J8V C;  4EO5 B;  3W96 D;  1TZY A;  5B32 B;  3VH5 T;  2IO5 C;  3AZJ C;  4QLC C;  4H9P A;  4H9S A;  3X1V B;  5AY8 D;  4WV4 B;  5CHL B;  2F8N H;  4ZUX C;  4J8V D;  4H9P B;  2F8N G;  3MVD C;  3MNN A;  1KX5 B;  3MGR A;  5B2I C;  4ZBJ C;  5E5A A;  5AVC A;  1ZLA C;  4QLC D;  3AZK A;  4CAY A;  4E45 A;  5CPK C;  2YFV A;  3TU4 C;  4XZQ B;  3MNN B;  3MGR B;  4ZUX D;  2YFW B;  5B31 C;  5E5A B;  3KXB A;  1P3G B;  4CAY B;  2NZD A;  5B2I D;  1P3P A;  3LJA B;  4JJN A;  5CP6 A;  3AZJ A;  1ZLA D;  4H9O A;  5CPK D;  3VH5 A;  2NZD B;  3TU4 D;  5B33 C;  5F99 A;  1P3K B;  5B31 D;  5AV6 A;  2NQB C;  3R45 A;  1M1A A;  3MVD A;  3WKJ C;  4J8X B;  2LY8 A;  3W97 C;  1HQ3 C;  4J8W A;  3X1S C;  4Z5T C;  4H9R A;  1KX3 C;  5BS7 C;  1N1J B;  3WTP C;  4WU9 B;  5B33 D;  5GT3 C;  5B1L A;  4KGC C;  5B0Z A;  3VH5 W;  3WAA A;  3WKJ D;  5B0Y B;  1BH9 A;  5BT1 C;  1HQ3 D;  3AN2 C;  5BO0 B;  4YS3 B;  3X1S D;  3B6G A;  4Z5T D;  1KX3 D;  5BNX A;  4LD9 A;  3WTP D;  3WTP E;  3WAA B;  2CV5 B;  4Z2M G;  2NQB A;  3B6F C;  2ARO B;  5GT3 D;  1M19 A;  5G49 B;  3UTA A;  2FJ7 C;  3W97 A;  3MGS A;  5BNX B;  4J8U C;  5B1M C;  3AN2 D;  1P3I A;  4WU8 C;  5JRG A;  1P3B A;  3C1C C;  1P3O A;  1EQZ A;  1P3A B;  3B6F D;  3AV2 A;  2FJ7 D;  4G91 C;  5JRG B;  3X1T B;  4J8U D;  3A6N C;  4XUJ B;  1P3M A;  5B1M D;  3WA9 C;  3MGQ B;  1P34 B;  1P3L A;  4DRB A;  1BH8 A;  4WU8 D;  2HUE B;  3C1C D; 
#chains in the Genus database with same CATH topology
 5AV5 A;  4EO5 C;  4CSR A;  2W8S A;  3REK C;  3LZ0 A;  3REL B;  3UTB D;  5CPI B;  5B32 C;  1P3L B;  3W98 A;  3A6N D;  3WA9 D;  5DNM C;  5AV5 B;  3X1V C;  2HIO A;  3MGP B;  3AZF B;  1HTA A;  5BNV B;  2BG1 A;  3LZ0 B;  1TZY C;  3W98 B;  2BYM A;  3V9R B;  1WWI A;  3AZH B;  4H9S C;  3LZ1 A;  3KUY B;  3REK D;  1KX5 C;  5B32 D;  1S32 B;  1B6W A;  3EPJ A;  5AV8 A;  3REH A;  5DNM D;  2BYM B;  1TAF B;  5AVB A;  3B0C T;  3LZ1 B;  3MNN C;  1TZY D;  3MGR C;  1T3U A;  5E5A C;  5AVC C;  5GT0 B;  5GSU A;  3AZK C;  3AYW A;  3AZM B;  3REH B;  5DNN A;  3X1V A;  3KXB C;  2Y2M A;  3AYW B;  2NZD C;  5GXQ B;  4R8P B;  3MNN D;  3MGR D;  4KUD B;  1P3P C;  4JJN C;  5DNN B;  5CP6 C;  5E5A D;  5AVC D;  1ID3 A;  3AZK D;  4HGA C;  3LEL B;  1ULY A;  1KX5 A;  