3NQUA

Crystal structure of partially trypsinized (cenp-a/h4)2 heterotetramer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
HLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nquA00
3REHD 5BO0A 5CPID 4H9NA 2F8ND 2YFWB 1HTAA 4EO5B 3MGQB 3KUYA 3W99C 4J8XA 5B2IB 1S32B 3X1UC 3UTBD 5B33C 3AZIC 1KX5A 1TZYC 4KGCB 1P3LC 1H3OB 4NE5A 1M1AD 1ID3D 1HQ3C 3AZGB 4J8UB 3C1BA 4WU8A 4J8VA 4EO5C 3MGQC 3AV2B 4KHAA 3AZED 3X1VA 1U35B 1S32C 1P3FD 3AV1D 4J8WB 3UTAB 3WA9B 4ZUXD 4M6BA 4NE3A 3AN2A 4KGCC 1BFMA 3UT9D 5KDMA 5JRGB 4LD9D 4XUJD 3W97D 5AV6B 4J8UC 3REHC 4H9RA 3X1SD 3AZGC 3AYWB 3B6FB 3X1UA 5AVCA 3AV2C 5B33A 1M19B 5B0YB 1A7WA 3LJAB 1U35C 5AV5A 3AZIA 1TZYA 1P3LA 4J8WC 3UTAC 5GSUC 3WA9C 1HQ3A 4X23B 5DNMD 5B24D 3KWQB 5JRGC 3REIB 3MGQA 2HIOB 2PYOD 5AV6C 5AV9B 1S32A 5B1LD 4E45A 3LZ0C 3AYWC 3B6FC 5F99A 4H9PA 3AZMD 1M19C 5B0YC 3LJAC 4KGCA 1P3MD 1ULYA 1P3BC 3REJD 4X23C 3REHA 3AZGA 5CPIA 3MNNB 3KWQC 5GT3B 3B6GB 3REIC 3AV2A 5B2JD 2HIOC 4LD9C 5AV9C 4NFTA 4J8WA 2BYMA 1M18B 5GSUA 3WA9A 3V9RA 3REKD 4Z5TB 5JRGA 3MGPB 5AV6A 4KUDD 3AZHD 3MNNC 5CP6B 3LZ0A 3AYWA 5GT3C 3B6GC 4J8XD 1BH9A 3O62B 1P3KD 2PYOC 4AWLB 1M18C 1P3BA 1P3LB 1AOID 3KWQA 4Z5TC 3VH6A 3REIA 3MGPC 3UT9A 3RELB 2HIOA 4LD9A 5B40B 5AV9A 4J8VD 4WU8D 5CP6C 1N1JB 1P3PB 3TU4B 3X1VD 3O62C 3WAAB 4XZQB 3AZJD 4AWLC 1R4VA 1ZLAB 1EQZB 3MNNA 5DNMA 5JA4B 3B6GA 3W99D 3RELC 5B40C 2PYOA 2AROD 4KUDC 1P3PC 3X1UD 1M18A 5B33D 3TU4C 3KXBB 3WAAC 3AZID 5BNVA 1TZYD 4XZQC 1JFIA 1P3LD 4Z5TA 3WTPB 1ZLAC 2L5AA 1AOIC 4G91B 5E5AB 5CP6A 1EQZC 3MGQD 5FUGB 3X1TB 3O62A 5B2ID 5B2JA 1S32D 3WTPE 4JJNB 2NQBB 3NQJB 1TAFB 4KGCD 3R45B 3WKJB 5B1MB 3WTPC 5B32G 3RELA 5B40A 3AZGD 4J8UD 4G91C 4H9SC 2BYKB 1N1JA 3VH6T 5AV8B 5E5AC 3AZHA 1P3PA 2IO5B 3AV2D 2CV5B 4KUDA 3X1TC 3TU4A 1P3OB 5B31B 1U35D 3WAAA 3A6NB 1P3KA 4J8WD 3AZNC 2AROC 4JJNC 