4AWLC

The nf-y transcription factor is structurally and functionally a sequence specific histone
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
b'VQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
publication title Sequence-Specific Transcription Factor NF-Y Displays Histone-Like DNA Binding and H2B-Like Ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4awlC00
1TZYB 5AV9B 5AV8A 1S32A 5B33D 1BH9B 3B6GD 3MVDC 3REJD 5B1LD 3AV2A 4G92B 4X23B 5B40C 1ZLAC 4KUDC 1Q9CA 4WU8C 4YS3A 3LELA 1P3MC 3NQJB 3AFAA 3LZ0D 3MGPC 4NE3A 3X1TC 3UT9C 4NE5A 3AZND 4J8WD 3MGQD 3X1UD 5AVCD 3AZFB 5B2IB 1TZYC 5AY8D 5AV9C 5CP6D 3UTAB 3REIB 2NZDB 4G92C 4WU9C 4R8PB 4CAYB 3REHA 4Z5TD 3WKJB 3RELB 3WAAC 3AZMD 1P3LB 4Z66A 1KX4B 5F99D 3AZEB 3W97D 2CV5D 3WA9D 4UUZB 1JFIA 3AZFC 5B2IC 2F8NB 2BYKB 1WWSA 5B32B 3REIC 3W99A 3UTBB 4H9OB 4H9NB 4R8PC 1P3AD 1EQZB 1P3FB 1P3BC 3AZJA 4H9SA 2PYOC 1BH8A 1P3LC 3MVDA 3X1VB 3AZEC 5B40A 4KUDA 1ZLAA 3X1SB 4WU8A 3C1CC 1WWIA 3AZKA 1P3MA 1M18C 1U35C 5GSUB 5AVBB 3MGPA 3X1TA 3UT9A 5AV5C 4KGCB 5B1MD 3UTBC 3MGSD 4WV4B 5B0YB 3MNNB 3C1BD 5DNNB 2F8NH 1TZYA 5AV9A 2RVQD 2AROC 3AYWB 4JJNC 1P3FC 3W96B 2LY8A 5E5AB 1BH9A 1ID3B 3X1SC 5AV8D 3MGRB 1S32D 5BO0B 3NQJA 4H9RB 5GSUC 3WAAA 3AV2D 1P3IB 5CHLB 4KGCC 3AN2D 4YS3D 3AFAD 5B31B 1P3GC 5BNVA 3MNNC 5DNNC 3AZFA 5B2IA 2CWEA 3LELC 5GXQB 3W96C 1P3KB 1ID3C 3REIA 5B24C 2NQBB 2FJ7B 4R8PA 4CAYA 3LJAB 3MGRC 1P3BA 3B6FB 2PYOA 1HQ3B 1P3LA 4LD9B 3AZEA 1P3OB 5JA4A 3REHD 5CPKB 5B31C 4UUZA 4J8VC 3AZID 1M18A 1U35A 4Z66D 5CPIB 5GXQC 3LZ1B 2F8NA 2BYKA 5AV5A 5DNMD 1KX3B 1P3KC 3UTBA 2NQBC 5B0ZB 4H9OA 4H9NA 5BNXB 3AZLC 3LJAC 1AOIB 2AROA 3WTPB 4JJNA 3KUYB 3O62B 1P3FA 3W99D 1M19D 1P3OC 4E44A 3X1SA 4XZQB 5FUGB 1H3OB 3MVDD 5GSUA 5JRGB 5CPIC 5CPJB 3LZ1C 2HUEB 3AZJC 1ZLAD 4KUDD 4YM6B 4H9SC 3KWQB 4KGCA 5G49A 4WU8D 1P3GA 3MGPD 3X1TD 5B33B 5B0YA 3MNNA 3UT9D 5DNNA 3B6GB 5GT0C 3AZKC 4XUJC 3W96A 5B1LB 3WTPC 3AYWA 3O62C 3W98C 4ZUXB 3VH6W 1ID3A 3AZHC 5B24A 1TZYD 5AV9D 3REKB 4XZQC 3A6NB 3MGRA 3AZNB 3VH6T 5BO0A 3KXBB 4H9RA 5JRGC 3TU4D 2HUEC 4WU9D 5BS7C 4YM6C 3KWQC 3X1UB 5AY8B 5B31A 4X23C 4J8VA 3WAAD 5CP6B 5B33C 5GXQA 5B1LC 1KX5D 4Z2MG 1P3KA 4ZUXC 4Z5TB 3AZFD 1M1AB 2NQBA 3REKC 3AZLA 1A7WA 3A6NC 3LJAA 4G91B 3AZNC 1F1EA 5F99B 3KXBC 3W97B 3REID 3WA9B 2YFVB 3UTAC 1P3OA 3WTPE 4R8PD 5CPKA 2NZDC 4QLCD 1P3BD 4J8UB 2PYOD 1F66B 5CP6C 1P3LD 3VH6A 5CPIA 3AZED 3WKJC 3LZ1A 3RELC 1ULYA 4ZBJB 1KX3A 4E45A 3C1CD 1KX4C 1P3AB 1M18D 1U35D 2YFWA 1M1AC 5BNXA 4CSRA 2F8ND 1TAFB 5GT0A 4G91C 4XUJA 5AV5D 5AV6B 5F99C 3WTPA 3O62A 3W98A 3NQUB 3UTBD 4H9QB 5B2JB 4J8XB 3AZHA 3AV1D 5B32C 2AROD 2JSSA 4XZQA 5FUGA 4JJND 1P3FD 4J8UC 1F66C 3AZGB 5JRGA 1EQZC 5B1MB 5BS7A 4YM6A 3X1SD 3KWQA 3X1VC 3C1BB 4X23A 5GSUD 5B33A 4M6BA 4WNNB 5B1LA 5AV6C 5AVBC 4WZSB 4ZUXA 1P3GD 5B2JC 4J8XC 3MNND 1P3PB 5DNND 3LELD 3REKA 2L5AA 3AV2B 3W96D 3A6NA 3AZNA 5B0YC 3AN2B 3KXBA 5C3IB 1ID3D 3AZGC 4YS3B 3AYWC 3B0CW 5E5AC 5B24D 3UTAA 3MGRD 2NZDA 2IO5B 1B6WA 3B0CT 5CP6A 3WKJA 3RELA 1P3IC 5B31D 1KX4A 4J8VD 1P3PC 1M1AA 5GXQD 5GT3B 5F99A 1P3KD 3W97A 4KHAB 5C3IC 2YFVA 2NQBD 1BFMA 3R45B 3AZLD 1B67A 5B32A 3AZIB 4Z66B 3V9RB 4J8UA 3B0BA 5DNMB 1F66A 2FJ7C 1EQZA 2HIOB 3B6FC 1HQ3C 3X1VA 4LD9C 5BT1C 5CPKC 5CPID 5GT3C 3LZ1D 3AZJD 1TAFA 1M19B 5AV6A 1N1JB 5AVBA 3NQUA 1P34B 5B40D 4H9QA 5B2JA 4J8XA 1KX3C 3AZIC 3MVDB 5GT0D 3AZKD 4XUJD 3WTPD 1P3MD 3W98D 4KUDB 5B0ZC 5DNMC 4WU8B 3REJB 3AZGA 1AOIC 3AZHD 3KUYC 5E5AA 2HIOC 2F8NG 4XZQD 3LZ0B 5JRGD 4YM6D 4J8WB 1M19C 3MGQB 5CPJC 1P34C 1P3IA 4X23D 1P3PA 5AVCB 1HTAA 3TU4B 4WU9B 3AN2A 4ZUXD 3B6GC 3REJC 2F8NK 3REKD 3WAAB 3A6ND 3B0DB 1KX5B 5KDMB 3KXBD 5B2ID 3LZ0C 3AZMB 2FJ7A 4NE6A 3UTAD 1KU5A 4J8WC 5BNVB 3B6FA 1HQ3A 4DRAA 3MGQC 2CV5B 2NZDD 1R4VA 4LD9A 3X1UC 5AVCC 5AY8C 5GT3A 3WKJD 3TU4C 3RELD 1KX4D 4KHAA 4QLCB 1P3BB 1M1AD 3R45A 2PYOB 3AZIA 3B0DC 4Z5TC 3V9RA 1KX5C 2BYMB 4HGAB 5JA4B 4DRBA 5B0ZA 5B31G 5DNMA 3AZMC 3C1CB 1AOIA 3KUYA 5B32D 1M18B 2HIOA 1U35B 3W97C 2CV5C 3WA9C 4J8UD 5AV5B 1F66D 1EQZD 1M19A 1H3OA 4H9PB 3AV1B 1N1JA 3X1VD 5CPJA 2AROB 4QLCC 4JJNB 1P34A 3MGSB 4ZBJC 1P3AC 5AV6D 5AVBD 4HGAC 3B6GA 3REJA 4KGCD 5B2JD 4J8XD 5AV8B 1S32B 5B0YD 5G49B 3LZ0A 3AZGD 3AYWD 1P3GB 5E5AD 4J8WA 3AV1C 3MGQA 3LELB 5B1MC 3AFAB 3MGSC 3X1UA 5AVCA 3C1BC 5AY8A 2RVQC 3TU4A 5B24B 4WU9A 1P3ID 1P3PD 5AV8C 1S32C 4Z5TA 1KX5A 5KDMA 4EO5B 3AZMA 3AV2C 4J8VB 3AN2C 3VH5W 3REHB 4Z2MH 4YS3C 2CV5A 3WA9A 3AFAC 2FJ7D 3LJAD 2IO5C 3VH5T 3B6FD 1HQ3D 3AZLB 4LD9D 4NFTA 5BT1D 4QLCA 1P3OD 1JFIB 5CPKD 5GT3D 1P3AA 2BYMA 4EO5C 3W99B 4AWLB 3C1CA 1KX3D 3KSYA 3REHC 3AZJB 5B0ZD 1BH8B 4Z66C 1AOID 3KUYD 3O62D 5B40B 1ZLAB 2HIOD 2YFWB 4H9PA 4CSRB 3AV1A 5GT0B 3AZKB 4XUJB 5B1MA 1P3MB 3W98B 3MGPB 3MGSA 3X1TB 3C1BA 3UT9B 5B32G 3AZHB 3VH5A 5CPJD 3W99C 1P34D 4AWLC 4WNNA 3KWQD
