1KX5A

X-ray structure of the nucleosome core particle, ncp147, at 1.9 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 135
sequence length 135
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx5A00
4H9PA 5B0ZB 5B1LB 5AV9C 4Z5TD 2YFWA 4J8VA 4JJND 1P34A 3AZNA 3AZLD 5B1MB 1BFMA 2NZDB 5JA4A 3W99C 4X23D 4WU8D 1P3ID 5AV6A 3VH5T 1F66A 4UUZB 3B6GB 1TZYB 5B0ZD 5B1LD 5CPIB 5G49B 5B1MD 3MVDA 4H9RA 3MGQB 1S32B 5B32D 1EQZC 1P3AB 5B24A 4NE5A 1ID3B 5KDMA 3NQUA 5B33C 5AVCA 1U35A 5DNMD 3B6GD 3W96D 5CPID 5CP6B 3AZKA 3O62B 5GSUB 2L5AA 4QLCA 2PYOA 4XZQA 5B31A 3AFAC 3WTPB 5E5AA 3MGQD 1S32D 1P3AD 1BH9A 5AV5C 1ID3D 3AZHD 4WNNA 4H9SA 3AZGA 3W97C 5GT3A 4WU8A 3AV1B 1BH8B 5B2IC 2AROC 4E44A 4WZSB 3AZMB 5B40D 5CP6D 1P3LA 1M18C 3O62D 5GSUD 3AN2B 5C3IB 4CAYA 3WTPD 3W98B 3KWQA 4AWLB 1ZLAC 3AYWA 4HGAC 1KX4B 5AY8B 1HTAA 1TAFA 4YS3C 5B32A 3VH6A 1ULYA 3AV1D 4CSRA 5JRGC 2FJ7C 3AZMD 3MGRD 4M6BA 3AV2B 4KUDC 3V9RA 3X1SB 3A6NB 5DNMA 3UTBC 3B6GA 3LJAC 3W96A 3AZFC 2NQBC 4YS3A 3REKD 5JRGA 3W98D 4J8WC 4J8UD 3B6FB 3UT9C 5BO0B 5F99C 1AOIC 5AY8D 4Z2MH 2F8ND 1P3PC 5BT1C 3AZHA 3AV2D 1P3FD 1R4VA 3X1SD 1KX5C 3WKJA 4H9NB 4R8PA 4EO5C 4H9PB 5B40A 4WU9A 4KGCC 4H9OA 3C1BD 5GSUA 2YFWB 4J8VB 5DNNC 1P34B 3AZNB 3B6FD 2RVQC 5JA4B 5CPKC 5GXQC 3REIC 3KXBC 1M1AD 4NE6A 5AV6B 1F66B 3AZMA 3WAAC 3MGRA 1M19C 1P34D 4XUJD 4J8VD 3X1TC 3LZ0A 3REJC 3REKA 3MVDB 3AZEA 3NQJA 4ZBJC 4J8UA 3RELC 4H9RB 4Z66C 1B67A 5BNXA 4YM6A 5KDMB 5AV6D 3KSYA 3NQUB 1F66D 5AVCB 2BYMA 3REJA 1U35B 2F8NA 1P3FA 1P3OC 1H3OA 3AZKB 2HIOA 5B33B 4QLCB 3MVDD 4XZQB 5B31B 3VH5A 3C1CA 2F8NH 2PYOB 3C1BA 3X1VC 5E5AB 1BH9B 4ZUXC 4WNNB 5AVCD 3AZGB 5AVBC 5GT3B 1P3KC 1M1AA 4G92B 3AZIC 5B0YC 3AZKD 1P3LB 5B33D 4QLCD 2PYOD 4XZQD 5B31D 4CAYB 4XUJA 5E5AD 3KWQB 3VH5W 1Q9CA 5AV8A 1KX3A 4NFTA 1P3BC 4J8XC 3AZGD 3AYWB 5GT3D 4LD9C 5AV9A 1TAFB 5B32B 3LELC 4CSRB 3MGSC 5AV5D 1P3LD 3V9RB 5DNMB 3B0DC 1P3MC 3UTAC 3W96B 4YS3B 3W99A 5JRGB 5B2ID 3KWQD 3LZ1C 5B32G 3AYWD 5CPJC 1N1JA 4Z2MG 3AZHB 3MGPC 1HQ3C 3WKJB 1AOIB 1F1EA 4R8PB 4YS3D 1EQZA 5GT0C 5B40B 5JRGD 4WU9B 4H9OB 5B33A 3KUYC 3UTBD 3AZJC 3AZFD 2HUEC 2CV5C 3WKJD 1P3GC 3R45A 1AOID 3AFAA 4R8PD 5AV5A 4WU9D 3MGRB 5BT1D 3MNNC 3W97A 3WA9C 1P3GA 3LZ0B 4Z5TC 4JJNC 2LY8A 3REKB 3AZEB 3AZLC 3NQJB 2AROA 5B2IA 3B0CT 4J8UB 1M18A 5BNXB 5DNND 4YM6B 3TU4C 5FUGB 4X23C 2BYMB 3REJB 1P3IC 2F8NB 4Z66B 1P3FB 1ZLAA 5B0ZC 2CWEA 1H3OB 5B1LC 2HIOB 4G91B 3LZ0D 3AZED 3C1CB 2FJ7A 3C1BB 5B1MC 2F8NG 4KUDA 3UTBA 5BNVB 2NZDC 4YM6D 3LJAA 3AZFA 2JSSA 4E45A 2NQBA 3REJD 4J8WA 3UT9A 4Z66D 5F99A 2IO5C 1M1AB 1TZYC 1AOIA 2HIOD 5CPIC 1P3PA 3C1CD 3B0BA 4XUJB 1KX5A 5AV8B 1KX3B 5BS7C 3MGQC 1S32C 1P3AC 1ID3C 5AV9B 4KGCA 5DNNA 5CP6C 3REHC 3O62C 1P3KD 5CPKA 3W99B 5GXQA 3REIA 3KXBA 3X1UC 5AV8D 3AZID 1KX3D 5B0YD 3WTPC 3WAAA 5AV9D 1M19A 3VH6T 1N1JB 3X1TA 5FUGA 3AV1C 1WWIA 1P3BD 4J8XD 3RELA 4Z66A 3AN2C 3W99D 5CPJB 1EQZB 5C3IC 3W98C 4AWLC 5BNVA 1KX4C 1P3OA 5AY8C 3R45B 2YFVB 3AFAB 3AV2C 3X1VA 3A6NC 3X1SC 5CPJD 5CHLB 5B31G 1EQZD 5AV5B 4ZUXA 3MGPD 5AVBA 3W97B 1P3GB 1P3KA 3B6FC 5B2IB 2AROB 3AZIA 5B0YA 1M18B 3KUYD 3WA9B 3WTPE 3AZJD 3AFAD 1P3BA 1ZLAB 2BYKA 4J8XA 4KHAA 4HGAB 2CV5D 3W97D 1P3GD 4LD9A 4J8VC 3LELA 3AZNC 2FJ7B 2AROD 3MGSA 1M18D 4KUDB 5B2JC 3UTBB 3MNND 3LJAB 1P3MA 3UTAA 3AZFB 3WA9D 2NQBB 5AV6C 4J8WB 1F66C 3LZ1A 3UT9B 2F8NK 5F99B 5B2JA 1ZLAD 3TU4D 4H9QA 5CPJA 1P3PB 4NE3A 2FJ7D 3MVDC 3MGPA 1HQ3A 4KUDD 2IO5B 1KX5B 3LJAD 2NQBD 4EO5B 1JFIA 5B24C 5GT0A 4KGCB 4J8WD 5AVCC 3UT9D 1U35C 5DNNB 5F99D 3KUYA 2NZDD 2YFVA 3AZJA 4DRAA 3B0CW 1P3PD 3AZKC 5CPKB 5GXQB 1B6WA 4QLCC 4XZQC 5B31C 3KXBB 3REIB 2CV5A 1KX5D 1TZYD 2PYOC 5E5AC 3WAAB 3REHB 4KGCD 1M19B 4H9SC 3AZGC 3X1TB 3MNNA 5GT3C 3X1UB 3WA9A 2RVQD 4Z5TA 4WU8C 4JJNA 3AZLA 4G92C 4ZBJB 1P3LC 3RELB 1KU5A 5CPKD 5GXQD 3REID 3KXBD 3TU4A 4X23A 1P3IA 3KWQC 3WAAD 3REHD 1M19D 3AYWC 3X1TD 5B0ZA 1P3OB 5B1LA 3X1UD 5B32C 3RELD 3X1VB 5B1MA 5DNMC 3B6GC 2NZDA 3W96C 4ZUXB 5AVBB 1P3KB 4UUZA 3AN2D 4WV4B 3AZIB 1TZYA 5B0YB 1P3OD 5CPIA 5G49A 3AZHC 3X1VD 3WKJC 1KX4D 1P3BB 4ZUXD 4R8PC 5BS7A 3MGQA 2BYKB 4J8XB 1S32A 4KHAB 5AVBD 5B40C 4WU9C 1P3AA 1ID3A 4LD9B 5GSUC 3VH6W 3LELB 3A6ND 3MGSB 3B0DB 5CP6A 3UTAB 1P3MB 3REHA 3O62A 3X1UA 3WTPA 3LZ1B 5B2JB 3AZMC 3MGRC 4H9QB 4LD9D 1WWSA 3LELD 3LZ0C 3MGSD 3REKC 3AV1A 3AZEC 1BH8A 1HQ3B 3MGPB 4J8UC 1P3MD 3UTAD 3AN2A 1JFIB 4DRBA 4YM6C 3AZND 5GT0B 3LZ1D 3KUYB 5B2JD 3W98A 3AZJB 1A7WA 1P3FC 5B24B 1KX4A 2HUEB 5AY8A 4G91C 2HIOC 1HQ3D 3C1CC 2CV5B 3C1BC 3AV2A 3X1SA 3A6NA 5GT0D 3MNNB 4Z5TB 3B6FA 4JJNB 5BO0A 3AZLB 1M1AC 5B24D 1U35D 3TU4B 1P34C 4XUJC 4WU8B 4X23B 1P3IB 5AV8C 1KX3C 4H9NA