5GXQB 5GSUD 4YS3C 3UTAD 3WA9D 2NQBC 3AFAB 1ZLAA 1AOIA 5JA4A 3WKJC 4CAYA 5JRGD 5AV6D 2JSSA 3LZ0D 3AYWD 3B6FD 5AV8C 1M19D 3C1CB 2CV5C 5B0YD 4HGAB 3LJAD 1P3OC 5B31C 4H9OB 5B2IC 3B0DB 3AZJA 5GXQC 3VH5A 1P3BD 1P3AB 3AFAC 4X23D 3AZKB 5E5AA 5AVBB 3KWQD 3REID 3W98B 5FUGA 2HIOD 3AZFB 3W99A 1B6WA 5AV9D 1BH8A 3AZNA 2AROA 4JJNA 3AZLB 4YS3A 4HGAC 3B0DC 3R45A 2HUEB 1F1EA 1P3AC 1KX4B 3MNND 2BYKA 5AVBC 5GT3D 3B6GD 3W98C 2YFWA 2CV5A 5CPJB 5B31A 3AZFC 5B2IA 1M18D 4QLCB 4UUZB 4Z5TD 3MGPD 1H3OA 1KX4C 5CP6D 4J8UA 5CPJC 3O62D 4H9OA 1U35A 4WU9B 3UTAA 2F8NG 4QLCC 5AVBA 3VH5T 4XUJB 3RELD 5B40D 3AZFA 5DNNB 4E44A 1P3PD 3B6FA 3TU4D 1P34B 2F8NK 1M19A 3WAAD 5B0YA 3LJAA 4XZQD 4WU9C 2NZDB 1P3GB 1ZLAD 1KX4A 1EQZD 4X23A 3LELB 5CHLB 2FJ7B 4CSRB 5DNNC 3MGSB 4DRAA 3B0CW 5BT1C 1P34C 2F8NH 4UUZA 3WTPD 1WWSA 1P3GC 5BS7C 5E5AD 5B32B 3LELC 3X1TD 5GT3A 2FJ7C 3MGSC 4WU9A 5G49B 4R8PB 3AZND 4JJND 3W96B 4YS3D 2NQBD 4WNNB 1WWIA 3WKJD 5BO0B 5B1MD 4H9NB 3MGPA 1Q9CA 3KUYB 5AV8D 5B32C 2CV5D 1P3OD 5B31D 5C3IB 3A6ND 4R8PC 5GXQD 3W96C 2RVQC 1P3GA 1KX5B 3AFAD 5BS7A 1KX3B 3KXBC 3C1BB 2FJ7A 3NQUB 3MGSA 3KUYC 5GT0B 3C1CD 5C3IC 4XZQA 1P3AD 3AN2B 1KX5C 3MVDB 3AZKD 5KDMB 1KX3C 5AY8B 5AVBD 3MGRB 1EQZA 4Z66B 5B32A 3W98D 4YM6B 5B1MC 4H9RB 3C1BC 3AZFD 5AVCB 5GT0C 4R8PA 3W96A 3AZLD 5AV5B 2IO5C 3KXBA 5B0ZB 1P3IB 3LZ1B 3A6NC 1HQ3B 3WTPA 3AN2C 5CPKB 1B67A 3MVDC 1KX4D 4H9QB 5AY8C 3MGRC 4H9SA 5BNXB 4Z66C 5CPJD 4YM6C 1F66B 3X1TA 5AVCC 4H9PB 5F99B 5AV5C 3C1CC 2NQBA 3NQJA 4QLCD 1KX3A 5B0ZC 1P3IC 1TAFA 3LZ1C 3WKJA 3REHB 5B1MA 5CPIB 5CPKC 2F8NB 2YFVB 3NQUA 3AZKC 5GT0A 5AV8A 1F66C 1P3OA 2BYMB 5F99C 4WU9D 5GSUB 2CWEA 3A6NA 3V9RB 3UTBB 5GXQA 3AZLC 3MVDA 1KU5A 5AY8A 3AFAA 3MGRA 4Z66A 1M1AB 1ID3B 2HUEC 4Z2MG 4YM6A 5CPIC 5B31G 3LZ0B 5DNND 5BT1D 1BH9B 4WV4B 3AZEB 1P34D 3C1CA 1P3FB 5B0ZA 3AV1B 1P3IA 1P3BB 3LZ1A 