5C3I B;  4J8X C;  1AOI B;  4X23 B;  4NE6 A;  5F99 C;  5CPJ B;  3KXB D;  4DQY B;  1JFI B;  1ID3 B;  5AV6 C;  1M1A C;  2NZD D;  4XZQ A;  1P3P D;  4JJN D;  2YFW A;  1P3G A;  5CP6 D;  3AZJ D;  1Z2C B;  4J8W C;  4E44 A;  3W99 A;  5AV9 B;  3LJA A;  4Z66 B;  5B0Y C;  1U35 B;  2F8N B;  5F99 D;  4G92 C;  3AZL A;  5AV6 D;  5B1L C;  3AZI B;  5B0Z C;  3AZN A;  1M1A D;  3W99 B;  3MVD D;  3WAA C;  3O62 A;  1M18 A;  1P3K A;  3KWQ B;  3UT9 A;  4J8W D;  3B6G C;  4YM6 B;  4J8X A;  3AZL B;  3AV1 B;  2F8N K;  3AZN B;  4LD9 C;  2DQN C;  2PYO B;  3O62 B;  1M18 B;  3UT9 B;  2ZM5 A;  3B0C W;  5B1L D;  5B0Z D;  1N1J A;  4WU9 A;  1M19 C;  3UTA C;  3WAA D;  3MGS C;  4H9Q B;  1P3I C;  3B6G D;  5JRG C;  5B0Y A;  5AY8 B;  1P3B C;  4LD9 D;  1P3O C;  5BO0 A;  3MGQ C;  4YS3 A;  1EQZ C;  1P34 C;  3NQU A;  2NQB D;  3B0B A;  3AV2 C;  1M19 D;  3UTA D;  2CV5 A;  4J8V B;  3MGS D;  3W97 D;  1P3M C;  2ARO A;  1P3I D;  3H0R C;  5G49 A;  4QLC B;  3REJ A;  1P3L C;  3NQU B;  5JRG D;  1P3B D;  1P3O D;  4NE3 A;  5AV5 C;  5B40 A;  1EQZ D;  2JCH A;  4KGC D;  4ZUX B;  3AV2 D;  1P3F A;  3LZ0 C;  3REJ B;  3W98 C;  1P3A A;  5BT1 D;  5B2I B;  3IP4 C;  4ZBJ B;  1H3O B;  5B31 G;  4AWL C;  1P3M D;  3EPH A;  5B40 B;  2Y2K A;  1P3L D;  2HIO C;  3X1T A;  1S32 C;  2J8P A;  1P3F B;  4XUJ A;  5CPK B;  3MGQ A;  5AV5 D;  1P34 A;  3C1B A;  5B31 B;  3LZ1 C;  3LZ0 D;  3W98 D;  3REI A;  2BYK A;  5AV8 C;  3REH C;  3REL A;  3AZG A;  2Y2G A;  2CWE A;  5CPI A;  1F66 A;  2HIO D;  4NE5 A;  3C1B B;  4UUZ B;  5AVB C;  3AZE A;  1PZR A;  3REI B;  2BYK B;  5B33 B;  5GSU C;  5FUG B;  3MGP A;  3AYW C;  3AZF A;  5BNV A;  3AZG B;  3LZ1 D;  1F66 B;  3V9R A;  5B2J A;  5DNN C;  3AZE B;  3AZH A;  3WKJ B;  5AV8 D;  3REH D;  3KUY A;  1HQ3 B;  1S32 A;  5AVB D;  1KX3 B;  4H9N A;  3B0D B;  5B2J B;  1TAF A;  4WNN A;  3FDD A;  3WTP B;  1ID3 C;  5GSU D;  3AYW D;  1Q9C A;  5DNN D;  2L5A A;  5GT0 A;  3AZM A;  4H9N B;  3X1V D;  5B24 A;  4WNN B;  3AN2 B;  4XZQ C;  2ZY3 A;  1P3G C;  1ID3 D;  3W99 C;  5GXQ A;  5B24 B;  4R8P A;  1KX5 D;  4KUD A;  3LJA C;  1KU5 A;  2RVQ C;  3LEL A;  4J8U B;  3AZL C;  4WJ3 C;  3AZN C;  1AOI A;  4XZQ D;  4X23 A;  3O62 C;  5CPJ A;  1M18 C;  5KDM B;  1P3K C;  1P3G D;  1JFI A;  2RIQ A;  3UT9 C;  4KHA A;  1A7W A;  3W99 D;  3LJA D;  4NFT A;  3UTB B;  4M6B A;  2RVQ D;  2JE5 A;  1WWS A;  5AV9 A;  3AZL D;  3WA9 B;  4Z66 A;  4KHA B;  5B32 G;  3AZN D;  3P5J B;  4WU9 C;  1U35 A;  2F8N A;  2XD1 A;  3O62 D;  1M18 D;  1KX4 A;  1P3K D;  2ZY4 A;  3UT9 D;  3AZI A;  3X1U A;  4J8X D;  3KWQ A;  4DRA A;  3REK B;  2Y2I A;  4YS3 C;  1KX4 B;  2JSS A;  4YM6 A;  3AV1 A;  2DF4 C;  3X1U B;  5DNM B;  4WU9 D;  2PYO A;  2CV5 C;  3AFA A;  1TZY B;  2ARO C;  3REJ C;  3EG5 B;  3NQJ A;  3W96 A;  5B0Y D;  4H9Q A;  4YS3 D;  5B40 C;  3AFA B;  4UPK A;  5AY8 A;  1P3F C;  3NQJ B;  2CV5 D;  3W96 B;  1P3A C;  2ARO D;  5AVC B;  3REJ D;  3AZK B;  4J8V A;  3X1T C;  5JA4 A;  4XUJ C;  2YFV B;  5B40 D;  4QLC A;  3C1B C;  2HUE C;  1P3F D;  3KXB B;  3REI C;  5JA4 B;  1P3A D;  2Y2H A;  4ZUX A;  4JJN B;  2IO5 B;  1P3P B;  3REL C;  5CP6 B;  5CPI C;  3AZG C;  3AZJ B;  1F66 C;  4HGA B;  3X1T D;  4H9O B;  3AZE C;  4XUJ D;  5B2I A;  1H3O A;  3MGQ D;  1ZLA A;  1P34 D;  3C1B D;  5F99 B;  3MGP C;  3AZF C;  5CPK A;  5AV6 B;  3B0D C;  5B2J C;  3R45 B;  3REI D;  3TU4 A;  1M1A B;  3MVD B;  3AZH C;  5B31 A;  3KUY C;  3REL D;  3AZG D;  5CPI D;  1F66 D;  1ZLA B;  4J8W B;  3AZE D;  4H9R B;  3VH6 T;  3TU4 B;  4UUZ A;  3MGP D;  3AZF D;  4G92 B;  4Z2M H;  5B1L B;  5B2J D;  5B0Z B;  5GT0 C;  5B33 A;  3AZM C;  5FUG A;  3AZH D;  2Y2O A;  5B24 C;  3KUY D;  1BH9 B;  1S32 D;  3B6G B;  3WKJ A;  4LD9 B;  1HQ3 A;  3X1S A;  4Z5T A;  1BFM A;  2ZY2 A;  1KX3 A;  1R4V A;  3H0M C;  4R8P C;  5GXQ C;  4KUD C;  2NQB B;  5BS7 A;  3WTP A;  1M19 B;  5GT0 D;  3UTA B;  3AZM D;  3LEL C;  3MGS B;  3W97 B;  5B24 D;  5C3I C;  5GT3 A;  4KGC A;  1P3I B;  3X1S B;  4Z5T B;  3UTB C;  1AOI C;  1W2E A;  4X23 C;  5CPJ C;  2Y2J A;  1P3B B;  1P3O B;  3AN2 A;  1EQZ B;  5GXQ D;  4R8P D;  4KUD D;  5GT3 B;  4KGC B;  3AV2 B;  3VH6 A;  3LEL D;  5AV9 C;  1P3M B;  3B6F A;  4Z66 C;  2ZY5 A;  1AOI D;  2FJ7 A;  1U35 C;  1BH8 B;  4X23 D;  5CPJ D;  1B67 A;  4J8U A;  1KX4 C;  5B1M A;  3KFU G;  3AZI C;  3X1U C;  2UWX A;  4WU8 A;  3B6F B;  5KDM A;  4CSR B;  3KWQ C;  3C1C A;  2G5H C;  2FJ7 B;  4YM6 C;  3AV1 C;  5B1M B;  5AV9 D;  4AWL B;  4Z66 D;  3UTB A;  3VH6 W;  2HIO B;  4WU8 B;  2Y2L A;  1U35 D;  2F8N