chains in the Genus database with same CATH superfamily
1Z2CB 1TZYB 5AV9B 5AV8A 1S32A 5B33D 1BH9B 3B6GD 3MVDC 3REJD 5B1LD 3AV2A 4G92B 4X23B 5B40C 1ZLAC 4KUDC 1Q9CA 4WU8C 4YS3A 3LELA 1P3MC 3NQJB 3AFAA 3LZ0D 3MGPC 4NE3A 3X1TC 3UT9C 4NE5A 3AZND 4J8WD 3MGQD 2Y2HA 3X1UD 5AVCD 2XD5A 3AZFB 5B2IB 1TZYC 5AY8D 5AV9C 3FDDA 5CP6D 3UTAB 3REIB 2NZDB 4G92C 4WU9C 4R8PB 4CAYB 3REHA 4Z5TD 3WKJB 3RELB 3WAAC 3AZMD 1P3LB 4Z66A 1KX4B 5F99D 3AZEB 3W97D 2CV5D 3WA9D 4UUZB 1JFIA 3AZFC 5B2IC 2F8NB 2BYKB 1WWSA 2ZY3A 5B32B 3REIC 3W99A 3UTBB 4H9OB 4H9NB 4R8PC 1P3AD 1EQZB 1P3FB 1P3BC 3AZJA 4H9SA 2PYOC 1BH8A 1P3LC 3MVDA 3X1VB 3AZEC 5B40A 4UPKA 1ZLAA 4KUDA 3EPLA 3X1SB 4WU8A 3C1CC 1WWIA 3AZKA 1P3MA 1M18C 1U35C 5GSUB 5AVBB 3MGPA 3X1TA 3UT9A 5AV5C 4KGCB 5B1MD 3UTBC 3AL0C 3MGSD 4WV4B 5B0YB 3MNNB 3C1BD 5DNNB 2F8NH 1TZYA 5AV9A 2RVQD 2AROC 3AYWB 4JJNC 1P3FC 3W96B 2LY8A 2G5IC 5E5AB 1BH9A 1ID3B 2UWXA 3X1SC 5AV8D 3MGRB 1S32D 5BO0B 3NQJA 4H9RB 5GSUC 3WAAA 3AV2D 1P3IB 5CHLB 4KGCC 3EPJA 3AN2D 4WJ3C 4YS3D 3AFAD 5B31B 1P3GC 5BNVA 3MNNC 5DNNC 3AZFA 5B2IA 2CWEA 3LELC 5GXQB 3W96C 1P3KB 1ID3C 3REIA 5B24C 2NQBB 2Y2OA 2FJ7B 4R8PA 4CAYA 3LJAB 3MGRC 1P3BA 2W8SA 3B6FB 2PYOA 1HQ3B 1P3LA 4LD9B 3AZEA 1P3OB 5JA4A 3REHD 5CPKB 5B31C 4UUZA 4J8VC 3AZID 1M18A 1U35A 4Z66D 5CPIB 5GXQC 3LZ1B 2F8NA 2BYKA 5AV5A 5DNMD 1KX3B 1P3KC 3UTBA 2NQBC 5B0ZB 4H9OA 4H9NA 5BNXB 3AZLC 3LJAC 1AOIB 2AROA 3WTPB 4JJNA 3KUYB 3O62B 1P3FA 2G5HC 3W99D 1M19D 1P3OC 4E44A 3X1SA 4XZQB 5FUGB 2ZY4A 1H3OB 3MVDD 5GSUA 5JRGB 5CPIC 5CPJB 3LZ1C 2HUEB 3AZJC 1ZLAD 4KUDD 1PZRA 4H9SC 4YM6B 3KWQB 4KGCA 2RIQA 5G49A 4WU8D 1P3GA 3MGPD 3X1TD 5B33B 5B0YA 3MNNA 3UT9D 5DNNA 3B6GB 5GT0C 3AZKC 4XUJC 3W96A 5B1LB 3WTPC 3AYWA 3O62C 3W98C 4ZUXB 3VH6W 1ID3A 3AZHC 5B24A 1TZYD 5AV9D 3REKB 4XZQC 3A6NB 3MGRA 3AZNB 3VH6T 5BO0A 3P5JB 3KXBB 4H9RA 5JRGC 3IP4C 3TU4D 2HUEC 4WU9D 5BS7C 4YM6C 3KWQC 3X1UB 5AY8B 5B31A 4X23C 4J8VA 3WAAD 5CP6B 5B33C 2Y2IA 5GXQA 5B1LC 1KX5D 4Z2MG 1P3KA 4ZUXC 4Z5TB 2FFFB 3AZFD 1M1AB 2NQBA 3H0MC 3REKC 3AZLA 1A7WA 3A6NC 3LJAA 4G91B 3AZNC 1F1EA 5F99B 3KXBC 3W97B 3REID 3WA9B 2YFVB 3UTAC 1P3OA 3WTPE 4R8PD 3EG5B 5CPKA 2NZDC 4QLCD 1P3BD 1T3UA 4J8UB 2PYOD 1F66B 5CP6C 1P3LD 3VH6A 5CPIA 3AZED 3WKJC 3LZ1A 3RELC 1ULYA 4ZBJB 1KX3A 4E45A 3C1CD 1KX4C 1P3AB 1M18D 1U35D 2YFWA 1M1AC 5BNXA 4CSRA 2F8ND 1TAFB 5GT0A 4G91C 4XUJA 5AV5D 5AV6B 5F99C 3WTPA 3O62A 3W98A 3NQUB 2XD1A 3UTBD 4H9QB 3F6TA 5B2JB 4J8XB 3AZHA 5B32C 3AV1D 2AROD 2JSSA 4XZQA 5FUGA 4JJND 1P3FD 2ZY5A 4J8UC 1F66C 3AZGB 5JRGA 1EQZC 5B1MB 5BS7A 4YM6A 3X1SD 3KWQA 3X1VC 3C1BB 4X23A 5GSUD 5B33A 4M6BA 4WNNB 2ZY2A 5B1LA 5AV6C 5AVBC 4WZSB 4ZUXA 1P3GD 5B2JC 4J8XC 3MNND 1P3PB 5DNND 3LELD 3REKA 2L5AA 3AV2B 3W96D 3A6NA 3AZNA 5B0YC 3AN2B 3KXBA 5C3IB 1ID3D 3AZGC 4YS3B 3AYWC 2ZM5A 3B0CW 5E5AC 5B24D 3UTAA 3MGRD 2Y2LA 2IO5B 2NZDA 1B6WA 3B0CT 5CP6A 3A1KA 3WKJA 3RELA 1P3IC 5B31D 1KX4A 2Y2GA 4J8VD 1P3PC 1M1AA 5GXQD 5GT3B 5F99A 1P3KD 2F2AC 4KHAB 3W97A 5C3IC 2YFVA 2NQBD 1BFMA 3R45B 3AZLD 1B67A 5B32A 3AZIB 4Z66B 3V9RB 4J8UA 3B0BA 5DNMB 1F66A 2FJ7C 3H0RC 2Y2JA 1EQZA 2HIOB 3B6FC 1HQ3C 3X1VA 4LD9C 5BT1C 2Y2PA 5CPKC 5CPID 5GT3C 3LZ1D 3AZJD 1TAFA 1M19B 5AV6A 1N1JB 5AVBA 3NQUA 1P34B 5B40D 4H9QA 5B2JA 4J8XA 1KX3C 3AZIC 3MVDB 5GT0D 3AZKD 4XUJD 3WTPD 1P3MD 3W98D 4KUDB 2DF4C 5B0ZC 5DNMC 4WU8B 3REJB 3AZGA 1AOIC 3AZHD 3KUYC 5E5AA 2HIOC 2F8NG 4XZQD 2JE5A 3LZ0B 5JRGD 4YM6D 4J8WB 1M19C 3MGQB 5CPJC 1P34C 1P3IA 4X23D 1P3PA 5AVCB 1HTAA 2JCHA 3TU4B 4WU9B 3AN2A 4ZUXD 3B6GC 3REJC 2F8NK 3REKD 3WAAB 3A6ND 3B0DB 1W2EA 1KX5B 5KDMB 3KXBD 5B2ID 3LZ0C 3AZMB 2FJ7A 4NE6A 3UTAD 1KU5A 4J8WC 5BNVB 3B6FA 1HQ3A 4DRAA 3MGQC 2CV5B 2NZDD 1R4VA 4LD9A 2Y2QA 5AVCC 3X1UC 5AY8C 5GT3A 3WKJD 3TU4C 3RELD 1KX4D 4KHAA 4QLCB 2Y2KA 1P3BB 1M1AD 3R45A 2PYOB 3AZIA 3B0DC 4Z5TC 3V9RA 1KX5C 2BYMB 4HGAB 5JA4B 4DRBA 5B0ZA 5B31G 5DNMA 3AZMC 3EPHA 3C1CB 1AOIA 3KUYA 5B32D 1M18B 2HIOA 1U35B 3W97C 2CV5C 3WA9C 4J8UD 5AV5B 1F66D 3KFUG 1EQZD 1M19A 1H3OA 4H9PB 3AV1B 1N1JA 3X1VD 5CPJA 2AROB 4QLCC 4JJNB 2VQRA 1P34A 3MGSB 4ZBJC 2Y2NA 1P3AC 