2NZDD 3UTBC 1P3GD 4ZUXB 5CPKA 1P3AA 4H9QA 3AZKA 3UT9B 5BNXA 3LELD 1M1AC 1ID3C 4LD9B 1F66A 3W97B 3W98A 2FJ7D 3MGSD 3X1SB 4WZSB 3AZEC 3AZLA 1P3FC 3AV1C 4Z2MH 4ZUXC 2F8NA 5DNMB 2YFVA 5B24B 3UT9C 5B32D 4XUJC 3W97C 2PYOB 5CPJA 3X1SC 5B1LB 3VH5W 4R8PD 3UTBA 3W96D 2RVQD 3AZMB 5BNVB 1JFIB 3KXBD 3B0CT 1P3MB 4QLCA 1M1AA 1ID3A 3REJB 2NZDC 5DNMC 5B24C 3KUYD 3AZEA 5B2JB 3KSYA 1P3FA 5B1LC 3AV1A 3AZMC 4ZUXA 1KX5D 3B0BA 4ZBJB 4DRBA 1KX3D 1P3MC 3REKB 4XUJA 3REJC 3W97A 3C1BD 4KUDB 3AZHB 3X1SA 5DNNA 5GT0D 4J8XB 5B2JC 1P34A 1P3KB 2NZDA 3AN2D 1AOIB 4NE6A 4ZBJC 3MVDD 4CAYB 5AY8D 5B24A 3REKC 3MGRD 4Z66D 4YM6D 3LELA 2LY8A 3AZHC 4WU8B 5B1LA 4J8VB 5AVCD 4CSRA 4J8XC 4KHAB 5AV5D 3AZMA 3X1VB 1P3KC 3AZJB 5B0ZD 1P3ID 1P3MA 3LZ1D 1HQ3D 4G92B 3REJA 5CPKD 3W99B 1F66D 1BH8B 4J8VC 3AZNB 2AROB 4WU8C 5F99D 3X1UB 4YS3B 5B33B 5G49A 3X1VC 3AZIB 1TZYB 4WNNA 3AZJC 3VH6W 3REKA 4G92C
chains in the Genus database with same CATH superfamily
3REHD 5BO0A 2FFFB 4H9NA 5CPID 2F8ND 2Y2IA 2YFWB 1HTAA 4EO5B 3MGQB 3KUYA 3W99C 4J8XA 3KFUG 5B2IB 1S32B 2Y2MA 3X1UC 3UTBD 5B33C 3AZIC 1KX5A 1TZYC 4KGCB 1P3LC 1H3OB 4NE5A 1M1AD 1ID3D 1HQ3C 3AZGB 4J8UB 3C1BA 4WU8A 4J8VA 2BG1A 4EO5C 3MGQC 3AV2B 4KHAA 3AZED 3X1VA 1U35B 1S32C 1P3FD 3AV1D 4J8WB 3UTAB 3WA9B 4ZUXD 2RIQA 4M6BA 4NE3A 3AN2A 4KGCC 1BFMA 2G5HC 3UT9D 5KDMA 5JRGB 4LD9D 4XUJD 3W97D 5AV6B 4J8UC 3REHC 4H9RA 3X1SD 3AZGC 3AYWB 2ZY5A 3B6FB 3X1UA 5AVCA 3AV2C 5B33A 1M19B 5B0YB 1A7WA 3LJAB 2JCHA 1U35C 5AV5A 3AZIA 1TZYA 1P3LA 4J8WC 3UTAC 5GSUC 3WA9C 1HQ3A 4X23B 3H0MC 5DNMD 5B24D 3KWQB 5JRGC 3REIB 2G5IC 3MGQA 2HIOB 2PYOD 5AV6C 5AV9B 1S32A 5B1LD 4E45A 3LZ0C 3AYWC 3B6FC 1Z2CB 4H9PA 5F99A 3AZMD 5B0YC 1M19C 3LJAC 4KGCA 1P3MD 1ULYA 1P3BC 3REJD 4X23C 3REHA 3AZGA 5CPIA 3MNNB 3KWQC 5GT3B 3B6GB 3REIC 3AV2A 5B2JD 2HIOC 4LD9C 5AV9C 4NFTA 4J8WA 2BYMA 1M18B 