D;  1KX4 D;  2PYO C;  3A6N A;  3AFA C;  3C1C B;  3WA9 A;  3AZI D;  3X1U D;  3H0L C;  4WZS B;  3W96 C;  3KWQ D;  4G91 B;  1F1E A;  3A6N B;  4YM6 D;  3AV1 D;  5AV8 B;  5AY8 C;  3REK A;  5B32 A;  2PYO D;  5AVB B;  3AFA D;  5DNM A;  3EPL A;  5GSU B;  3KSY A;  4J8V C;  4EO5 B;  3W96 D;  1TZY A;  5B32 B;  3VH5 T;  2IO5 C;  3AZJ C;  4QLC C;  4H9P A;  4H9S A;  3X1V B;  5AY8 D;  4WV4 B;  5CHL B;  2F8N H;  4ZUX C;  3A1I A;  4J8V D;  4H9P B;  2F8N G;  3MVD C;  3MNN A;  1KX5 B;  3MGR A;  5B2I C;  4ZBJ C;  5E5A A;  5AVC A;  1ZLA C;  4QLC D;  3AZK A;  4CAY A;  4E45 A;  3EPK A;  5CPK C;  2Y2P A;  2YFV A;  3TU4 C;  4XZQ B;  3MNN B;  2G5I C;  3MGR B;  4ZUX D;  3AL0 C;  2YFW B;  5B31 C;  5E5A B;  3KXB A;  1P3G B;  4CAY B;  2NZD A;  5B2I D;  1P3P A;  3LJA B;  3A1K A;  4JJN A;  5CP6 A;  3AZJ A;  1ZLA D;  4H9O A;  5CPK D;  3VH5 A;  2NZD B;  3TU4 D;  5B33 C;  5F99 A;  1P3K B;  5B31 D;  5AV6 A;  2NQB C;  3R45 A;  1M1A A;  3MVD A;  2F2A C;  3WKJ C;  4J8X B;  2LY8 A;  3W97 C;  1HQ3 C;  4J8W A;  3X1S C;  4Z5T C;  4H9R A;  1KX3 C;  2XD5 A;  5BS7 C;  1N1J B;  3WTP C;  4WU9 B;  5B33 D;  2VQR A;  5GT3 C;  5B1L A;  4KGC C;  5B0Z A;  3VH5 W;  3WAA A;  3WKJ D;  5B0Y B;  1BH9 A;  2Y2Q A;  1HQ3 D;  5BT1 C;  3AN2 C;  5BO0 B;  4YS3 B;  3X1S D;  3B6G A;  4Z5T D;  1KX3 D;  5BNX A;  4LD9 A;  3WTP D;  3WTP E;  3WAA B;  2CV5 B;  4Z2M G;  2NQB A;  3B6F C;  2ARO B;  5GT3 D;  1M19 A;  5G49 B;  3UTA A;  2FJ7 C;  3W97 A;  3MGS A;  5BNX B;  4J8U C;  5B1M C;  3AN2 D;  1P3I A;  4WU8 C;  5JRG A;  1P3B A;  3C1C C;  1P3O A;  3F6T A;  1EQZ A;  1P3A B;  2FFF B;  3B6F D;  3AV2 A;  2FJ7 D;  4G91 C;  5JRG B;  3X1T B;  4J8U D;  3A6N C;  4XUJ B;  1P3M A;  5B1M D;  3WA9 C;  2Y2N A;  3MGQ B;  1P34 B;  1P3L A;  4DRB A;  1BH8 A;  4WU8 D;  2HUE B;  3C1C D; 
#chains in the Genus database with same CATH homology
 5AV5 A;  4EO5 C;  4CSR A;  2W8S A;  3REK C;  3LZ0 A;  3REL B;  3UTB D;  5CPI B;  5B32 C;  1P3L B;  3W98 A;  3A6N D;  3WA9 D;  5DNM C;  5AV5 B;  3X1V C;  2HIO A;  3MGP B;  3AZF B;  1HTA A;  5BNV B;  2BG1 A;  3LZ0 B;  1TZY C;  3W98 B;  2BYM A;  3V9R B;  1WWI A;  3AZH B;  4H9S C;  3LZ1 A;  3KUY B;  3REK D;  1KX5 C;  5B32 D;  1S32 B;  1B6W A;  3EPJ A;  5AV8 A;  3REH A;  