5AV6D 5AVBD 4HGAC 3B6GA 3REJA 4KGCD 2Y2MA 5B2JD 4J8XD 5AV8B 1S32B 4DQYB 5B0YD 2DQNC 5G49B 3LZ0A 3AZGD 3AYWD 1P3GB 5E5AD 4J8WA 2J8PA 3AV1C 3MGQA 3LELB 5B1MC 3AFAB 3MGSC 3X1UA 5AVCA 3C1BC 5AY8A 2RVQC 3H0LC 3TU4A 5B24B 4WU9A 1P3ID 1P3PD 5AV8C 1S32C 4Z5TA 1KX5A 5KDMA 4EO5B 3AZMA 3AV2C 4J8VB 3AN2C 3VH5W 3REHB 4Z2MH 4YS3C 2CV5A 3WA9A 3AFAC 2FJ7D 3EPKA 3LJAD 2IO5C 3VH5T 3B6FD 1HQ3D 3A1IA 3AZLB 4LD9D 4NFTA 5BT1D 4QLCA 1P3OD 1JFIB 5CPKD 5GT3D 1P3AA 2BYMA 4EO5C 3W99B 4AWLB 3C1CA 1KX3D 3KSYA 2BG1A 3REHC 3AZJB 5B0ZD 1BH8B 4Z66C 1AOID 3KUYD 3O62D 5B40B 1ZLAB 2HIOD 2YFWB 4H9PA 4CSRB 3AV1A 5GT0B 3AZKB 4XUJB 5B1MA 1P3MB 3W98B 3MGPB 3MGSA 3X1TB 3C1BA 3UT9B 5B32G 3AZHB 3VH5A 5CPJD 3W99C 1P34D 4AWLC 4WNNA 3KWQD
chains in the Genus database with same CATH topology
1Z2CB 1TZYB 5AV9B 5AV8A 1S32A 5B33D 1BH9B 3B6GD 3MVDC 3REJD 5B1LD 3AV2A 4G92B 4X23B 5B40C 1ZLAC 4KUDC 1Q9CA 4WU8C 4YS3A 3LELA 1P3MC 3NQJB 3AFAA 3LZ0D 3MGPC 4NE3A 3X1TC 3UT9C 4NE5A 3AZND 4J8WD 3MGQD 2Y2HA 3X1UD 5AVCD 2XD5A 3AZFB 5B2IB 1TZYC 5AY8D 5AV9C 3FDDA 5CP6D 3UTAB 3REIB 2NZDB 4G92C 4WU9C 4R8PB 4CAYB 3REHA 4Z5TD 3WKJB 3RELB 3WAAC 3AZMD 1P3LB 4Z66A 1KX4B 5F99D 3AZEB 3W97D 2CV5D 3WA9D 4UUZB 1JFIA 3AZFC 5B2IC 2F8NB 2BYKB 1WWSA 2ZY3A 5B32B 3REIC 3W99A 3UTBB 4H9OB 4H9NB 4R8PC 1P3AD 1EQZB 1P3FB 1P3BC 3AZJA 4H9SA 2PYOC 1BH8A 1P3LC 3MVDA 3X1VB 3AZEC 5B40A 4UPKA 1ZLAA 4KUDA 3EPLA 3X1SB 4WU8A 3C1CC 1WWIA 3AZKA 1P3MA 1M18C 1U35C 5GSUB 5AVBB 3MGPA 3X1TA 3UT9A 5AV5C 4KGCB 5B1MD 3UTBC 3AL0C 3MGSD 4WV4B 5B0YB 3MNNB 3C1BD 5DNNB 2F8NH 1TZYA 5AV9A 2RVQD 2AROC 3AYWB 4JJNC 1P3FC 3W96B 2LY8A 2G5IC 5E5AB 1BH9A 1ID3B 2UWXA 3X1SC 5AV8D 3MGRB 1S32D 5BO0B 3NQJA 4H9RB 5GSUC 3WAAA 3AV2D 1P3IB 5CHLB 4KGCC 3EPJA 3AN2D 4WJ3C 4YS3D 3AFAD 5B31B 1P3GC 5BNVA 3MNNC 5DNNC 3AZFA 5B2IA 2CWEA 3LELC 5GXQB 3W96C 1P3KB 1ID3C 3REIA 5B24C 2NQBB 2Y2OA 2FJ7B 4R8PA 4CAYA 3LJAB 3MGRC 1P3BA 2W8SA 3B6FB 2PYOA 1HQ3B 1P3LA 4LD9B 3AZEA 1P3OB 5JA4A 3REHD 5CPKB 5B31C 4UUZA 4J8VC 3AZID 1M18A 1U35A 4Z66D 5CPIB 5GXQC 3LZ1B 2F8NA 2BYKA 5AV5A 5DNMD 1KX3B 1P3KC 3UTBA 2NQBC 5B0ZB 4H9OA 4H9NA 5BNXB 3AZLC 3LJAC 1AOIB 2AROA 3WTPB 4JJNA 3KUYB 3O62B 1P3FA 2G5HC 3W99D 1M19D 1P3OC 4E44A 3X1SA 4XZQB 5FUGB 2ZY4A 1H3OB 3MVDD 5GSUA 5JRGB 5CPIC 5CPJB 3LZ1C 2HUEB 3AZJC 1ZLAD 4KUDD 1PZRA 4H9SC 4YM6B 3KWQB 4KGCA 2RIQA 5G49A 4WU8D 1P3GA 3MGPD 3X1TD 5B33B 5B0YA 3MNNA 3UT9D 5DNNA 3B6GB 5GT0C 3AZKC 4XUJC 3W96A 5B1LB 3WTPC 3AYWA 3O62C 3W98C 4ZUXB 3VH6W 1ID3A 3AZHC 5B24A 1TZYD 5AV9D 3REKB 4XZQC 3A6NB 3MGRA 3AZNB 3VH6T 5BO0A 3P5JB 3KXBB 4H9RA 5JRGC 3IP4C 3TU4D 2HUEC 4WU9D 5BS7C 4YM6C 3KWQC 3X1UB 5AY8B 5B31A 4X23C 4J8VA 3WAAD 5CP6B 5B33C 2Y2IA 5GXQA 5B1LC 1KX5D 4Z2MG 1P3KA 4ZUXC 4Z5TB 2FFFB 3AZFD 1M1AB 2NQBA 3H0MC 3REKC 3AZLA 1A7WA 3A6NC 3LJAA 4G91B 3AZNC 1F1EA 5F99B 3KXBC 3W97B 3REID 3WA9B 2YFVB 3UTAC 1P3OA 3WTPE 4R8PD 3EG5B 5CPKA 2NZDC 4QLCD 1P3BD 1T3UA 4J8UB 2PYOD 1F66B 5CP6C 1P3LD 3VH6A 5CPIA 3AZED 3WKJC 3LZ1A 3RELC 1ULYA 4ZBJB 1KX3A 4E45A 3C1CD 1KX4C 1P3AB 1M18D 1U35D 2YFWA 1M1AC 5BNXA 4CSRA 2F8ND 1TAFB 5GT0A 4G91C 4XUJA 5AV5D 5AV6B 5F99C 3WTPA 3O62A 3W98A 3NQUB 2XD1A 3UTBD 4H9QB 3F6TA 5B2JB 4J8XB 3AZHA 5B32C 3AV1D 2AROD 2JSSA 4XZQA 5FUGA 4JJND 1P3FD 2ZY5A 4J8UC 1F66C 3AZGB 5JRGA 1EQZC 5B1MB 5BS7A 4YM6A 3X1SD 3KWQA 3X1VC 3C1BB 4X23A 5GSUD 5B33A 4M6BA 4WNNB 2ZY2A 5B1LA 5AV6C 5AVBC 4WZSB 4ZUXA 1P3GD 5B2JC 4J8XC 3MNND 1P3PB 5DNND 3LELD 3REKA 2L5AA 3AV2B 3W96D 3A6NA 3AZNA 5B0YC 3AN2B 3KXBA 5C3IB 1ID3D 3AZGC 4YS3B 3AYWC 2ZM5A 3B0CW 5E5AC 5B24D 3UTAA 3MGRD 2Y2LA 2IO5B 2NZDA 1B6WA 3B0CT 5CP6A 3A1KA 3WKJA 3RELA 1P3IC 5B31D 1KX4A 2Y2GA 4J8VD 1P3PC 1M1AA 5GXQD 5GT3B 5F99A 1P3KD 2F2AC 4KHAB 3W97A 5C3IC 2YFVA 2NQBD 1BFMA 3R45B 3AZLD 1B67A 5B32A 3AZIB 4Z66B 3V9RB 4J8UA 3B0BA 5DNMB 1F66A 2FJ7C 3H0RC 2Y2JA 1EQZA 2HIOB 3B6FC 1HQ3C 3X1VA 4LD9C 5BT1C 2Y2PA 5CPKC 5CPID 5GT3C 3LZ1D 3AZJD 1TAFA 1M19B 5AV6A 1N1JB 5AVBA 3NQUA 1P34B 5B40D 4H9QA 5B2JA 4J8XA 1KX3C 3AZIC 3MVDB 5GT0D 3AZKD 4XUJD 3WTPD 1P3MD 3W98D 4KUDB 2DF4C 5B0ZC 5DNMC 4WU8B 3REJB 3AZGA 1AOIC 3AZHD 3KUYC 5E5AA 2HIOC 2F8NG 4XZQD 2JE5A 3LZ0B 5JRGD 4YM6D 4J8WB 1M19C 3MGQB 5CPJC 1P34C 1P3IA 4X23D 1P3PA 5AVCB 1HTAA 2JCHA 3TU4B 4WU9B 3AN2A 4ZUXD 3B6GC 3REJC 2F8NK 3REKD 3WAAB 3A6ND 3B0DB 1W2EA 1KX5B 5KDMB 3KXBD 5B2ID 3LZ0C 3AZMB 2FJ7A 4NE6A 3UTAD 1KU5A 4J8WC 5BNVB 3B6FA 1HQ3A 4DRAA 3MGQC 2CV5B 2NZDD 1R4VA 4LD9A 2Y2QA 5AVCC 3X1UC 