4AWLC

The nf-y transcription factor is structurally and functionally a sequence specific histone
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
VQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
publication title Sequence-Specific Transcription Factor NF-Y Displays Histone-Like DNA Binding and H2B-Like Ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4awlC00
1P34A 3AZJC 3LJAB 5AY8B 3UTAD 4Z5TD 1A7WA 3LZ0D 1P3KC 5GT0C 3WTPD 2AROA 3W98C 5AVBC 3AZKC 1M1AA 3AZFD 3KXBC 3MVDB 5AV5D 1KX4D 4X23A 1M19A 3B6GD 4EO5C 1KX4A 5DNND 5JA4A 3AZIA 4QLCD 5JRGC 1F66B 4LD9A 5CPIC 4ZUXB 4HGAC 4YS3D 3WA9D 2HIOC 3UTBA 3LZ1C 5B1MD 2F8NG 3RELD 4YM6A 3VH5A 3MGSB 5CP6B 4UUZA 3A6ND 1P34B 4KUDD 2FJ7D 3W96C 5B33C 2NZDD 1P3LA 4J8VD 3TU4D 5AV9D 3WKJD 2AROB 1ZLAA 3AFAA 1P3MA 1P3IA 1M1AB 4WNNA 3REKC 5B0ZC 3AN2C 5GT3C 4E45A 4X23B 1M19B 1TZYC 1BH8A 1S32D 3X1UD 5E5AD 3MGQD 5CPKD 3AZIB 5B32G 1KU5A 5CPJD 5AV8A 5F99A 4CSRA 3LZ0C 4XUJD 2CV5D 4LD9B 5BNXA 3W97D 3UTBB 3W99A 3AZFC 5B2JD 3AYWD 5AV5C 5GXQC 2BYKA 2NQBA 5AV6D 3AYWA 4YM6B 1AOID 2PYOD 5B24C 1KX3A 1P3OD 1ID3C 3AZHA 4YS3C 3AZJD 1P3LB 3WA9C 3WAAA 3X1TC 3AZNC 3AZJA 1P3KD 4WV4B 5B1MC 1P3AB 5GT0D 3AFAB 1P3MB 1P3IB 1ZLAB 4WNNB 4ZBJC 3W98D 3AZKD 3RELC 1P3BA 3W98A 5AVBA 4Z66A 1BH8B 3KXBD 5G49A 4J8XD 2BYMA 2YFVA 3O62A 3A6NC 4KUDC 5AV8B 3X1SD 4H9OA 4CSRB 5F99B 1JFIA 4G92C 4J8VC 1EQZB 5BNXB 3WKJC 3REIC 3W99B 3AZLC 5JRGA 4H9NA 3NQUA 2HIOD 5B0YB 4WU9C 2BYKB 5CPIA 2NQBB 2HIOA 1S32C 5E5AC 3MGQC 1KX3B 3LZ1A 5CPKC 3AZMC 3AZHB 5B1LD 3W97C 1M18C 3VH6A 3WAAB 3AV1A 4XZQC 5B33D 3W96A 4J8UB 5AV6C 5B2IC 3VH6T 1AOIC 2PYOC 3KUYA 1P3BB 3B6FA 3MNNA 3REKD 5AVBB 4Z66B 5B0ZD 5G49B 3KSYA 2BYMB 3AN2D 1KX5C 5GT3D 3O62B 1BH9A 5B0ZA 3LELB 3AN2A 4H9OB 3UT9B 1TZYA 3AZED 1JFIB 1HQ3C 3UTAA 1HTAA 4Z5TA 4H9NB 5BO0B 5JRGB 3NQUB 3LZ0A 3R45A 5CPIB 3WTPA 4G91B 5B32B 4J8XC 3AV2D 5GXQD 4H9RA 3X1VC 3LZ1B 2YFWA 3AZFA 5AV5A 3X1SC 5BS7C 5B24D 3B6GA 3MGRB 4WU8D 1U35B 5AVCB 3REHC 1ID3D 5C3IC 5DNNA 1P3GC 3AV1B 1ID3A 4QLCA 1TAFA 4R8PC 3W96B 3VH6W 3B0DB 3X1TD 3AZND 3MGPC 4YS3A 3WA9A 3B6FB 3KUYB 3X1TA 3MNNB 3AZNA 4JJNC 5B1MA 5BNVB 1BH9B 3RELA 5DNMD 1P3PD 5B1LC 3LJAC 1TZYB 2HUEC 3A6NA 1ULYA 5FUGA 2FJ7A 4KUDA 3UTAB 4Z5TB 5CHLB 3LZ0B 2NZDA 3REID 4J8VA 3TU4A 5AV9A 3R45B 3AZLD 3WTPB 3WKJA 3C1CD 4H9RB 4WU9D 3AZFB 2YFWB 5AV5B 1KX4B 3B6GB 3AZEC 5JA4B 1S32A 3X1UA 2IO5C 3AZMD 5E5AA 3MGQA 5DNNB 3REJD 5CPKA 4CAYA 5CPJA 4QLCB 1TAFB 1M18D 4XUJA 2CV5A 4XZQD 3W97A 1M18A 4YS3B 4H9QA 3WA9B 3AV2C 5B1MB 5B2JA 5B2ID 5KDMA 4WU8C 5CP6C 5AV6A 3C1BC 3RELB 2PYOA 1AOIA 1R4VA 4UUZB 1KX5D 3KWQD 2LY8A 1P3OA 3A6NB 5FUGB 2FJ7B 4KUDB 2AROC 2NZDB 1HQ3D 4G92B 4J8VB 3TU4B 5AV9B 1M1AC 3WKJB 1P3KA 1M19C 5GT0A 5B31C 4H9PA 5GSUD 3AZKA 5DNMC 1P3FD 1P3PC 3AZIC 3X1VD 3KXBA 4J8XA 3X1UB 1S32B 5E5AB 3MGQB 4J8WD 5CPKB 4CAYB 3REHD 5CPJB 3X1SA 1P3GD 4XUJB 5B40D 2CV5B 3W97B 4R8PD 4H9QB 3C1CC 3AZGD 4YM6C 3MGPD 5B2JB 3AYWB 5KDMB 5AV6B 3MGPA 4JJND 2PYOB 1AOIB 4KGCD 4JJNA 3REJC 1BFMA 1P3OB 1P3LC 2JSSA 3LJAD 5AY8D 5B1LA 1P3AC 3AZJB 1F1EA 5B33A 1P3KB 5GT0B 4H9PB 3WTPE 3MVDD 3W98B 3AZKB 2YFVB 3KWQC 3REKA 3KXBB 4J8XB 5GT3A 1EQZC 4EO5B 3X1SB 1F66D 3W99C 3AZEA 4H9SC 4ZUXD 4NE6A 5C3IB 5B0YC 2NQBC 5GSUC 4KHAA 4HGAB 2HIOB 1P3FC 1KX3C 2RVQC 3AZHC 4WZSB 3AV2A 5GXQA 4J8WC 5CP6D 3C1BD 4AWLC 1P34D 3WAAC 5B24A 2F8NH 4WU8A 5CP6A 3C1BA 5B40C 5B1LB 3V9RA 3AZGC 2HUEB 2AROD 5B33B 4J8UC 1P3BC 1M1AD 4Z66C 3O62C 4X23D 5B31D 1M19D 4KGCC 3LELC 3REKB 5B0ZB 3AN2B 5B31A 3UT9C 5GT3B 3AZID 5AY8C 1H3OA 5DNMA 1P3PA 3AZEB 4LD9D 2IO5B 3NQJA 3UTBD 4DRBA 4G91C 4KHAB 5B32C 3MVDC 3REIA 3AZLA 3C1CA 4YM6D 3AV2B 5GXQB 3MGRC 4WU9A 1U35C 5AVCC 1WWSA 5B24B 1F66C 5BT1C 4WU8B 3AV1C 3C1BB 1ID3B 4ZUXC 3AZMA 3V9RB 1P3LD 3REJA 4NFTA 3B0DC 3VH5T 1P3AD 1ZLAD 3B6FC 3AFAD 3KUYC 1P3MD 1P3ID 3MNNC 4XZQA 3X1TB 3AZNB 1P3AA 3MGSC 4ZBJB 5B31B 5B2IA 1P34C 5AV8D 1H3OB 5F99D 5DNMB 1P3PB 1KX5A 3UTAC 4Z5TC 3KWQA 1EQZD 3NQJB 3W99D 1EQZA 3WTPC 3REIB 1HQ3A 5B0YD 4X23C 4H9SA 3AZLB 2NQBD 3B0BA 3C1CB 5B0YA 1KX4C 3B6GC 4WU9B 1KX3D 5GSUA 2RVQD 3B0CT 3AZHD 5DNNC 1Q9CA 1P3FA 3X1VA 4QLCC 4LD9C 3VH5W 3AZMB 4J8WA 1N1JA 5BS7A 3WAAD 2F8ND 3REJB 3UTBC 3REHA 2F8NA 1M18B 1P3GA 5B40A 4XZQB 4J8UD 1WWIA 4R8PA 3AZGA 1P3BD 4J8UA 4Z2MH 5AVBD 4Z66D 5B2IB 3O62D 3LELD 1KX5B 3UT9D 2FJ7C 4KGCA 3LELA 3KWQB 4E44A 5B31G 3UT9A 2NZDC 3LJAA 5AV9C 5AY8A 3AFAC 3TU4C 5JRGD 1P3IC 1P3MC 1ZLAC 4DRAA 1HQ3B 5BO0A 5CPID 5B32D 3B0CW 5GSUB 3LZ1D 5B32A 4NE5A 3X1UC 3MVDA 5AV8C 5F99C 1P3FB 3MGRD 2L5AA 1U35D 5AVCD 3X1VB 5CPJC 2F8NK 4M6BA 4J8WB 1N1JB 3MGRA 1U35A 4XUJC 5BT1D 5AVCA 3AV1D 1B6WA 2CV5C 4AWLB 3REHB 4Z2MG 1F66A 1P3GB 2F8NB 3W96D 5B40B 4ZUXA 5B2JC 4R8PB 3AYWC 3B6FD 3AZGB 3KUYD 3MNND 3MGPB 2CWEA 3MGSD 4NE3A 1P3OC 4JJNB 3MGSA 1TZYD 4KGCB 5BNVA 1B67A
