3NQUA

Crystal structure of partially trypsinized (cenp-a/h4)2 heterotetramer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
b'HLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nquA00
3X1UC 2PYOB 3B0DB 5B31A 3LJAB 3KSYA 1HQ3A 3MGSA 3UTBB 4CAYA 4XZQC 1P3PA 5AV9D 4X23B 2NZDD 3C1BA 2NQBC 2AROB 4Z5TB 3O62A 3VH5T 5B31C 1P3IA 3LJAD 1P3FB 5DNMC 1BH9A 1P3BB 1HQ3C 4EO5B 5AV5A 4H9RB 3UTBD 3AV1B 1ZLAB 4X23D 2AROD 4Z5TD 5B40B 3C1BC 3O62C 3RELB 3REJB 1P3FD 4WU9A 1M19A 1P3BD 3C1CA 5AV5C 1ZLAD 5FUGB 3RELD 5B40D 3AZLD 3REJD 5GXQB 3NQJA 1S32B 5JRGD 3MNNA 3MGRB 1M19C 3C1CC 5CPIA 5G49A 5CPJD 4R8PA 5GXQD 1S32D 5B0YB 4WNNA 3MNNC 1EQZB 3AFAA 4JJNA 2F8NA 5CPIC 5B32A 4R8PC 5B0YD 1KX5A 3KXBB 1EQZD 5B2JB 3AV2B 3AZNA 3LELB 3B6FA 1P3AB 1KX5C 3REHA 3AV2D 5B33A 5CP6A 3UTAB 1WWIA 1P3AD 2BYMA 3B6FC 4DRAA 3VH5A 2PYOA 3LZ0B 3LJAA 5DNNB 3REHC 3AYWA 5B33C 4E44A 5CP6C 3UTAD 3W97B 3W98B 4WU8B 4X23A 3X1VB 4G92C 3WA9B 1P3LB 3LZ0D 2PYOC 4NE3A 5DNND 1P3FA 3AYWC 3W97D 5AV6A 3TU4B 3AV1A 3W98D 3X1VD 4CSRB 4XUJA 5B40A 3WA9D 1P3LD 5B31G 1KX4B 4NE6A 2L5AA 3AZED 3TU4D 4EO5C 5AV6C 3AV1C 5AVBA 4XUJC 1KX4D 4XZQB 3MVDD 3X1UD 2NQBB 3MGRA 5B31B 3WTPA 5DNMB 1HQ3B 5AVBC 4XZQD 4M6BA 3C1BB 4ZBJC 3O62B 5B31D 1EQZA 3WTPC 1HQ3D 3W96C 3C1BD 3O62D 2YFWA 4H9PB 3KXBA 5B2JA 1M1AC 1M19B 5AV5D 3LELA 5JA4A 3C1CB 3KXBC 3NQJB 5B2JC 2F8NG 1M19D 3MNNB 5B32G 3C1CD 3UTAA 2F8NH 3LELC 5CPIB 4R8PB 3W99A 4WNNB 3MNND 4WU8A 5BNXA 3X1VA 2F8NB 5CPID 4R8PD 3WA9A 1P3LA 3W99C 4Z66C 1KX5B 2BYKA 5B24A 5AVCA 2F8ND 5GT0A 1TZYB 4WU8C 3B6FB 1KX5D 5B24C 5AVCC 5GT0C 5CP6B 3AZND 3B6FD 3VH5W 2BYMB 2NQBA 4G92B 3REHD 5B33D 3AYWB 5DNMA 1WWSA 5CP6D 1KU5A 3AN2A 3LZ1C 2PYOD 3AYWD 3VH6A 3AZIA 5AV6B 4XUJB 1B6WA 4H9PA 3AN2C 5AY8A 5AV6D 3AV1D 3AZIC 5C3IC 4XUJD 5AVBB 3AZGB 4ZUXA 3X1SA 4ZBJB 5AY8C 1P3OC 3WTPB 5AVBD 4UUZB 3W96B 2HUEC 4ZUXC 3X1SC 3MGRD 3WTPD 3NQUB 2FJ7C 1M1AB 2HIOA 3AZKA 3W96D 2CV5A 2YFWB 5CPKB 1AOIC 1M1AD 1TZYA 4KUDC 2HIOC 3AZKC 5JA4B 2CV5C 3KXBD 5AV8A 5B2JD 3R45A 1TZYC 4G91C 3LELD 5B2IA 4HGAC 3W99B 5AV8C 1JFIB 4Z66B 3WKJA 3MGPC 3AZMA 1U35A 5BNXB 5B2IC 1KX3A 4YM6A 3W99D 4Z66D 3WKJC 2BYKB 5B24B 1HTAA 3B0CT 5AVCB 3AZMC 3X1TC 4WU8D 1U35C 5GT0B 1KX3C 4YM6C 3AZFC 3B6GC 1H3OA 5B24D 4DRBA 5AVCD 5GT0D 5F99C 4KGCA 2F8NK 5E5AA 3AZGA 3LZ1B 1F66B 1BH8A 5B1LA 4UUZA 4KGCC 4QLCA 5E5AC 3W96A 3AZGC 4H9QA 2NQBD 3A6NC 3AN2B 3VH6W 3NQUA 4H9OA 5DNMD 1M1AA 5B1LC 3AZIB 4QLCC 5C3IB 4E45A 3AN2D 4J8VA 4LD9A 5CPKA 3KUYA 3AZHA 1P3GB 5AY8B 3AZID 1P3OB 4J8VC 2HUEB 4LD9C 4ZUXB 5CPKC 3KUYC 3X1SB 5AY8D 3AZHC 5BO0B 1P3OD 2FJ7B 5BS7A 1JFIA 4ZUXD 4Z66A 3X1SD 5GSUC 1AOIB 4KUDB 2HIOB 5BS7C 4J8XA 1N1JA 3AZKB 4YS3A 2CV5B 3V9RB 4WZSB 5KDMB 2IO5B 3REIA 1AOID 4KUDD 2HIOD 4G91B 3AZKD 4J8XC 5B1MA 2CV5D 4YS3C 4HGAB 5AV8B 3MGQB 3REIC 4AWLC 3MGPB 1TZYD 3R45B 1P34A 3KWQB 5B1MC 5B2IB 3LZ1A 1F66A 5AV8D 3WKJB 1B67A 3MGPD 3REKA 3AZMB 1P34C 3X1TB 1U35B 5B2ID 1KX3B 4YM6B 3AZFB 1F66C 3B6GB 3WKJD 1M18C 3AZMD 3X1TD 3REKC 1U35D 5F99B 4NFTA 1KX3D 4J8WA 4YM6D 3AZFD 3B6GD 1H3OB 1P3GA 1P3OA 5F99D 4KGCB 2NZDB 5E5AB 4J8WC 3A6NB 1BH8B 5BO0A 1P3GC 5BT1C 2FJ7A 4KGCD 5B1LB 5E5AD 4QLCB 3AZGD 3A6ND 4H9QB 4H9NA 5GT3A 1R4VA 1AOIA 3MGSC 4H9OB 2CWEA 5B1LD 4KUDA 1P3PC 4QLCD 3AZLB 3V9RA 1P3IC 5GT3C 4J8VB 5JRGB 5KDMA 4LD9B 3KUYB 3AZHB 2YFVB 5CPJB 5B0ZA 3AZJA 4J8VD 3MGQA 4LD9D 4WU9C 3KUYD 5CPKD 2RVQC 2IO5C 4J8UA 3MGPA 5GSUB 3UT9A 3AZHD 3KWQA 4Z2MG 5B0ZC 4KHAB 3AZJC 4Z2MH 3MGQC 3B0CW 5GSUD 4J8UC 3UT9C 3KWQC 3X1TA 1P3KA 1Q9CA 4J8XB 1N1JB 3AZFA 1ID3A 3B6GA 3WAAA 4YS3B 1P3MA 3AFAC 4JJNC 3REIB 4AWLB 5B32C 1P3KC 5F99A 4J8XD 4H9SA 3WAAC 5B1MB 1ID3C 4YS3D 1P3MC 3REID 3AZNC 5AV9A 4NE5A 5BNVB 2NZDA 1P34B 5B1MD 4H9SC 3A6NA 3UTBA 5AV9C 2AROA 1TAFB 4Z5TA 3REKB 1P34D 1M18B 2NZDC 3B0DC 2LY8A 3LZ1D 3LJAC 3WTPE 1F66D 3AZEB 1P3BA 4H9RA 1F1EA 3UTBC 1ZLAA 1M18D 4X23C 3RELA 3REKD 2AROC 4Z5TC 3REJA 3AZLA 3MVDB 3X1UB 4J8WB 5JRGA 1P3FC 3B0BA 1P3BC 4WV4B 5FUGA 1ZLAC 2YFVA 2JSSA 3RELC 5B40C 5CPJA 5GXQA 3AZLC 3REJC 1S32A 4J8WD 5JRGC 1BFMA 5GSUA 1P3GD 5BT1D 3MGSB 4CAYB 5CPJC 5GXQC 1P3PB 1S32C 4KHAA 5B0YA 3MGRC 1P3IB 4H9NB 5GT3B 5CHLB 1BH9B 3MGSD 5AV5B 2FJ7D 1P3PD 5B0YC 1ULYA 1P3ID 1EQZC 3AV2A 5GT3D 3VH6T 4WU9B 1P3AA 5B0ZB 3AZJB 3AV2C 4WU9D 2RVQD 4J8UB 3UT9B 1P3AC 5BNVA 1A7WA 5G49B 5B0ZD 3LZ0A 3AZJD 5DNNA 3MGQD 3W97A 3UTAC 3W98A 4J8UD 3UT9D 3AFAB 4JJNB 1M18A 1TAFA 3KWQD 5B32B 1P3KB 3LZ0C 5DNNC 3WAAB 3AZEA 1ID3B 3TU4A 3W97C 3AFAD 3W98C 4CSRA 4JJND 1P3MB 3X1VC 3AZNB 1KX4A 5B32D 1P3KD 3WA9C 1P3LC 3MVDA 3X1UA 3WAAD 1ID3D 3AZEC 3TU4C 3REHB 5B33B 1P3MD 1KX4C 4XZQA 3MVDC 5AV9B
chains in the Genus database with same CATH superfamily
3X1UC 2Y2LA 2PYOB 3B0DB 5B31A 3LJAB 3KSYA 1HQ3A 3MGSA 3UTBB 4CAYA 4XZQC 1P3PA 5AV9D 4X23B 2NZDD 3C1BA 2NQBC 2AROB 4Z5TB 3O62A 3VH5T 5B31C 1P3IA 3LJAD 1P3FB 5DNMC 1BH9A 1P3BB 1HQ3C 4EO5B 5AV5A 4H9RB 3UTBD 3AV1B 1Z2CB 1ZLAB 4X23D 2AROD 4Z5TD 5B40B 3C1BC 3O62C 3RELB 3REJB 1P3FD 4WU9A 1M19A 1P3BD 3C1CA 5AV5C 1ZLAD 5FUGB 3RELD 5B40D 3AZLD 3REJD 5GXQB 3NQJA 1S32B 3AL0C 5JRGD 3MNNA 3MGRB 1M19C 3C1CC 5CPIA 5G49A 5CPJD 4R8PA 5GXQD 2ZY5A 1S32D 5B0YB 3P5JB 4WNNA 3MNNC 1EQZB 3AFAA 4JJNA 2F8NA 5CPIC 5B32A 4R8PC 2F2AC 5B0YD 2Y2PA 1KX5A 3KXBB 1EQZD 5B2JB 3AV2B 3AZNA 3LELB 3B6FA 1P3AB 1KX5C 3REHA 3AV2D 5B33A 5CP6A 3UTAB 1WWIA 1P3AD 2BYMA 3B6FC 4DRAA 3VH5A 2PYOA 3LZ0B 3LJAA 5DNNB 3REHC 3AYWA 5B33C 4E44A 5CP6C 3UTAD 3W97B 3W98B 4WU8B 4X23A 3X1VB 4G92C 3WA9B 1P3LB 3LZ0D 2PYOC 4NE3A 5DNND 1P3FA 3AYWC 3W97D 5AV6A 3TU4B 2VQRA 3AV1A 3W98D 3X1VD 4CSRB 4XUJA 5B40A 3WA9D 1P3LD 5B31G 1KX4B 3EPKA 4NE6A 2L5AA 3AZED 2W8SA 3TU4D 4EO5C 5AV6C 3AV1C 5AVBA 4XUJC 1KX4D 2Y2NA 4XZQB 3MVDD 3X1UD 2NQBB 3MGRA 5B31B 3WTPA 5DNMB 1HQ3B 5AVBC 4XZQD 3IP4C 4M6BA 3C1BB 4ZBJC 3O62B 5B31D 1EQZA 3WTPC 1HQ3D 3W96C 3C1BD 3O62D 2YFWA 4H9PB 3KXBA 5B2JA 1M1AC 1M19B 5AV5D 3LELA 5JA4A 3C1CB 3KXBC 3EPLA 3NQJB 5B2JC 2F8NG 1M19D 3MNNB 5B32G 3C1CD 3UTAA 2F8NH 3LELC 5CPIB 4R8PB 3W99A 4WNNB 3MNND 4WU8A 5BNXA 3X1VA 2F8NB 5CPID 4R8PD 3WA9A 1P3LA 3W99C 4Z66C 1KX5B 2BYKA 5B24A 5AVCA 2F8ND 5GT0A 1TZYB 4WU8C 3B6FB 1KX5D 2G5IC 5B24C 2XD1A 5AVCC 5GT0C 5CP6B 3AZND 3B6FD 3VH5W 2BYMB 2NQBA 4G92B 3REHD 5B33D 3AYWB 5DNMA 1WWSA 5CP6D 1KU5A 3AN2A 3LZ1C 2PYOD 3AYWD 3VH6A 3AZIA 5AV6B 4XUJB 1B6WA 4H9PA 3AN2C 5AY8A 5AV6D 3AV1D 3AZIC 5C3IC 4XUJD 3H0MC 5AVBB 3AZGB 4ZUXA 3X1SA 3F6TA 4ZBJB 5AY8C 1P3OC 3WTPB 5AVBD 4UUZB 3W96B 2HUEC 4ZUXC 3X1SC 3MGRD 3WTPD 3NQUB 2FJ7C 1M1AB 2HIOA 3AZKA 3W96D 2Y2MA 2CV5A 2YFWB 5CPKB 1AOIC 1M1AD 1TZYA 4KUDC 2HIOC 3A1IA 3AZKC 5JA4B 2CV5C 3KXBD 2ZY4A 5AV8A 5B2JD 3R45A 1TZYC 4G91C 3LELD 5B2IA 4HGAC 3W99B 5AV8C 3FDDA 2Y2HA 4Z66B 1JFIB 3WKJA 3MGPC 3AZMA 3EG5B 1U35A 5BNXB 5B2IC 1KX3A 4YM6A 3W99D 4Z66D 3WKJC 2BYKB 2Y2GA 5B24B 1HTAA 2JCHA 3B0CT 5AVCB 3AZMC 3X1TC 4WU8D 1U35C 5GT0B 1KX3C 4YM6C 3AZFC 3B6GC 1H3OA 5B24D 4DRBA 5AVCD 5GT0D 5F99C 4KGCA 2F8NK 5E5AA 3AZGA 3LZ1B 1F66B 1BH8A 5B1LA 4UUZA 4KGCC 4QLCA 5E5AC 3W96A 3AZGC 4H9QA 2NQBD 3A6NC 3AN2B 3VH6W 1W2EA 3NQUA 4H9OA 5DNMD 1M1AA 5B1LC 2DQNC 3AZIB 4QLCC 5C3IB 4E45A 3AN2D 4J8VA 4LD9A 5CPKA 3KUYA 2FFFB 3AZHA 1P3GB 5AY8B 3AZID 1P3OB 4J8VC 2HUEB 4LD9C 4ZUXB 5CPKC 3KUYC 3A1KA 3X1SB 2JE5A 5AY8D 3AZHC 5BO0B 1P3OD 2FJ7B 5BS7A 1JFIA 4ZUXD 4Z66A 3X1SD 5GSUC 1AOIB 4KUDB 2HIOB 5BS7C 4J8XA 1N1JA 3AZKB 4YS3A 2CV5B 3V9RB 4WZSB 3EPHA 5KDMB 2IO5B 3REIA 1AOID 4KUDD 2HIOD 4G91B 3AZKD 4J8XC 5B1MA 2CV5D 1PZRA 4YS3C 4HGAB 5AV8B 3MGQB 3REIC 4AWLC 3MGPB 1TZYD 3R45B 1P34A 3KWQB 5B1MC 5B2IB 3LZ1A 1F66A 5AV8D 3WKJB 1B67A 3MGPD 2DF4C 3REKA 3AZMB 1P34C 3X1TB 1U35B 5B2ID 1KX3B 4YM6B 3AZFB 1F66C 3B6GB 3WKJD 4UPKA 3AZMD 1M18C 3X1TD 3REKC 1U35D 5F99B 4NFTA 1KX3D 4J8WA 4YM6D 3AZFD 3B6GD 1H3OB 1P3GA 1P3OA 5F99D 4KGCB 2NZDB 5E5AB 4J8WC 3A6NB 1BH8B 5BO0A 1P3GC 5BT1C 2FJ7A 4KGCD 5B1LB 5E5AD 4QLCB 3AZGD 3A6ND 4H9QB 4H9NA 5GT3A 1R4VA 1AOIA 3MGSC 4H9OB 2CWEA 5B1LD 4KUDA 1P3PC 4QLCD 3AZLB 3V9RA 1P3IC 5GT3C 4J8VB 5JRGB 5KDMA 4LD9B 3KUYB 2ZY2A 3AZHB 2YFVB 5CPJB 5B0ZA 3AZJA 4J8VD 3MGQA 4LD9D 4WU9C 3KUYD 5CPKD 2RVQC 2IO5C 4J8UA 3MGPA 5GSUB 3UT9A 3AZHD 3KWQA 4Z2MG 5B0ZC 4KHAB 3AZJC 4Z2MH 3MGQC 3B0CW 5GSUD 3EPJA 4J8UC 3UT9C 3KWQC 3X1TA 1P3KA 1Q9CA 4J8XB 1N1JB 3AZFA 1ID3A 3B6GA 3WAAA 4YS3B 2G5HC 1P3MA 3AFAC 4JJNC 3REIB 4AWLB 5B32C 1P3KC 5F99A 2Y2JA 4J8XD 4H9SA 3WAAC 5B1MB 1ID3C 4YS3D 1P3MC 3REID 3AZNC 2XD5A 5AV9A 4NE5A 5BNVB 2NZDA 1P34B 5B1MD 4H9SC 3A6NA 3UTBA 2Y2KA 5AV9C 2AROA 1TAFB 4Z5TA 3REKB 1P34D 1M18B 2NZDC 3B0DC 4DQYB 2LY8A 3LZ1D 3LJAC 3WTPE 1F66D 3AZEB 1P3BA 4H9RA 1F1EA 3UTBC 1ZLAA 1T3UA 1M18D 4X23C 3RELA 3REKD 2AROC 4Z5TC 3REJA 3AZLA 3MVDB 3X1UB 4J8WB 2J8PA 5JRGA 1P3FC 3B0BA 1P3BC 2RIQA 4WV4B 5FUGA 1ZLAC 2YFVA 3KFUG 2JSSA 3RELC 5B40C 5CPJA 5GXQA 3AZLC 3REJC 1S32A 4J8WD 2ZY3A 5JRGC 1BFMA 4WJ3C 5GSUA 1P3GD 5BT1D 3MGSB 4CAYB 5CPJC 5GXQC 1P3PB 2BG1A 4KHAA 5B0YA 1S32C 3MGRC 1P3IB 3H0RC 4H9NB 5GT3B 5CHLB 1BH9B 3MGSD 5AV5B 2FJ7D 1P3PD 5B0YC 1ULYA 1P3ID 1EQZC 3AV2A 5GT3D 3VH6T 4WU9B 2UWXA 1P3AA 5B0ZB 3AZJB 3H0LC 3AV2C 4WU9D 2RVQD 4J8UB 2Y2IA 2Y2QA 3UT9B 1P3AC 5BNVA 1A7WA 5G49B 2ZM5A 5B0ZD 3LZ0A 3AZJD 5DNNA 3MGQD 3W97A 3UTAC 3W98A 4J8UD 3UT9D 3AFAB 4JJNB 1M18A 1TAFA 3KWQD 5B32B 1P3KB 3LZ0C 5DNNC 3WAAB 3AZEA 1ID3B 3TU4A 3W97C 3AFAD 3W98C 4CSRA 4JJND 1P3MB 3X1VC 3AZNB 1KX4A 5B32D 1P3KD 3WA9C 1P3LC 3MVDA 3X1UA 3WAAD 1ID3D 3AZEC 3TU4C 2Y2OA 3REHB 5B33B 1P3MD 1KX4C 4XZQA 3MVDC 5AV9B