5AY8C 5GT3A 3WKJD 3TU4C 3RELD 1KX4D 4KHAA 4QLCB 2Y2KA 1P3BB 1M1AD 3R45A 2PYOB 3AZIA 3B0DC 4Z5TC 3V9RA 1KX5C 2BYMB 4HGAB 5JA4B 4DRBA 5B0ZA 5B31G 5DNMA 3AZMC 3EPHA 3C1CB 1AOIA 3KUYA 5B32D 1M18B 2HIOA 1U35B 3W97C 2CV5C 3WA9C 4J8UD 5AV5B 1F66D 3KFUG 1EQZD 1M19A 1H3OA 4H9PB 3AV1B 1N1JA 3X1VD 5CPJA 2AROB 4QLCC 4JJNB 2VQRA 1P34A 3MGSB 4ZBJC 2Y2NA 1P3AC 5AV6D 5AVBD 4HGAC 3B6GA 3REJA 4KGCD 2Y2MA 5B2JD 4J8XD 5AV8B 1S32B 4DQYB 5B0YD 2DQNC 5G49B 3LZ0A 3AZGD 3AYWD 1P3GB 5E5AD 4J8WA 2J8PA 3AV1C 3MGQA 3LELB 5B1MC 3AFAB 3MGSC 3X1UA 5AVCA 3C1BC 5AY8A 2RVQC 3H0LC 3TU4A 5B24B 4WU9A 1P3ID 1P3PD 5AV8C 1S32C 4Z5TA 1KX5A 5KDMA 4EO5B 3AZMA 3AV2C 4J8VB 3AN2C 3VH5W 3REHB 4Z2MH 4YS3C 2CV5A 3WA9A 3AFAC 2FJ7D 3EPKA 3LJAD 2IO5C 3VH5T 3B6FD 1HQ3D 3A1IA 3AZLB 4LD9D 4NFTA 5BT1D 4QLCA 1P3OD 1JFIB 5CPKD 5GT3D 1P3AA 2BYMA 4EO5C 3W99B 4AWLB 3C1CA 1KX3D 3KSYA 2BG1A 3REHC 3AZJB 5B0ZD 1BH8B 4Z66C 1AOID 3KUYD 3O62D 5B40B 1ZLAB 2HIOD 2YFWB 4H9PA 4CSRB 3AV1A 5GT0B 3AZKB 4XUJB 5B1MA 1P3MB 3W98B 3MGPB 3MGSA 3X1TB 3C1BA 3UT9B 5B32G 3AZHB 3VH5A 5CPJD 3W99C 1P34D 4AWLC 4WNNA 3KWQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY B;  5AV9 B;  5AV8 A;  1S32 A;  5B33 D;  1BH9 B;  3B6G D;  3MVD C;  3REJ D;  5B1L D;  3AV2 A;  4G92 B;  4X23 B;  5B40 C;  1ZLA C;  4KUD C;  1Q9C A;  4WU8 C;  4YS3 A;  3LEL A;  1P3M C;  3NQJ B;  3AFA A;  3LZ0 D;  3MGP C;  4NE3 A;  3X1T C;  3UT9 C;  4NE5 A;  3AZN D;  4J8W D;  3MGQ D;  3X1U D;  5AVC D;  3AZF B;  5B2I B;  1TZY C;  5AY8 D;  5AV9 C;  5CP6 D;  3UTA B;  3REI B;  2NZD B;  4G92 C;  4WU9 C;  4R8P B;  4CAY B;  3REH A;  4Z5T D;  3WKJ B;  3REL B;  3WAA C;  3AZM D;  1P3L B;  4Z66 A;  1KX4 B;  5F99 D;  3AZE B;  3W97 D;  2CV5 D;  3WA9 D;  4UUZ B;  1JFI A;  3AZF C;  5B2I C;  2F8N B;  2BYK B;  1WWS A;  5B32 B;  3REI C;  3W99 A;  3UTB B;  4H9O B;  4H9N B;  4R8P C;  1P3A D;  1EQZ B;  1P3F B;  1P3B C;  3AZJ A;  4H9S A;  2PYO C;  1BH8 A;  1P3L C;  3MVD A;  3X1V B;  3AZE C;  5B40 A;  4KUD A;  1ZLA A;  3X1S B;  4WU8 A;  3C1C C;  1WWI A;  3AZK A;  1P3M A;  1M18 C;  1U35 C;  5GSU B;  5AVB B;  3MGP A;  3X1T A;  3UT9 A;  5AV5 C;  4KGC B;  5B1M D;  3UTB C;  3MGS D;  4WV4 B;  5B0Y B;  3MNN B;  3C1B D;  5DNN B;  2F8N H;  1TZY A;  5AV9 A;  2RVQ D;  2ARO C;  3AYW B;  4JJN C;  1P3F C;  3W96 B;  2LY8 A;  5E5A B;  1BH9 A;  1ID3 B;  3X1S C;  5AV8 D;  3MGR B;  1S32 D;  5BO0 B;  3NQJ A;  4H9R B;  5GSU C;  3WAA A;  3AV2 D;  1P3I B;  5CHL B;  4KGC C;  3AN2 D;  4YS3 D;  3AFA D;  5B31 B;  1P3G C;  5BNV A;  3MNN C;  5DNN C;  3AZF A;  5B2I A;  2CWE A;  3LEL C;  5GXQ B;  3W96 C;  1P3K B;  1ID3 C;  3REI A;  5B24 C;  2NQB B;  2FJ7 B;  4R8P A;  4CAY A;  3LJA B;  3MGR C;  1P3B A;  3B6F B;  2PYO A;  1HQ3 B;  1P3L A;  4LD9 B;  3AZE A;  1P3O B;  5JA4 A;  3REH D;  5CPK B;  5B31 C;  4UUZ A;  4J8V C;  3AZI D;  1M18 A;  1U35 A;  4Z66 D;  5CPI B;  5GXQ C;  3LZ1 B;  2F8N A;  2BYK A;  5AV5 A;  5DNM D;  1KX3 B;  1P3K C;  3UTB A;  2NQB C;  5B0Z B;  4H9O A;  4H9N A;  5BNX B;  3AZL C;  3LJA C;  1AOI B;  2ARO A;  3WTP B;  4JJN A;  3KUY B;  3O62 B;  1P3F A;  3W99 D;  1M19 D;  1P3O C;  4E44 A;  3X1S A;  4XZQ B;  5FUG B;  1H3O B;  3MVD D;  5GSU A;  5JRG B;  5CPI C;  5CPJ B;  3LZ1 C;  2HUE B;  3AZJ C;  1ZLA D;  4KUD D;  4YM6 B;  4H9S C;  3KWQ B;  4KGC A;  5G49 A;  4WU8 D;  1P3G A;  3MGP D;  3X1T D;  5B33 B;  5B0Y A;  3MNN A;  3UT9 D;  5DNN A;  3B6G B;  5GT0 C;  3AZK C;  4XUJ C;  3W96 A;  5B1L B;  3WTP C;  3AYW A;  3O62 C;  3W98 C;  4ZUX B;  3VH6 W;  1ID3 A;  3AZH C;  5B24 A;  1TZY D;  5AV9 D;  3REK B;  4XZQ C;  3A6N B;  3MGR A;  3AZN B;  3VH6 T;  5BO0 A;  3KXB B;  4H9R A;  5JRG C;  3TU4 D;  2HUE C;  4WU9 D;  5BS7 C;  4YM6 C;  3KWQ C;  3X1U B;  5AY8 B;  5B31 A;  4X23 C;  4J8V A;  3WAA D;  5CP6 B;  5B33 C;  5GXQ A;  5B1L C;  1KX5 D;  4Z2M G;  1P3K A;  4ZUX C;  4Z5T B;  3AZF D;  1M1A B;  2NQB A;  3REK C;  3AZL A;  1A7W A;  3A6N C;  3LJA A;  4G91 B;  3AZN C;  1F1E A;  5F99 B;  3KXB C;  3W97 B;  3REI D;  3WA9 B;  2YFV B;  3UTA C;  1P3O A;  3WTP E;  4R8P D;  5CPK A;  2NZD C;  4QLC D;  1P3B D;  4J8U B;  2PYO D;  1F66 B;  5CP6 C;  1P3L D;  3VH6 A;  5CPI A;  3AZE D;  3WKJ C;  3LZ1 A;  3REL C;  1ULY A;  4ZBJ B;  1KX3 A;  4E45 A;  3C1C D;  1KX4 C;  1P3A B;  1M18 D;  1U35 D;  2YFW A;  1M1A C;  5BNX A;  4CSR A;  2F8N D;  1TAF B;  5GT0 A;  4G91 C;  4XUJ A;  5AV5 D;  5AV6 B;  5F99 C;  3WTP A;  3O62 A;  3W98 A;  