chains in the Genus database with same CATH superfamily
4H9PA 5B0ZB 5B1LB 5AV9C 4Z5TD 2YFWA 4J8VA 4JJND 1P34A 3AZNA 3AZLD 2UWXA 2Y2GA 5B1MB 1BFMA 2NZDB 3AL0C 5JA4A 3W99C 4X23D 4WU8D 1P3ID 5AV6A 3VH5T 1F66A 4UUZB 1W2EA 3B6GB 1TZYB 2XD1A 5B0ZD 5B1LD 2RIQA 5CPIB 5G49B 5B1MD 3MVDA 4H9RA 3MGQB 1S32B 5B32D 1EQZC 1P3AB 5B24A 4NE5A 1ID3B 5KDMA 3NQUA 5B33C 5AVCA 1U35A 5DNMD 3B6GD 3W96D 5CPID 5CP6B 3AZKA 3O62B 5GSUB 2L5AA 4QLCA 2PYOA 4XZQA 5B31A 3AFAC 3WTPB 5E5AA 3MGQD 1S32D 2Y2PA 1P3AD 1BH9A 5AV5C 1ID3D 3AZHD 4WNNA 4H9SA 3AZGA 3W97C 5GT3A 4WU8A 3AV1B 1BH8B 5B2IC 2AROC 4E44A 4WZSB 3AZMB 5B40D 5CP6D 1P3LA 1M18C 3O62D 5GSUD 3AN2B 2Y2NA 5C3IB 4CAYA 3WTPD 3W98B 3KWQA 3H0LC 4AWLB 1ZLAC 2DF4C 3AYWA 4HGAC 1KX4B 5AY8B 1HTAA 1TAFA 4YS3C 5B32A 2F2AC 1ULYA 3VH6A 4CSRA 5JRGC 3AV1D 2FJ7C 3AZMD 3MGRD 4M6BA 3AV2B 4KUDC 3V9RA 3X1SB 3A6NB 5DNMA 3UTBC 3B6GA 3LJAC 3W96A 3AZFC 2NQBC 4YS3A 3REKD 5JRGA 3W98D 4J8WC 4J8UD 3B6FB 3UT9C 5BO0B 5F99C 1AOIC 5AY8D 4Z2MH 2F8ND 1P3PC 2ZY2A 5BT1C 3AZHA 3AV2D 1P3FD 1R4VA 3X1SD 1KX5C 3WKJA 4H9NB 4R8PA 4EO5C 2Y2LA 4H9PB 3F6TA 5B40A 4WU9A 4KGCC 4H9OA 3C1BD 5GSUA 2YFWB 4J8VB 5DNNC 1P34B 3AZNB 3B6FD 2RVQC 2Y2QA 5JA4B 5CPKC 5GXQC 3REIC 3KXBC 1M1AD 2VQRA 4NE6A 5AV6B 1F66B 3AZMA 3WAAC 3MGRA 1M19C 3EG5B 1P34D 4XUJD 4J8VD 3X1TC 3LZ0A 3REJC 3REKA 3MVDB 3AZEA 3NQJA 4ZBJC 4J8UA 3RELC 4H9RB 4Z66C 3H0MC 1B67A 5BNXA 4YM6A 5KDMB 5AV6D 3KSYA 3NQUB 1F66D 5AVCB 2BYMA 3REJA 1U35B 2F8NA 3FDDA 1P3FA 3A1KA 1P3OC 1H3OA 3AZKB 2HIOA 5B33B 4QLCB 3MVDD 4XZQB 5B31B 3VH5A 3C1CA 2F8NH 2PYOB 3C1BA 3X1VC 5E5AB 1BH9B 4ZUXC 4WNNB 5AVCD 3AZGB 5AVBC 5GT3B 1P3KC 1M1AA 4G92B 3AZIC 5B0YC 3AZKD 1P3LB 5B33D 4QLCD 2PYOD 4XZQD 5B31D 4CAYB 4XUJA 5E5AD 3KWQB 3VH5W 1Q9CA 5AV8A 1KX3A 4NFTA 1P3BC 4J8XC 3AZGD 3AYWB 5GT3D 4LD9C 5AV9A 1TAFB 5B32B 3LELC 4CSRB 3MGSC 2ZY4A 5AV5D 1P3LD 3V9RB 5DNMB 3B0DC 1P3MC 3UTAC 3W96B 4YS3B 3W99A 5JRGB 5B2ID 3KWQD 2Y2KA 3LZ1C 5B32G 3AYWD 5CPJC 1N1JA 4Z2MG 3AZHB 3MGPC 1HQ3C 3WKJB 2Y2HA 1AOIB 1F1EA 4R8PB 4YS3D 1EQZA 5GT0C 5B40B 5JRGD 4WU9B 4H9OB 5B33A 3KUYC 3UTBD 3AZJC 3AZFD 4UPKA 2HUEC 3A1IA 2CV5C 3WKJD 1P3GC 3R45A 1AOID 3AFAA 4R8PD 5AV5A 4WU9D 3MGRB 5BT1D 3MNNC 3W97A 3WA9C 1P3GA 3LZ0B 4Z5TC 4JJNC 2LY8A 3REKB 3AZEB 3AZLC 5B2IA 3NQJB 2AROA 3B0CT 4J8UB 1M18A 5BNXB 5DNND 4YM6B 1PZRA 5FUGB 3TU4C 2JE5A 4X23C 2BYMB 2Y2JA 3IP4C 3REJB 1P3IC 2F8NB 4Z66B 1P3FB 1ZLAA 5B0ZC 2CWEA 1H3OB 5B1LC 2HIOB 4G91B 3LZ0D 3AZED 3C1CB 2FJ7A 3C1BB 5B1MC 2F8NG 4KUDA 3UTBA 5BNVB 2NZDC 4YM6D 3LJAA 3AZFA 2JSSA 4E45A 2NQBA 3REJD 4J8WA 3UT9A 4Z66D 5F99A 2IO5C 1M1AB 1TZYC 1AOIA 2HIOD 5CPIC 1P3PA 3C1CD 2ZY5A 3B0BA 4XUJB 1KX5A 5AV8B 1KX3B 5BS7C 3MGQC 1S32C 1P3AC 1ID3C 5AV9B 4KGCA 5DNNA 4DQYB 2Y2OA 5CP6C 3REHC 3O62C 1P3KD 5CPKA 3W99B 5GXQA 3REIA 3KXBA 3X1UC 5AV8D 3AZID 1KX3D 5B0YD 3WTPC 2Y2IA 3WAAA 5AV9D 1M19A 4WJ3C 3VH6T 1N1JB 3X1TA 5FUGA 2Y2MA 2ZM5A 3AV1C 1WWIA 1P3BD 4J8XD 3RELA 4Z66A 3AN2C 3W99D 5CPJB 1EQZB 3EPJA 5C3IC 3W98C 4AWLC 5BNVA 1KX4C 1P3OA 5AY8C 3R45B 2YFVB 3AFAB 3AV2C 3X1VA 2FFFB 3A6NC 3X1SC 5CPJD 5CHLB 5B31G 1EQZD 5AV5B 4ZUXA 3MGPD 5AVBA 3W97B 1P3GB 1P3KA 3B6FC 5B2IB 2AROB 3AZIA 5B0YA 1M18B 3KUYD 3WA9B 3WTPE 3AZJD 3AFAD 1P3BA 1ZLAB 2BYKA 4J8XA 4KHAA 4HGAB 2CV5D 3W97D 1P3GD 4LD9A 3KFUG 4J8VC 3LELA 3AZNC 2FJ7B 2AROD 3MGSA 1M18D 4KUDB 5B2JC 3UTBB 3MNND 3LJAB 1P3MA 3UTAA 3AZFB 3WA9D 2NQBB 3EPHA 5AV6C 4J8WB 1F66C 3LZ1A 3UT9B 2F8NK 5F99B 5B2JA 1ZLAD 3TU4D 4H9QA 2ZY3A 5CPJA 1P3PB 4NE3A 2FJ7D 2XD5A 3MVDC 3MGPA 1HQ3A 4KUDD 2IO5B 1KX5B 3LJAD 2NQBD 4EO5B 1JFIA 5B24C 5GT0A 4KGCB 4J8WD 5AVCC 3UT9D 1U35C 5DNNB 5F99D 3KUYA 2NZDD 2YFVA 3AZJA 4DRAA 3B0CW 1P3PD 3AZKC 5CPKB 5GXQB 1B6WA 4QLCC 4XZQC 5B31C 3KXBB 3REIB 2CV5A 1KX5D 1TZYD 2PYOC 5E5AC 3WAAB 3REHB 4KGCD 1M19B 3H0RC 4H9SC 3AZGC 3X1TB 3MNNA 5GT3C 3X1UB 3WA9A 2RVQD 4Z5TA 4WU8C 4JJNA 3AZLA 4G92C 4ZBJB 2DQNC 1P3LC 3RELB 1KU5A 5CPKD 5GXQD 3REID 3KXBD 3TU4A 2G5IC 2G5HC 4X23A 1P3IA 3KWQC 3WAAD 3REHD 1M19D 3AYWC 3X1TD 5B0ZA 1P3OB 5B1LA 3X1UD 5B32C 3EPLA 3RELD 3X1VB 5B1MA 5DNMC 3B6GC 2NZDA 3W96C 4ZUXB 5AVBB 1P3KB 4UUZA 3AN2D 4WV4B 3AZIB 1TZYA 5B0YB 1P3OD 5CPIA 2W8SA 5G49A 3AZHC 3X1VD 3WKJC 1Z2CB 1KX4D 1P3BB 3P5JB 4R8PC 5BS7A 4ZUXD 2BYKB 3MGQA 4J8XB 1S32A 4KHAB 5AVBD 5B40C 4WU9C 1P3AA 1ID3A 4LD9B 5GSUC 1T3UA 3VH6W 3LELB 3A6ND 3MGSB 3B0DB 5CP6A 3UTAB 1P3MB 3REHA 3O62A 3EPKA 3X1UA 3WTPA 3LZ1B 5B2JB 3AZMC 3MGRC 4H9QB 4LD9D 1WWSA 3LELD 3LZ0C 3MGSD 2BG1A 3REKC 3AZEC 1BH8A 1HQ3B 3MGPB 3AV1A 4J8UC 1P3MD 3UTAD 3AN2A 1JFIB 4DRBA 4YM6C 3AZND 5GT0B 3LZ1D 3KUYB 5B2JD 3W98A 3AZJB 1A7WA 1P3FC 5B24B 1KX4A 2HUEB 5AY8A 2HIOC 4G91C 2J8PA 1HQ3D 3C1CC 2CV5B 2JCHA 3C1BC 3AV2A 3X1SA 3A6NA 5GT0D 3MNNB 4Z5TB 3B6FA 4JJNB 5BO0A 3AZLB 1M1AC 5B24D 1U35D 3TU4B 1P34C 4XUJC 4WU8B 4X23B 1P3IB 5AV8C 1KX3C 4H9NA