chains in the Genus database with same CATH topology
3X1UC 2Y2LA 2PYOB 3B0DB 5B31A 3LJAB 3KSYA 1HQ3A 3MGSA 3UTBB 4CAYA 4XZQC 1P3PA 5AV9D 4X23B 2NZDD 3C1BA 2NQBC 2AROB 4Z5TB 3O62A 3VH5T 5B31C 1P3IA 3LJAD 1P3FB 5DNMC 1BH9A 1P3BB 1HQ3C 4EO5B 5AV5A 4H9RB 3UTBD 3AV1B 1Z2CB 1ZLAB 4X23D 2AROD 4Z5TD 5B40B 3C1BC 3O62C 3RELB 3REJB 1P3FD 4WU9A 1M19A 1P3BD 3C1CA 5AV5C 1ZLAD 5FUGB 3RELD 5B40D 3AZLD 3REJD 5GXQB 3NQJA 1S32B 3AL0C 5JRGD 3MNNA 3MGRB 1M19C 3C1CC 5CPIA 5G49A 5CPJD 4R8PA 5GXQD 2ZY5A 1S32D 5B0YB 3P5JB 4WNNA 3MNNC 1EQZB 3AFAA 4JJNA 2F8NA 5CPIC 5B32A 4R8PC 2F2AC 5B0YD 2Y2PA 1KX5A 3KXBB 1EQZD 5B2JB 3AV2B 3AZNA 3LELB 3B6FA 1P3AB 1KX5C 3REHA 3AV2D 5B33A 5CP6A 3UTAB 1WWIA 1P3AD 2BYMA 3B6FC 4DRAA 3VH5A 2PYOA 3LZ0B 3LJAA 5DNNB 3REHC 3AYWA 5B33C 4E44A 5CP6C 3UTAD 3W97B 3W98B 4WU8B 4X23A 3X1VB 4G92C 3WA9B 1P3LB 3LZ0D 2PYOC 4NE3A 5DNND 1P3FA 3AYWC 3W97D 5AV6A 3TU4B 2VQRA 3AV1A 3W98D 3X1VD 4CSRB 4XUJA 5B40A 3WA9D 1P3LD 5B31G 1KX4B 3EPKA 4NE6A 2L5AA 3AZED 2W8SA 3TU4D 4EO5C 5AV6C 3AV1C 5AVBA 4XUJC 1KX4D 2Y2NA 4XZQB 3MVDD 3X1UD 2NQBB 3MGRA 5B31B 3WTPA 5DNMB 1HQ3B 5AVBC 4XZQD 3IP4C 4M6BA 3C1BB 4ZBJC 3O62B 5B31D 1EQZA 3WTPC 1HQ3D 3W96C 3C1BD 3O62D 2YFWA 4H9PB 3KXBA 5B2JA 1M1AC 1M19B 5AV5D 3LELA 5JA4A 3C1CB 3KXBC 3EPLA 3NQJB 5B2JC 2F8NG 1M19D 3MNNB 5B32G 3C1CD 3UTAA 2F8NH 3LELC 5CPIB 4R8PB 3W99A 4WNNB 3MNND 4WU8A 5BNXA 3X1VA 2F8NB 5CPID 4R8PD 3WA9A 1P3LA 3W99C 4Z66C 1KX5B 2BYKA 5B24A 5AVCA 2F8ND 5GT0A 1TZYB 4WU8C 3B6FB 1KX5D 2G5IC 5B24C 2XD1A 5AVCC 5GT0C 5CP6B 3AZND 3B6FD 3VH5W 2BYMB 2NQBA 4G92B 3REHD 5B33D 3AYWB 5DNMA 1WWSA 5CP6D 1KU5A 3AN2A 3LZ1C 2PYOD 3AYWD 3VH6A 3AZIA 5AV6B 4XUJB 1B6WA 4H9PA 3AN2C 5AY8A 5AV6D 3AV1D 3AZIC 5C3IC 4XUJD 3H0MC 5AVBB 3AZGB 4ZUXA 3X1SA 3F6TA 4ZBJB 5AY8C 1P3OC 3WTPB 5AVBD 4UUZB 3W96B 2HUEC 4ZUXC 3X1SC 3MGRD 3WTPD 3NQUB 2FJ7C 1M1AB 2HIOA 3AZKA 3W96D 2Y2MA 2CV5A 2YFWB 5CPKB 1AOIC 1M1AD 1TZYA 4KUDC 2HIOC 3A1IA 3AZKC 5JA4B 2CV5C 3KXBD 2ZY4A 5AV8A 5B2JD 3R45A 1TZYC 4G91C 3LELD 5B2IA 4HGAC 3W99B 5AV8C 3FDDA 2Y2HA 4Z66B 1JFIB 3WKJA 3MGPC 3AZMA 3EG5B 1U35A 5BNXB 5B2IC 1KX3A 4YM6A 3W99D 4Z66D 3WKJC 2BYKB 2Y2GA 5B24B 1HTAA 2JCHA 3B0CT 5AVCB 3AZMC 3X1TC 4WU8D 1U35C 5GT0B 1KX3C 4YM6C 3AZFC 3B6GC 1H3OA 5B24D 4DRBA 5AVCD 5GT0D 5F99C 4KGCA 2F8NK 5E5AA 3AZGA 3LZ1B 1F66B 1BH8A 5B1LA 4UUZA 4KGCC 4QLCA 5E5AC 3W96A 3AZGC 4H9QA 2NQBD 3A6NC 3AN2B 3VH6W 1W2EA 3NQUA 4H9OA 5DNMD 1M1AA 5B1LC 2DQNC 3AZIB 4QLCC 5C3IB 4E45A 3AN2D 4J8VA 4LD9A 5CPKA 3KUYA 2FFFB 3AZHA 1P3GB 5AY8B 3AZID 1P3OB 4J8VC 2HUEB 4LD9C 4ZUXB 5CPKC 3KUYC 3A1KA 3X1SB 2JE5A 5AY8D 3AZHC 5BO0B 1P3OD 2FJ7B 5BS7A 1JFIA 4ZUXD 4Z66A 3X1SD 5GSUC 1AOIB 4KUDB 2HIOB 5BS7C 4J8XA 1N1JA 3AZKB 4YS3A 2CV5B 3V9RB 4WZSB 3EPHA 5KDMB 2IO5B 3REIA 1AOID 4KUDD 2HIOD 4G91B 3AZKD 4J8XC 5B1MA 2CV5D 1PZRA 4YS3C 4HGAB 5AV8B 3MGQB 3REIC 4AWLC 3MGPB 1TZYD 3R45B 1P34A 3KWQB 5B1MC 5B2IB 3LZ1A 1F66A 5AV8D 3WKJB 1B67A 3MGPD 2DF4C 3REKA 3AZMB 1P34C 3X1TB 1U35B 5B2ID 1KX3B 4YM6B 3AZFB 1F66C 3B6GB 3WKJD 4UPKA 3AZMD 1M18C 3X1TD 3REKC 1U35D 5F99B 4NFTA 1KX3D 4J8WA 4YM6D 3AZFD 3B6GD 1H3OB 1P3GA 1P3OA 5F99D 4KGCB 2NZDB 5E5AB 4J8WC 3A6NB 1BH8B 5BO0A 1P3GC 5BT1C 2FJ7A 4KGCD 5B1LB 5E5AD 4QLCB 3AZGD 3A6ND 4H9QB 4H9NA 5GT3A 1R4VA 1AOIA 3MGSC 4H9OB 2CWEA 5B1LD 4KUDA 1P3PC 4QLCD 3AZLB 3V9RA 1P3IC 5GT3C 4J8VB 5JRGB 5KDMA 4LD9B 3KUYB 2ZY2A 3AZHB 2YFVB 5CPJB 5B0ZA 3AZJA 4J8VD 3MGQA 4LD9D 4WU9C 3KUYD 5CPKD 2RVQC 2IO5C 4J8UA 3MGPA 5GSUB 3UT9A 3AZHD 3KWQA 4Z2MG 5B0ZC 4KHAB 3AZJC 4Z2MH 3MGQC 3B0CW 5GSUD 3EPJA 4J8UC 3UT9C 3KWQC 3X1TA 1P3KA 1Q9CA 4J8XB 1N1JB 3AZFA 1ID3A 3B6GA 3WAAA 4YS3B 2G5HC 1P3MA 3AFAC 4JJNC 3REIB 4AWLB 5B32C 1P3KC 5F99A 2Y2JA 4J8XD 4H9SA 3WAAC 5B1MB 1ID3C 4YS3D 1P3MC 3REID 3AZNC 2XD5A 5AV9A 4NE5A 5BNVB 2NZDA 1P34B 5B1MD 4H9SC 3A6NA 3UTBA 