3NQU B;  3UTB D;  4H9Q B;  5B2J B;  4J8X B;  3AZH A;  3AV1 D;  5B32 C;  2ARO D;  2JSS A;  4XZQ A;  5FUG A;  4JJN D;  1P3F D;  4J8U C;  1F66 C;  3AZG B;  5JRG A;  1EQZ C;  5B1M B;  5BS7 A;  4YM6 A;  3X1S D;  3KWQ A;  3X1V C;  3C1B B;  4X23 A;  5GSU D;  5B33 A;  4M6B A;  4WNN B;  5B1L A;  5AV6 C;  5AVB C;  4WZS B;  4ZUX A;  1P3G D;  5B2J C;  4J8X C;  3MNN D;  1P3P B;  5DNN D;  3LEL D;  3REK A;  2L5A A;  3AV2 B;  3W96 D;  3A6N A;  3AZN A;  5B0Y C;  3AN2 B;  3KXB A;  5C3I B;  1ID3 D;  3AZG C;  4YS3 B;  3AYW C;  3B0C W;  5E5A C;  5B24 D;  3UTA A;  3MGR D;  2NZD A;  2IO5 B;  1B6W A;  3B0C T;  5CP6 A;  3WKJ A;  3REL A;  1P3I C;  5B31 D;  1KX4 A;  4J8V D;  1P3P C;  1M1A A;  5GXQ D;  5GT3 B;  5F99 A;  1P3K D;  3W97 A;  4KHA B;  5C3I C;  2YFV A;  2NQB D;  1BFM A;  3R45 B;  3AZL D;  1B67 A;  5B32 A;  3AZI B;  4Z66 B;  3V9R B;  4J8U A;  3B0B A;  5DNM B;  1F66 A;  2FJ7 C;  1EQZ A;  2HIO B;  3B6F C;  1HQ3 C;  3X1V A;  4LD9 C;  5BT1 C;  5CPK C;  5CPI D;  5GT3 C;  3LZ1 D;  3AZJ D;  1TAF A;  1M19 B;  5AV6 A;  1N1J B;  5AVB A;  3NQU A;  1P34 B;  5B40 D;  4H9Q A;  5B2J A;  4J8X A;  1KX3 C;  3AZI C;  3MVD B;  5GT0 D;  3AZK D;  4XUJ D;  3WTP D;  1P3M D;  3W98 D;  4KUD B;  5B0Z C;  5DNM C;  4WU8 B;  3REJ B;  3AZG A;  1AOI C;  3AZH D;  3KUY C;  5E5A A;  2HIO C;  2F8N G;  4XZQ D;  3LZ0 B;  5JRG D;  4YM6 D;  4J8W B;  1M19 C;  3MGQ B;  5CPJ C;  1P34 C;  1P3I A;  4X23 D;  1P3P A;  5AVC B;  1HTA A;  3TU4 B;  4WU9 B;  3AN2 A;  4ZUX D;  3B6G C;  3REJ C;  2F8N K;  3REK D;  3WAA B;  3A6N D;  3B0D B;  1KX5 B;  5KDM B;  3KXB D;  5B2I D;  3LZ0 C;  3AZM B;  2FJ7 A;  4NE6 A;  3UTA D;  1KU5 A;  4J8W C;  5BNV B;  3B6F A;  1HQ3 A;  4DRA A;  3MGQ C;  2CV5 B;  2NZD D;  1R4V A;  4LD9 A;  3X1U C;  5AVC C;  5AY8 C;  5GT3 A;  3WKJ D;  3TU4 C;  3REL D;  1KX4 D;  4KHA A;  4QLC B;  1P3B B;  1M1A D;  3R45 A;  2PYO B;  3AZI A;  3B0D C;  4Z5T C;  3V9R A;  1KX5 C;  2BYM B;  4HGA B;  5JA4 B;  4DRB A;  5B0Z A;  5B31 G;  5DNM A;  3AZM C;  3C1C B;  1AOI A;  3KUY A;  5B32 D;  1M18 B;  2HIO A;  1U35 B;  3W97 C;  2CV5 C;  3WA9 C;  4J8U D;  5AV5 B;  1F66 D;  1EQZ D;  1M19 A;  1H3O A;  4H9P B;  3AV1 B;  1N1J A;  3X1V D;  5CPJ A;  2ARO B;  4QLC C;  4JJN B;  1P34 A;  3MGS B;  4ZBJ C;  1P3A C;  5AV6 D;  5AVB D;  4HGA C;  3B6G A;  3REJ A;  4KGC D;  5B2J D;  4J8X D;  5AV8 B;  1S32 B;  5B0Y D;  5G49 B;  3LZ0 A;  3AZG D;  3AYW D;  1P3G B;  5E5A D;  4J8W A;  3AV1 C;  3MGQ A;  3LEL B;  5B1M C;  3AFA B;  3MGS C;  3X1U A;  5AVC A;  3C1B C;  5AY8 A;  2RVQ C;  3TU4 A;  5B24 B;  4WU9 A;  1P3I D;  1P3P D;  5AV8 C;  1S32 C;  4Z5T A;  1KX5 A;  5KDM A;  4EO5 B;  3AZM A;  3AV2 C;  4J8V B;  3AN2 C;  3VH5 W;  3REH B;  4Z2M H;  4YS3 C;  2CV5 A;  3WA9 A;  3AFA C;  2FJ7 D;  3LJA D;  2IO5 C;  3VH5 T;  3B6F D;  1HQ3 D;  3AZL B;  4LD9 D;  4NFT A;  5BT1 D;  4QLC A;  1P3O D;  1JFI B;  5CPK D;  5GT3 D;  1P3A A;  2BYM A;  4EO5 C;  3W99 B;  4AWL B;  3C1C A;  1KX3 D;  3KSY A;  3REH C;  3AZJ B;  5B0Z D;  1BH8 B;  4Z66 C;  1AOI D;  3KUY D;  3O62 D;  5B40 B;  1ZLA B;  2HIO D;  2YFW B;  4H9P A;  4CSR B;  3AV1 A;  5GT0 B;  3AZK B;  4XUJ B;  5B1M A;  1P3M B;  3W98 B;  3MGP B;  3MGS A;  3X1T B;  3C1B A;  3UT9 B;  5B32 G;  3AZH B;  3VH5 A;  5CPJ D;  3W99 C;  1P34 D;  4AWL C;  4WNN A;  3KWQ D; 
#chains in the Genus database with same CATH topology
 1Z2C B;  1TZY B;  5AV9 B;  5AV8 A;  1S32 A;  5B33 D;  1BH9 B;  3B6G D;  3MVD C;  3REJ D;  5B1L D;  3AV2 A;  4G92 B;  4X23 B;  5B40 C;  1ZLA C;  4KUD C;  1Q9C A;  4WU8 C;  4YS3 A;  3LEL A;  1P3M C;  3NQJ B;  3AFA A;  3LZ0 D;  3MGP C;  4NE3 A;  3X1T C;  3UT9 C;  4NE5 A;  3AZN D;  4J8W D;  3MGQ D;  2Y2H A;  3X1U D;  5AVC D;  2XD5 A;  3AZF B;  5B2I B;  1TZY C;  5AY8 D;  5AV9 C;  3FDD A;  5CP6 D;  3UTA B;  3REI B;  2NZD B;  4G92 C;  4WU9 C;  4R8P B;  4CAY B;  3REH A;  4Z5T D;  3WKJ B;  3REL B;  3WAA C;  3AZM D;  1P3L B;  4Z66 A;  1KX4 B;  5F99 D;  3AZE B;  3W97 D;  2CV5 D;  3WA9 D;  4UUZ B;  1JFI A;  3AZF C;  5B2I C;  2F8N B;  2BYK B;  1WWS A;  2ZY3 A;  5B32 B;  3REI C;  3W99 A;  3UTB B;  4H9O B;  4H9N B;  4R8P C;  1P3A D;  1EQZ B;  1P3F B;  1P3B C;  3AZJ A;  4H9S A;  2PYO C;  1BH8 A;  1P3L C;  3MVD A;  3X1V B;  3AZE C;  5B40 A;  4UPK A;  1ZLA A;  4KUD A;  3EPL A;  3X1S B;  4WU8 A;  3C1C C;  1WWI A;  3AZK A;  1P3M A;  1M18 C;  1U35 C;  5GSU B;  5AVB B;  3MGP A;  3X1T A;  3UT9 A;  5AV5 C;  