chains in the Genus database with same CATH superfamily
1P34A 3AZJC 3LJAB 5AY8B 3UTAD 4Z5TD 1A7WA 3LZ0D 1P3KC 5GT0C 3WTPD 2AROA 3W98C 2G5IC 5AVBC 3AZKC 1M1AA 3AZFD 3KXBC 3MVDB 5AV5D 1KX4D 4X23A 1M19A 3B6GD 4EO5C 1KX4A 5DNND 5JA4A 3AZIA 2BG1A 4QLCD 5JRGC 1F66B 4LD9A 5CPIC 4ZUXB 4HGAC 4YS3D 3WA9D 2HIOC 3UTBA 3LZ1C 5B1MD 2F8NG 3RELD 4YM6A 3VH5A 3MGSB 5CP6B 2XD1A 3H0RC 4UUZA 3A6ND 1P34B 4KUDD 2FJ7D 3H0LC 3W96C 5B33C 2NZDD 1P3LA 4J8VD 3TU4D 5AV9D 3WKJD 2AROB 2Y2HA 1ZLAA 3AFAA 1P3MA 1P3IA 1M1AB 4WNNA 3REKC 5B0ZC 3AN2C 5GT3C 4E45A 4X23B 1M19B 1TZYC 2Y2QA 3IP4C 1BH8A 1S32D 3X1UD 5E5AD 3MGQD 3EPLA 5CPKD 3A1KA 5B32G 1KU5A 5CPJD 5AV8A 3AZIB 5F99A 4CSRA 3LZ0C 4XUJD 2CV5D 4LD9B 5BNXA 3W97D 3UTBB 3W99A 3AZFC 5B2JD 3AYWD 5AV5C 2ZY3A 5GXQC 2BYKA 2NQBA 5AV6D 3AYWA 4YM6B 1AOID 2PYOD 5B24C 2RIQA 1KX3A 1P3OD 1ID3C 3AZHA 4YS3C 3AZJD 1P3LB 3WA9C 3WAAA 2Y2GA 3X1TC 3AZNC 3AZJA 1P3KD 4WV4B 5B1MC 1P3AB 5GT0D 3AFAB 1P3MB 1P3IB 1ZLAB 4WNNB 4ZBJC 3W98D 3AZKD 3RELC 1P3BA 3W98A 5AVBA 4Z66A 1BH8B 3KXBD 5G49A 4J8XD 2BYMA 2YFVA 3O62A 3A6NC 4KUDC 5AV8B 3X1SD 4H9OA 4CSRB 5F99B 1JFIA 4G92C 4J8VC 1EQZB 5BNXB 3WKJC 3REIC 2Y2JA 3W99B 3AZLC 5JRGA 1Z2CB 4H9NA 3NQUA 2HIOD 5B0YB 4WU9C 2BYKB 5CPIA 2NQBB 2HIOA 1S32C 5E5AC 3MGQC 1KX3B 3LZ1A 5CPKC 3AZMC 3AZHB 5B1LD 1PZRA 3W97C 1M18C 3VH6A 3WAAB 2JE5A 3AV1A 4XZQC 5B33D 3W96A 4J8UB 5AV6C 5B2IC 3VH6T 1AOIC 2PYOC 3KUYA 1P3BB 3B6FA 3MNNA 3REKD 5AVBB 4Z66B 4WJ3C 5B0ZD 5G49B 3KSYA 2BYMB 3AN2D 1KX5C 5GT3D 3O62B 1BH9A 5B0ZA 3LELB 3AN2A 4H9OB 3UT9B 1TZYA 3AZED 1JFIB 3AL0C 1HQ3C 2DF4C 3UTAA 1HTAA 4Z5TA 4H9NB 5BO0B 5JRGB 3NQUB 3LZ0A 3R45A 5CPIB 3WTPA 4G91B 5B32B 4J8XC 3AV2D 5GXQD 4H9RA 3X1VC 3LZ1B 2YFWA 3AZFA 5AV5A 3X1SC 5BS7C 5B24D 3B6GA 3MGRB 4WU8D 1U35B 5AVCB 3REHC 1ID3D 5C3IC 5DNNA 1P3GC 3AV1B 1ID3A 4QLCA 1TAFA 2Y2OA 4R8PC 3W96B 3VH6W 2J8PA 3B0DB 3X1TD 3AZND 3MGPC 4YS3A 3WA9A 3B6FB 3KUYB 3X1TA 3MNNB 3AZNA 4JJNC 5B1MA 5BNVB 1BH9B 3RELA 5DNMD 1P3PD 5B1LC 3LJAC 1TZYB 2VQRA 2HUEC 3A6NA 1ULYA 5FUGA 2FJ7A 4KUDA 3UTAB 4Z5TB 2DQNC 5CHLB 3LZ0B 2NZDA 3REID 4J8VA 3TU4A 5AV9A 3R45B 3AZLD 3WTPB 3WKJA 3EPKA 3C1CD 4H9RB 3F6TA 4WU9D 3AZFB 2YFWB 5AV5B 1KX4B 3B6GB 3AZEC 5JA4B 1S32A 3X1UA 2IO5C 3AZMD 5E5AA 3MGQA 5DNNB 3REJD 5CPKA 4CAYA 5CPJA 4QLCB 1TAFB 1M18D 2Y2IA 4XUJA 2CV5A 4XZQD 3W97A 1M18A 4YS3B 4H9QA 3WA9B 3AV2C 5B1MB 5B2JA 5B2ID 3A1IA 5KDMA 4WU8C 5CP6C 5AV6A 3C1BC 3RELB 2PYOA 1AOIA 1R4VA 4UUZB 1KX5D 3KWQD 2LY8A 1P3OA 3A6NB 5FUGB 2FJ7B 4KUDB 2AROC 2Y2PA 2NZDB 1HQ3D 4G92B 4J8VB 3TU4B 5AV9B 1M1AC 3WKJB 2F2AC 2ZM5A 1P3KA 1M19C 5GT0A 5B31C 4H9PA 5GSUD 2ZY4A 3AZKA 5DNMC 1P3FD 1P3PC 3AZIC 3FDDA 3X1VD 3KXBA 4J8XA 3X1UB 1S32B 5E5AB 3MGQB 4J8WD 5CPKB 4CAYB 3REHD 5CPJB 3X1SA 1P3GD 4XUJB 5B40D 2CV5B 3W97B 4R8PD 4H9QB 3C1CC 3AZGD 4YM6C 3MGPD 5B2JB 3AYWB 5KDMB 5AV6B 3MGPA 4JJND 2PYOB 1AOIB 4KGCD 4JJNA 3REJC 1BFMA 1P3OB 1P3LC 2JSSA 3LJAD 5AY8D 2Y2MA 5B1LA 1P3AC 3AZJB 1F1EA 5B33A 1P3KB 5GT0B 2ZY2A 4H9PB 3WTPE 3MVDD 3W98B 2G5HC 3AZKB 2YFVB 3KWQC 3REKA 3KXBB 4J8XB 5GT3A 1EQZC 4EO5B 3X1SB 1F66D 3W99C 3AZEA 4H9SC 4ZUXD 4NE6A 5C3IB 3KFUG 5B0YC 2NQBC 5GSUC 4KHAA 4HGAB 2HIOB 1P3FC 1KX3C 2RVQC 3AZHC 4WZSB 3AV2A 5GXQA 4J8WC 5CP6D 3C1BD 4AWLC 1P34D 3WAAC 5B24A 2F8NH 4WU8A 5CP6A 3C1BA 5B40C 5B1LB 3V9RA 3AZGC 2HUEB 2XD5A 2AROD 5B33B 4J8UC 1P3BC 1M1AD 4Z66C 3O62C 4X23D 5B31D 1M19D 4KGCC 3LELC 3REKB 5B0ZB 3AN2B 5B31A 3UT9C 5GT3B 3AZID 5AY8C 2JCHA 1H3OA 5DNMA 1W2EA 1P3PA 3AZEB 4LD9D 2IO5B 3NQJA 3UTBD 4DRBA 4G91C 4KHAB 5B32C 3MVDC 3REIA 3AZLA 3C1CA 4YM6D 3AV2B 5GXQB 3MGRC 4WU9A 1U35C 5AVCC 1WWSA 5B24B 1F66C 5BT1C 4WU8B 3AV1C 3C1BB 1ID3B 4ZUXC 3AZMA 1T3UA 3V9RB 1P3LD 3REJA 4NFTA 3B0DC 3VH5T 2Y2NA 1P3AD 1ZLAD 3B6FC 3AFAD 3KUYC 1P3MD 1P3ID 3MNNC 4XZQA 3X1TB 3AZNB 1P3AA 3MGSC 4ZBJB 5B31B 5B2IA 1P34C 3P5JB 5AV8D 1H3OB 5F99D 5DNMB 1P3PB 1KX5A 3UTAC 4Z5TC 3KWQA 1EQZD 3NQJB 3W99D 1EQZA 3WTPC 4DQYB 3REIB 1HQ3A 2FFFB 5B0YD 4X23C 4H9SA 3AZLB 2NQBD 3B0BA 3C1CB 5B0YA 1KX4C 3B6GC 4WU9B 1KX3D 5GSUA 2RVQD 3B0CT 3AZHD 5DNNC 1Q9CA 1P3FA 3H0MC 3X1VA 