2Y2KA 5AV9C 2AROA 1TAFB 4Z5TA 3REKB 1P34D 1M18B 2NZDC 3B0DC 4DQYB 2LY8A 3LZ1D 3LJAC 3WTPE 1F66D 3AZEB 1P3BA 4H9RA 1F1EA 3UTBC 1ZLAA 1T3UA 1M18D 4X23C 3RELA 3REKD 2AROC 4Z5TC 3REJA 3AZLA 3MVDB 3X1UB 4J8WB 2J8PA 5JRGA 1P3FC 3B0BA 1P3BC 2RIQA 4WV4B 5FUGA 1ZLAC 2YFVA 3KFUG 2JSSA 3RELC 5B40C 5CPJA 5GXQA 3AZLC 3REJC 1S32A 4J8WD 2ZY3A 5JRGC 1BFMA 4WJ3C 5GSUA 1P3GD 5BT1D 3MGSB 4CAYB 5CPJC 5GXQC 1P3PB 2BG1A 4KHAA 5B0YA 1S32C 3MGRC 1P3IB 3H0RC 4H9NB 5GT3B 5CHLB 1BH9B 3MGSD 5AV5B 2FJ7D 1P3PD 5B0YC 1ULYA 1P3ID 1EQZC 3AV2A 5GT3D 3VH6T 4WU9B 2UWXA 1P3AA 5B0ZB 3AZJB 3H0LC 3AV2C 4WU9D 2RVQD 4J8UB 2Y2IA 2Y2QA 3UT9B 1P3AC 5BNVA 1A7WA 5G49B 2ZM5A 5B0ZD 3LZ0A 3AZJD 5DNNA 3MGQD 3W97A 3UTAC 3W98A 4J8UD 3UT9D 3AFAB 4JJNB 1M18A 1TAFA 3KWQD 5B32B 1P3KB 3LZ0C 5DNNC 3WAAB 3AZEA 1ID3B 3TU4A 3W97C 3AFAD 3W98C 4CSRA 4JJND 1P3MB 3X1VC 3AZNB 1KX4A 5B32D 1P3KD 3WA9C 1P3LC 3MVDA 3X1UA 3WAAD 1ID3D 3AZEC 3TU4C 2Y2OA 3REHB 5B33B 1P3MD 1KX4C 4XZQA 3MVDC 5AV9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U C;  2PYO B;  3B0D B;  5B31 A;  3LJA B;  3KSY A;  1HQ3 A;  3MGS A;  3UTB B;  4CAY A;  4XZQ C;  1P3P A;  5AV9 D;  4X23 B;  2NZD D;  3C1B A;  2NQB C;  2ARO B;  4Z5T B;  3O62 A;  3VH5 T;  5B31 C;  1P3I A;  3LJA D;  1P3F B;  5DNM C;  1BH9 A;  1P3B B;  1HQ3 C;  4EO5 B;  5AV5 A;  4H9R B;  3UTB D;  3AV1 B;  1ZLA B;  4X23 D;  2ARO D;  4Z5T D;  5B40 B;  3C1B C;  3O62 C;  3REL B;  3REJ B;  1P3F D;  4WU9 A;  1M19 A;  1P3B D;  3C1C A;  5AV5 C;  1ZLA D;  5FUG B;  3REL D;  5B40 D;  3AZL D;  3REJ D;  5GXQ B;  3NQJ A;  1S32 B;  5JRG D;  3MNN A;  3MGR B;  1M19 C;  3C1C C;  5CPI A;  5G49 A;  5CPJ D;  4R8P A;  5GXQ D;  1S32 D;  5B0Y B;  4WNN A;  3MNN C;  1EQZ B;  3AFA A;  4JJN A;  2F8N A;  5CPI C;  5B32 A;  4R8P C;  5B0Y D;  1KX5 A;  3KXB B;  1EQZ D;  5B2J B;  3AV2 B;  3AZN A;  3LEL B;  3B6F A;  1P3A B;  1KX5 C;  3REH A;  3AV2 D;  5B33 A;  5CP6 A;  3UTA B;  1WWI A;  1P3A D;  2BYM A;  3B6F C;  4DRA A;  3VH5 A;  2PYO A;  3LZ0 B;  3LJA A;  5DNN B;  3REH C;  3AYW A;  5B33 C;  4E44 A;  5CP6 C;  3UTA D;  3W97 B;  3W98 B;  4WU8 B;  4X23 A;  3X1V B;  4G92 C;  3WA9 B;  1P3L B;  3LZ0 D;  2PYO C;  4NE3 A;  5DNN D;  1P3F A;  3AYW C;  3W97 D;  5AV6 A;  3TU4 B;  3AV1 A;  3W98 D;  3X1V D;  4CSR B;  4XUJ A;  5B40 A;  3WA9 D;  1P3L D;  5B31 G;  1KX4 B;  4NE6 A;  2L5A A;  3AZE D;  3TU4 D;  4EO5 C;  5AV6 C;  3AV1 C;  5AVB A;  4XUJ C;  1KX4 D;  4XZQ B;  3MVD D;  3X1U D;  2NQB B;  3MGR A;  5B31 B;  3WTP A;  5DNM B;  1HQ3 B;  5AVB C;  4XZQ D;  4M6B A;  3C1B B;  4ZBJ C;  3O62 B;  5B31 D;  1EQZ A;  3WTP C;  1HQ3 D;  3W96 C;  3C1B D;  3O62 D;  2YFW A;  4H9P B;  3KXB A;  5B2J A;  1M1A C;  1M19 B;  5AV5 D;  3LEL A;  5JA4 A;  3C1C B;  3KXB C;  3NQJ B;  5B2J C;  2F8N G;  1M19 D;  3MNN B;  5B32 G;  3C1C D;  3UTA A;  2F8N H;  3LEL C;  5CPI B;  4R8P B;  3W99 A;  4WNN B;  3MNN D;  4WU8 A;  5BNX A;  3X1V A;  2F8N B;  5CPI D;  4R8P D;  3WA9 A;  1P3L A;  3W99 C;  4Z66 C;  1KX5 B;  2BYK A;  5B24 A;  5AVC A;  2F8N D;  5GT0 A;  1TZY B;  4WU8 C;  3B6F B;  1KX5 D;  5B24 C;  5AVC C;  5GT0 C;  5CP6 B;  3AZN D;  3B6F D;  3VH5 W;  2BYM B;  2NQB A;  4G92 B;  3REH D;  5B33 D;  3AYW B;  5DNM A;  1WWS A;  5CP6 D;  1KU5 A;  3AN2 A;  3LZ1 C;  2PYO D;  3AYW D;  3VH6 A;  3AZI A;  5AV6 B;  4XUJ B;  1B6W A;  4H9P A;  3AN2 C;  5AY8 A;  5AV6 D;  3AV1 D;  3AZI C;  5C3I C;  4XUJ D;  5AVB B;  3AZG B;  4ZUX A;  3X1S A;  4ZBJ B;  5AY8 C;  1P3O C;  3WTP B;  5AVB D;  4UUZ B;  3W96 B;  2HUE C;  4ZUX C;  3X1S C;  3MGR D;  3WTP D;  3NQU B;  2FJ7 C;  1M1A B;  2HIO A;  3AZK A;  3W96 D;  2CV5 A;  2YFW B;  5CPK B;  1AOI C;  1M1A D;  1TZY A;  4KUD C;  2HIO C;  3AZK C;  5JA4 B;  2CV5 C;  3KXB D;  5AV8 A;  5B2J D;  3R45 A;  1TZY C;  4G91 C;  3LEL D;  5B2I A;  4HGA C;  3W99 B;  5AV8 C;  1JFI B;  4Z66 B;  3WKJ A;  3MGP C;  3AZM A;  1U35 A;  5BNX B;  5B2I C;  1KX3 A;  4YM6 A;  3W99 D;  4Z66 D;  3WKJ C;  2BYK B;  5B24 B;  1HTA A;  3B0C T;  5AVC B;  3AZM C;  3X1T C;  4WU8 D;  1U35 C;  5GT0 B;  1KX3 C;  4YM6 C;  3AZF C;  3B6G C;  1H3O A;  5B24 D;  4DRB A;  5AVC D;  5GT0 D;  5F99 C;  4KGC A;  2F8N K;  5E5A A;  3AZG A;  3LZ1 B;  1F66 B;  1BH8 A;  5B1L A;  4UUZ A;  4KGC C;  4QLC A;  5E5A C;  3W96 A;  3AZG C;  4H9Q A;  2NQB D;  3A6N C;  3AN2 B;  3VH6 W;  3NQU A;  4H9O A;  5DNM D;  1M1A A;  5B1L C;  3AZI B;  4QLC C;  5C3I B;  4E45 A;  