4KGC B;  5B1M D;  3UTB C;  3AL0 C;  3MGS D;  4WV4 B;  5B0Y B;  3MNN B;  3C1B D;  5DNN B;  2F8N H;  1TZY A;  5AV9 A;  2RVQ D;  2ARO C;  3AYW B;  4JJN C;  1P3F C;  3W96 B;  2LY8 A;  2G5I C;  5E5A B;  1BH9 A;  1ID3 B;  2UWX A;  3X1S C;  5AV8 D;  3MGR B;  1S32 D;  5BO0 B;  3NQJ A;  4H9R B;  5GSU C;  3WAA A;  3AV2 D;  1P3I B;  5CHL B;  4KGC C;  3EPJ A;  3AN2 D;  4WJ3 C;  4YS3 D;  3AFA D;  5B31 B;  1P3G C;  5BNV A;  3MNN C;  5DNN C;  3AZF A;  5B2I A;  2CWE A;  3LEL C;  5GXQ B;  3W96 C;  1P3K B;  1ID3 C;  3REI A;  5B24 C;  2NQB B;  2Y2O A;  2FJ7 B;  4R8P A;  4CAY A;  3LJA B;  3MGR C;  1P3B A;  2W8S A;  3B6F B;  2PYO A;  1HQ3 B;  1P3L A;  4LD9 B;  3AZE A;  1P3O B;  5JA4 A;  3REH D;  5CPK B;  5B31 C;  4UUZ A;  4J8V C;  3AZI D;  1M18 A;  1U35 A;  4Z66 D;  5CPI B;  5GXQ C;  3LZ1 B;  2F8N A;  2BYK A;  5AV5 A;  5DNM D;  1KX3 B;  1P3K C;  3UTB A;  2NQB C;  5B0Z B;  4H9O A;  4H9N A;  5BNX B;  3AZL C;  3LJA C;  1AOI B;  2ARO A;  3WTP B;  4JJN A;  3KUY B;  3O62 B;  1P3F A;  2G5H C;  3W99 D;  1M19 D;  1P3O C;  4E44 A;  3X1S A;  4XZQ B;  5FUG B;  2ZY4 A;  1H3O B;  3MVD D;  5GSU A;  5JRG B;  5CPI C;  5CPJ B;  3LZ1 C;  2HUE B;  3AZJ C;  1ZLA D;  4KUD D;  1PZR A;  4H9S C;  4YM6 B;  3KWQ B;  4KGC A;  2RIQ A;  5G49 A;  4WU8 D;  1P3G A;  3MGP D;  3X1T D;  5B33 B;  5B0Y A;  3MNN A;  3UT9 D;  5DNN A;  3B6G B;  5GT0 C;  3AZK C;  4XUJ C;  3W96 A;  5B1L B;  3WTP C;  3AYW A;  3O62 C;  3W98 C;  4ZUX B;  3VH6 W;  1ID3 A;  3AZH C;  5B24 A;  1TZY D;  5AV9 D;  3REK B;  4XZQ C;  3A6N B;  3MGR A;  3AZN B;  3VH6 T;  5BO0 A;  3P5J B;  3KXB B;  4H9R A;  5JRG C;  3IP4 C;  3TU4 D;  2HUE C;  4WU9 D;  5BS7 C;  4YM6 C;  3KWQ C;  3X1U B;  5AY8 B;  5B31 A;  4X23 C;  4J8V A;  3WAA D;  5CP6 B;  5B33 C;  2Y2I A;  5GXQ A;  5B1L C;  1KX5 D;  4Z2M G;  1P3K A;  4ZUX C;  4Z5T B;  2FFF B;  3AZF D;  1M1A B;  2NQB A;  3H0M C;  3REK C;  3AZL A;  1A7W A;  3A6N C;  3LJA A;  4G91 B;  3AZN C;  1F1E A;  5F99 B;  3KXB C;  3W97 B;  3REI D;  3WA9 B;  2YFV B;  3UTA C;  1P3O A;  3WTP E;  4R8P D;  3EG5 B;  5CPK A;  2NZD C;  4QLC D;  1P3B D;  1T3U A;  4J8U B;  2PYO D;  1F66 B;  5CP6 C;  1P3L D;  3VH6 A;  5CPI A;  3AZE D;  3WKJ C;  3LZ1 A;  3REL C;  1ULY A;  4ZBJ B;  1KX3 A;  4E45 A;  3C1C D;  1KX4 C;  1P3A B;  1M18 D;  1U35 D;  2YFW A;  1M1A C;  5BNX A;  4CSR A;  2F8N D;  1TAF B;  5GT0 A;  4G91 C;  4XUJ A;  5AV5 D;  5AV6 B;  5F99 C;  3WTP A;  3O62 A;  3W98 A;  3NQU B;  2XD1 A;  3UTB D;  4H9Q B;  3F6T A;  5B2J B;  4J8X B;  3AZH A;  5B32 C;  3AV1 D;  2ARO D;  2JSS A;  4XZQ A;  5FUG A;  4JJN D;  1P3F D;  2ZY5 A;  4J8U C;  1F66 C;  3AZG B;  5JRG A;  1EQZ C;  5B1M B;  5BS7 A;  4YM6 A;  3X1S D;  3KWQ A;  3X1V C;  3C1B B;  4X23 A;  5GSU D;  5B33 A;  4M6B A;  4WNN B;  2ZY2 A;  5B1L A;  5AV6 C;  5AVB C;  4WZS B;  4ZUX A;  1P3G D;  5B2J C;  4J8X C;  3MNN D;  1P3P B;  5DNN D;  3LEL D;  3REK A;  2L5A A;  3AV2 B;  3W96 D;  3A6N A;  3AZN A;  5B0Y C;  3AN2 B;  3KXB A;  5C3I B;  1ID3 D;  3AZG C;  4YS3 B;  3AYW C;  2ZM5 A;  3B0C W;  5E5A C;  5B24 D;  3UTA A;  3MGR D;  2Y2L A;  2IO5 B;  2NZD A;  1B6W A;  3B0C T;  5CP6 A;  3A1K A;  3WKJ A;  3REL A;  1P3I C;  5B31 D;  1KX4 A;  2Y2G A;  4J8V D;  1P3P C;  1M1A A;  5GXQ D;  5GT3 B;  5F99 A;  1P3K D;  2F2A C;  4KHA B;  3W97 A;  5C3I C;  2YFV A;  2NQB D;  1BFM A;  3R45 B;  3AZL D;  1B67 A;  5B32 A;  3AZI B;  4Z66 B;  3V9R B;  4J8U A;  3B0B A;  5DNM B;  1F66 A;  2FJ7 C;  3H0R C;  2Y2J A;  1EQZ A;  2HIO B;  3B6F C;  1HQ3 C;  3X1V A;  4LD9 C;  5BT1 C;  2Y2P A;  5CPK C;  5CPI D;  5GT3 C;  3LZ1 D;  3AZJ D;  1TAF A;  1M19 B;  5AV6 A;  1N1J B;  5AVB A;  3NQU A;  1P34 B;  5B40 D;  4H9Q A;  5B2J A;  4J8X A;  1KX3 C;  3AZI C;  3MVD B;  5GT0 D;  3AZK D;  4XUJ D;  3WTP D;  1P3M D;  3W98 D;  4KUD B;  2DF4 C;  5B0Z C;  5DNM C;  4WU8 B;  3REJ B;  3AZG A;  1AOI C;  3AZH D;  3KUY C;  5E5A A;  2HIO C;  2F8N G;  4XZQ D;  2JE5 A;  3LZ0 B;  5JRG D;  4YM6 D;  4J8W B;  1M19 C;  3MGQ B;  5CPJ C;  1P34 C;  1P3I A;  4X23 D;  1P3P A;  5AVC B;  1HTA A;  2JCH A;  3TU4 B;  4WU9 B;  3AN2 A;  4ZUX D;  3B6G C;  3REJ C;  2F8N K;  3REK D;  3WAA B;  3A6N D;  3B0D B;  1W2E A;  1KX5 B;  5KDM B;  3KXB D;  5B2I D;  3LZ0 C;  3AZM B;  2FJ7 A;  4NE6 A;  3UTA D;  1KU5 A;  4J8W C;  5BNV B;  3B6F A;  1HQ3 A;  4DRA A;  3MGQ C;  2CV5 B;  2NZD D;  1R4V A;  4LD9 A;  2Y2Q A;  5AVC C;  3X1U C;  5AY8 C;  5GT3 A;  3WKJ D;  