chains in the Genus database with same CATH topology
4H9PA 5B0ZB 5B1LB 5AV9C 4Z5TD 2YFWA 4J8VA 4JJND 1P34A 3AZNA 3AZLD 2UWXA 2Y2GA 5B1MB 1BFMA 2NZDB 3AL0C 5JA4A 3W99C 4X23D 4WU8D 1P3ID 5AV6A 3VH5T 1F66A 4UUZB 1W2EA 3B6GB 1TZYB 2XD1A 5B0ZD 5B1LD 2RIQA 5CPIB 5G49B 5B1MD 3MVDA 4H9RA 3MGQB 1S32B 5B32D 1EQZC 1P3AB 5B24A 4NE5A 1ID3B 5KDMA 3NQUA 5B33C 5AVCA 1U35A 5DNMD 3B6GD 3W96D 5CPID 5CP6B 3AZKA 3O62B 5GSUB 2L5AA 4QLCA 2PYOA 4XZQA 5B31A 3AFAC 3WTPB 5E5AA 3MGQD 1S32D 2Y2PA 1P3AD 1BH9A 5AV5C 1ID3D 3AZHD 4WNNA 4H9SA 3AZGA 3W97C 5GT3A 4WU8A 3AV1B 1BH8B 5B2IC 2AROC 4E44A 4WZSB 3AZMB 5B40D 5CP6D 1P3LA 1M18C 3O62D 5GSUD 3AN2B 2Y2NA 5C3IB 4CAYA 3WTPD 3W98B 3KWQA 3H0LC 4AWLB 1ZLAC 2DF4C 3AYWA 4HGAC 1KX4B 5AY8B 1HTAA 1TAFA 4YS3C 5B32A 2F2AC 1ULYA 3VH6A 4CSRA 5JRGC 3AV1D 2FJ7C 3AZMD 3MGRD 4M6BA 3AV2B 4KUDC 3V9RA 3X1SB 3A6NB 5DNMA 3UTBC 3B6GA 3LJAC 3W96A 3AZFC 2NQBC 4YS3A 3REKD 5JRGA 3W98D 4J8WC 4J8UD 3B6FB 3UT9C 5BO0B 5F99C 1AOIC 5AY8D 4Z2MH 2F8ND 1P3PC 2ZY2A 5BT1C 3AZHA 3AV2D 1P3FD 1R4VA 3X1SD 1KX5C 3WKJA 4H9NB 4R8PA 4EO5C 2Y2LA 4H9PB 3F6TA 5B40A 4WU9A 4KGCC 4H9OA 3C1BD 5GSUA 2YFWB 4J8VB 5DNNC 1P34B 3AZNB 3B6FD 2RVQC 2Y2QA 5JA4B 5CPKC 5GXQC 3REIC 3KXBC 1M1AD 2VQRA 4NE6A 5AV6B 1F66B 3AZMA 3WAAC 3MGRA 1M19C 3EG5B 1P34D 4XUJD 4J8VD 3X1TC 3LZ0A 3REJC 3REKA 3MVDB 3AZEA 3NQJA 4ZBJC 4J8UA 3RELC 4H9RB 4Z66C 3H0MC 1B67A 5BNXA 4YM6A 5KDMB 5AV6D 3KSYA 3NQUB 1F66D 5AVCB 2BYMA 3REJA 1U35B 2F8NA 3FDDA 1P3FA 3A1KA 1P3OC 1H3OA 3AZKB 2HIOA 5B33B 4QLCB 3MVDD 4XZQB 5B31B 3VH5A 3C1CA 2F8NH 2PYOB 3C1BA 3X1VC 5E5AB 1BH9B 4ZUXC 4WNNB 5AVCD 3AZGB 5AVBC 5GT3B 1P3KC 1M1AA 4G92B 3AZIC 5B0YC 3AZKD 1P3LB 5B33D 4QLCD 2PYOD 4XZQD 5B31D 4CAYB 4XUJA 5E5AD 3KWQB 3VH5W 1Q9CA 5AV8A 1KX3A 4NFTA 1P3BC 4J8XC 3AZGD 3AYWB 5GT3D 4LD9C 5AV9A 1TAFB 5B32B 3LELC 4CSRB 3MGSC 2ZY4A 5AV5D 1P3LD 3V9RB 5DNMB 3B0DC 1P3MC 3UTAC 3W96B 4YS3B 3W99A 5JRGB 5B2ID 3KWQD 2Y2KA 3LZ1C 5B32G 3AYWD 5CPJC 1N1JA 4Z2MG 3AZHB 3MGPC 1HQ3C 3WKJB 2Y2HA 1AOIB 1F1EA 4R8PB 4YS3D 1EQZA 5GT0C 5B40B 5JRGD 4WU9B 4H9OB 5B33A 3KUYC 3UTBD 3AZJC 3AZFD 4UPKA 2HUEC 3A1IA 2CV5C 3WKJD 1P3GC 3R45A 1AOID 3AFAA 4R8PD 5AV5A 4WU9D 3MGRB 5BT1D 3MNNC 3W97A 3WA9C 1P3GA 3LZ0B 4Z5TC 4JJNC 2LY8A 3REKB 3AZEB 3AZLC 5B2IA 3NQJB 2AROA 3B0CT 4J8UB 1M18A 5BNXB 5DNND 4YM6B 1PZRA 5FUGB 3TU4C 2JE5A 4X23C 2BYMB 2Y2JA 3IP4C 3REJB 1P3IC 2F8NB 4Z66B 1P3FB 1ZLAA 5B0ZC 2CWEA 1H3OB 5B1LC 2HIOB 4G91B 3LZ0D 3AZED 3C1CB 2FJ7A 3C1BB 5B1MC 2F8NG 4KUDA 3UTBA 5BNVB 2NZDC 4YM6D 3LJAA 3AZFA 2JSSA 4E45A 2NQBA 3REJD 4J8WA 3UT9A 4Z66D 5F99A 2IO5C 1M1AB 1TZYC 1AOIA 2HIOD 5CPIC 1P3PA 3C1CD 2ZY5A 3B0BA 4XUJB 1KX5A 5AV8B 1KX3B 5BS7C 3MGQC 1S32C 1P3AC 1ID3C 5AV9B 4KGCA 5DNNA 4DQYB 2Y2OA 5CP6C 3REHC 3O62C 1P3KD 5CPKA 3W99B 5GXQA 3REIA 3KXBA 3X1UC 5AV8D 3AZID 1KX3D 5B0YD 3WTPC 2Y2IA 3WAAA 5AV9D 1M19A 4WJ3C 3VH6T 1N1JB 3X1TA 5FUGA 2Y2MA 2ZM5A 3AV1C 1WWIA 1P3BD 4J8XD 3RELA 4Z66A 3AN2C 3W99D 5CPJB 1EQZB 3EPJA 5C3IC 3W98C 4AWLC 5BNVA 1KX4C 1P3OA 5AY8C 3R45B 2YFVB 3AFAB 3AV2C 3X1VA 2FFFB 3A6NC 3X1SC 5CPJD 5CHLB 5B31G 1EQZD 5AV5B 4ZUXA 3MGPD 5AVBA 3W97B 1P3GB 1P3KA 3B6FC 5B2IB 2AROB 3AZIA 5B0YA 1M18B 3KUYD 3WA9B 3WTPE 3AZJD 3AFAD 1P3BA 1ZLAB 2BYKA 4J8XA 4KHAA 4HGAB 2CV5D 3W97D 1P3GD 4LD9A 3KFUG 4J8VC 3LELA 3AZNC 2FJ7B 2AROD 3MGSA 1M18D 4KUDB 5B2JC 3UTBB 3MNND 3LJAB 1P3MA 3UTAA 3AZFB 3WA9D 2NQBB 3EPHA 5AV6C 4J8WB 1F66C 3LZ1A 3UT9B 2F8NK 5F99B 5B2JA 1ZLAD 3TU4D 4H9QA 2ZY3A 5CPJA 1P3PB 4NE3A 2FJ7D 2XD5A 3MVDC 3MGPA 1HQ3A 4KUDD 2IO5B 1KX5B 3LJAD 2NQBD 4EO5B 1JFIA 5B24C 5GT0A 4KGCB 4J8WD 5AVCC 3UT9D 1U35C 5DNNB 5F99D 3KUYA 2NZDD 2YFVA 3AZJA 4DRAA 3B0CW 1P3PD 3AZKC 5CPKB 5GXQB 1B6WA 4QLCC 4XZQC 5B31C 3KXBB 3REIB 2CV5A 1KX5D 1TZYD 2PYOC 5E5AC 3WAAB 3REHB 4KGCD 1M19B 3H0RC 4H9SC 3AZGC 3X1TB 3MNNA 5GT3C 