5GSUA 3WA9A 3V9RA 3REKD 4Z5TB 5JRGA 3MGPB 5AV6A 4KUDD 3AZHD 3EPKA 3MNNC 5CP6B 3LZ0A 3AYWA 5GT3C 3B6GC 4J8XD 1BH9A 3O62B 1P3KD 2PYOC 4AWLB 1M18C 1P3BA 1P3LB 1AOID 4UPKA 3KWQA 3FDDA 4Z5TC 3VH6A 3MGPC 3REIA 3UT9A 3RELB 2HIOA 4LD9A 5B40B 5AV9A 4J8VD 4WU8D 5CP6C 1N1JB 1P3PB 2Y2PA 3TU4B 3X1VD 3O62C 2Y2JA 3WAAB 4XZQB 3AZJD 4AWLC 2VQRA 1R4VA 1ZLAB 1EQZB 3MNNA 5DNMA 5JA4B 3B6GA 3W99D 3RELC 5B40C 2PYOA 2AROD 4KUDC 1P3PC 3X1UD 1M18A 5B33D 3TU4C 3KXBB 2XD1A 3WAAC 3AZID 5BNVA 1TZYD 4XZQC 1JFIA 1P3LD 4Z5TA 3WTPB 1ZLAC 2L5AA 1AOIC 4G91B 5E5AB 5CP6A 1EQZC 3MGQD 5FUGB 3X1TB 3O62A 5B2ID 5B2JA 1S32D 2DF4C 3WTPE 4JJNB 2NQBB 3NQJB 1TAFB 4KGCD 3R45B 3WKJB 5B1MB 3WTPC 5B32G 3RELA 5B40A 3AZGD 4J8UD 4G91C 4H9SC 2BYKB 1N1JA 3VH6T 5AV8B 5E5AC 3AZHA 1P3PA 2IO5B 3AV2D 2CV5B 4KUDA 3X1TC 3TU4A 1P3OB 5B31B 1U35D 3WAAA 2J8PA 3A6NB 1P3KA 4J8WD 3AZNC 2AROC 4JJNC 5GXQB 5GSUD 4YS3C 3UTAD 3WA9D 2NQBC 3AFAB 1ZLAA 1AOIA 5JA4A 1PZRA 4CAYA 5JRGD 3WKJC 2ZY2A 5AV6D 2JSSA 3LZ0D 3AYWD 3B6FD 5AV8C 3F6TA 1M19D 3C1CB 2CV5C 5B0YD 4HGAB 3LJAD 1P3OC 5B31C 4H9OB 5B2IC 3B0DB 3AZJA 5GXQC 3VH5A 1P3BD 1P3AB 3AFAC 4X23D 3AZKB 2Y2NA 5E5AA 5AVBB 3KWQD 3REID 3W98B 5FUGA 2HIOD 3AZFB 3W99A 1B6WA 5AV9D 1BH8A 3AZNA 2AROA 4JJNA 3AZLB 4YS3A 4HGAC 3B0DC 3R45A 2HUEB 1F1EA 1P3AC 1KX4B 3EG5B 3MNND 2BYKA 5AVBC 5GT3D 3B6GD 3W98C 2YFWA 2CV5A 2Y2LA 5CPJB 5B31A 3AZFC 5B2IA 3EPJA 1M18D 4QLCB 4UUZB 4Z5TD 3MGPD 1H3OA 1KX4C 5CP6D 4J8UA 3A1IA 5CPJC 3O62D 4H9OA 1U35A 4WU9B 3UTAA 2F8NG 3H0LC 4QLCC 5AVBA 3VH5T 4XUJB 3RELD 5B40D 3AZFA 5DNNB 4E44A 1P3PD 3B6FA 3TU4D 1P34B 2F8NK 1M19A 3WAAD 2Y2GA 5B0YA 3LJAA 4XZQD 4WU9C 2NZDB 1P3GB 1ZLAD 1KX4A 1EQZD 4X23A 3LELB 3EPHA 5CHLB 2FJ7B 4CSRB 5DNNC 3MGSB 4DRAA 3B0CW 5BT1C 1P34C 3EPLA 2F8NH 4UUZA 3WTPD 1WWSA 1P3GC 5BS7C 5E5AD 5B32B 3LELC 3X1TD 5GT3A 2FJ7C 3MGSC 4WU9A 