3TU4 C;  3REL D;  1KX4 D;  4KHA A;  4QLC B;  2Y2K A;  1P3B B;  1M1A D;  3R45 A;  2PYO B;  3AZI A;  3B0D C;  4Z5T C;  3V9R A;  1KX5 C;  2BYM B;  4HGA B;  5JA4 B;  4DRB A;  5B0Z A;  5B31 G;  5DNM A;  3AZM C;  3EPH A;  3C1C B;  1AOI A;  3KUY A;  5B32 D;  1M18 B;  2HIO A;  1U35 B;  3W97 C;  2CV5 C;  3WA9 C;  4J8U D;  5AV5 B;  1F66 D;  3KFU G;  1EQZ D;  1M19 A;  1H3O A;  4H9P B;  3AV1 B;  1N1J A;  3X1V D;  5CPJ A;  2ARO B;  4QLC C;  4JJN B;  2VQR A;  1P34 A;  3MGS B;  4ZBJ C;  2Y2N A;  1P3A C;  5AV6 D;  5AVB D;  4HGA C;  3B6G A;  3REJ A;  4KGC D;  2Y2M A;  5B2J D;  4J8X D;  5AV8 B;  1S32 B;  4DQY B;  5B0Y D;  2DQN C;  5G49 B;  3LZ0 A;  3AZG D;  3AYW D;  1P3G B;  5E5A D;  4J8W A;  2J8P A;  3AV1 C;  3MGQ A;  3LEL B;  5B1M C;  3AFA B;  3MGS C;  3X1U A;  5AVC A;  3C1B C;  5AY8 A;  2RVQ C;  3H0L C;  3TU4 A;  5B24 B;  4WU9 A;  1P3I D;  1P3P D;  5AV8 C;  1S32 C;  4Z5T A;  1KX5 A;  5KDM A;  4EO5 B;  3AZM A;  3AV2 C;  4J8V B;  3AN2 C;  3VH5 W;  3REH B;  4Z2M H;  4YS3 C;  2CV5 A;  3WA9 A;  3AFA C;  2FJ7 D;  3EPK A;  3LJA D;  2IO5 C;  3VH5 T;  3B6F D;  1HQ3 D;  3A1I A;  3AZL B;  4LD9 D;  4NFT A;  5BT1 D;  4QLC A;  1P3O D;  1JFI B;  5CPK D;  5GT3 D;  1P3A A;  2BYM A;  4EO5 C;  3W99 B;  4AWL B;  3C1C A;  1KX3 D;  3KSY A;  2BG1 A;  3REH C;  3AZJ B;  5B0Z D;  1BH8 B;  4Z66 C;  1AOI D;  3KUY D;  3O62 D;  5B40 B;  1ZLA B;  2HIO D;  2YFW B;  4H9P A;  4CSR B;  3AV1 A;  5GT0 B;  3AZK B;  4XUJ B;  5B1M A;  1P3M B;  3W98 B;  3MGP B;  3MGS A;  3X1T B;  3C1B A;  3UT9 B;  5B32 G;  3AZH B;  3VH5 A;  5CPJ D;  3W99 C;  1P34 D;  4AWL C;  4WNN A;  3KWQ D; 
#chains in the Genus database with same CATH homology
 1Z2C B;  1TZY B;  5AV9 B;  5AV8 A;  1S32 A;  5B33 D;  1BH9 B;  3B6G D;  3MVD C;  3REJ D;  5B1L D;  3AV2 A;  4G92 B;  4X23 B;  5B40 C;  1ZLA C;  4KUD C;  1Q9C A;  4WU8 C;  4YS3 A;  3LEL A;  1P3M C;  3NQJ B;  3AFA A;  3LZ0 D;  3MGP C;  4NE3 A;  3X1T C;  3UT9 C;  4NE5 A;  3AZN D;  4J8W D;  3MGQ D;  2Y2H A;  3X1U D;  5AVC D;  2XD5 A;  3AZF B;  5B2I B;  1TZY C;  5AY8 D;  5AV9 C;  3FDD A;  5CP6 D;  3UTA B;  3REI B;  2NZD B;  4G92 C;  4WU9 C;  4R8P B;  4CAY B;  3REH A;  4Z5T D;  3WKJ B;  3REL B;  3WAA C;  3AZM D;  1P3L B;  4Z66 A;  1KX4 B;  5F99 D;  3AZE B;  3W97 D;  2CV5 D;  3WA9 D;  4UUZ B;  1JFI A;  3AZF C;  5B2I C;  2F8N B;  2BYK B;  1WWS A;  2ZY3 A;  5B32 B;  3REI C;  3W99 A;  3UTB B;  4H9O B;  4H9N B;  4R8P C;  1P3A D;  1EQZ B;  1P3F B;  1P3B C;  3AZJ A;  4H9S A;  2PYO C;  1BH8 A;  1P3L C;  3MVD A;  3X1V B;  3AZE C;  5B40 A;  4UPK A;  1ZLA A;  4KUD A;  3EPL A;  3X1S B;  4WU8 A;  3C1C C;  1WWI A;  3AZK A;  1P3M A;  1M18 C;  1U35 C;  5GSU B;  5AVB B;  3MGP A;  3X1T A;  3UT9 A;  5AV5 C;  4KGC B;  5B1M D;  3UTB C;  3AL0 C;  3MGS D;  4WV4 B;  5B0Y B;  3MNN B;  3C1B D;  5DNN B;  2F8N H;  1TZY A;  5AV9 A;  2RVQ D;  2ARO C;  3AYW B;  4JJN C;  1P3F C;  3W96 B;  2LY8 A;  2G5I C;  5E5A B;  1BH9 A;  1ID3 B;  2UWX A;  3X1S C;  5AV8 D;  3MGR B;  1S32 D;  5BO0 B;  3NQJ A;  4H9R B;  5GSU C;  3WAA A;  3AV2 D;  1P3I B;  5CHL B;  4KGC C;  3EPJ A;  3AN2 D;  4WJ3 C;  4YS3 D;  3AFA D;  5B31 B;  1P3G C;  5BNV A;  3MNN C;  5DNN C;  3AZF A;  5B2I A;  2CWE A;  3LEL C;  5GXQ B;  3W96 C;  1P3K B;  1ID3 C;  3REI A;  5B24 C;  2NQB B;  2Y2O A;  2FJ7 B;  4R8P A;  4CAY A;  3LJA B;  3MGR C;  1P3B A;  2W8S A;  3B6F B;  2PYO A;  1HQ3 B;  1P3L A;  4LD9 B;  3AZE A;  1P3O B;  5JA4 A;  3REH D;  5CPK B;  5B31 C;  4UUZ A;  4J8V C;  3AZI D;  1M18 A;  1U35 A;  4Z66 D;  5CPI B;  5GXQ C;  3LZ1 B;  2F8N A;  2BYK A;  5AV5 A;  5DNM D;  1KX3 B;  1P3K C;  3UTB A;  2NQB C;  5B0Z B;  4H9O A;  4H9N A;  5BNX B;  3AZL C;  3LJA C;  1AOI B;  2ARO A;  3WTP B;  4JJN A;  3KUY B;  3O62 B;  1P3F A;  2G5H C;  3W99 D;  1M19 D;  1P3O C;  4E44 A;  3X1S A;  4XZQ B;  5FUG B;  2ZY4 A;  1H3O B;  3MVD D;  5GSU A;  5JRG B;  5CPI C;  5CPJ B;  3LZ1 C;  2HUE B;  3AZJ C;  1ZLA D;  4KUD D;  1PZR A;  4H9S C;  4YM6 B;  3KWQ B;  4KGC A;  2RIQ A;  5G49 A;  4WU8 D;  1P3G A;  3MGP D;  3X1T D;  5B33 B;  5B0Y A;  3MNN A;  3UT9 D;  5DNN A;  3B6G B;  5GT0 C;  3AZK C;  4XUJ C;  3W96 A;  5B1L B;  3WTP C;  3AYW A;  3O62 C;  3W98 C;  4ZUX B;  3VH6 W;  1ID3 A;  3AZH C;  5B24 A;  1TZY D;  5AV9 D;  3REK B;  4XZQ C;  3A6N B;  3MGR A;  3AZN B;  3VH6 T;  5BO0 A;  3P5J B;  3KXB B;  4H9R A;  5JRG C;  3IP4 C;  3TU4 D;  2HUE C;  4WU9 D;  5BS7 C;  4YM6 