3X1UB 3WA9A 2RVQD 4Z5TA 4WU8C 4JJNA 3AZLA 4G92C 4ZBJB 2DQNC 1P3LC 3RELB 1KU5A 5CPKD 5GXQD 3REID 3KXBD 3TU4A 2G5IC 2G5HC 4X23A 1P3IA 3KWQC 3WAAD 3REHD 1M19D 3AYWC 3X1TD 5B0ZA 1P3OB 5B1LA 3X1UD 5B32C 3EPLA 3RELD 3X1VB 5B1MA 5DNMC 3B6GC 2NZDA 3W96C 4ZUXB 5AVBB 1P3KB 4UUZA 3AN2D 4WV4B 3AZIB 1TZYA 5B0YB 1P3OD 5CPIA 2W8SA 5G49A 3AZHC 3X1VD 3WKJC 1Z2CB 1KX4D 1P3BB 3P5JB 4R8PC 5BS7A 4ZUXD 2BYKB 3MGQA 4J8XB 1S32A 4KHAB 5AVBD 5B40C 4WU9C 1P3AA 1ID3A 4LD9B 5GSUC 1T3UA 3VH6W 3LELB 3A6ND 3MGSB 3B0DB 5CP6A 3UTAB 1P3MB 3REHA 3O62A 3EPKA 3X1UA 3WTPA 3LZ1B 5B2JB 3AZMC 3MGRC 4H9QB 4LD9D 1WWSA 3LELD 3LZ0C 3MGSD 2BG1A 3REKC 3AZEC 1BH8A 1HQ3B 3MGPB 3AV1A 4J8UC 1P3MD 3UTAD 3AN2A 1JFIB 4DRBA 4YM6C 3AZND 5GT0B 3LZ1D 3KUYB 5B2JD 3W98A 3AZJB 1A7WA 1P3FC 5B24B 1KX4A 2HUEB 5AY8A 2HIOC 4G91C 2J8PA 1HQ3D 3C1CC 2CV5B 2JCHA 3C1BC 3AV2A 3X1SA 3A6NA 5GT0D 3MNNB 4Z5TB 3B6FA 4JJNB 5BO0A 3AZLB 1M1AC 5B24D 1U35D 3TU4B 1P34C 4XUJC 4WU8B 4X23B 1P3IB 5AV8C 1KX3C 4H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P A;  5B0Z B;  5B1L B;  5AV9 C;  4Z5T D;  2YFW A;  4J8V A;  4JJN D;  1P34 A;  3AZN A;  3AZL D;  5B1M B;  1BFM A;  2NZD B;  5JA4 A;  3W99 C;  4X23 D;  4WU8 D;  1P3I D;  5AV6 A;  3VH5 T;  1F66 A;  4UUZ B;  3B6G B;  1TZY B;  5B0Z D;  5B1L D;  5CPI B;  5G49 B;  5B1M D;  3MVD A;  4H9R A;  3MGQ B;  1S32 B;  5B32 D;  1EQZ C;  1P3A B;  5B24 A;  4NE5 A;  1ID3 B;  5KDM A;  3NQU A;  5B33 C;  5AVC A;  1U35 A;  5DNM D;  3B6G D;  3W96 D;  5CPI D;  5CP6 B;  3AZK A;  3O62 B;  5GSU B;  2L5A A;  4QLC A;  2PYO A;  4XZQ A;  5B31 A;  3AFA C;  3WTP B;  5E5A A;  3MGQ D;  1S32 D;  1P3A D;  1BH9 A;  5AV5 C;  1ID3 D;  3AZH D;  4WNN A;  4H9S A;  3AZG A;  3W97 C;  5GT3 A;  4WU8 A;  3AV1 B;  1BH8 B;  5B2I C;  2ARO C;  4E44 A;  4WZS B;  3AZM B;  5B40 D;  5CP6 D;  1P3L A;  1M18 C;  3O62 D;  5GSU D;  3AN2 B;  5C3I B;  4CAY A;  3WTP D;  3W98 B;  3KWQ A;  4AWL B;  1ZLA C;  3AYW A;  4HGA C;  1KX4 B;  5AY8 B;  1HTA A;  1TAF A;  4YS3 C;  5B32 A;  3VH6 A;  1ULY A;  3AV1 D;  4CSR A;  5JRG C;  2FJ7 C;  3AZM D;  3MGR D;  4M6B A;  3AV2 B;  4KUD C;  3V9R A;  3X1S B;  3A6N B;  5DNM A;  3UTB C;  3B6G A;  3LJA C;  3W96 A;  3AZF C;  2NQB C;  4YS3 A;  3REK D;  5JRG A;  3W98 D;  4J8W C;  4J8U D;  3B6F B;  3UT9 C;  5BO0 B;  5F99 C;  1AOI C;  5AY8 D;  4Z2M H;  2F8N D;  1P3P C;  5BT1 C;  3AZH A;  3AV2 D;  1P3F D;  1R4V A;  3X1S D;  1KX5 C;  3WKJ A;  4H9N B;  4R8P A;  4EO5 C;  4H9P B;  5B40 A;  4WU9 A;  4KGC C;  4H9O A;  3C1B D;  5GSU A;  2YFW B;  4J8V B;  5DNN C;  1P34 B;  3AZN B;  3B6F D;  2RVQ C;  5JA4 B;  5CPK C;  5GXQ C;  3REI C;  3KXB C;  1M1A D;  4NE6 A;  5AV6 B;  1F66 B;  3AZM A;  3WAA C;  3MGR A;  1M19 C;  1P34 D;  4XUJ D;  4J8V D;  3X1T C;  3LZ0 A;  3REJ C;  3REK A;  3MVD B;  3AZE A;  3NQJ A;  4ZBJ C;  4J8U A;  3REL C;  4H9R B;  4Z66 C;  1B67 A;  5BNX A;  4YM6 A;  5KDM B;  5AV6 D;  3KSY A;  3NQU B;  1F66 D;  5AVC B;  2BYM A;  3REJ A;  1U35 B;  2F8N A;  1P3F A;  1P3O C;  1H3O A;  3AZK B;  2HIO A;  5B33 B;  4QLC B;  3MVD D;  4XZQ B;  5B31 B;  3VH5 A;  3C1C A;  2F8N H;  2PYO B;  3C1B A;  3X1V C;  5E5A B;  1BH9 B;  4ZUX C;  4WNN B;  5AVC D;  3AZG B;  5AVB C;  5GT3 B;  1P3K C;  1M1A A;  4G92 B;  3AZI C;  5B0Y C;  3AZK D;  1P3L B;  5B33 D;  4QLC D;  2PYO D;  4XZQ D;  5B31 D;  4CAY B;  4XUJ A;  5E5A D;  3KWQ B;  3VH5 W;  1Q9C A;  5AV8 A;  1KX3 A;  4NFT A;  1P3B C;  4J8X C;  3AZG D;  3AYW B;  5GT3 D;  4LD9 C;  5AV9 A;  1TAF B;  5B32 B;  3LEL C;  4CSR B;  3MGS C;  5AV5 D;  1P3L D;  3V9R B;  5DNM B;  3B0D C;  1P3M C;  3UTA C;  3W96 B;  4YS3 B;  3W99 A;  5JRG B;  5B2I D;  3KWQ D;  3LZ1 C;  5B32 G;  3AYW D;  5CPJ C;  1N1J A;  4Z2M G;  3AZH B;  3MGP C;  1HQ3 C;  3WKJ B;  1AOI B;  1F1E A;  4R8P B;  4YS3 D;  1EQZ A;  5GT0 C;  5B40 B;  5JRG D;  4WU9 B;  4H9O B;  5B33 A;  3KUY C;  3UTB D;  3AZJ C;  3AZF D;  2HUE C;  2CV5 C;  3WKJ D;  1P3G C;  3R45 A;  1AOI D;  3AFA A;  4R8P D;  5AV5 A;  4WU9 D;  3MGR B;  5BT1 D;  3MNN C;  3W97 A;  3WA9 C;  1P3G A;  3LZ0 B;  4Z5T C;  4JJN C;  2LY8 A;  3REK B;  3AZE B;  3AZL C;  3NQJ B;  2ARO A;  5B2I A;  3B0C T;  4J8U B;  1M18 A;  5BNX B;  5DNN D;  4YM6 B;  3TU4 C;  5FUG B;  4X23 C;  2BYM B;  3REJ B;  1P3I C;  2F8N B;  4Z66 B;  1P3F B;  1ZLA A;  5B0Z C;  2CWE A;  1H3O B;  5B1L C;  2HIO B;  4G91 B;  3LZ0 D;  3AZE D;  3C1C B;  2FJ7 A;  3C1B B;  5B1M C;  2F8N