5G49B 4R8PB 3AZND 4JJND 3W96B 4YS3D 2NQBD 4WNNB 1WWIA 3WKJD 5BO0B 5B1MD 4H9NB 3MGPA 2JE5A 1Q9CA 3KUYB 5AV8D 5B32C 2CV5D 1P3OD 5B31D 5C3IB 3A6ND 4R8PC 5GXQD 3W96C 2RVQC 1P3GA 1KX5B 3AFAD 5BS7A 1KX3B 3KXBC 3C1BB 2FJ7A 3NQUB 3MGSA 3KUYC 2ZY4A 5GT0B 2Y2OA 3C1CD 5C3IC 4XZQA 1P3AD 3AN2B 1KX5C 3MVDB 3AZKD 5KDMB 1KX3C 5AY8B 5AVBD 3MGRB 1EQZA 4Z66B 5B32A 3W98D 4YM6B 5B1MC 4H9RB 3C1BC 3AZFD 5AVCB 5GT0C 4R8PA 3W96A 3AZLD 5AV5B 2IO5C 3KXBA 5B0ZB 1P3IB 3LZ1B 3A6NC 1HQ3B 3WTPA 3AN2C 5CPKB 1B67A 3MVDC 1KX4D 2DQNC 4H9QB 5AY8C 3MGRC 4H9SA 2UWXA 5BNXB 4Z66C 5CPJD 4YM6C 1F66B 3X1TA 5AVCC 4H9PB 5F99B 5AV5C 3C1CC 2NQBA 3NQJA 4QLCD 1KX3A 5B0ZC 1P3IC 1TAFA 3LZ1C 3WKJA 3REHB 5B1MA 5CPIB 5CPKC 2F8NB 2YFVB 3NQUA 3AZKC 5GT0A 5AV8A 1F66C 1P3OA 2BYMB 5F99C 5GSUB 2CWEA 4WU9D 3A6NA 3V9RB 3UTBB 5GXQA 3IP4C 3MVDA 3AZLC 1KU5A 5AY8A 3P5JB 3AFAA 3MGRA 4Z66A 1M1AB 1ID3B 2HUEC 4Z2MG 4YM6A 5CPIC 5B31G 3LZ0B 5DNND 5BT1D 1BH9B 4WV4B 3AZEB 1P34D 2Y2HA 3C1CA 1P3FB 5B0ZA 3AV1B 1P3IA 1P3BB 3LZ1A 2NZDD 3UTBC 1P3GD 4ZUXB 5CPKA 3AL0C 1P3AA 4H9QA 3AZKA 3UT9B 4DQYB 5BNXA 2Y2KA 3LELD 1M1AC 1ID3C 2ZY3A 3A1KA 4LD9B 1F66A 3W97B 3W98A 2FJ7D 3H0RC 3MGSD 3X1SB 4WZSB 3AZEC 2Y2QA 3AZLA 1P3FC 2F2AC 3AV1C 4Z2MH 4ZUXC 2F8NA 5DNMB 2YFVA 5B24B 3UT9C 5B32D 4XUJC 3W97C 2PYOB 5CPJA 3X1SC 5B1LB 3VH5W 4R8PD 3UTBA 3W96D 2RVQD 3AZMB 5BNVB 1JFIB 2XD5A 3KXBD 3B0CT 1P3MB 4QLCA 1M1AA 1W2EA 1ID3A 3REJB 2NZDC 5DNMC 5B24C 3KUYD 3AZEA 5B2JB 3KSYA 1P3FA 5B1LC 3AV1A 3AZMC 4ZUXA 1KX5D 3B0BA 4ZBJB 4DRBA 1KX3D 1P3MC 3REKB 4XUJA 2W8SA 3REJC 3W97A 3C1BD 4KUDB 3AZHB 3X1SA 5DNNA 5GT0D 4J8XB 2ZM5A 5B2JC 1P34A 1P3KB 4WJ3C 2NZDA 3AN2D 1AOIB 4NE6A 4ZBJC 3MVDD 4CAYB 5AY8D 5B24A 3REKC 3MGRD 4Z66D 4YM6D 3LELA 2LY8A 1T3UA 3AZHC 4WU8B 5B1LA 4J8VB 5AVCD 4CSRA 4J8XC 4KHAB 5AV5D 3AZMA 3X1VB 1P3KC 3AZJB 5B0ZD 1P3ID 1P3MA 3LZ1D 1HQ3D 4G92B 3REJA 5CPKD 3W99B 1F66D 1BH8B 4J8VC 3AZNB 2AROB 4WU8C 5F99D 3X1UB 4YS3B 5B33B 5G49A 3X1VC 3AZIB 1TZYB 4WNNA 3AZJC 3VH6W 3REKA 4G92C