C;  3KWQ C;  3X1U B;  5AY8 B;  5B31 A;  4X23 C;  4J8V A;  3WAA D;  5CP6 B;  5B33 C;  2Y2I A;  5GXQ A;  5B1L C;  1KX5 D;  4Z2M G;  1P3K A;  4ZUX C;  4Z5T B;  2FFF B;  3AZF D;  1M1A B;  2NQB A;  3H0M C;  3REK C;  3AZL A;  1A7W A;  3A6N C;  3LJA A;  4G91 B;  3AZN C;  1F1E A;  5F99 B;  3KXB C;  3W97 B;  3REI D;  3WA9 B;  2YFV B;  3UTA C;  1P3O A;  3WTP E;  4R8P D;  3EG5 B;  5CPK A;  2NZD C;  4QLC D;  1P3B D;  1T3U A;  4J8U B;  2PYO D;  1F66 B;  5CP6 C;  1P3L D;  3VH6 A;  5CPI A;  3AZE D;  3WKJ C;  3LZ1 A;  3REL C;  1ULY A;  4ZBJ B;  1KX3 A;  4E45 A;  3C1C D;  1KX4 C;  1P3A B;  1M18 D;  1U35 D;  2YFW A;  1M1A C;  5BNX A;  4CSR A;  2F8N D;  1TAF B;  5GT0 A;  4G91 C;  4XUJ A;  5AV5 D;  5AV6 B;  5F99 C;  3WTP A;  3O62 A;  3W98 A;  3NQU B;  2XD1 A;  3UTB D;  4H9Q B;  3F6T A;  5B2J B;  4J8X B;  3AZH A;  5B32 C;  3AV1 D;  2ARO D;  2JSS A;  4XZQ A;  5FUG A;  4JJN D;  1P3F D;  2ZY5 A;  4J8U C;  1F66 C;  3AZG B;  5JRG A;  1EQZ C;  5B1M B;  5BS7 A;  4YM6 A;  3X1S D;  3KWQ A;  3X1V C;  3C1B B;  4X23 A;  5GSU D;  5B33 A;  4M6B A;  4WNN B;  2ZY2 A;  5B1L A;  5AV6 C;  5AVB C;  4WZS B;  4ZUX A;  1P3G D;  5B2J C;  4J8X C;  3MNN D;  1P3P B;  5DNN D;  3LEL D;  3REK A;  2L5A A;  3AV2 B;  3W96 D;  3A6N A;  3AZN A;  5B0Y C;  3AN2 B;  3KXB A;  5C3I B;  1ID3 D;  3AZG C;  4YS3 B;  3AYW C;  2ZM5 A;  3B0C W;  5E5A C;  5B24 D;  3UTA A;  3MGR D;  2Y2L A;  2IO5 B;  2NZD A;  1B6W A;  3B0C T;  5CP6 A;  3A1K A;  3WKJ A;  3REL A;  1P3I C;  5B31 D;  1KX4 A;  2Y2G A;  4J8V D;  1P3P C;  1M1A A;  5GXQ D;  5GT3 B;  5F99 A;  1P3K D;  2F2A C;  4KHA B;  3W97 A;  5C3I C;  2YFV A;  2NQB D;  1BFM A;  3R45 B;  3AZL D;  1B67 A;  5B32 A;  3AZI B;  4Z66 B;  3V9R B;  4J8U A;  3B0B A;  5DNM B;  1F66 A;  2FJ7 C;  3H0R C;  2Y2J A;  1EQZ A;  2HIO B;  3B6F C;  1HQ3 C;  3X1V A;  4LD9 C;  5BT1 C;  2Y2P A;  5CPK C;  5CPI D;  5GT3 C;  3LZ1 D;  3AZJ D;  1TAF A;  1M19 B;  5AV6 A;  1N1J B;  5AVB A;  3NQU A;  1P34 B;  5B40 D;  4H9Q A;  5B2J A;  4J8X A;  1KX3 C;  3AZI C;  3MVD B;  5GT0 D;  3AZK D;  4XUJ D;  3WTP D;  1P3M D;  3W98 D;  4KUD B;  2DF4 C;  5B0Z C;  5DNM C;  4WU8 B;  3REJ B;  3AZG A;  1AOI C;  3AZH D;  3KUY C;  5E5A A;  2HIO C;  2F8N G;  4XZQ D;  2JE5 A;  3LZ0 B;  5JRG D;  4YM6 D;  4J8W B;  1M19 C;  3MGQ B;  5CPJ C;  1P34 C;  1P3I A;  4X23 D;  1P3P A;  5AVC B;  1HTA A;  2JCH A;  3TU4 B;  4WU9 B;  3AN2 A;  4ZUX D;  3B6G C;  3REJ C;  2F8N K;  3REK D;  3WAA B;  3A6N D;  3B0D B;  1W2E A;  1KX5 B;  5KDM B;  3KXB D;  5B2I D;  3LZ0 C;  3AZM B;  2FJ7 A;  4NE6 A;  3UTA D;  1KU5 A;  4J8W C;  5BNV B;  3B6F A;  1HQ3 A;  4DRA A;  3MGQ C;  2CV5 B;  2NZD D;  1R4V A;  4LD9 A;  2Y2Q A;  5AVC C;  3X1U C;  5AY8 C;  5GT3 A;  3WKJ D;  3TU4 C;  3REL D;  1KX4 D;  4KHA A;  4QLC B;  2Y2K A;  1P3B B;  1M1A D;  3R45 A;  2PYO B;  3AZI A;  3B0D C;  4Z5T C;  3V9R A;  1KX5 C;  2BYM B;  4HGA B;  5JA4 B;  4DRB A;  5B0Z A;  5B31 G;  5DNM A;  3AZM C;  3EPH A;  3C1C B;  1AOI A;  3KUY A;  5B32 D;  1M18 B;  2HIO A;  1U35 B;  3W97 C;  2CV5 C;  3WA9 C;  4J8U D;  5AV5 B;  1F66 D;  3KFU G;  1EQZ D;  1M19 A;  1H3O A;  4H9P B;  3AV1 B;  1N1J A;  3X1V D;  5CPJ A;  2ARO B;  4QLC C;  4JJN B;  2VQR A;  1P34 A;  3MGS B;  4ZBJ C;  2Y2N A;  1P3A C;  5AV6 D;  5AVB D;  4HGA C;  3B6G A;  3REJ A;  4KGC D;  2Y2M A;  5B2J D;  4J8X D;  5AV8 B;  1S32 B;  4DQY B;  5B0Y D;  2DQN C;  5G49 B;  3LZ0 A;  3AZG D;  3AYW D;  1P3G B;  5E5A D;  4J8W A;  2J8P A;  3AV1 C;  3MGQ A;  3LEL B;  5B1M C;  3AFA B;  3MGS C;  3X1U A;  5AVC A;  3C1B C;  5AY8 A;  2RVQ C;  3H0L C;  3TU4 A;  5B24 B;  4WU9 A;  1P3I D;  1P3P D;  5AV8 C;  1S32 C;  4Z5T A;  1KX5 A;  5KDM A;  4EO5 B;  3AZM A;  3AV2 C;  4J8V B;  3AN2 C;  3VH5 W;  3REH B;  4Z2M H;  4YS3 C;  2CV5 A;  3WA9 A;  3AFA C;  2FJ7 D;  3EPK A;  3LJA D;  2IO5 C;  3VH5 T;  3B6F D;  1HQ3 D;  3A1I A;  3AZL B;  4LD9 D;  4NFT A;  5BT1 D;  4QLC A;  1P3O D;  1JFI B;  5CPK D;  5GT3 D;  1P3A A;  2BYM A;  4EO5 C;  3W99 B;  4AWL B;  3C1C A;  1KX3 D;  3KSY A;  2BG1 A;  3REH C;  3AZJ B;  5B0Z D;  1BH8 B;  4Z66 C;  1AOI D;  3KUY D;  3O62 D;  5B40 B;  1ZLA B;  2HIO D;  2YFW B;  4H9P A;  4CSR B;  3AV1 A;  5GT0 B;  3AZK B;  4XUJ B;  5B1M A;  1P3M B;  3W98 B;  3MGP B;  3MGS A;  3X1T B;  3C1B A;  3UT9 B;  5B32 G;  3AZH B;  3VH5 A;  5CPJ D;  3W99 C;  1P34 D;  4AWL C;  4WNN A;  3KWQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...