G;  4KUD A;  3UTB A;  5BNV B;  2NZD C;  4YM6 D;  3LJA A;  3AZF A;  2JSS A;  4E45 A;  2NQB A;  3REJ D;  4J8W A;  3UT9 A;  4Z66 D;  5F99 A;  2IO5 C;  1M1A B;  1TZY C;  1AOI A;  2HIO D;  5CPI C;  1P3P A;  3C1C D;  3B0B A;  4XUJ B;  1KX5 A;  5AV8 B;  1KX3 B;  5BS7 C;  3MGQ C;  1S32 C;  1P3A C;  1ID3 C;  5AV9 B;  4KGC A;  5DNN A;  5CP6 C;  3REH C;  3O62 C;  1P3K D;  5CPK A;  3W99 B;  5GXQ A;  3REI A;  3KXB A;  3X1U C;  5AV8 D;  3AZI D;  1KX3 D;  5B0Y D;  3WTP C;  3WAA A;  5AV9 D;  1M19 A;  3VH6 T;  1N1J B;  3X1T A;  5FUG A;  3AV1 C;  1WWI A;  1P3B D;  4J8X D;  3REL A;  4Z66 A;  3AN2 C;  3W99 D;  5CPJ B;  1EQZ B;  5C3I C;  3W98 C;  4AWL C;  5BNV A;  1KX4 C;  1P3O A;  5AY8 C;  3R45 B;  2YFV B;  3AFA B;  3AV2 C;  3X1V A;  3A6N C;  3X1S C;  5CPJ D;  5CHL B;  5B31 G;  1EQZ D;  5AV5 B;  4ZUX A;  3MGP D;  5AVB A;  3W97 B;  1P3G B;  1P3K A;  3B6F C;  5B2I B;  2ARO B;  3AZI A;  5B0Y A;  1M18 B;  3KUY D;  3WA9 B;  3WTP E;  3AZJ D;  3AFA D;  1P3B A;  1ZLA B;  2BYK A;  4J8X A;  4KHA A;  4HGA B;  2CV5 D;  3W97 D;  1P3G D;  4LD9 A;  4J8V C;  3LEL A;  3AZN C;  2FJ7 B;  2ARO D;  3MGS A;  1M18 D;  4KUD B;  5B2J C;  3UTB B;  3MNN D;  3LJA B;  1P3M A;  3UTA A;  3AZF B;  3WA9 D;  2NQB B;  5AV6 C;  4J8W B;  1F66 C;  3LZ1 A;  3UT9 B;  2F8N K;  5F99 B;  5B2J A;  1ZLA D;  3TU4 D;  4H9Q A;  5CPJ A;  1P3P B;  4NE3 A;  2FJ7 D;  3MVD C;  3MGP A;  1HQ3 A;  4KUD D;  2IO5 B;  1KX5 B;  3LJA D;  2NQB D;  4EO5 B;  1JFI A;  5B24 C;  5GT0 A;  4KGC B;  4J8W D;  5AVC C;  3UT9 D;  1U35 C;  5DNN B;  5F99 D;  3KUY A;  2NZD D;  2YFV A;  3AZJ A;  4DRA A;  3B0C W;  1P3P D;  3AZK C;  5CPK B;  5GXQ B;  1B6W A;  4QLC C;  4XZQ C;  5B31 C;  3KXB B;  3REI B;  2CV5 A;  1KX5 D;  1TZY D;  2PYO C;  5E5A C;  3WAA B;  3REH B;  4KGC D;  1M19 B;  4H9S C;  3AZG C;  3X1T B;  3MNN A;  5GT3 C;  3X1U B;  3WA9 A;  2RVQ D;  4Z5T A;  4WU8 C;  4JJN A;  3AZL A;  4G92 C;  4ZBJ B;  1P3L C;  3REL B;  1KU5 A;  5CPK D;  5GXQ D;  3REI D;  3KXB D;  3TU4 A;  4X23 A;  1P3I A;  3KWQ C;  3WAA D;  3REH D;  1M19 D;  3AYW C;  3X1T D;  5B0Z A;  1P3O B;  5B1L A;  3X1U D;  5B32 C;  3REL D;  3X1V B;  5B1M A;  5DNM C;  3B6G C;  2NZD A;  3W96 C;  4ZUX B;  5AVB B;  1P3K B;  4UUZ A;  3AN2 D;  4WV4 B;  3AZI B;  1TZY A;  5B0Y B;  1P3O D;  5CPI A;  5G49 A;  3AZH C;  3X1V D;  3WKJ C;  1KX4 D;  1P3B B;  4ZUX D;  4R8P C;  5BS7 A;  3MGQ A;  2BYK B;  4J8X B;  1S32 A;  4KHA B;  5AVB D;  5B40 C;  4WU9 C;  1P3A A;  1ID3 A;  4LD9 B;  5GSU C;  3VH6 W;  3LEL B;  3A6N D;  3MGS B;  3B0D B;  5CP6 A;  3UTA B;  1P3M B;  3REH A;  3O62 A;  3X1U A;  3WTP A;  3LZ1 B;  5B2J B;  3AZM C;  3MGR C;  4H9Q B;  4LD9 D;  1WWS A;  3LEL D;  3LZ0 C;  3MGS D;  3REK C;  3AV1 A;  3AZE C;  1BH8 A;  1HQ3 B;  3MGP B;  4J8U C;  1P3M D;  3UTA D;  3AN2 A;  1JFI B;  4DRB A;  4YM6 C;  3AZN D;  5GT0 B;  3LZ1 D;  3KUY B;  5B2J D;  3W98 A;  3AZJ B;  1A7W A;  1P3F C;  5B24 B;  1KX4 A;  2HUE B;  5AY8 A;  4G91 C;  2HIO C;  1HQ3 D;  3C1C C;  2CV5 B;  3C1B C;  3AV2 A;  3X1S A;  3A6N A;  5GT0 D;  3MNN B;  4Z5T B;  3B6F A;  4JJN B;  5BO0 A;  3AZL B;  1M1A C;  5B24 D;  1U35 D;  3TU4 B;  1P34 C;  4XUJ C;  4WU8 B;  4X23 B;  1P3I B;  5AV8 C;  1KX3 C;  4H9N A; 
#chains in the Genus database with same CATH topology
 4H9P A;  5B0Z B;  5B1L B;  5AV9 C;  4Z5T D;  2YFW A;  4J8V A;  4JJN D;  1P34 A;  3AZN A;  3AZL D;  2UWX A;  2Y2G A;  5B1M B;  1BFM A;  2NZD B;  3AL0 C;  5JA4 A;  3W99 C;  4X23 D;  4WU8 D;  1P3I D;  5AV6 A;  3VH5 T;  1F66 A;  4UUZ B;  1W2E A;  3B6G B;  1TZY B;  2XD1 A;  5B0Z D;  5B1L D;  2RIQ A;  5CPI B;  5G49 B;  5B1M D;  3MVD A;  4H9R A;  3MGQ B;  1S32 B;  5B32 D;  1EQZ C;  1P3A B;  5B24 A;  4NE5 A;  1ID3 B;  5KDM A;  3NQU A;  5B33 C;  5AVC A;  1U35 A;  5DNM D;  3B6G D;  3W96 D;  5CPI D;  5CP6 B;  3AZK A;  3O62 B;  5GSU B;  2L5A A;  4QLC A;  2PYO A;  4XZQ A;  5B31 A;  3AFA C;  3WTP B;  5E5A A;  3MGQ D;  1S32 D;  2Y2P A;  1P3A D;  1BH9 A;  5AV5 C;  1ID3 D;  3AZH D;  4WNN A;  4H9S A;  3AZG A;  3W97 C;  5GT3 A;  4WU8 A;  3AV1 B;  1BH8 B;  5B2I C;  2ARO C;  4E44 A;  4WZS B;  3AZM B;  5B40 D;  5CP6 D;  1P3L A;  1M18 C;  3O62 D;  5GSU D;  3AN2 B;  2Y2N A;  5C3I B;  4CAY A;  3WTP D;  3W98 B;  3KWQ A;  3H0L C;  4AWL B;  1ZLA C;  2DF4 C;  3AYW A;  4HGA C;  1KX4 B;  5AY8 B;  1HTA A;  1TAF A;  4YS3 C;  5B32 A;  2F2A C;  1ULY A;  3VH6 A;  4CSR A;  5JRG C;  