5DNM D;  2BYM B;  1TAF B;  5AVB A;  3B0C T;  3LZ1 B;  3MNN C;  1TZY D;  3MGR C;  1T3U A;  5E5A C;  5AVC C;  5GT0 B;  5GSU A;  3AZK C;  3AYW A;  3AZM B;  3REH B;  5DNN A;  3X1V A;  3KXB C;  2Y2M A;  3AYW B;  2NZD C;  5GXQ B;  4R8P B;  3MNN D;  3MGR D;  4KUD B;  1P3P C;  4JJN C;  5DNN B;  5CP6 C;  5E5A D;  5AVC D;  1ID3 A;  3AZK D;  4HGA C;  3LEL B;  1ULY A;  1KX5 A;  5C3I B;  4J8X C;  1AOI B;  4X23 B;  4NE6 A;  5F99 C;  5CPJ B;  3KXB D;  4DQY B;  1JFI B;  1ID3 B;  5AV6 C;  1M1A C;  2NZD D;  4XZQ A;  1P3P D;  4JJN D;  2YFW A;  1P3G A;  5CP6 D;  3AZJ D;  1Z2C B;  4J8W C;  4E44 A;  3W99 A;  5AV9 B;  3LJA A;  4Z66 B;  5B0Y C;  1U35 B;  2F8N B;  5F99 D;  4G92 C;  3AZL A;  5AV6 D;  5B1L C;  3AZI B;  5B0Z C;  3AZN A;  1M1A D;  3W99 B;  3MVD D;  3WAA C;  3O62 A;  1M18 A;  1P3K A;  3KWQ B;  3UT9 A;  4J8W D;  3B6G C;  4YM6 B;  4J8X A;  3AZL B;  3AV1 B;  2F8N K;  3AZN B;  4LD9 C;  2DQN C;  2PYO B;  3O62 B;  1M18 B;  3UT9 B;  2ZM5 A;  3B0C W;  5B1L D;  5B0Z D;  1N1J A;  4WU9 A;  1M19 C;  3UTA C;  3WAA D;  3MGS C;  4H9Q B;  1P3I C;  3B6G D;  5JRG C;  5B0Y A;  5AY8 B;  1P3B C;  4LD9 D;  1P3O C;  5BO0 A;  3MGQ C;  4YS3 A;  1EQZ C;  1P34 C;  3NQU A;  2NQB D;  3B0B A;  3AV2 C;  1M19 D;  3UTA D;  2CV5 A;  4J8V B;  3MGS D;  3W97 D;  1P3M C;  2ARO A;  1P3I D;  3H0R C;  5G49 A;  4QLC B;  3REJ A;  1P3L C;  3NQU B;  5JRG D;  1P3B D;  1P3O D;  4NE3 A;  5AV5 C;  5B40 A;  1EQZ D;  2JCH A;  4KGC D;  4ZUX B;  3AV2 D;  1P3F A;  3LZ0 C;  3REJ B;  3W98 C;  1P3A A;  5BT1 D;  5B2I B;  3IP4 C;  4ZBJ B;  1H3O B;  5B31 G;  4AWL C;  1P3M D;  3EPH A;  5B40 B;  2Y2K A;  1P3L D;  2HIO C;  3X1T A;  1S32 C;  2J8P A;  1P3F B;  4XUJ A;  5CPK B;  3MGQ A;  5AV5 D;  1P34 A;  3C1B A;  5B31 B;  3LZ1 C;  3LZ0 D;  3W98 D;  3REI A;  2BYK A;  5AV8 C;  3REH C;  3REL A;  3AZG A;  2Y2G A;  2CWE A;  5CPI A;  1F66 A;  2HIO D;  4NE5 A;  3C1B B;  4UUZ B;  5AVB C;  3AZE A;  1PZR A;  3REI B;  2BYK B;  5B33 B;  5GSU C;  5FUG B;  3MGP A;  3AYW C;  3AZF A;  5BNV A;  3AZG B;  3LZ1 D;  1F66 B;  3V9R A;  5B2J A;  5DNN C;  3AZE B;  3AZH A;  3WKJ B;  5AV8 D;  3REH D;  3KUY A;  1HQ3 B;  1S32 A;  5AVB D;  1KX3 B;  4H9N A;  3B0D B;  5B2J B;  1TAF A;  4WNN A;  3FDD A;  3WTP B;  