4QLCC 4LD9C 3VH5W 3AZMB 4J8WA 1N1JA 5BS7A 3WAAD 2F8ND 3REJB 3UTBC 3REHA 2F8NA 1M18B 1P3GA 5B40A 4XZQB 4J8UD 1WWIA 4R8PA 3AZGA 3EPHA 1P3BD 4J8UA 4Z2MH 5AVBD 4Z66D 5B2IB 3O62D 3LELD 1KX5B 3UT9D 2FJ7C 4KGCA 3LELA 3KWQB 4E44A 5B31G 3UT9A 2NZDC 3LJAA 5AV9C 5AY8A 3AFAC 3TU4C 5JRGD 1P3IC 1P3MC 1ZLAC 4DRAA 1HQ3B 5BO0A 4UPKA 5CPID 5B32D 3B0CW 5GSUB 3LZ1D 5B32A 4NE5A 3X1UC 3MVDA 5AV8C 5F99C 1P3FB 3MGRD 2L5AA 2Y2LA 5AVCD 3X1VB 5CPJC 1U35D 2ZY5A 2F8NK 4M6BA 4J8WB 1N1JB 3MGRA 1U35A 4XUJC 5BT1D 5AVCA 3AV1D 1B6WA 2CV5C 4AWLB 2Y2KA 3REHB 2UWXA 4Z2MG 1P3GB 1F66A 2F8NB 3W96D 5B40B 4ZUXA 5B2JC 4R8PB 3AYWC 3B6FD 3AZGB 3KUYD 2W8SA 3MNND 3MGPB 2CWEA 3MGSD 4NE3A 3EPJA 1P3OC 4JJNB 3MGSA 1TZYD 4KGCB 5BNVA 3EG5B 1B67A
chains in the Genus database with same CATH topology
1P34A 3AZJC 3LJAB 5AY8B 3UTAD 4Z5TD 1A7WA 3LZ0D 1P3KC 5GT0C 3WTPD 2AROA 3W98C 2G5IC 5AVBC 3AZKC 1M1AA 3AZFD 3KXBC 3MVDB 5AV5D 1KX4D 4X23A 1M19A 3B6GD 4EO5C 1KX4A 5DNND 5JA4A 3AZIA 2BG1A 4QLCD 5JRGC 1F66B 4LD9A 5CPIC 4ZUXB 4HGAC 4YS3D 3WA9D 2HIOC 3UTBA 3LZ1C 5B1MD 2F8NG 3RELD 4YM6A 3VH5A 3MGSB 5CP6B 2XD1A 3H0RC 4UUZA 3A6ND 1P34B 4KUDD 2FJ7D 3H0LC 3W96C 5B33C 2NZDD 1P3LA 4J8VD 3TU4D 5AV9D 3WKJD 2AROB 2Y2HA 1ZLAA 3AFAA 1P3MA 1P3IA 1M1AB 4WNNA 3REKC 5B0ZC 3AN2C 5GT3C 4E45A 4X23B 1M19B 1TZYC 2Y2QA 3IP4C 1BH8A 1S32D 3X1UD 5E5AD 3MGQD 3EPLA 5CPKD 3A1KA 5B32G 1KU5A 5CPJD 5AV8A 3AZIB 5F99A 4CSRA 3LZ0C 4XUJD 2CV5D 4LD9B 5BNXA 3W97D 3UTBB 3W99A 3AZFC 5B2JD 3AYWD 5AV5C 2ZY3A 5GXQC 2BYKA 2NQBA 5AV6D 3AYWA 4YM6B 1AOID 2PYOD 5B24C 2RIQA 1KX3A 1P3OD 1ID3C 3AZHA 4YS3C 3AZJD 1P3LB 3WA9C 3WAAA 2Y2GA 3X1TC 3AZNC 3AZJA 1P3KD 4WV4B 5B1MC 1P3AB 5GT0D 3AFAB 1P3MB 1P3IB 1ZLAB 4WNNB 4ZBJC 3W98D 3AZKD 3RELC 1P3BA 3W98A 5AVBA 4Z66A 1BH8B 3KXBD 5G49A 4J8XD 2BYMA 2YFVA 3O62A 3A6NC 4KUDC 5AV8B 3X1SD 4H9OA 4CSRB 5F99B 1JFIA 4G92C 4J8VC 1EQZB 5BNXB 3WKJC 3REIC 2Y2JA 3W99B 3AZLC 5JRGA 1Z2CB 4H9NA 3NQUA 2HIOD 5B0YB 4WU9C 2BYKB 5CPIA 2NQBB 2HIOA 1S32C 5E5AC 3MGQC 1KX3B 3LZ1A 5CPKC 3AZMC 3AZHB 5B1LD 1PZRA 3W97C 1M18C 3VH6A 3WAAB 2JE5A 3AV1A 4XZQC 5B33D 3W96A 4J8UB 5AV6C 5B2IC 3VH6T 1AOIC 2PYOC 3KUYA 1P3BB 3B6FA 3MNNA 3REKD 5AVBB 4Z66B 4WJ3C 5B0ZD 5G49B 3KSYA 2BYMB 3AN2D 1KX5C 5GT3D 3O62B 1BH9A 5B0ZA 3LELB 3AN2A 4H9OB 3UT9B 1TZYA 3AZED 1JFIB 3AL0C 1HQ3C 2DF4C 3UTAA 1HTAA 4Z5TA 4H9NB 5BO0B 5JRGB 3NQUB 3LZ0A 3R45A 5CPIB 3WTPA 4G91B 5B32B 4J8XC 3AV2D 5GXQD 4H9RA 3X1VC 3LZ1B 2YFWA 3AZFA 5AV5A 3X1SC 5BS7C 5B24D 3B6GA 3MGRB 4WU8D 1U35B 5AVCB 3REHC 1ID3D 5C3IC 5DNNA 1P3GC 3AV1B 1ID3A 4QLCA 1TAFA 2Y2OA 4R8PC 3W96B 3VH6W 2J8PA 3B0DB 3X1TD 3AZND 3MGPC 4YS3A 3WA9A 3B6FB 3KUYB 3X1TA 3MNNB 3AZNA 4JJNC 5B1MA 5BNVB 1BH9B 3RELA 5DNMD 1P3PD 5B1LC 3LJAC 1TZYB 2VQRA 2HUEC 3A6NA 1ULYA 5FUGA 2FJ7A 4KUDA 3UTAB 4Z5TB 2DQNC 5CHLB 3LZ0B 2NZDA 3REID 4J8VA 3TU4A 5AV9A 3R45B 3AZLD 3WTPB 3WKJA 3EPKA 3C1CD 4H9RB 3F6TA 4WU9D 3AZFB 2YFWB 5AV5B 1KX4B 3B6GB 3AZEC 5JA4B 1S32A 3X1UA 2IO5C 3AZMD 5E5AA 3MGQA 5DNNB 3REJD 5CPKA 4CAYA 5CPJA 4QLCB 1TAFB 1M18D 2Y2IA 4XUJA 2CV5A 4XZQD 3W97A 1M18A 4YS3B 4H9QA 3WA9B 3AV2C 5B1MB 5B2JA 5B2ID 3A1IA 5KDMA 4WU8C 5CP6C 5AV6A 3C1BC 3RELB 2PYOA 1AOIA 1R4VA 4UUZB 1KX5D 3KWQD 2LY8A 1P3OA 3A6NB 5FUGB 2FJ7B 4KUDB 2AROC 2Y2PA 2NZDB 1HQ3D 4G92B 4J8VB 3TU4B 5AV9B 1M1AC 3WKJB 2F2AC 2ZM5A 1P3KA 1M19C 5GT0A 5B31C 4H9PA 5GSUD 2ZY4A 3AZKA 5DNMC 1P3FD 1P3PC 3AZIC 3FDDA 3X1VD 3KXBA 4J8XA 3X1UB 1S32B 5E5AB 3MGQB 4J8WD 5CPKB 4CAYB 3REHD 5CPJB 3X1SA 1P3GD 4XUJB 5B40D 2CV5B 3W97B 4R8PD 4H9QB 3C1CC 3AZGD 4YM6C 3MGPD 5B2JB 3AYWB 5KDMB 5AV6B 3MGPA 4JJND 2PYOB 1AOIB 4KGCD 4JJNA 3REJC 1BFMA 1P3OB 1P3LC 2JSSA 3LJAD 5AY8D 2Y2MA 5B1LA 1P3AC 3AZJB 1F1EA 5B33A 1P3KB 5GT0B 2ZY2A 4H9PB 3WTPE 3MVDD 3W98B 2G5HC 3AZKB 2YFVB 3KWQC 3REKA 3KXBB 4J8XB 5GT3A 1EQZC 4EO5B 3X1SB 1F66D 3W99C 3AZEA 4H9SC 4ZUXD 4NE6A 5C3IB 3KFUG 5B0YC 2NQBC 5GSUC 4KHAA 4HGAB 2HIOB 1P3FC 1KX3C 2RVQC 3AZHC 4WZSB 3AV2A 5GXQA 4J8WC 5CP6D 3C1BD 4AWLC 1P34D 3WAAC 5B24A 2F8NH 4WU8A 5CP6A 3C1BA 5B40C 5B1LB 3V9RA 3AZGC 2HUEB 2XD5A 2AROD 5B33B 4J8UC 1P3BC 1M1AD 4Z66C 3O62C 4X23D 5B31D 1M19D 4KGCC 3LELC 3REKB 5B0ZB 3AN2B 5B31A 3UT9C 5GT3B 3AZID 5AY8C 2JCHA 1H3OA 5DNMA 1W2EA 1P3PA 3AZEB 4LD9D 2IO5B 3NQJA 3UTBD 4DRBA 4G91C 4KHAB 5B32C 3MVDC 3REIA 3AZLA 3C1CA 4YM6D 3AV2B 5GXQB 3MGRC 4WU9A 1U35C 5AVCC 1WWSA 5B24B 1F66C 5BT1C 4WU8B 3AV1C 3C1BB 1ID3B 4ZUXC 3AZMA 1T3UA 3V9RB 1P3LD 3REJA 4NFTA 3B0DC 3VH5T 