3AV1 D;  2FJ7 C;  3AZM D;  3MGR D;  4M6B A;  3AV2 B;  4KUD C;  3V9R A;  3X1S B;  3A6N B;  5DNM A;  3UTB C;  3B6G A;  3LJA C;  3W96 A;  3AZF C;  2NQB C;  4YS3 A;  3REK D;  5JRG A;  3W98 D;  4J8W C;  4J8U D;  3B6F B;  3UT9 C;  5BO0 B;  5F99 C;  1AOI C;  5AY8 D;  4Z2M H;  2F8N D;  1P3P C;  2ZY2 A;  5BT1 C;  3AZH A;  3AV2 D;  1P3F D;  1R4V A;  3X1S D;  1KX5 C;  3WKJ A;  4H9N B;  4R8P A;  4EO5 C;  2Y2L A;  4H9P B;  3F6T A;  5B40 A;  4WU9 A;  4KGC C;  4H9O A;  3C1B D;  5GSU A;  2YFW B;  4J8V B;  5DNN C;  1P34 B;  3AZN B;  3B6F D;  2RVQ C;  2Y2Q A;  5JA4 B;  5CPK C;  5GXQ C;  3REI C;  3KXB C;  1M1A D;  2VQR A;  4NE6 A;  5AV6 B;  1F66 B;  3AZM A;  3WAA C;  3MGR A;  1M19 C;  3EG5 B;  1P34 D;  4XUJ D;  4J8V D;  3X1T C;  3LZ0 A;  3REJ C;  3REK A;  3MVD B;  3AZE A;  3NQJ A;  4ZBJ C;  4J8U A;  3REL C;  4H9R B;  4Z66 C;  3H0M C;  1B67 A;  5BNX A;  4YM6 A;  5KDM B;  5AV6 D;  3KSY A;  3NQU B;  1F66 D;  5AVC B;  2BYM A;  3REJ A;  1U35 B;  2F8N A;  3FDD A;  1P3F A;  3A1K A;  1P3O C;  1H3O A;  3AZK B;  2HIO A;  5B33 B;  4QLC B;  3MVD D;  4XZQ B;  5B31 B;  3VH5 A;  3C1C A;  2F8N H;  2PYO B;  3C1B A;  3X1V C;  5E5A B;  1BH9 B;  4ZUX C;  4WNN B;  5AVC D;  3AZG B;  5AVB C;  5GT3 B;  1P3K C;  1M1A A;  4G92 B;  3AZI C;  5B0Y C;  3AZK D;  1P3L B;  5B33 D;  4QLC D;  2PYO D;  4XZQ D;  5B31 D;  4CAY B;  4XUJ A;  5E5A D;  3KWQ B;  3VH5 W;  1Q9C A;  5AV8 A;  1KX3 A;  4NFT A;  1P3B C;  4J8X C;  3AZG D;  3AYW B;  5GT3 D;  4LD9 C;  5AV9 A;  1TAF B;  5B32 B;  3LEL C;  4CSR B;  3MGS C;  2ZY4 A;  5AV5 D;  1P3L D;  3V9R B;  5DNM B;  3B0D C;  1P3M C;  3UTA C;  3W96 B;  4YS3 B;  3W99 A;  5JRG B;  5B2I D;  3KWQ D;  2Y2K A;  3LZ1 C;  5B32 G;  3AYW D;  5CPJ C;  1N1J A;  4Z2M G;  3AZH B;  3MGP C;  1HQ3 C;  3WKJ B;  2Y2H A;  1AOI B;  1F1E A;  4R8P B;  4YS3 D;  1EQZ A;  5GT0 C;  5B40 B;  5JRG D;  4WU9 B;  4H9O B;  5B33 A;  3KUY C;  3UTB D;  3AZJ C;  3AZF D;  4UPK A;  2HUE C;  3A1I A;  2CV5 C;  3WKJ D;  1P3G C;  3R45 A;  1AOI D;  3AFA A;  4R8P D;  5AV5 A;  4WU9 D;  3MGR B;  5BT1 D;  3MNN C;  3W97 A;  3WA9 C;  1P3G A;  3LZ0 B;  4Z5T C;  4JJN C;  2LY8 A;  3REK B;  3AZE B;  3AZL C;  5B2I A;  3NQJ B;  2ARO A;  3B0C T;  4J8U B;  1M18 A;  5BNX B;  5DNN D;  4YM6 B;  1PZR A;  5FUG B;  3TU4 C;  2JE5 A;  4X23 C;  2BYM B;  2Y2J A;  3IP4 C;  3REJ B;  1P3I C;  2F8N B;  4Z66 B;  1P3F B;  1ZLA A;  5B0Z C;  2CWE A;  1H3O B;  5B1L C;  2HIO B;  4G91 B;  3LZ0 D;  3AZE D;  3C1C B;  2FJ7 A;  3C1B B;  5B1M C;  2F8N G;  4KUD A;  3UTB A;  5BNV B;  2NZD C;  4YM6 D;  3LJA A;  3AZF A;  2JSS A;  4E45 A;  2NQB A;  3REJ D;  4J8W A;  3UT9 A;  4Z66 D;  5F99 A;  2IO5 C;  1M1A B;  1TZY C;  1AOI A;  2HIO D;  5CPI C;  1P3P A;  3C1C D;  2ZY5 A;  3B0B A;  4XUJ B;  1KX5 A;  5AV8 B;  1KX3 B;  5BS7 C;  3MGQ C;  1S32 C;  1P3A C;  1ID3 C;  5AV9 B;  4KGC A;  5DNN A;  4DQY B;  2Y2O A;  5CP6 C;  3REH C;  3O62 C;  1P3K D;  5CPK A;  3W99 B;  5GXQ A;  3REI A;  3KXB A;  3X1U C;  5AV8 D;  3AZI D;  1KX3 D;  5B0Y D;  3WTP C;  2Y2I A;  3WAA A;  5AV9 D;  1M19 A;  4WJ3 C;  3VH6 T;  1N1J B;  3X1T A;  5FUG A;  2Y2M A;  2ZM5 A;  3AV1 C;  1WWI A;  1P3B D;  4J8X D;  3REL A;  4Z66 A;  3AN2 C;  3W99 D;  5CPJ B;  1EQZ B;  3EPJ A;  5C3I C;  3W98 C;  4AWL C;  5BNV A;  1KX4 C;  1P3O A;  5AY8 C;  3R45 B;  2YFV B;  3AFA B;  3AV2 C;  3X1V A;  2FFF B;  3A6N C;  3X1S C;  5CPJ D;  5CHL B;  5B31 G;  1EQZ D;  5AV5 B;  4ZUX A;  3MGP D;  5AVB A;  3W97 B;  1P3G B;  1P3K A;  3B6F C;  5B2I B;  2ARO B;  3AZI A;  5B0Y A;  1M18 B;  3KUY D;  3WA9 B;  3WTP E;  3AZJ D;  3AFA D;  1P3B A;  1ZLA B;  2BYK A;  4J8X A;  4KHA A;  4HGA B;  2CV5 D;  3W97 D;  1P3G D;  4LD9 A;  3KFU G;  4J8V C;  3LEL A;  3AZN C;  2FJ7 B;  2ARO D;  3MGS A;  1M18 D;  4KUD B;  5B2J C;  3UTB B;  3MNN D;  3LJA B;  1P3M A;  3UTA A;  3AZF B;  3WA9 D;  2NQB B;  3EPH A;  5AV6 C;  4J8W B;  1F66 C;  3LZ1 A;  3UT9 B;  2F8N K;  5F99 B;  5B2J A;  1ZLA D;  3TU4 D;  4H9Q A;  2ZY3 A;  5CPJ A;  1P3P B;  4NE3 A;  2FJ7 D;  2XD5 A;  3MVD C;  3MGP A;  1HQ3 A;  4KUD D;  2IO5 B;  1KX5 B;  3LJA D;  2NQB D;  4EO5 B;  1JFI A;  5B24 C;  5GT0 A;  4KGC B;  4J8W D;  5AVC C;  3UT9 D;  1U35 C;  5DNN B;  5F99 D;  3KUY A;  2NZD D;  2YFV A;  3AZJ A;  4DRA A;  3B0C W;  1P3P D;  3AZK C;  5CPK B;  5GXQ B;  1B6W A;  4QLC C;  4XZQ C;  5B31 C;  3KXB B;  3REI B;  2CV5 A;  1KX5 D;  1TZY D;  2PYO C;  5E5A