3AN2 D;  4J8V A;  4LD9 A;  5CPK A;  3KUY A;  3AZH A;  1P3G B;  5AY8 B;  3AZI D;  1P3O B;  4J8V C;  2HUE B;  4LD9 C;  4ZUX B;  5CPK C;  3KUY C;  3X1S B;  5AY8 D;  3AZH C;  5BO0 B;  1P3O D;  2FJ7 B;  5BS7 A;  1JFI A;  4ZUX D;  4Z66 A;  3X1S D;  5GSU C;  1AOI B;  4KUD B;  2HIO B;  5BS7 C;  4J8X A;  1N1J A;  3AZK B;  4YS3 A;  2CV5 B;  3V9R B;  4WZS B;  5KDM B;  2IO5 B;  3REI A;  1AOI D;  4KUD D;  2HIO D;  4G91 B;  3AZK D;  4J8X C;  5B1M A;  2CV5 D;  4YS3 C;  4HGA B;  5AV8 B;  3MGQ B;  3REI C;  4AWL C;  3MGP B;  1TZY D;  3R45 B;  1P34 A;  3KWQ B;  5B1M C;  5B2I B;  3LZ1 A;  1F66 A;  5AV8 D;  3WKJ B;  1B67 A;  3MGP D;  3REK A;  3AZM B;  1P34 C;  3X1T B;  1U35 B;  5B2I D;  1KX3 B;  4YM6 B;  3AZF B;  1F66 C;  3B6G B;  3WKJ D;  1M18 C;  3AZM D;  3X1T D;  3REK C;  1U35 D;  5F99 B;  4NFT A;  1KX3 D;  4J8W A;  4YM6 D;  3AZF D;  3B6G D;  1H3O B;  1P3G A;  1P3O A;  5F99 D;  4KGC B;  2NZD B;  5E5A B;  4J8W C;  3A6N B;  1BH8 B;  5BO0 A;  1P3G C;  5BT1 C;  2FJ7 A;  4KGC D;  5B1L B;  5E5A D;  4QLC B;  3AZG D;  3A6N D;  4H9Q B;  4H9N A;  5GT3 A;  1R4V A;  1AOI A;  3MGS C;  4H9O B;  2CWE A;  5B1L D;  4KUD A;  1P3P C;  4QLC D;  3AZL B;  3V9R A;  1P3I C;  5GT3 C;  4J8V B;  5JRG B;  5KDM A;  4LD9 B;  3KUY B;  3AZH B;  2YFV B;  5CPJ B;  5B0Z A;  3AZJ A;  4J8V D;  3MGQ A;  4LD9 D;  4WU9 C;  3KUY D;  5CPK D;  2RVQ C;  2IO5 C;  4J8U A;  3MGP A;  5GSU B;  3UT9 A;  3AZH D;  3KWQ A;  4Z2M G;  5B0Z C;  4KHA B;  3AZJ C;  4Z2M H;  3MGQ C;  3B0C W;  5GSU D;  4J8U C;  3UT9 C;  3KWQ C;  3X1T A;  1P3K A;  1Q9C A;  4J8X B;  1N1J B;  3AZF A;  1ID3 A;  3B6G A;  3WAA A;  4YS3 B;  1P3M A;  3AFA C;  4JJN C;  3REI B;  4AWL B;  5B32 C;  1P3K C;  5F99 A;  4J8X D;  4H9S A;  3WAA C;  5B1M B;  1ID3 C;  4YS3 D;  1P3M C;  3REI D;  3AZN C;  5AV9 A;  4NE5 A;  5BNV B;  2NZD A;  1P34 B;  5B1M D;  4H9S C;  3A6N A;  3UTB A;  5AV9 C;  2ARO A;  1TAF B;  4Z5T A;  3REK B;  1P34 D;  1M18 B;  2NZD C;  3B0D C;  2LY8 A;  3LZ1 D;  3LJA C;  3WTP E;  1F66 D;  3AZE B;  1P3B A;  4H9R A;  1F1E A;  3UTB C;  1ZLA A;  1M18 D;  4X23 C;  3REL A;  3REK D;  2ARO C;  4Z5T C;  3REJ A;  3AZL A;  3MVD B;  3X1U B;  4J8W B;  5JRG A;  1P3F C;  3B0B A;  1P3B C;  4WV4 B;  5FUG A;  1ZLA C;  2YFV A;  2JSS A;  3REL C;  5B40 C;  5CPJ A;  5GXQ A;  3AZL C;  3REJ C;  1S32 A;  4J8W D;  5JRG C;  1BFM A;  5GSU A;  1P3G D;  5BT1 D;  3MGS B;  4CAY B;  5CPJ C;  5GXQ C;  1P3P B;  1S32 C;  4KHA A;  5B0Y A;  3MGR C;  1P3I B;  4H9N B;  5GT3 B;  5CHL B;  1BH9 B;  3MGS D;  5AV5 B;  2FJ7 D;  1P3P D;  5B0Y C;  1ULY A;  1P3I D;  1EQZ C;  3AV2 A;  5GT3 D;  3VH6 T;  4WU9 B;  1P3A A;  5B0Z B;  3AZJ B;  3AV2 C;  4WU9 D;  2RVQ D;  4J8U B;  3UT9 B;  1P3A C;  5BNV A;  1A7W A;  5G49 B;  5B0Z D;  3LZ0 A;  3AZJ D;  5DNN A;  3MGQ D;  3W97 A;  3UTA C;  3W98 A;  4J8U D;  3UT9 D;  3AFA B;  4JJN B;  1M18 A;  1TAF A;  3KWQ D;  5B32 B;  1P3K B;  3LZ0 C;  5DNN C;  3WAA B;  3AZE A;  1ID3 B;  3TU4 A;  3W97 C;  3AFA D;  3W98 C;  4CSR A;  4JJN D;  1P3M B;  3X1V C;  3AZN B;  1KX4 A;  5B32 D;  1P3K D;  3WA9 C;  1P3L C;  3MVD A;  3X1U A;  3WAA D;  1ID3 D;  3AZE C;  3TU4 C;  3REH B;  5B33 B;  1P3M D;  1KX4 C;  4XZQ A;  3MVD C;  5AV9 B; 
#chains in the Genus database with same CATH topology
 3X1U C;  2Y2L A;  2PYO B;  3B0D B;  5B31 A;  3LJA B;  3KSY A;  1HQ3 A;  3MGS A;  3UTB B;  4CAY A;  4XZQ C;  1P3P A;  5AV9 D;  4X23 B;  2NZD D;  3C1B A;  2NQB C;  2ARO B;  4Z5T B;  3O62 A;  3VH5 T;  5B31 C;  1P3I A;  3LJA D;  1P3F B;  5DNM C;  1BH9 A;  1P3B B;  1HQ3 C;  4EO5 B;  5AV5 A;  4H9R B;  3UTB D;  3AV1 B;  1Z2C B;  1ZLA B;  4X23 D;  2ARO D;  4Z5T D;  5B40 B;  3C1B C;  3O62 C;  3REL B;  3REJ B;  1P3F D;  4WU9 A;  1M19 A;  1P3B D;  3C1C A;  5AV5 C;  1ZLA D;  5FUG B;  3REL D;  5B40 D;  3AZL D;  3REJ D;  5GXQ B;  3NQJ A;  1S32 B;  3AL0 C;  5JRG D;  3MNN A;  3MGR B;  1M19 C;  3C1C C;  5CPI A;  5G49 A;  5CPJ D;  4R8P A;  5GXQ D;  2ZY5 A;  1S32 D;  5B0Y B;  3P5J B;  4WNN A;  3MNN C;  1EQZ B;  3AFA A;  4JJN A;  2F8N A;  5CPI C;  5B32 A;  4R8P C;  2F2A C;  5B0Y D;  2Y2P A;  1KX5 A;  3KXB B;  1EQZ D;  5B2J B;  3AV2 B;  3AZN A;  3LEL B;  3B6F A;  1P3A B;  1KX5 C;  3REH A;  3AV2 D;  5B33 A;  5CP6 A;  3UTA B;  1WWI A;  1P3A D;  2BYM A;  3B6F C;  4DRA A;  3VH5 A;  2PYO A;  3LZ0 B;  3LJA A;  5DNN B;  3REH C;  3AYW A;  5B33 C;  4E44 A;  5CP6 C;  3UTA D;  3W97 