chains in the Genus database with same CATH topology
3REHD 5BO0A 2FFFB 4H9NA 5CPID 2F8ND 2Y2IA 2YFWB 1HTAA 4EO5B 3MGQB 3KUYA 3W99C 4J8XA 3KFUG 5B2IB 1S32B 2Y2MA 3X1UC 3UTBD 5B33C 3AZIC 1KX5A 1TZYC 4KGCB 1P3LC 1H3OB 4NE5A 1M1AD 1ID3D 1HQ3C 3AZGB 4J8UB 3C1BA 4WU8A 4J8VA 2BG1A 4EO5C 3MGQC 3AV2B 4KHAA 3AZED 3X1VA 1U35B 1S32C 1P3FD 3AV1D 4J8WB 3UTAB 3WA9B 4ZUXD 2RIQA 4M6BA 4NE3A 3AN2A 4KGCC 1BFMA 2G5HC 3UT9D 5KDMA 5JRGB 4LD9D 4XUJD 3W97D 5AV6B 4J8UC 3REHC 4H9RA 3X1SD 3AZGC 3AYWB 2ZY5A 3B6FB 3X1UA 5AVCA 3AV2C 5B33A 1M19B 5B0YB 1A7WA 3LJAB 2JCHA 1U35C 5AV5A 3AZIA 1TZYA 1P3LA 4J8WC 3UTAC 5GSUC 3WA9C 1HQ3A 4X23B 3H0MC 5DNMD 5B24D 3KWQB 5JRGC 3REIB 2G5IC 3MGQA 2HIOB 2PYOD 5AV6C 5AV9B 1S32A 5B1LD 4E45A 3LZ0C 3AYWC 3B6FC 1Z2CB 4H9PA 5F99A 3AZMD 5B0YC 1M19C 3LJAC 4KGCA 1P3MD 1ULYA 1P3BC 3REJD 4X23C 3REHA 3AZGA 5CPIA 3MNNB 3KWQC 5GT3B 3B6GB 3REIC 3AV2A 5B2JD 2HIOC 4LD9C 5AV9C 4NFTA 4J8WA 2BYMA 1M18B 5GSUA 3WA9A 3V9RA 3REKD 4Z5TB 5JRGA 3MGPB 5AV6A 4KUDD 3AZHD 3EPKA 3MNNC 5CP6B 3LZ0A 3AYWA 5GT3C 3B6GC 4J8XD 1BH9A 3O62B 1P3KD 2PYOC 4AWLB 1M18C 1P3BA 1P3LB 1AOID 4UPKA 3KWQA 3FDDA 4Z5TC 3VH6A 3MGPC 3REIA 3UT9A 3RELB 2HIOA 4LD9A 5B40B 5AV9A 4J8VD 4WU8D 5CP6C 1N1JB 1P3PB 2Y2PA 3TU4B 3X1VD 3O62C 2Y2JA 3WAAB 4XZQB 3AZJD 4AWLC 2VQRA 1R4VA 1ZLAB 1EQZB 3MNNA 5DNMA 5JA4B 3B6GA 3W99D 3RELC 5B40C 2PYOA 2AROD 4KUDC 1P3PC 3X1UD 1M18A 5B33D 3TU4C 3KXBB 2XD1A 3WAAC 3AZID 5BNVA 1TZYD 4XZQC 1JFIA 1P3LD 4Z5TA 3WTPB 1ZLAC 2L5AA 1AOIC 4G91B 5E5AB 5CP6A 1EQZC 3MGQD 5FUGB 3X1TB 3O62A 5B2ID 5B2JA 1S32D 2DF4C 3WTPE 4JJNB 2NQBB 3NQJB 1TAFB 4KGCD 3R45B 3WKJB 5B1MB 3WTPC 5B32G 3RELA 5B40A 3AZGD 4J8UD 4G91C 4H9SC 2BYKB 1N1JA 