2Y2NA 1P3AD 1ZLAD 3B6FC 3AFAD 3KUYC 1P3MD 1P3ID 3MNNC 4XZQA 3X1TB 3AZNB 1P3AA 3MGSC 4ZBJB 5B31B 5B2IA 1P34C 3P5JB 5AV8D 1H3OB 5F99D 5DNMB 1P3PB 1KX5A 3UTAC 4Z5TC 3KWQA 1EQZD 3NQJB 3W99D 1EQZA 3WTPC 4DQYB 3REIB 1HQ3A 2FFFB 5B0YD 4X23C 4H9SA 3AZLB 2NQBD 3B0BA 3C1CB 5B0YA 1KX4C 3B6GC 4WU9B 1KX3D 5GSUA 2RVQD 3B0CT 3AZHD 5DNNC 1Q9CA 1P3FA 3H0MC 3X1VA 4QLCC 4LD9C 3VH5W 3AZMB 4J8WA 1N1JA 5BS7A 3WAAD 2F8ND 3REJB 3UTBC 3REHA 2F8NA 1M18B 1P3GA 5B40A 4XZQB 4J8UD 1WWIA 4R8PA 3AZGA 3EPHA 1P3BD 4J8UA 4Z2MH 5AVBD 4Z66D 5B2IB 3O62D 3LELD 1KX5B 3UT9D 2FJ7C 4KGCA 3LELA 3KWQB 4E44A 5B31G 3UT9A 2NZDC 3LJAA 5AV9C 5AY8A 3AFAC 3TU4C 5JRGD 1P3IC 1P3MC 1ZLAC 4DRAA 1HQ3B 5BO0A 4UPKA 5CPID 5B32D 3B0CW 5GSUB 3LZ1D 5B32A 4NE5A 3X1UC 3MVDA 5AV8C 5F99C 1P3FB 3MGRD 2L5AA 2Y2LA 5AVCD 3X1VB 5CPJC 1U35D 2ZY5A 2F8NK 4M6BA 4J8WB 1N1JB 3MGRA 1U35A 4XUJC 5BT1D 5AVCA 3AV1D 1B6WA 2CV5C 4AWLB 2Y2KA 3REHB 2UWXA 4Z2MG 1P3GB 1F66A 2F8NB 3W96D 5B40B 4ZUXA 5B2JC 4R8PB 3AYWC 3B6FD 3AZGB 3KUYD 2W8SA 3MNND 3MGPB 2CWEA 3MGSD 4NE3A 3EPJA 1P3OC 4JJNB 3MGSA 1TZYD 4KGCB 5BNVA 3EG5B 1B67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 A;  3AZJ C;  3LJA B;  5AY8 B;  3UTA D;  4Z5T D;  1A7W A;  3LZ0 D;  1P3K C;  5GT0 C;  3WTP D;  2ARO A;  3W98 C;  5AVB C;  3AZK C;  1M1A A;  3AZF D;  3KXB C;  3MVD B;  5AV5 D;  1KX4 D;  4X23 A;  1M19 A;  3B6G D;  4EO5 C;  1KX4 A;  5DNN D;  5JA4 A;  3AZI A;  4QLC D;  5JRG C;  1F66 B;  4LD9 A;  5CPI C;  4ZUX B;  4HGA C;  4YS3 D;  3WA9 D;  2HIO C;  3UTB A;  3LZ1 C;  5B1M D;  2F8N G;  3REL D;  4YM6 A;  3VH5 A;  3MGS B;  5CP6 B;  4UUZ A;  3A6N D;  1P34 B;  4KUD D;  2FJ7 D;  3W96 C;  5B33 C;  2NZD D;  1P3L A;  4J8V D;  3TU4 D;  5AV9 D;  3WKJ D;  2ARO B;  1ZLA A;  3AFA A;  1P3M A;  1P3I A;  1M1A B;  4WNN A;  3REK C;  5B0Z C;  3AN2 C;  5GT3 C;  4E45 A;  4X23 B;  1M19 B;  1TZY C;  1BH8 A;  1S32 D;  3X1U D;  5E5A D;  3MGQ D;  5CPK D;  3AZI B;  5B32 G;  1KU5 A;  5CPJ D;  5AV8 A;  5F99 A;  4CSR A;  3LZ0 C;  4XUJ D;  2CV5 D;  4LD9 B;  5BNX A;  3W97 D;  3UTB B;  3W99 A;  3AZF C;  5B2J D;  3AYW D;  5AV5 C;  5GXQ C;  2BYK A;  2NQB A;  5AV6 D;  3AYW A;  4YM6 B;  1AOI D;  2PYO D;  5B24 C;  1KX3 A;  1P3O D;  1ID3 C;  3AZH A;  4YS3 C;  3AZJ D;  1P3L B;  3WA9 C;  3WAA A;  3X1T C;  3AZN C;  3AZJ A;  1P3K D;  4WV4 B;  5B1M C;  1P3A B;  5GT0 D;  3AFA B;  1P3M B;  1P3I B;  1ZLA B;  4WNN B;  4ZBJ C;  3W98 D;  3AZK D;  3REL C;  1P3B A;  3W98 A;  5AVB A;  4Z66 A;  1BH8 B;  3KXB D;  5G49 A;  4J8X D;  2BYM A;  2YFV A;  3O62 A;  3A6N C;  4KUD C;  5AV8 B;  3X1S D;  4H9O A;  4CSR B;  5F99 B;  1JFI A;  4G92 C;  4J8V C;  1EQZ B;  5BNX B;  3WKJ C;  3REI C;  3W99 B;  3AZL C;  5JRG A;  4H9N A;  3NQU A;  2HIO D;  5B0Y B;  4WU9 C;  2BYK B;  5CPI A;  2NQB B;  2HIO A;  1S32 C;  5E5A C;  3MGQ C;  1KX3 B;  3LZ1 A;  5CPK C;  3AZM C;  3AZH B;  5B1L D;  3W97 C;  1M18 C;  3VH6 A;  3WAA B;  3AV1 A;  4XZQ C;  5B33 D;  3W96 A;  4J8U B;  5AV6 C;  5B2I C;  3VH6 T;  1AOI C;  2PYO C;  3KUY A;  1P3B B;  3B6F A;  3MNN A;  3REK D;  5AVB B;  4Z66 B;  5B0Z D;  5G49 B;  3KSY A;  2BYM B;  3AN2 D;  1KX5 C;  5GT3 D;  3O62 B;  1BH9 A;  5B0Z A;  3LEL B;  3AN2 A;  4H9O B;  3UT9 B;  1TZY A;  3AZE D;  1JFI B;  1HQ3 C;  3UTA A;  1HTA A;  4Z5T A;  4H9N B;  5BO0 B;  5JRG B;  3NQU B;  3LZ0 A;  3R45 A;  5CPI B;  3WTP A;  4G91 B;  5B32 B;  4J8X C;  3AV2 D;  5GXQ D;  4H9R A;  3X1V C;  3LZ1 B;  2YFW A;  3AZF A;  5AV5 A;  3X1S C;  5BS7 C;  5B24 D;  3B6G A;  3MGR B;  4WU8 D;  1U35 B;  5AVC B;  3REH C;  1ID3 D;  5C3I C;  5DNN A;  1P3G C;  3AV1 B;  1ID3 A;  4QLC A;  1TAF A;  4R8P C;  3W96 B;  3VH6 W;  3B0D B;  3X1T D;  3AZN D;  3MGP C;  4YS3 A;  3WA9 A;  3B6F B;  3KUY B;  3X1T A;  3MNN B;  3AZN A;  4JJN C;  5B1M A;  5BNV B;  1BH9 B;  3REL A;  5DNM D;  1P3P D;  5B1L C;  3LJA C;  1TZY B;  2HUE C;  3A6N A;  1ULY A;  5FUG A;  2FJ7 A;  4KUD A;  3UTA B;  4Z5T B;  5CHL B;  3LZ0 B;  2NZD A;  3REI D;  4J8V A;  3TU4 A;  5AV9 A;  3R45 B;  3AZL D;  3WTP B;  3WKJ A;  3C1C D;  4H9R B;  4WU9 D;  3AZF B;  2YFW B;  5AV5 B;  1KX4 B;  3B6G B;  3AZE C;  5JA4 B;  1S32 A;  3X1U A;  2IO5 C;  3AZM D;  5E5A A;  3MGQ A;  5DNN B;  3REJ D;  5CPK A;  4CAY A;  5CPJ A;  4QLC B;  1TAF B;  1M18 D;  4XUJ A;  2CV5 A;  4XZQ D;  3W97 A;  1M18 A;  4YS3 B;  4H9Q A;  3WA9 B;  3AV2 C;  5B1M B;  5B2J A;  5B2I D;  5KDM A;  4WU8 C;  5CP6 C;  5AV6 A;  3C1B C;  3REL B;  