B;  3W98 B;  4WU8 B;  4X23 A;  3X1V B;  4G92 C;  3WA9 B;  1P3L B;  3LZ0 D;  2PYO C;  4NE3 A;  5DNN D;  1P3F A;  3AYW C;  3W97 D;  5AV6 A;  3TU4 B;  2VQR A;  3AV1 A;  3W98 D;  3X1V D;  4CSR B;  4XUJ A;  5B40 A;  3WA9 D;  1P3L D;  5B31 G;  1KX4 B;  3EPK A;  4NE6 A;  2L5A A;  3AZE D;  2W8S A;  3TU4 D;  4EO5 C;  5AV6 C;  3AV1 C;  5AVB A;  4XUJ C;  1KX4 D;  2Y2N A;  4XZQ B;  3MVD D;  3X1U D;  2NQB B;  3MGR A;  5B31 B;  3WTP A;  5DNM B;  1HQ3 B;  5AVB C;  4XZQ D;  3IP4 C;  4M6B A;  3C1B B;  4ZBJ C;  3O62 B;  5B31 D;  1EQZ A;  3WTP C;  1HQ3 D;  3W96 C;  3C1B D;  3O62 D;  2YFW A;  4H9P B;  3KXB A;  5B2J A;  1M1A C;  1M19 B;  5AV5 D;  3LEL A;  5JA4 A;  3C1C B;  3KXB C;  3EPL A;  3NQJ B;  5B2J C;  2F8N G;  1M19 D;  3MNN B;  5B32 G;  3C1C D;  3UTA A;  2F8N H;  3LEL C;  5CPI B;  4R8P B;  3W99 A;  4WNN B;  3MNN D;  4WU8 A;  5BNX A;  3X1V A;  2F8N B;  5CPI D;  4R8P D;  3WA9 A;  1P3L A;  3W99 C;  4Z66 C;  1KX5 B;  2BYK A;  5B24 A;  5AVC A;  2F8N D;  5GT0 A;  1TZY B;  4WU8 C;  3B6F B;  1KX5 D;  2G5I C;  5B24 C;  2XD1 A;  5AVC C;  5GT0 C;  5CP6 B;  3AZN D;  3B6F D;  3VH5 W;  2BYM B;  2NQB A;  4G92 B;  3REH D;  5B33 D;  3AYW B;  5DNM A;  1WWS A;  5CP6 D;  1KU5 A;  3AN2 A;  3LZ1 C;  2PYO D;  3AYW D;  3VH6 A;  3AZI A;  5AV6 B;  4XUJ B;  1B6W A;  4H9P A;  3AN2 C;  5AY8 A;  5AV6 D;  3AV1 D;  3AZI C;  5C3I C;  4XUJ D;  3H0M C;  5AVB B;  3AZG B;  4ZUX A;  3X1S A;  3F6T A;  4ZBJ B;  5AY8 C;  1P3O C;  3WTP B;  5AVB D;  4UUZ B;  3W96 B;  2HUE C;  4ZUX C;  3X1S C;  3MGR D;  3WTP D;  3NQU B;  2FJ7 C;  1M1A B;  2HIO A;  3AZK A;  3W96 D;  2Y2M A;  2CV5 A;  2YFW B;  5CPK B;  1AOI C;  1M1A D;  1TZY A;  4KUD C;  2HIO C;  3A1I A;  3AZK C;  5JA4 B;  2CV5 C;  3KXB D;  2ZY4 A;  5AV8 A;  5B2J D;  3R45 A;  1TZY C;  4G91 C;  3LEL D;  5B2I A;  4HGA C;  3W99 B;  5AV8 C;  3FDD A;  2Y2H A;  4Z66 B;  1JFI B;  3WKJ A;  3MGP C;  3AZM A;  3EG5 B;  1U35 A;  5BNX B;  5B2I C;  1KX3 A;  4YM6 A;  3W99 D;  4Z66 D;  3WKJ C;  2BYK B;  2Y2G A;  5B24 B;  1HTA A;  2JCH A;  3B0C T;  5AVC B;  3AZM C;  3X1T C;  4WU8 D;  1U35 C;  5GT0 B;  1KX3 C;  4YM6 C;  3AZF C;  3B6G C;  1H3O A;  5B24 D;  4DRB A;  5AVC D;  5GT0 D;  5F99 C;  4KGC A;  2F8N K;  5E5A A;  3AZG A;  3LZ1 B;  1F66 B;  1BH8 A;  5B1L A;  4UUZ A;  4KGC C;  4QLC A;  5E5A C;  3W96 A;  3AZG C;  4H9Q A;  2NQB D;  3A6N C;  3AN2 B;  3VH6 W;  1W2E A;  3NQU A;  4H9O A;  5DNM D;  1M1A A;  5B1L C;  2DQN C;  3AZI B;  4QLC C;  5C3I B;  4E45 A;  3AN2 D;  4J8V A;  4LD9 A;  5CPK A;  3KUY A;  2FFF B;  3AZH A;  1P3G B;  5AY8 B;  3AZI D;  1P3O B;  4J8V C;  2HUE B;  4LD9 C;  4ZUX B;  5CPK C;  3KUY C;  3A1K A;  3X1S B;  2JE5 A;  5AY8 D;  3AZH C;  5BO0 B;  1P3O D;  2FJ7 B;  5BS7 A;  1JFI A;  4ZUX D;  4Z66 A;  3X1S D;  5GSU C;  1AOI B;  4KUD B;  2HIO B;  5BS7 C;  4J8X A;  1N1J A;  3AZK B;  4YS3 A;  2CV5 B;  3V9R B;  4WZS B;  3EPH A;  5KDM B;  2IO5 B;  3REI A;  1AOI D;  4KUD D;  2HIO D;  4G91 B;  3AZK D;  4J8X C;  5B1M A;  2CV5 D;  1PZR A;  4YS3 C;  4HGA B;  5AV8 B;  3MGQ B;  3REI C;  4AWL C;  3MGP B;  1TZY D;  3R45 B;  1P34 A;  3KWQ B;  5B1M C;  5B2I B;  3LZ1 A;  1F66 A;  5AV8 D;  3WKJ B;  1B67 A;  3MGP D;  2DF4 C;  3REK A;  3AZM B;  1P34 C;  3X1T B;  1U35 B;  5B2I D;  1KX3 B;  4YM6 B;  3AZF B;  1F66 C;  3B6G B;  3WKJ D;  4UPK A;  3AZM D;  1M18 C;  3X1T D;  3REK C;  1U35 D;  5F99 B;  4NFT A;  1KX3 D;  4J8W A;  4YM6 D;  3AZF D;  3B6G D;  1H3O B;  1P3G A;  1P3O A;  5F99 D;  4KGC B;  2NZD B;  5E5A B;  4J8W C;  3A6N B;  1BH8 B;  5BO0 A;  1P3G C;  5BT1 C;  2FJ7 A;  4KGC D;  5B1L B;  5E5A D;  4QLC B;  3AZG D;  3A6N D;  4H9Q B;  4H9N A;  5GT3 A;  1R4V A;  1AOI A;  3MGS C;  4H9O B;  2CWE A;  5B1L D;  4KUD A;  1P3P C;  4QLC D;  3AZL B;  3V9R A;  1P3I C;  5GT3 C;  4J8V B;  5JRG B;  5KDM A;  4LD9 B;  3KUY B;  2ZY2 A;  3AZH B;  2YFV B;  5CPJ B;  5B0Z A;  3AZJ A;  4J8V D;  3MGQ A;  4LD9 D;  4WU9 C;  3KUY D;  5CPK D;  2RVQ C;  2IO5 C;  4J8U A;  3MGP A;  5GSU B;  3UT9 A;  3AZH D;  3KWQ A;  4Z2M G;  5B0Z C;  4KHA B;  3AZJ C;  4Z2M H;  3MGQ C;  3B0C W;  5GSU D;  3EPJ A;  4J8U C;  3UT9 C;  3KWQ C;  3X1T A;  1P3K A;  1Q9C A;  4J8X B;  1N1J B;  3AZF A;  1ID3 A;  3B6G A;  3WAA A;  4YS3 B;  2G5H C;  1P3M A;  3AFA C;  4JJN C;  3REI B;  4AWL B;  5B32 C;  1P3K C;  5F99 A;  2Y2J A;  4J8X D;  4H9S A;  3WAA C;  5B1M B;  1ID3 C;  4YS3 D;  1P3M C;  3REI D;  