1ID3 C;  5GSU D;  3AYW D;  1Q9C A;  5DNN D;  2L5A A;  5GT0 A;  3AZM A;  4H9N B;  3X1V D;  5B24 A;  4WNN B;  3AN2 B;  4XZQ C;  2ZY3 A;  1P3G C;  1ID3 D;  3W99 C;  5GXQ A;  5B24 B;  4R8P A;  1KX5 D;  4KUD A;  3LJA C;  1KU5 A;  2RVQ C;  3LEL A;  4J8U B;  3AZL C;  4WJ3 C;  3AZN C;  1AOI A;  4XZQ D;  4X23 A;  3O62 C;  5CPJ A;  1M18 C;  5KDM B;  1P3K C;  1P3G D;  1JFI A;  2RIQ A;  3UT9 C;  4KHA A;  1A7W A;  3W99 D;  3LJA D;  4NFT A;  3UTB B;  4M6B A;  2RVQ D;  2JE5 A;  1WWS A;  5AV9 A;  3AZL D;  3WA9 B;  4Z66 A;  4KHA B;  5B32 G;  3AZN D;  3P5J B;  4WU9 C;  1U35 A;  2F8N A;  2XD1 A;  3O62 D;  1M18 D;  1KX4 A;  1P3K D;  2ZY4 A;  3UT9 D;  3AZI A;  3X1U A;  4J8X D;  3KWQ A;  4DRA A;  3REK B;  2Y2I A;  4YS3 C;  1KX4 B;  2JSS A;  4YM6 A;  3AV1 A;  2DF4 C;  3X1U B;  5DNM B;  4WU9 D;  2PYO A;  2CV5 C;  3AFA A;  1TZY B;  2ARO C;  3REJ C;  3EG5 B;  3NQJ A;  3W96 A;  5B0Y D;  4H9Q A;  4YS3 D;  5B40 C;  3AFA B;  4UPK A;  5AY8 A;  1P3F C;  3NQJ B;  2CV5 D;  3W96 B;  1P3A C;  2ARO D;  5AVC B;  3REJ D;  3AZK B;  4J8V A;  3X1T C;  5JA4 A;  4XUJ C;  2YFV B;  5B40 D;  4QLC A;  3C1B C;  2HUE C;  1P3F D;  3KXB B;  3REI C;  5JA4 B;  1P3A D;  2Y2H A;  4ZUX A;  4JJN B;  2IO5 B;  1P3P B;  3REL C;  5CP6 B;  5CPI C;  3AZG C;  3AZJ B;  1F66 C;  4HGA B;  3X1T D;  4H9O B;  3AZE C;  4XUJ D;  5B2I A;  1H3O A;  3MGQ D;  1ZLA A;  1P34 D;  3C1B D;  5F99 B;  3MGP C;  3AZF C;  5CPK A;  5AV6 B;  3B0D C;  5B2J C;  3R45 B;  3REI D;  3TU4 A;  1M1A B;  3MVD B;  3AZH C;  5B31 A;  3KUY C;  3REL D;  3AZG D;  5CPI D;  1F66 D;  1ZLA B;  4J8W B;  3AZE D;  4H9R B;  3VH6 T;  3TU4 B;  4UUZ A;  3MGP D;  3AZF D;  4G92 B;  4Z2M H;  5B1L B;  5B2J D;  5B0Z B;  5GT0 C;  5B33 A;  3AZM C;  5FUG A;  3AZH D;  2Y2O A;  5B24 C;  3KUY D;  1BH9 B;  1S32 D;  3B6G B;  3WKJ A;  4LD9 B;  1HQ3 A;  3X1S A;  4Z5T A;  1BFM A;  2ZY2 A;  1KX3 A;  1R4V A;  3H0M C;  4R8P C;  5GXQ C;  4KUD C;  2NQB B;  5BS7 A;  3WTP A;  1M19 B;  5GT0 D;  3UTA B;  3AZM D;  3LEL C;  3MGS B;  3W97 B;  5B24 D;  5C3I C;  5GT3 A;  4KGC A;  1P3I B;  3X1S B;  4Z5T B;  3UTB C;  1AOI C;  1W2E A;  4X23 C;  5CPJ C;  2Y2J A;  1P3B B;  1P3O B;  3AN2 A;  1EQZ B;  5GXQ D;  4R8P D;  4KUD D;  5GT3 B;  4KGC B;  3AV2 B;  3VH6 