2PYO A;  1AOI A;  1R4V A;  4UUZ B;  1KX5 D;  3KWQ D;  2LY8 A;  1P3O A;  3A6N B;  5FUG B;  2FJ7 B;  4KUD B;  2ARO C;  2NZD B;  1HQ3 D;  4G92 B;  4J8V B;  3TU4 B;  5AV9 B;  1M1A C;  3WKJ B;  1P3K A;  1M19 C;  5GT0 A;  5B31 C;  4H9P A;  5GSU D;  3AZK A;  5DNM C;  1P3F D;  1P3P C;  3AZI C;  3X1V D;  3KXB A;  4J8X A;  3X1U B;  1S32 B;  5E5A B;  3MGQ B;  4J8W D;  5CPK B;  4CAY B;  3REH D;  5CPJ B;  3X1S A;  1P3G D;  4XUJ B;  5B40 D;  2CV5 B;  3W97 B;  4R8P D;  4H9Q B;  3C1C C;  3AZG D;  4YM6 C;  3MGP D;  5B2J B;  3AYW B;  5KDM B;  5AV6 B;  3MGP A;  4JJN D;  2PYO B;  1AOI B;  4KGC D;  4JJN A;  3REJ C;  1BFM A;  1P3O B;  1P3L C;  2JSS A;  3LJA D;  5AY8 D;  5B1L A;  1P3A C;  3AZJ B;  1F1E A;  5B33 A;  1P3K B;  5GT0 B;  4H9P B;  3WTP E;  3MVD D;  3W98 B;  3AZK B;  2YFV B;  3KWQ C;  3REK A;  3KXB B;  4J8X B;  5GT3 A;  1EQZ C;  4EO5 B;  3X1S B;  1F66 D;  3W99 C;  3AZE A;  4H9S C;  4ZUX D;  4NE6 A;  5C3I B;  5B0Y C;  2NQB C;  5GSU C;  4KHA A;  4HGA B;  2HIO B;  1P3F C;  1KX3 C;  2RVQ C;  3AZH C;  4WZS B;  3AV2 A;  5GXQ A;  4J8W C;  5CP6 D;  3C1B D;  4AWL C;  1P34 D;  3WAA C;  5B24 A;  2F8N H;  4WU8 A;  5CP6 A;  3C1B A;  5B40 C;  5B1L B;  3V9R A;  3AZG C;  2HUE B;  2ARO D;  5B33 B;  4J8U C;  1P3B C;  1M1A D;  4Z66 C;  3O62 C;  4X23 D;  5B31 D;  1M19 D;  4KGC C;  3LEL C;  3REK B;  5B0Z B;  3AN2 B;  5B31 A;  3UT9 C;  5GT3 B;  3AZI D;  5AY8 C;  1H3O A;  5DNM A;  1P3P A;  3AZE B;  4LD9 D;  2IO5 B;  3NQJ A;  3UTB D;  4DRB A;  4G91 C;  4KHA B;  5B32 C;  3MVD C;  3REI A;  3AZL A;  3C1C A;  4YM6 D;  3AV2 B;  5GXQ B;  3MGR C;  4WU9 A;  1U35 C;  5AVC C;  1WWS A;  5B24 B;  1F66 C;  5BT1 C;  4WU8 B;  3AV1 C;  3C1B B;  1ID3 B;  4ZUX C;  3AZM A;  3V9R B;  1P3L D;  3REJ A;  4NFT A;  3B0D C;  3VH5 T;  1P3A D;  1ZLA D;  3B6F C;  3AFA D;  3KUY C;  1P3M D;  1P3I D;  3MNN C;  4XZQ A;  3X1T B;  3AZN B;  1P3A A;  3MGS C;  4ZBJ B;  5B31 B;  5B2I A;  1P34 C;  5AV8 D;  1H3O B;  5F99 D;  5DNM B;  1P3P B;  1KX5 A;  3UTA C;  4Z5T C;  3KWQ A;  1EQZ D;  3NQJ B;  3W99 D;  1EQZ A;  3WTP C;  3REI B;  1HQ3 A;  5B0Y D;  4X23 C;  4H9S A;  3AZL B;  2NQB D;  3B0B A;  3C1C B;  5B0Y A;  1KX4 C;  3B6G C;  4WU9 B;  1KX3 D;  5GSU A;  2RVQ D;  3B0C T;  3AZH D;  5DNN C;  1Q9C A;  1P3F A;  3X1V A;  4QLC C;  4LD9 C;  3VH5 W;  3AZM B;  4J8W A;  1N1J A;  5BS7 A;  3WAA D;  2F8N D;  3REJ B;  3UTB C;  3REH A;  2F8N A;  1M18 B;  1P3G A;  5B40 A;  4XZQ B;  4J8U D;  1WWI A;  4R8P A;  3AZG A;  1P3B D;  4J8U A;  4Z2M H;  5AVB D;  4Z66 D;  5B2I B;  3O62 D;  3LEL D;  1KX5 B;  3UT9 D;  2FJ7 C;  4KGC A;  3LEL A;  3KWQ B;  4E44 A;  5B31 G;  3UT9 A;  2NZD C;  3LJA A;  5AV9 C;  5AY8 A;  3AFA C;  3TU4 C;  5JRG D;  1P3I C;  1P3M C;  1ZLA C;  4DRA A;  1HQ3 B;  5BO0 A;  5CPI D;  5B32 D;  3B0C W;  5GSU B;  3LZ1 D;  5B32 A;  4NE5 A;  3X1U C;  3MVD A;  5AV8 C;  5F99 C;  1P3F B;  3MGR D;  2L5A A;  1U35 D;  5AVC D;  3X1V B;  5CPJ C;  2F8N K;  4M6B A;  4J8W B;  1N1J B;  3MGR A;  1U35 A;  4XUJ C;  5BT1 D;  5AVC A;  3AV1 D;  1B6W A;  2CV5 C;  4AWL B;  3REH B;  4Z2M G;  1F66 A;  1P3G B;  2F8N B;  3W96 D;  5B40 B;  4ZUX A;  5B2J C;  4R8P B;  3AYW C;  3B6F D;  3AZG B;  3KUY D;  3MNN D;  3MGP B;  2CWE A;  3MGS D;  4NE3 A;  1P3O C;  4JJN B;  3MGS A;  1TZY D;  4KGC B;  5BNV A;  1B67 A; 
#chains in the Genus database with same CATH topology
 1P34 A;  3AZJ C;  3LJA B;  5AY8 B;  3UTA D;  4Z5T D;  1A7W A;  3LZ0 D;  1P3K C;  5GT0 C;  3WTP D;  2ARO A;  3W98 C;  2G5I C;  5AVB C;  3AZK C;  1M1A A;  3AZF D;  3KXB C;  3MVD B;  5AV5 D;  1KX4 D;  4X23 A;  1M19 A;  3B6G D;  4EO5 C;  1KX4 A;  5DNN D;  5JA4 A;  3AZI A;  2BG1 A;  4QLC D;  5JRG C;  1F66 B;  4LD9 A;  5CPI C;  4ZUX B;  4HGA C;  4YS3 D;  3WA9 D;  2HIO C;  3UTB A;  3LZ1 C;  5B1M D;  2F8N G;  3REL D;  4YM6 A;  3VH5 A;  3MGS B;  5CP6 B;  2XD1 A;  3H0R C;  4UUZ A;  3A6N D;  1P34 B;  4KUD D;  2FJ7 D;  3H0L C;  3W96 C;  5B33 C;  2NZD D;  1P3L A;  4J8V D;  3TU4 D;  5AV9 D;  3WKJ D;  2ARO B;  2Y2H A;  1ZLA A;  3AFA A;  1P3M A;  1P3I A;  1M1A B;  4WNN A;  3REK C;  5B0Z C;  3AN2 C;  5GT3 C;  4E45 A;  4X23 B;  1M19 B;  1TZY C;  2Y2Q A;  3IP4 C;  1BH8 A;  1S32 D;  3X1U D;  5E5A D;  3MGQ D;  3EPL A;  5CPK D;  3A1K A;  5B32 G;  1KU5 A;  5CPJ D;  5AV8 A;  3AZI B;  5F99 A;  4CSR A;  3LZ0 C;  4XUJ D;  2CV5 D;  4LD9 B;  5BNX A;  3W97 D;  3UTB B;  3W99 A;  3AZF C;  5B2J D;  3AYW D;  5AV5 C;  