3AZN C;  2XD5 A;  5AV9 A;  4NE5 A;  5BNV B;  2NZD A;  1P34 B;  5B1M D;  4H9S C;  3A6N A;  3UTB A;  2Y2K A;  5AV9 C;  2ARO A;  1TAF B;  4Z5T A;  3REK B;  1P34 D;  1M18 B;  2NZD C;  3B0D C;  4DQY B;  2LY8 A;  3LZ1 D;  3LJA C;  3WTP E;  1F66 D;  3AZE B;  1P3B A;  4H9R A;  1F1E A;  3UTB C;  1ZLA A;  1T3U A;  1M18 D;  4X23 C;  3REL A;  3REK D;  2ARO C;  4Z5T C;  3REJ A;  3AZL A;  3MVD B;  3X1U B;  4J8W B;  2J8P A;  5JRG A;  1P3F C;  3B0B A;  1P3B C;  2RIQ A;  4WV4 B;  5FUG A;  1ZLA C;  2YFV A;  3KFU G;  2JSS A;  3REL C;  5B40 C;  5CPJ A;  5GXQ A;  3AZL C;  3REJ C;  1S32 A;  4J8W D;  2ZY3 A;  5JRG C;  1BFM A;  4WJ3 C;  5GSU A;  1P3G D;  5BT1 D;  3MGS B;  4CAY B;  5CPJ C;  5GXQ C;  1P3P B;  2BG1 A;  4KHA A;  5B0Y A;  1S32 C;  3MGR C;  1P3I B;  3H0R C;  4H9N B;  5GT3 B;  5CHL B;  1BH9 B;  3MGS D;  5AV5 B;  2FJ7 D;  1P3P D;  5B0Y C;  1ULY A;  1P3I D;  1EQZ C;  3AV2 A;  5GT3 D;  3VH6 T;  4WU9 B;  2UWX A;  1P3A A;  5B0Z B;  3AZJ B;  3H0L C;  3AV2 C;  4WU9 D;  2RVQ D;  4J8U B;  2Y2I A;  2Y2Q A;  3UT9 B;  1P3A C;  5BNV A;  1A7W A;  5G49 B;  2ZM5 A;  5B0Z D;  3LZ0 A;  3AZJ D;  5DNN A;  3MGQ D;  3W97 A;  3UTA C;  3W98 A;  4J8U D;  3UT9 D;  3AFA B;  4JJN B;  1M18 A;  1TAF A;  3KWQ D;  5B32 B;  1P3K B;  3LZ0 C;  5DNN C;  3WAA B;  3AZE A;  1ID3 B;  3TU4 A;  3W97 C;  3AFA D;  3W98 C;  4CSR A;  4JJN D;  1P3M B;  3X1V C;  3AZN B;  1KX4 A;  5B32 D;  1P3K D;  3WA9 C;  1P3L C;  3MVD A;  3X1U A;  3WAA D;  1ID3 D;  3AZE C;  3TU4 C;  2Y2O A;  3REH B;  5B33 B;  1P3M D;  1KX4 C;  4XZQ A;  3MVD C;  5AV9 B; 
#chains in the Genus database with same CATH homology
 3X1U C;  2Y2L A;  2PYO B;  3B0D B;  5B31 A;  3LJA B;  3KSY A;  1HQ3 A;  3MGS A;  3UTB B;  4CAY A;  4XZQ C;  1P3P A;  5AV9 D;  4X23 B;  2NZD D;  3C1B A;  2NQB C;  2ARO B;  4Z5T B;  3O62 A;  3VH5 T;  5B31 C;  1P3I A;  3LJA D;  1P3F B;  5DNM C;  1BH9 A;  1P3B B;  1HQ3 C;  4EO5 B;  5AV5 A;  4H9R B;  3UTB D;  3AV1 B;  1Z2C B;  1ZLA B;  4X23 D;  2ARO D;  4Z5T D;  5B40 B;  3C1B C;  3O62 C;  3REL B;  3REJ B;  1P3F D;  4WU9 A;  1M19 A;  1P3B D;  3C1C A;  5AV5 C;  1ZLA D;  5FUG B;  3REL D;  5B40 D;  3AZL D;  3REJ D;  5GXQ B;  3NQJ A;  1S32 B;  3AL0 C;  5JRG D;  3MNN A;  3MGR B;  1M19 C;  3C1C C;  5CPI A;  5G49 A;  5CPJ D;  4R8P A;  5GXQ D;  2ZY5 A;  1S32 D;  5B0Y B;  3P5J B;  4WNN A;  3MNN C;  1EQZ B;  3AFA A;  4JJN A;  2F8N A;  5CPI C;  5B32 A;  4R8P C;  2F2A C;  5B0Y D;  2Y2P A;  1KX5 A;  3KXB B;  1EQZ D;  5B2J B;  3AV2 B;  3AZN A;  3LEL B;  3B6F A;  1P3A B;  1KX5 C;  3REH A;  3AV2 D;  5B33 A;  5CP6 A;  3UTA B;  1WWI A;  1P3A D;  2BYM A;  3B6F C;  4DRA A;  3VH5 A;  2PYO A;  3LZ0 B;  3LJA A;  5DNN B;  3REH C;  3AYW A;  5B33 C;  4E44 A;  5CP6 C;  3UTA D;  3W97 B;  3W98 B;  4WU8 B;  4X23 A;  3X1V B;  4G92 C;  3WA9 B;  1P3L B;  3LZ0 D;  2PYO C;  4NE3 A;  5DNN D;  1P3F A;  3AYW C;  3W97 D;  5AV6 A;  3TU4 B;  2VQR A;  3AV1 A;  3W98 D;  3X1V D;  4CSR B;  4XUJ A;  5B40 A;  3WA9 D;  1P3L D;  5B31 G;  1KX4 B;  3EPK A;  4NE6 A;  2L5A A;  3AZE D;  2W8S A;  3TU4 D;  4EO5 C;  5AV6 C;  3AV1 C;  5AVB A;  4XUJ C;  1KX4 D;  2Y2N A;  4XZQ B;  3MVD D;  3X1U D;  2NQB B;  3MGR A;  5B31 B;  3WTP A;  5DNM B;  1HQ3 B;  5AVB C;  4XZQ D;  3IP4 C;  4M6B A;  3C1B B;  4ZBJ C;  3O62 B;  5B31 D;  1EQZ A;  3WTP C;  1HQ3 D;  3W96 C;  3C1B D;  3O62 D;  2YFW A;  4H9P B;  3KXB A;  5B2J A;  1M1A C;  1M19 B;  5AV5 D;  3LEL A;  5JA4 A;  3C1C B;  3KXB C;  3EPL A;  3NQJ B;  5B2J C;  2F8N G;  1M19 D;  3MNN B;  5B32 G;  3C1C D;  3UTA A;  2F8N H;  3LEL C;  5CPI B;  4R8P B;  3W99 A;  4WNN B;  3MNN D;  4WU8 A;  5BNX A;  3X1V A;  2F8N B;  5CPI D;  4R8P D;  3WA9 A;  1P3L A;  3W99 C;  4Z66 C;  1KX5 B;  2BYK A;  5B24 A;  5AVC A;  2F8N D;  5GT0 A;  1TZY B;  4WU8 C;  3B6F B;  1KX5 D;  2G5I C;  5B24 C;  2XD1 A;  5AVC C;  5GT0 C;  5CP6 B;  3AZN D;  3B6F D;  3VH5 W;  2BYM B;  2NQB A;  4G92 B;  3REH D;  5B33 D;  3AYW B;  5DNM A;  1WWS A;  5CP6 D;  1KU5 A;  3AN2 A;  3LZ1 C;  2PYO D;  3AYW D;  3VH6 A;  3AZI A;  5AV6 B;  4XUJ B;  1B6W A;  4H9P A;  3AN2 C;  5AY8 A;  5AV6 D;  3AV1 D;  3AZI C;  5C3I C;  4XUJ D;  3H0M C;  5AVB B;  3AZG B;  4ZUX A;  3X1S A;  3F6T A;  4ZBJ B;  5AY8 C;  1P3O C;  3WTP B;  5AVB D;  4UUZ B;  3W96 B;  2HUE C;  4ZUX C;  3X1S C;  3MGR D;  3WTP D;  3NQU B;  2FJ7 C;  1M1A B;  2HIO A;  3AZK A;  3W96 D;  2Y2M A;  2CV5 A;  