C;  3WAA B;  3REH B;  4KGC D;  1M19 B;  3H0R C;  4H9S C;  3AZG C;  3X1T B;  3MNN A;  5GT3 C;  3X1U B;  3WA9 A;  2RVQ D;  4Z5T A;  4WU8 C;  4JJN A;  3AZL A;  4G92 C;  4ZBJ B;  2DQN C;  1P3L C;  3REL B;  1KU5 A;  5CPK D;  5GXQ D;  3REI D;  3KXB D;  3TU4 A;  2G5I C;  2G5H C;  4X23 A;  1P3I A;  3KWQ C;  3WAA D;  3REH D;  1M19 D;  3AYW C;  3X1T D;  5B0Z A;  1P3O B;  5B1L A;  3X1U D;  5B32 C;  3EPL A;  3REL D;  3X1V B;  5B1M A;  5DNM C;  3B6G C;  2NZD A;  3W96 C;  4ZUX B;  5AVB B;  1P3K B;  4UUZ A;  3AN2 D;  4WV4 B;  3AZI B;  1TZY A;  5B0Y B;  1P3O D;  5CPI A;  2W8S A;  5G49 A;  3AZH C;  3X1V D;  3WKJ C;  1Z2C B;  1KX4 D;  1P3B B;  3P5J B;  4R8P C;  5BS7 A;  4ZUX D;  2BYK B;  3MGQ A;  4J8X B;  1S32 A;  4KHA B;  5AVB D;  5B40 C;  4WU9 C;  1P3A A;  1ID3 A;  4LD9 B;  5GSU C;  1T3U A;  3VH6 W;  3LEL B;  3A6N D;  3MGS B;  3B0D B;  5CP6 A;  3UTA B;  1P3M B;  3REH A;  3O62 A;  3EPK A;  3X1U A;  3WTP A;  3LZ1 B;  5B2J B;  3AZM C;  3MGR C;  4H9Q B;  4LD9 D;  1WWS A;  3LEL D;  3LZ0 C;  3MGS D;  2BG1 A;  3REK C;  3AZE C;  1BH8 A;  1HQ3 B;  3MGP B;  3AV1 A;  4J8U C;  1P3M D;  3UTA D;  3AN2 A;  1JFI B;  4DRB A;  4YM6 C;  3AZN D;  5GT0 B;  3LZ1 D;  3KUY B;  5B2J D;  3W98 A;  3AZJ B;  1A7W A;  1P3F C;  5B24 B;  1KX4 A;  2HUE B;  5AY8 A;  2HIO C;  4G91 C;  2J8P A;  1HQ3 D;  3C1C C;  2CV5 B;  2JCH A;  3C1B C;  3AV2 A;  3X1S A;  3A6N A;  5GT0 D;  3MNN B;  4Z5T B;  3B6F A;  4JJN B;  5BO0 A;  3AZL B;  1M1A C;  5B24 D;  1U35 D;  3TU4 B;  1P34 C;  4XUJ C;  4WU8 B;  4X23 B;  1P3I B;  5AV8 C;  1KX3 C;  4H9N A; 
#chains in the Genus database with same CATH homology
 4H9P A;  5B0Z B;  5B1L B;  5AV9 C;  4Z5T D;  2YFW A;  4J8V A;  4JJN D;  1P34 A;  3AZN A;  3AZL D;  2UWX A;  2Y2G A;  5B1M B;  1BFM A;  2NZD B;  3AL0 C;  5JA4 A;  3W99 C;  4X23 D;  4WU8 D;  1P3I D;  5AV6 A;  3VH5 T;  1F66 A;  4UUZ B;  1W2E A;  3B6G B;  1TZY B;  2XD1 A;  5B0Z D;  5B1L D;  2RIQ A;  5CPI B;  5G49 B;  5B1M D;  3MVD A;  4H9R A;  3MGQ B;  1S32 B;  5B32 D;  1EQZ C;  1P3A B;  5B24 A;  4NE5 A;  1ID3 B;  5KDM A;  3NQU A;  5B33 C;  5AVC A;  1U35 A;  5DNM D;  3B6G D;  3W96 D;  5CPI D;  5CP6 B;  3AZK A;  3O62 B;  5GSU B;  2L5A A;  4QLC A;  2PYO A;  4XZQ A;  5B31 A;  3AFA C;  3WTP B;  5E5A A;  3MGQ D;  1S32 D;  2Y2P A;  1P3A D;  1BH9 A;  5AV5 C;  1ID3 D;  3AZH D;  4WNN A;  4H9S A;  3AZG A;  3W97 C;  5GT3 A;  4WU8 A;  3AV1 B;  1BH8 B;  5B2I C;  2ARO C;  4E44 A;  4WZS B;  3AZM B;  5B40 D;  5CP6 D;  1P3L A;  1M18 C;  3O62 D;  5GSU D;  3AN2 B;  2Y2N A;  5C3I B;  4CAY A;  3WTP D;  3W98 B;  3KWQ A;  3H0L C;  4AWL B;  1ZLA C;  2DF4 C;  3AYW A;  4HGA C;  1KX4 B;  5AY8 B;  1HTA A;  1TAF A;  4YS3 C;  5B32 A;  2F2A C;  1ULY A;  3VH6 A;  4CSR A;  5JRG C;  3AV1 D;  2FJ7 C;  3AZM D;  3MGR D;  4M6B A;  3AV2 B;  4KUD C;  3V9R A;  3X1S B;  3A6N B;  5DNM A;  3UTB C;  3B6G A;  3LJA C;  3W96 A;  3AZF C;  2NQB C;  4YS3 A;  3REK D;  5JRG A;  3W98 D;  4J8W C;  4J8U D;  3B6F B;  3UT9 C;  5BO0 B;  5F99 C;  1AOI C;  5AY8 D;  4Z2M H;  2F8N D;  1P3P C;  2ZY2 A;  5BT1 C;  3AZH A;  3AV2 D;  1P3F D;  1R4V A;  3X1S D;  1KX5 C;  3WKJ A;  4H9N B;  4R8P A;  4EO5 C;  2Y2L A;  4H9P B;  3F6T A;  5B40 A;  4WU9 A;  4KGC C;  4H9O A;  3C1B D;  5GSU A;  2YFW B;  4J8V B;  5DNN C;  1P34 B;  3AZN B;  3B6F D;  2RVQ C;  2Y2Q A;  5JA4 B;  5CPK C;  5GXQ C;  3REI C;  3KXB C;  1M1A D;  2VQR A;  4NE6 A;  5AV6 B;  1F66 B;  3AZM A;  3WAA C;  3MGR A;  1M19 C;  3EG5 B;  1P34 D;  4XUJ D;  4J8V D;  3X1T C;  3LZ0 A;  3REJ C;  3REK A;  3MVD B;  3AZE A;  3NQJ A;  4ZBJ C;  4J8U A;  3REL C;  4H9R B;  4Z66 C;  3H0M C;  1B67 A;  5BNX A;  4YM6 A;  5KDM B;  5AV6 D;  3KSY A;  3NQU B;  1F66 D;  5AVC B;  2BYM A;  3REJ A;  1U35 B;  2F8N A;  3FDD A;  1P3F A;  3A1K A;  1P3O C;  1H3O A;  3AZK B;  2HIO A;  5B33 B;  4QLC B;  3MVD D;  4XZQ B;  5B31 B;  3VH5 A;  3C1C A;  2F8N H;  2PYO B;  3C1B A;  3X1V C;  5E5A B;  1BH9 B;  4ZUX C;  4WNN B;  5AVC D;  3AZG B;  5AVB C;  5GT3 B;  1P3K C;  1M1A A;  4G92 B;  3AZI C;  5B0Y C;  3AZK D;  1P3L B;  5B33 D;  4QLC D;  2PYO D;  4XZQ D;  5B31 D;  4CAY B;  4XUJ A;  5E5A D;  3KWQ B;  3VH5 W;  1Q9C A;  5AV8 A;  1KX3 A;  4NFT A;  1P3B C;  4J8X C;  3AZG D;  3AYW B;  5GT3 D;  4LD9 C;  5AV9 A;  1TAF B;  5B32 B;  3LEL C;  4CSR B;  3MGS C;  2ZY4 A;  5AV5 D;  1P3L D;  3V9R B;  5DNM B;  3B0D C;  1P3M C;  3UTA C;  3W96 B;  