A;  3LEL D;  5AV9 C;  1P3M B;  3B6F A;  4Z66 C;  2ZY5 A;  1AOI D;  2FJ7 A;  1U35 C;  1BH8 B;  4X23 D;  5CPJ D;  1B67 A;  4J8U A;  1KX4 C;  5B1M A;  3KFU G;  3AZI C;  3X1U C;  2UWX A;  4WU8 A;  3B6F B;  5KDM A;  4CSR B;  3KWQ C;  3C1C A;  2G5H C;  2FJ7 B;  4YM6 C;  3AV1 C;  5B1M B;  5AV9 D;  4AWL B;  4Z66 D;  3UTB A;  3VH6 W;  2HIO B;  4WU8 B;  2Y2L A;  1U35 D;  2F8N D;  1KX4 D;  2PYO C;  3A6N A;  3AFA C;  3C1C B;  3WA9 A;  3AZI D;  3X1U D;  3H0L C;  4WZS B;  3W96 C;  3KWQ D;  4G91 B;  1F1E A;  3A6N B;  4YM6 D;  3AV1 D;  5AV8 B;  5AY8 C;  3REK A;  5B32 A;  2PYO D;  5AVB B;  3AFA D;  5DNM A;  3EPL A;  5GSU B;  3KSY A;  4J8V C;  4EO5 B;  3W96 D;  1TZY A;  5B32 B;  3VH5 T;  2IO5 C;  3AZJ C;  4QLC C;  4H9P A;  4H9S A;  3X1V B;  5AY8 D;  4WV4 B;  5CHL B;  2F8N H;  4ZUX C;  3A1I A;  4J8V D;  4H9P B;  2F8N G;  3MVD C;  3MNN A;  1KX5 B;  3MGR A;  5B2I C;  4ZBJ C;  5E5A A;  5AVC A;  1ZLA C;  4QLC D;  3AZK A;  4CAY A;  4E45 A;  3EPK A;  5CPK C;  2Y2P A;  2YFV A;  3TU4 C;  4XZQ B;  3MNN B;  2G5I C;  3MGR B;  4ZUX D;  3AL0 C;  2YFW B;  5B31 C;  5E5A B;  3KXB A;  1P3G B;  4CAY B;  2NZD A;  5B2I D;  1P3P A;  3LJA B;  3A1K A;  4JJN A;  5CP6 A;  3AZJ A;  1ZLA D;  4H9O A;  5CPK D;  3VH5 A;  2NZD B;  3TU4 D;  5B33 C;  5F99 A;  1P3K B;  5B31 D;  5AV6 A;  2NQB C;  3R45 A;  1M1A A;  3MVD A;  2F2A C;  3WKJ C;  4J8X B;  2LY8 A;  3W97 C;  1HQ3 C;  4J8W A;  3X1S C;  4Z5T C;  4H9R A;  1KX3 C;  2XD5 A;  5BS7 C;  1N1J B;  3WTP C;  4WU9 B;  5B33 D;  2VQR A;  5GT3 C;  5B1L A;  4KGC C;  5B0Z A;  3VH5 W;  3WAA A;  3WKJ D;  5B0Y B;  1BH9 A;  2Y2Q A;  1HQ3 D;  5BT1 C;  3AN2 C;  5BO0 B;  4YS3 B;  3X1S D;  3B6G A;  4Z5T D;  1KX3 D;  5BNX A;  4LD9 A;  3WTP D;  3WTP E;  3WAA B;  2CV5 B;  4Z2M G;  2NQB A;  3B6F C;  2ARO B;  5GT3 D;  1M19 A;  5G49 B;  3UTA A;  2FJ7 C;  3W97 A;  3MGS A;  5BNX B;  4J8U C;  5B1M C;  3AN2 D;  1P3I A;  4WU8 C;  5JRG A;  1P3B A;  3C1C C;  1P3O A;  3F6T A;  1EQZ A;  1P3A B;  2FFF B;  3B6F D;  3AV2 A;  2FJ7 D;  4G91 C;  5JRG B;  3X1T B;  4J8U D;  3A6N C;  4XUJ B;  1P3M A;  5B1M D;  3WA9 C;  2Y2N A;  3MGQ B;  1P34 B;  1P3L A;  4DRB A;  1BH8 A;  4WU8 D;  2HUE B;  3C1C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...