2ZY3 A;  5GXQ C;  2BYK A;  2NQB A;  5AV6 D;  3AYW A;  4YM6 B;  1AOI D;  2PYO D;  5B24 C;  2RIQ A;  1KX3 A;  1P3O D;  1ID3 C;  3AZH A;  4YS3 C;  3AZJ D;  1P3L B;  3WA9 C;  3WAA A;  2Y2G A;  3X1T C;  3AZN C;  3AZJ A;  1P3K D;  4WV4 B;  5B1M C;  1P3A B;  5GT0 D;  3AFA B;  1P3M B;  1P3I B;  1ZLA B;  4WNN B;  4ZBJ C;  3W98 D;  3AZK D;  3REL C;  1P3B A;  3W98 A;  5AVB A;  4Z66 A;  1BH8 B;  3KXB D;  5G49 A;  4J8X D;  2BYM A;  2YFV A;  3O62 A;  3A6N C;  4KUD C;  5AV8 B;  3X1S D;  4H9O A;  4CSR B;  5F99 B;  1JFI A;  4G92 C;  4J8V C;  1EQZ B;  5BNX B;  3WKJ C;  3REI C;  2Y2J A;  3W99 B;  3AZL C;  5JRG A;  1Z2C B;  4H9N A;  3NQU A;  2HIO D;  5B0Y B;  4WU9 C;  2BYK B;  5CPI A;  2NQB B;  2HIO A;  1S32 C;  5E5A C;  3MGQ C;  1KX3 B;  3LZ1 A;  5CPK C;  3AZM C;  3AZH B;  5B1L D;  1PZR A;  3W97 C;  1M18 C;  3VH6 A;  3WAA B;  2JE5 A;  3AV1 A;  4XZQ C;  5B33 D;  3W96 A;  4J8U B;  5AV6 C;  5B2I C;  3VH6 T;  1AOI C;  2PYO C;  3KUY A;  1P3B B;  3B6F A;  3MNN A;  3REK D;  5AVB B;  4Z66 B;  4WJ3 C;  5B0Z D;  5G49 B;  3KSY A;  2BYM B;  3AN2 D;  1KX5 C;  5GT3 D;  3O62 B;  1BH9 A;  5B0Z A;  3LEL B;  3AN2 A;  4H9O B;  3UT9 B;  1TZY A;  3AZE D;  1JFI B;  3AL0 C;  1HQ3 C;  2DF4 C;  3UTA A;  1HTA A;  4Z5T A;  4H9N B;  5BO0 B;  5JRG B;  3NQU B;  3LZ0 A;  3R45 A;  5CPI B;  3WTP A;  4G91 B;  5B32 B;  4J8X C;  3AV2 D;  5GXQ D;  4H9R A;  3X1V C;  3LZ1 B;  2YFW A;  3AZF A;  5AV5 A;  3X1S C;  5BS7 C;  5B24 D;  3B6G A;  3MGR B;  4WU8 D;  1U35 B;  5AVC B;  3REH C;  1ID3 D;  5C3I C;  5DNN A;  1P3G C;  3AV1 B;  1ID3 A;  4QLC A;  1TAF A;  2Y2O A;  4R8P C;  3W96 B;  3VH6 W;  2J8P A;  3B0D B;  3X1T D;  3AZN D;  3MGP C;  4YS3 A;  3WA9 A;  3B6F B;  3KUY B;  3X1T A;  3MNN B;  3AZN A;  4JJN C;  5B1M A;  5BNV B;  1BH9 B;  3REL A;  5DNM D;  1P3P D;  5B1L C;  3LJA C;  1TZY B;  2VQR A;  2HUE C;  3A6N A;  1ULY A;  5FUG A;  2FJ7 A;  4KUD A;  3UTA B;  4Z5T B;  2DQN C;  5CHL B;  3LZ0 B;  2NZD A;  3REI D;  4J8V A;  3TU4 A;  5AV9 A;  3R45 B;  3AZL D;  3WTP B;  3WKJ A;  3EPK A;  3C1C D;  4H9R B;  3F6T A;  4WU9 D;  3AZF B;  2YFW B;  5AV5 B;  1KX4 B;  3B6G B;  3AZE C;  5JA4 B;  1S32 A;  3X1U A;  2IO5 C;  3AZM D;  5E5A A;  3MGQ A;  5DNN B;  3REJ D;  5CPK A;  4CAY A;  5CPJ A;  4QLC B;  1TAF B;  1M18 D;  2Y2I A;  4XUJ A;  2CV5 A;  4XZQ D;  3W97 A;  1M18 A;  4YS3 B;  4H9Q A;  3WA9 B;  3AV2 C;  5B1M B;  5B2J A;  5B2I D;  3A1I A;  5KDM A;  4WU8 C;  5CP6 C;  5AV6 A;  3C1B C;  3REL B;  2PYO A;  1AOI A;  1R4V A;  4UUZ B;  1KX5 D;  3KWQ D;  2LY8 A;  1P3O A;  3A6N B;  5FUG B;  2FJ7 B;  4KUD B;  2ARO C;  2Y2P A;  2NZD B;  1HQ3 D;  4G92 B;  4J8V B;  3TU4 B;  5AV9 B;  1M1A C;  3WKJ B;  2F2A C;  2ZM5 A;  1P3K A;  1M19 C;  5GT0 A;  5B31 C;  4H9P A;  5GSU D;  2ZY4 A;  3AZK A;  5DNM C;  1P3F D;  1P3P C;  3AZI C;  3FDD A;  3X1V D;  3KXB A;  4J8X A;  3X1U B;  1S32 B;  5E5A B;  3MGQ B;  4J8W D;  5CPK B;  4CAY B;  3REH D;  5CPJ B;  3X1S A;  1P3G D;  4XUJ B;  5B40 D;  2CV5 B;  3W97 B;  4R8P D;  4H9Q B;  3C1C C;  3AZG D;  4YM6 C;  3MGP D;  5B2J B;  3AYW B;  5KDM B;  5AV6 B;  3MGP A;  4JJN D;  2PYO B;  1AOI B;  4KGC D;  4JJN A;  3REJ C;  1BFM A;  1P3O B;  1P3L C;  2JSS A;  3LJA D;  5AY8 D;  2Y2M A;  5B1L A;  1P3A C;  3AZJ B;  1F1E A;  5B33 A;  1P3K B;  5GT0 B;  2ZY2 A;  4H9P B;  3WTP E;  3MVD D;  3W98 B;  2G5H C;  3AZK B;  2YFV B;  3KWQ C;  3REK A;  3KXB B;  4J8X B;  5GT3 A;  1EQZ C;  4EO5 B;  3X1S B;  1F66 D;  3W99 C;  3AZE A;  4H9S C;  4ZUX D;  4NE6 A;  5C3I B;  3KFU G;  5B0Y C;  2NQB C;  5GSU C;  4KHA A;  4HGA B;  2HIO B;  1P3F C;  1KX3 C;  2RVQ C;  3AZH C;  4WZS B;  3AV2 A;  5GXQ A;  4J8W C;  5CP6 D;  3C1B D;  4AWL C;  1P34 D;  3WAA C;  5B24 A;  2F8N H;  4WU8 A;  5CP6 A;  3C1B A;  5B40 C;  5B1L B;  3V9R A;  3AZG C;  2HUE B;  2XD5 A;  2ARO D;  5B33 B;  4J8U C;  1P3B C;  1M1A D;  4Z66 C;  3O62 C;  4X23 D;  5B31 D;  1M19 D;  4KGC C;  3LEL C;  3REK B;  5B0Z B;  3AN2 B;  5B31 A;  3UT9 C;  5GT3 B;  3AZI D;  5AY8 C;  2JCH A;  1H3O A;  5DNM A;  1W2E A;  1P3P A;  3AZE B;  4LD9 D;  2IO5 B;  3NQJ A;  3UTB D;  4DRB A;  4G91 C;  4KHA B;  5B32 C;  3MVD C;  3REI A;  3AZL A;  3C1C A;  4YM6 D;  3AV2 B;  5GXQ B;  3MGR C;  4WU9 A;  1U35 C;  5AVC C;  1WWS A;  5B24 B;  1F66 C;  5BT1 C;  4WU8 B;  3AV1 C;  3C1B B;  1ID3 B;  4ZUX C;  3AZM A;  1T3U A;  3V9R B;  1P3L D;  3REJ A;  4NFT A;  3B0D C;  3VH5 T;  2Y2N A;  1P3A D;  1ZLA D;  