3VH6T 5AV8B 5E5AC 3AZHA 1P3PA 2IO5B 3AV2D 2CV5B 4KUDA 3X1TC 3TU4A 1P3OB 5B31B 1U35D 3WAAA 2J8PA 3A6NB 1P3KA 4J8WD 3AZNC 2AROC 4JJNC 5GXQB 5GSUD 4YS3C 3UTAD 3WA9D 2NQBC 3AFAB 1ZLAA 1AOIA 5JA4A 1PZRA 4CAYA 5JRGD 3WKJC 2ZY2A 5AV6D 2JSSA 3LZ0D 3AYWD 3B6FD 5AV8C 3F6TA 1M19D 3C1CB 2CV5C 5B0YD 4HGAB 3LJAD 1P3OC 5B31C 4H9OB 5B2IC 3B0DB 3AZJA 5GXQC 3VH5A 1P3BD 1P3AB 3AFAC 4X23D 3AZKB 2Y2NA 5E5AA 5AVBB 3KWQD 3REID 3W98B 5FUGA 2HIOD 3AZFB 3W99A 1B6WA 5AV9D 1BH8A 3AZNA 2AROA 4JJNA 3AZLB 4YS3A 4HGAC 3B0DC 3R45A 2HUEB 1F1EA 1P3AC 1KX4B 3EG5B 3MNND 2BYKA 5AVBC 5GT3D 3B6GD 3W98C 2YFWA 2CV5A 2Y2LA 5CPJB 5B31A 3AZFC 5B2IA 3EPJA 1M18D 4QLCB 4UUZB 4Z5TD 3MGPD 1H3OA 1KX4C 5CP6D 4J8UA 3A1IA 5CPJC 3O62D 4H9OA 1U35A 4WU9B 3UTAA 2F8NG 3H0LC 4QLCC 5AVBA 3VH5T 4XUJB 3RELD 5B40D 3AZFA 5DNNB 4E44A 1P3PD 3B6FA 3TU4D 1P34B 2F8NK 1M19A 3WAAD 2Y2GA 5B0YA 3LJAA 4XZQD 4WU9C 2NZDB 1P3GB 1ZLAD 1KX4A 1EQZD 4X23A 3LELB 3EPHA 5CHLB 2FJ7B 4CSRB 5DNNC 3MGSB 4DRAA 3B0CW 5BT1C 1P34C 3EPLA 2F8NH 4UUZA 3WTPD 1WWSA 1P3GC 5BS7C 5E5AD 5B32B 3LELC 3X1TD 5GT3A 2FJ7C 3MGSC 4WU9A 5G49B 4R8PB 3AZND 4JJND 3W96B 4YS3D 2NQBD 4WNNB 1WWIA 3WKJD 5BO0B 5B1MD 4H9NB 3MGPA 2JE5A 1Q9CA 3KUYB 5AV8D 5B32C 2CV5D 1P3OD 5B31D 5C3IB 3A6ND 4R8PC 5GXQD 3W96C 2RVQC 1P3GA 1KX5B 3AFAD 5BS7A 1KX3B 3KXBC 3C1BB 2FJ7A 3NQUB 3MGSA 3KUYC 2ZY4A 5GT0B 2Y2OA 3C1CD 5C3IC 4XZQA 1P3AD 3AN2B 1KX5C 3MVDB 3AZKD 5KDMB 1KX3C 5AY8B 5AVBD 3MGRB 1EQZA 4Z66B 5B32A 3W98D 4YM6B 5B1MC 4H9RB 3C1BC 3AZFD 5AVCB 5GT0C 4R8PA 3W96A 3AZLD 5AV5B 2IO5C 3KXBA 5B0ZB 1P3IB 3LZ1B 3A6NC 1HQ3B 3WTPA 3AN2C 5CPKB 1B67A 3MVDC 1KX4D 2DQNC 4H9QB 5AY8C 3MGRC 4H9SA 2UWXA 5BNXB 4Z66C 5CPJD 4YM6C 1F66B 3X1TA 5AVCC 4H9PB 5F99B 5AV5C 3C1CC 2NQBA 3NQJA 4QLCD 1KX3A 5B0ZC 1P3IC 1TAFA 3LZ1C 3WKJA 3REHB 5B1MA 5CPIB 5CPKC 2F8NB 2YFVB 3NQUA 3AZKC 5GT0A 