4YS3 B;  3W99 A;  5JRG B;  5B2I D;  3KWQ D;  2Y2K A;  3LZ1 C;  5B32 G;  3AYW D;  5CPJ C;  1N1J A;  4Z2M G;  3AZH B;  3MGP C;  1HQ3 C;  3WKJ B;  2Y2H A;  1AOI B;  1F1E A;  4R8P B;  4YS3 D;  1EQZ A;  5GT0 C;  5B40 B;  5JRG D;  4WU9 B;  4H9O B;  5B33 A;  3KUY C;  3UTB D;  3AZJ C;  3AZF D;  4UPK A;  2HUE C;  3A1I A;  2CV5 C;  3WKJ D;  1P3G C;  3R45 A;  1AOI D;  3AFA A;  4R8P D;  5AV5 A;  4WU9 D;  3MGR B;  5BT1 D;  3MNN C;  3W97 A;  3WA9 C;  1P3G A;  3LZ0 B;  4Z5T C;  4JJN C;  2LY8 A;  3REK B;  3AZE B;  3AZL C;  5B2I A;  3NQJ B;  2ARO A;  3B0C T;  4J8U B;  1M18 A;  5BNX B;  5DNN D;  4YM6 B;  1PZR A;  5FUG B;  3TU4 C;  2JE5 A;  4X23 C;  2BYM B;  2Y2J A;  3IP4 C;  3REJ B;  1P3I C;  2F8N B;  4Z66 B;  1P3F B;  1ZLA A;  5B0Z C;  2CWE A;  1H3O B;  5B1L C;  2HIO B;  4G91 B;  3LZ0 D;  3AZE D;  3C1C B;  2FJ7 A;  3C1B B;  5B1M C;  2F8N G;  4KUD A;  3UTB A;  5BNV B;  2NZD C;  4YM6 D;  3LJA A;  3AZF A;  2JSS A;  4E45 A;  2NQB A;  3REJ D;  4J8W A;  3UT9 A;  4Z66 D;  5F99 A;  2IO5 C;  1M1A B;  1TZY C;  1AOI A;  2HIO D;  5CPI C;  1P3P A;  3C1C D;  2ZY5 A;  3B0B A;  4XUJ B;  1KX5 A;  5AV8 B;  1KX3 B;  5BS7 C;  3MGQ C;  1S32 C;  1P3A C;  1ID3 C;  5AV9 B;  4KGC A;  5DNN A;  4DQY B;  2Y2O A;  5CP6 C;  3REH C;  3O62 C;  1P3K D;  5CPK A;  3W99 B;  5GXQ A;  3REI A;  3KXB A;  3X1U C;  5AV8 D;  3AZI D;  1KX3 D;  5B0Y D;  3WTP C;  2Y2I A;  3WAA A;  5AV9 D;  1M19 A;  4WJ3 C;  3VH6 T;  1N1J B;  3X1T A;  5FUG A;  2Y2M A;  2ZM5 A;  3AV1 C;  1WWI A;  1P3B D;  4J8X D;  3REL A;  4Z66 A;  3AN2 C;  3W99 D;  5CPJ B;  1EQZ B;  3EPJ A;  5C3I C;  3W98 C;  4AWL C;  5BNV A;  1KX4 C;  1P3O A;  5AY8 C;  3R45 B;  2YFV B;  3AFA B;  3AV2 C;  3X1V A;  2FFF B;  3A6N C;  3X1S C;  5CPJ D;  5CHL B;  5B31 G;  1EQZ D;  5AV5 B;  4ZUX A;  3MGP D;  5AVB A;  3W97 B;  1P3G B;  1P3K A;  3B6F C;  5B2I B;  2ARO B;  3AZI A;  5B0Y A;  1M18 B;  3KUY D;  3WA9 B;  3WTP E;  3AZJ D;  3AFA D;  1P3B A;  1ZLA B;  2BYK A;  4J8X A;  4KHA A;  4HGA B;  2CV5 D;  3W97 D;  1P3G D;  4LD9 A;  3KFU G;  4J8V C;  3LEL A;  3AZN C;  2FJ7 B;  2ARO D;  3MGS A;  1M18 D;  4KUD B;  5B2J C;  3UTB B;  3MNN D;  3LJA B;  1P3M A;  3UTA A;  3AZF B;  3WA9 D;  2NQB B;  3EPH A;  5AV6 C;  4J8W B;  1F66 C;  3LZ1 A;  3UT9 B;  2F8N K;  5F99 B;  5B2J A;  1ZLA D;  3TU4 D;  4H9Q A;  2ZY3 A;  5CPJ A;  1P3P B;  4NE3 A;  2FJ7 D;  2XD5 A;  3MVD C;  3MGP A;  1HQ3 A;  4KUD D;  2IO5 B;  1KX5 B;  3LJA D;  2NQB D;  4EO5 B;  1JFI A;  5B24 C;  5GT0 A;  4KGC B;  4J8W D;  5AVC C;  3UT9 D;  1U35 C;  5DNN B;  5F99 D;  3KUY A;  2NZD D;  2YFV A;  3AZJ A;  4DRA A;  3B0C W;  1P3P D;  3AZK C;  5CPK B;  5GXQ B;  1B6W A;  4QLC C;  4XZQ C;  5B31 C;  3KXB B;  3REI B;  2CV5 A;  1KX5 D;  1TZY D;  2PYO C;  5E5A C;  3WAA B;  3REH B;  4KGC D;  1M19 B;  3H0R C;  4H9S C;  3AZG C;  3X1T B;  3MNN A;  5GT3 C;  3X1U B;  3WA9 A;  2RVQ D;  4Z5T A;  4WU8 C;  4JJN A;  3AZL A;  4G92 C;  4ZBJ B;  2DQN C;  1P3L C;  3REL B;  1KU5 A;  5CPK D;  5GXQ D;  3REI D;  3KXB D;  3TU4 A;  2G5I C;  2G5H C;  4X23 A;  1P3I A;  3KWQ C;  3WAA D;  3REH D;  1M19 D;  3AYW C;  3X1T D;  5B0Z A;  1P3O B;  5B1L A;  3X1U D;  5B32 C;  3EPL A;  3REL D;  3X1V B;  5B1M A;  5DNM C;  3B6G C;  2NZD A;  3W96 C;  4ZUX B;  5AVB B;  1P3K B;  4UUZ A;  3AN2 D;  4WV4 B;  3AZI B;  1TZY A;  5B0Y B;  1P3O D;  5CPI A;  2W8S A;  5G49 A;  3AZH C;  3X1V D;  3WKJ C;  1Z2C B;  1KX4 D;  1P3B B;  3P5J B;  4R8P C;  5BS7 A;  4ZUX D;  2BYK B;  3MGQ A;  4J8X B;  1S32 A;  4KHA B;  5AVB D;  5B40 C;  4WU9 C;  1P3A A;  1ID3 A;  4LD9 B;  5GSU C;  1T3U A;  3VH6 W;  3LEL B;  3A6N D;  3MGS B;  3B0D B;  5CP6 A;  3UTA B;  1P3M B;  3REH A;  3O62 A;  3EPK A;  3X1U A;  3WTP A;  3LZ1 B;  5B2J B;  3AZM C;  3MGR C;  4H9Q B;  4LD9 D;  1WWS A;  3LEL D;  3LZ0 C;  3MGS D;  2BG1 A;  3REK C;  3AZE C;  1BH8 A;  1HQ3 B;  3MGP B;  3AV1 A;  4J8U C;  1P3M D;  3UTA D;  3AN2 A;  1JFI B;  4DRB A;  4YM6 C;  3AZN D;  5GT0 B;  3LZ1 D;  3KUY B;  5B2J D;  3W98 A;  3AZJ B;  1A7W A;  1P3F C;  5B24 B;  1KX4 A;  2HUE B;  5AY8 A;  2HIO C;  4G91 C;  2J8P A;  1HQ3 D;  3C1C C;  2CV5 B;  2JCH A;  3C1B C;  3AV2 A;  3X1S A;  3A6N A;  5GT0 D;  3MNN B;  4Z5T B;  3B6F A;  4JJN B;  5BO0 A;  3AZL B;  1M1A C;  5B24 D;  1U35 D;  3TU4 B;  1P34 C;  4XUJ C;  4WU8 B;  4X23 B;  1P3I B;  5AV8 C;  1KX3 C;  4H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...