3B6F C;  3AFA D;  3KUY C;  1P3M D;  1P3I D;  3MNN C;  4XZQ A;  3X1T B;  3AZN B;  1P3A A;  3MGS C;  4ZBJ B;  5B31 B;  5B2I A;  1P34 C;  3P5J B;  5AV8 D;  1H3O B;  5F99 D;  5DNM B;  1P3P B;  1KX5 A;  3UTA C;  4Z5T C;  3KWQ A;  1EQZ D;  3NQJ B;  3W99 D;  1EQZ A;  3WTP C;  4DQY B;  3REI B;  1HQ3 A;  2FFF B;  5B0Y D;  4X23 C;  4H9S A;  3AZL B;  2NQB D;  3B0B A;  3C1C B;  5B0Y A;  1KX4 C;  3B6G C;  4WU9 B;  1KX3 D;  5GSU A;  2RVQ D;  3B0C T;  3AZH D;  5DNN C;  1Q9C A;  1P3F A;  3H0M C;  3X1V A;  4QLC C;  4LD9 C;  3VH5 W;  3AZM B;  4J8W A;  1N1J A;  5BS7 A;  3WAA D;  2F8N D;  3REJ B;  3UTB C;  3REH A;  2F8N A;  1M18 B;  1P3G A;  5B40 A;  4XZQ B;  4J8U D;  1WWI A;  4R8P A;  3AZG A;  3EPH A;  1P3B D;  4J8U A;  4Z2M H;  5AVB D;  4Z66 D;  5B2I B;  3O62 D;  3LEL D;  1KX5 B;  3UT9 D;  2FJ7 C;  4KGC A;  3LEL A;  3KWQ B;  4E44 A;  5B31 G;  3UT9 A;  2NZD C;  3LJA A;  5AV9 C;  5AY8 A;  3AFA C;  3TU4 C;  5JRG D;  1P3I C;  1P3M C;  1ZLA C;  4DRA A;  1HQ3 B;  5BO0 A;  4UPK A;  5CPI D;  5B32 D;  3B0C W;  5GSU B;  3LZ1 D;  5B32 A;  4NE5 A;  3X1U C;  3MVD A;  5AV8 C;  5F99 C;  1P3F B;  3MGR D;  2L5A A;  2Y2L A;  5AVC D;  3X1V B;  5CPJ C;  1U35 D;  2ZY5 A;  2F8N K;  4M6B A;  4J8W B;  1N1J B;  3MGR A;  1U35 A;  4XUJ C;  5BT1 D;  5AVC A;  3AV1 D;  1B6W A;  2CV5 C;  4AWL B;  2Y2K A;  3REH B;  2UWX A;  4Z2M G;  1P3G B;  1F66 A;  2F8N B;  3W96 D;  5B40 B;  4ZUX A;  5B2J C;  4R8P B;  3AYW C;  3B6F D;  3AZG B;  3KUY D;  2W8S A;  3MNN D;  3MGP B;  2CWE A;  3MGS D;  4NE3 A;  3EPJ A;  1P3O C;  4JJN B;  3MGS A;  1TZY D;  4KGC B;  5BNV A;  3EG5 B;  1B67 A; 
#chains in the Genus database with same CATH homology
 1P34 A;  3AZJ C;  3LJA B;  5AY8 B;  3UTA D;  4Z5T D;  1A7W A;  3LZ0 D;  1P3K C;  5GT0 C;  3WTP D;  2ARO A;  3W98 C;  2G5I C;  5AVB C;  3AZK C;  1M1A A;  3AZF D;  3KXB C;  3MVD B;  5AV5 D;  1KX4 D;  4X23 A;  1M19 A;  3B6G D;  4EO5 C;  1KX4 A;  5DNN D;  5JA4 A;  3AZI A;  2BG1 A;  4QLC D;  5JRG C;  1F66 B;  4LD9 A;  5CPI C;  4ZUX B;  4HGA C;  4YS3 D;  3WA9 D;  2HIO C;  3UTB A;  3LZ1 C;  5B1M D;  2F8N G;  3REL D;  4YM6 A;  3VH5 A;  3MGS B;  5CP6 B;  2XD1 A;  3H0R C;  4UUZ A;  3A6N D;  1P34 B;  4KUD D;  2FJ7 D;  3H0L C;  3W96 C;  5B33 C;  2NZD D;  1P3L A;  4J8V D;  3TU4 D;  5AV9 D;  3WKJ D;  2ARO B;  2Y2H A;  1ZLA A;  3AFA A;  1P3M A;  1P3I A;  1M1A B;  4WNN A;  3REK C;  5B0Z C;  3AN2 C;  5GT3 C;  4E45 A;  4X23 B;  1M19 B;  1TZY C;  2Y2Q A;  3IP4 C;  1BH8 A;  1S32 D;  3X1U D;  5E5A D;  3MGQ D;  3EPL A;  5CPK D;  3A1K A;  5B32 G;  1KU5 A;  5CPJ D;  5AV8 A;  3AZI B;  5F99 A;  4CSR A;  3LZ0 C;  4XUJ D;  2CV5 D;  4LD9 B;  5BNX A;  3W97 D;  3UTB B;  3W99 A;  3AZF C;  5B2J D;  3AYW D;  5AV5 C;  2ZY3 A;  5GXQ C;  2BYK A;  2NQB A;  5AV6 D;  3AYW A;  4YM6 B;  1AOI D;  2PYO D;  5B24 C;  2RIQ A;  1KX3 A;  1P3O D;  1ID3 C;  3AZH A;  4YS3 C;  3AZJ D;  1P3L B;  3WA9 C;  3WAA A;  2Y2G A;  3X1T C;  3AZN C;  3AZJ A;  1P3K D;  4WV4 B;  5B1M C;  1P3A B;  5GT0 D;  3AFA B;  1P3M B;  1P3I B;  1ZLA B;  4WNN B;  4ZBJ C;  3W98 D;  3AZK D;  3REL C;  1P3B A;  3W98 A;  5AVB A;  4Z66 A;  1BH8 B;  3KXB D;  5G49 A;  4J8X D;  2BYM A;  2YFV A;  3O62 A;  3A6N C;  4KUD C;  5AV8 B;  3X1S D;  4H9O A;  4CSR B;  5F99 B;  1JFI A;  4G92 C;  4J8V C;  1EQZ B;  5BNX B;  3WKJ C;  3REI C;  2Y2J A;  3W99 B;  3AZL C;  5JRG A;  1Z2C B;  4H9N A;  3NQU A;  2HIO D;  5B0Y B;  4WU9 C;  2BYK B;  5CPI A;  2NQB B;  2HIO A;  1S32 C;  5E5A C;  3MGQ C;  1KX3 B;  3LZ1 A;  5CPK C;  3AZM C;  3AZH B;  5B1L D;  1PZR A;  3W97 C;  1M18 C;  3VH6 A;  3WAA B;  2JE5 A;  3AV1 A;  4XZQ C;  5B33 D;  3W96 A;  4J8U B;  5AV6 C;  5B2I C;  3VH6 T;  1AOI C;  2PYO C;  3KUY A;  1P3B B;  3B6F A;  3MNN A;  3REK D;  5AVB B;  4Z66 B;  4WJ3 C;  5B0Z D;  5G49 B;  3KSY A;  2BYM B;  3AN2 D;  1KX5 C;  5GT3 D;  3O62 B;  1BH9 A;  5B0Z A;  3LEL B;  3AN2 A;  4H9O B;  3UT9 B;  1TZY A;  3AZE D;  1JFI B;  3AL0 C;  1HQ3 C;  2DF4 C;  3UTA A;  1HTA A;  4Z5T A;  4H9N B;  5BO0 B;  5JRG B;  3NQU B;  3LZ0 A;  3R45 A;  5CPI B;  3WTP A;  4G91 B;  5B32 B;  4J8X C;  3AV2 D;  5GXQ D;  4H9R A;  3X1V C;  3LZ1 B;  2YFW A;  3AZF A;  5AV5 A;  3X1S C;  5BS7 C;  5B24 D;  3B6G A;  3MGR B;  4WU8 D;  1U35 B;  5AVC B;  3REH C;  1ID3 D;  5C3I C;  5DNN A;  1P3G C;  3AV1 B;  1ID3 A;  4QLC A;  1TAF A;  2Y2O A;  4R8P C;  3W96 B;  3VH6 W;  2J8P A;  3B0D B;  3X1T D;  3AZN D;  3MGP