2YFW B;  5CPK B;  1AOI C;  1M1A D;  1TZY A;  4KUD C;  2HIO C;  3A1I A;  3AZK C;  5JA4 B;  2CV5 C;  3KXB D;  2ZY4 A;  5AV8 A;  5B2J D;  3R45 A;  1TZY C;  4G91 C;  3LEL D;  5B2I A;  4HGA C;  3W99 B;  5AV8 C;  3FDD A;  2Y2H A;  4Z66 B;  1JFI B;  3WKJ A;  3MGP C;  3AZM A;  3EG5 B;  1U35 A;  5BNX B;  5B2I C;  1KX3 A;  4YM6 A;  3W99 D;  4Z66 D;  3WKJ C;  2BYK B;  2Y2G A;  5B24 B;  1HTA A;  2JCH A;  3B0C T;  5AVC B;  3AZM C;  3X1T C;  4WU8 D;  1U35 C;  5GT0 B;  1KX3 C;  4YM6 C;  3AZF C;  3B6G C;  1H3O A;  5B24 D;  4DRB A;  5AVC D;  5GT0 D;  5F99 C;  4KGC A;  2F8N K;  5E5A A;  3AZG A;  3LZ1 B;  1F66 B;  1BH8 A;  5B1L A;  4UUZ A;  4KGC C;  4QLC A;  5E5A C;  3W96 A;  3AZG C;  4H9Q A;  2NQB D;  3A6N C;  3AN2 B;  3VH6 W;  1W2E A;  3NQU A;  4H9O A;  5DNM D;  1M1A A;  5B1L C;  2DQN C;  3AZI B;  4QLC C;  5C3I B;  4E45 A;  3AN2 D;  4J8V A;  4LD9 A;  5CPK A;  3KUY A;  2FFF B;  3AZH A;  1P3G B;  5AY8 B;  3AZI D;  1P3O B;  4J8V C;  2HUE B;  4LD9 C;  4ZUX B;  5CPK C;  3KUY C;  3A1K A;  3X1S B;  2JE5 A;  5AY8 D;  3AZH C;  5BO0 B;  1P3O D;  2FJ7 B;  5BS7 A;  1JFI A;  4ZUX D;  4Z66 A;  3X1S D;  5GSU C;  1AOI B;  4KUD B;  2HIO B;  5BS7 C;  4J8X A;  1N1J A;  3AZK B;  4YS3 A;  2CV5 B;  3V9R B;  4WZS B;  3EPH A;  5KDM B;  2IO5 B;  3REI A;  1AOI D;  4KUD D;  2HIO D;  4G91 B;  3AZK D;  4J8X C;  5B1M A;  2CV5 D;  1PZR A;  4YS3 C;  4HGA B;  5AV8 B;  3MGQ B;  3REI C;  4AWL C;  3MGP B;  1TZY D;  3R45 B;  1P34 A;  3KWQ B;  5B1M C;  5B2I B;  3LZ1 A;  1F66 A;  5AV8 D;  3WKJ B;  1B67 A;  3MGP D;  2DF4 C;  3REK A;  3AZM B;  1P34 C;  3X1T B;  1U35 B;  5B2I D;  1KX3 B;  4YM6 B;  3AZF B;  1F66 C;  3B6G B;  3WKJ D;  4UPK A;  3AZM D;  1M18 C;  3X1T D;  3REK C;  1U35 D;  5F99 B;  4NFT A;  1KX3 D;  4J8W A;  4YM6 D;  3AZF D;  3B6G D;  1H3O B;  1P3G A;  1P3O A;  5F99 D;  4KGC B;  2NZD B;  5E5A B;  4J8W C;  3A6N B;  1BH8 B;  5BO0 A;  1P3G C;  5BT1 C;  2FJ7 A;  4KGC D;  5B1L B;  5E5A D;  4QLC B;  3AZG D;  3A6N D;  4H9Q B;  4H9N A;  5GT3 A;  1R4V A;  1AOI A;  3MGS C;  4H9O B;  2CWE A;  5B1L D;  4KUD A;  1P3P C;  4QLC D;  3AZL B;  3V9R A;  1P3I C;  5GT3 C;  4J8V B;  5JRG B;  5KDM A;  4LD9 B;  3KUY B;  2ZY2 A;  3AZH B;  2YFV B;  5CPJ B;  5B0Z A;  3AZJ A;  4J8V D;  3MGQ A;  4LD9 D;  4WU9 C;  3KUY D;  5CPK D;  2RVQ C;  2IO5 C;  4J8U A;  3MGP A;  5GSU B;  3UT9 A;  3AZH D;  3KWQ A;  4Z2M G;  5B0Z C;  4KHA B;  3AZJ C;  4Z2M H;  3MGQ C;  3B0C W;  5GSU D;  3EPJ A;  4J8U C;  3UT9 C;  3KWQ C;  3X1T A;  1P3K A;  1Q9C A;  4J8X B;  1N1J B;  3AZF A;  1ID3 A;  3B6G A;  3WAA A;  4YS3 B;  2G5H C;  1P3M A;  3AFA C;  4JJN C;  3REI B;  4AWL B;  5B32 C;  1P3K C;  5F99 A;  2Y2J A;  4J8X D;  4H9S A;  3WAA C;  5B1M B;  1ID3 C;  4YS3 D;  1P3M C;  3REI D;  3AZN C;  2XD5 A;  5AV9 A;  4NE5 A;  5BNV B;  2NZD A;  1P34 B;  5B1M D;  4H9S C;  3A6N A;  3UTB A;  2Y2K A;  5AV9 C;  2ARO A;  1TAF B;  4Z5T A;  3REK B;  1P34 D;  1M18 B;  2NZD C;  3B0D C;  4DQY B;  2LY8 A;  3LZ1 D;  3LJA C;  3WTP E;  1F66 D;  3AZE B;  1P3B A;  4H9R A;  1F1E A;  3UTB C;  1ZLA A;  1T3U A;  1M18 D;  4X23 C;  3REL A;  3REK D;  2ARO C;  4Z5T C;  3REJ A;  3AZL A;  3MVD B;  3X1U B;  4J8W B;  2J8P A;  5JRG A;  1P3F C;  3B0B A;  1P3B C;  2RIQ A;  4WV4 B;  5FUG A;  1ZLA C;  2YFV A;  3KFU G;  2JSS A;  3REL C;  5B40 C;  5CPJ A;  5GXQ A;  3AZL C;  3REJ C;  1S32 A;  4J8W D;  2ZY3 A;  5JRG C;  1BFM A;  4WJ3 C;  5GSU A;  1P3G D;  5BT1 D;  3MGS B;  4CAY B;  5CPJ C;  5GXQ C;  1P3P B;  2BG1 A;  4KHA A;  5B0Y A;  1S32 C;  3MGR C;  1P3I B;  3H0R C;  4H9N B;  5GT3 B;  5CHL B;  1BH9 B;  3MGS D;  5AV5 B;  2FJ7 D;  1P3P D;  5B0Y C;  1ULY A;  1P3I D;  1EQZ C;  3AV2 A;  5GT3 D;  3VH6 T;  4WU9 B;  2UWX A;  1P3A A;  5B0Z B;  3AZJ B;  3H0L C;  3AV2 C;  4WU9 D;  2RVQ D;  4J8U B;  2Y2I A;  2Y2Q A;  3UT9 B;  1P3A C;  5BNV A;  1A7W A;  5G49 B;  2ZM5 A;  5B0Z D;  3LZ0 A;  3AZJ D;  5DNN A;  3MGQ D;  3W97 A;  3UTA C;  3W98 A;  4J8U D;  3UT9 D;  3AFA B;  4JJN B;  1M18 A;  1TAF A;  3KWQ D;  5B32 B;  1P3K B;  3LZ0 C;  5DNN C;  3WAA B;  3AZE A;  1ID3 B;  3TU4 A;  3W97 C;  3AFA D;  3W98 C;  4CSR A;  4JJN D;  1P3M B;  3X1V C;  3AZN B;  1KX4 A;  5B32 D;  1P3K D;  3WA9 C;  1P3L C;  3MVD A;  3X1U A;  3WAA D;  1ID3 D;  3AZE C;  3TU4 C;  2Y2O A;  3REH B;  5B33 B;  1P3M D;  1KX4 C;  4XZQ A;  3MVD C;  5AV9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...