C;  4YS3 A;  3WA9 A;  3B6F B;  3KUY B;  3X1T A;  3MNN B;  3AZN A;  4JJN C;  5B1M A;  5BNV B;  1BH9 B;  3REL A;  5DNM D;  1P3P D;  5B1L C;  3LJA C;  1TZY B;  2VQR A;  2HUE C;  3A6N A;  1ULY A;  5FUG A;  2FJ7 A;  4KUD A;  3UTA B;  4Z5T B;  2DQN C;  5CHL B;  3LZ0 B;  2NZD A;  3REI D;  4J8V A;  3TU4 A;  5AV9 A;  3R45 B;  3AZL D;  3WTP B;  3WKJ A;  3EPK A;  3C1C D;  4H9R B;  3F6T A;  4WU9 D;  3AZF B;  2YFW B;  5AV5 B;  1KX4 B;  3B6G B;  3AZE C;  5JA4 B;  1S32 A;  3X1U A;  2IO5 C;  3AZM D;  5E5A A;  3MGQ A;  5DNN B;  3REJ D;  5CPK A;  4CAY A;  5CPJ A;  4QLC B;  1TAF B;  1M18 D;  2Y2I A;  4XUJ A;  2CV5 A;  4XZQ D;  3W97 A;  1M18 A;  4YS3 B;  4H9Q A;  3WA9 B;  3AV2 C;  5B1M B;  5B2J A;  5B2I D;  3A1I A;  5KDM A;  4WU8 C;  5CP6 C;  5AV6 A;  3C1B C;  3REL B;  2PYO A;  1AOI A;  1R4V A;  4UUZ B;  1KX5 D;  3KWQ D;  2LY8 A;  1P3O A;  3A6N B;  5FUG B;  2FJ7 B;  4KUD B;  2ARO C;  2Y2P A;  2NZD B;  1HQ3 D;  4G92 B;  4J8V B;  3TU4 B;  5AV9 B;  1M1A C;  3WKJ B;  2F2A C;  2ZM5 A;  1P3K A;  1M19 C;  5GT0 A;  5B31 C;  4H9P A;  5GSU D;  2ZY4 A;  3AZK A;  5DNM C;  1P3F D;  1P3P C;  3AZI C;  3FDD A;  3X1V D;  3KXB A;  4J8X A;  3X1U B;  1S32 B;  5E5A B;  3MGQ B;  4J8W D;  5CPK B;  4CAY B;  3REH D;  5CPJ B;  3X1S A;  1P3G D;  4XUJ B;  5B40 D;  2CV5 B;  3W97 B;  4R8P D;  4H9Q B;  3C1C C;  3AZG D;  4YM6 C;  3MGP D;  5B2J B;  3AYW B;  5KDM B;  5AV6 B;  3MGP A;  4JJN D;  2PYO B;  1AOI B;  4KGC D;  4JJN A;  3REJ C;  1BFM A;  1P3O B;  1P3L C;  2JSS A;  3LJA D;  5AY8 D;  2Y2M A;  5B1L A;  1P3A C;  3AZJ B;  1F1E A;  5B33 A;  1P3K B;  5GT0 B;  2ZY2 A;  4H9P B;  3WTP E;  3MVD D;  3W98 B;  2G5H C;  3AZK B;  2YFV B;  3KWQ C;  3REK A;  3KXB B;  4J8X B;  5GT3 A;  1EQZ C;  4EO5 B;  3X1S B;  1F66 D;  3W99 C;  3AZE A;  4H9S C;  4ZUX D;  4NE6 A;  5C3I B;  3KFU G;  5B0Y C;  2NQB C;  5GSU C;  4KHA A;  4HGA B;  2HIO B;  1P3F C;  1KX3 C;  2RVQ C;  3AZH C;  4WZS B;  3AV2 A;  5GXQ A;  4J8W C;  5CP6 D;  3C1B D;  4AWL C;  1P34 D;  3WAA C;  5B24 A;  2F8N H;  4WU8 A;  5CP6 A;  3C1B A;  5B40 C;  5B1L B;  3V9R A;  3AZG C;  2HUE B;  2XD5 A;  2ARO D;  5B33 B;  4J8U C;  1P3B C;  1M1A D;  4Z66 C;  3O62 C;  4X23 D;  5B31 D;  1M19 D;  4KGC C;  3LEL C;  3REK B;  5B0Z B;  3AN2 B;  5B31 A;  3UT9 C;  5GT3 B;  3AZI D;  5AY8 C;  2JCH A;  1H3O A;  5DNM A;  1W2E A;  1P3P A;  3AZE B;  4LD9 D;  2IO5 B;  3NQJ A;  3UTB D;  4DRB A;  4G91 C;  4KHA B;  5B32 C;  3MVD C;  3REI A;  3AZL A;  3C1C A;  4YM6 D;  3AV2 B;  5GXQ B;  3MGR C;  4WU9 A;  1U35 C;  5AVC C;  1WWS A;  5B24 B;  1F66 C;  5BT1 C;  4WU8 B;  3AV1 C;  3C1B B;  1ID3 B;  4ZUX C;  3AZM A;  1T3U A;  3V9R B;  1P3L D;  3REJ A;  4NFT A;  3B0D C;  3VH5 T;  2Y2N A;  1P3A D;  1ZLA D;  3B6F C;  3AFA D;  3KUY C;  1P3M D;  1P3I D;  3MNN C;  4XZQ A;  3X1T B;  3AZN B;  1P3A A;  3MGS C;  4ZBJ B;  5B31 B;  5B2I A;  1P34 C;  3P5J B;  5AV8 D;  1H3O B;  5F99 D;  5DNM B;  1P3P B;  1KX5 A;  3UTA C;  4Z5T C;  3KWQ A;  1EQZ D;  3NQJ B;  3W99 D;  1EQZ A;  3WTP C;  4DQY B;  3REI B;  1HQ3 A;  2FFF B;  5B0Y D;  4X23 C;  4H9S A;  3AZL B;  2NQB D;  3B0B A;  3C1C B;  5B0Y A;  1KX4 C;  3B6G C;  4WU9 B;  1KX3 D;  5GSU A;  2RVQ D;  3B0C T;  3AZH D;  5DNN C;  1Q9C A;  1P3F A;  3H0M C;  3X1V A;  4QLC C;  4LD9 C;  3VH5 W;  3AZM B;  4J8W A;  1N1J A;  5BS7 A;  3WAA D;  2F8N D;  3REJ B;  3UTB C;  3REH A;  2F8N A;  1M18 B;  1P3G A;  5B40 A;  4XZQ B;  4J8U D;  1WWI A;  4R8P A;  3AZG A;  3EPH A;  1P3B D;  4J8U A;  4Z2M H;  5AVB D;  4Z66 D;  5B2I B;  3O62 D;  3LEL D;  1KX5 B;  3UT9 D;  2FJ7 C;  4KGC A;  3LEL A;  3KWQ B;  4E44 A;  5B31 G;  3UT9 A;  2NZD C;  3LJA A;  5AV9 C;  5AY8 A;  3AFA C;  3TU4 C;  5JRG D;  1P3I C;  1P3M C;  1ZLA C;  4DRA A;  1HQ3 B;  5BO0 A;  4UPK A;  5CPI D;  5B32 D;  3B0C W;  5GSU B;  3LZ1 D;  5B32 A;  4NE5 A;  3X1U C;  3MVD A;  5AV8 C;  5F99 C;  1P3F B;  3MGR D;  2L5A A;  2Y2L A;  5AVC D;  3X1V B;  5CPJ C;  1U35 D;  2ZY5 A;  2F8N K;  4M6B A;  4J8W B;  1N1J B;  3MGR A;  1U35 A;  4XUJ C;  5BT1 D;  5AVC A;  3AV1 D;  1B6W A;  2CV5 C;  4AWL B;  2Y2K A;  3REH B;  2UWX A;  4Z2M G;  1P3G B;  1F66 A;  2F8N B;  3W96 D;  5B40 B;  4ZUX A;  5B2J C;  4R8P B;  3AYW C;  3B6F D;  3AZG B;  3KUY D;  2W8S A;  3MNN D;  3MGP B;  2CWE A;  3MGS D;  4NE3 A;  3EPJ A;  1P3O C;  4JJN B;  3MGS A;  1TZY D;  4KGC B;  5BNV A;  3EG5 B;  1B67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...