5AV8A 1F66C 1P3OA 2BYMB 5F99C 5GSUB 2CWEA 4WU9D 3A6NA 3V9RB 3UTBB 5GXQA 3IP4C 3MVDA 3AZLC 1KU5A 5AY8A 3P5JB 3AFAA 3MGRA 4Z66A 1M1AB 1ID3B 2HUEC 4Z2MG 4YM6A 5CPIC 5B31G 3LZ0B 5DNND 5BT1D 1BH9B 4WV4B 3AZEB 1P34D 2Y2HA 3C1CA 1P3FB 5B0ZA 3AV1B 1P3IA 1P3BB 3LZ1A 2NZDD 3UTBC 1P3GD 4ZUXB 5CPKA 3AL0C 1P3AA 4H9QA 3AZKA 3UT9B 4DQYB 5BNXA 2Y2KA 3LELD 1M1AC 1ID3C 2ZY3A 3A1KA 4LD9B 1F66A 3W97B 3W98A 2FJ7D 3H0RC 3MGSD 3X1SB 4WZSB 3AZEC 2Y2QA 3AZLA 1P3FC 2F2AC 3AV1C 4Z2MH 4ZUXC 2F8NA 5DNMB 2YFVA 5B24B 3UT9C 5B32D 4XUJC 3W97C 2PYOB 5CPJA 3X1SC 5B1LB 3VH5W 4R8PD 3UTBA 3W96D 2RVQD 3AZMB 5BNVB 1JFIB 2XD5A 3KXBD 3B0CT 1P3MB 4QLCA 1M1AA 1W2EA 1ID3A 3REJB 2NZDC 5DNMC 5B24C 3KUYD 3AZEA 5B2JB 3KSYA 1P3FA 5B1LC 3AV1A 3AZMC 4ZUXA 1KX5D 3B0BA 4ZBJB 4DRBA 1KX3D 1P3MC 3REKB 4XUJA 2W8SA 3REJC 3W97A 3C1BD 4KUDB 3AZHB 3X1SA 5DNNA 5GT0D 4J8XB 2ZM5A 5B2JC 1P34A 1P3KB 4WJ3C 2NZDA 3AN2D 1AOIB 4NE6A 4ZBJC 3MVDD 4CAYB 5AY8D 5B24A 3REKC 3MGRD 4Z66D 4YM6D 3LELA 2LY8A 1T3UA 3AZHC 4WU8B 5B1LA 4J8VB 5AVCD 4CSRA 4J8XC 4KHAB 5AV5D 3AZMA 3X1VB 1P3KC 3AZJB 5B0ZD 1P3ID 1P3MA 3LZ1D 1HQ3D 4G92B 3REJA 5CPKD 3W99B 1F66D 1BH8B 4J8VC 3AZNB 2AROB 4WU8C 5F99D 3X1UB 4YS3B 5B33B 5G49A 3X1VC 3AZIB 1TZYB 4WNNA 3AZJC 3VH6W 3REKA 4G92C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH D;  5BO0 A;  5CPI D;  4H9N A;  2F8N D;  2YFW B;  1HTA A;  4EO5 B;  3MGQ B;  3KUY A;  3W99 C;  4J8X A;  5B2I B;  1S32 B;  3X1U C;  3UTB D;  5B33 C;  3AZI C;  1KX5 A;  1TZY C;  4KGC B;  1P3L C;  1H3O B;  4NE5 A;  1M1A D;  1ID3 D;  1HQ3 C;  3AZG B;  4J8U B;  3C1B A;  4WU8 A;  4J8V A;  4EO5 C;  3MGQ C;  3AV2 B;  4KHA A;  3AZE D;  3X1V A;  1U35 B;  1S32 C;  1P3F D;  3AV1 D;  4J8W B;  3UTA B;  3WA9 B;  4ZUX D;  4M6B A;  4NE3 A;  3AN2 A;  4KGC C;  1BFM A;  3UT9 D;  5KDM A;  5JRG B;  4LD9 D;  4XUJ D;  3W97 D;  5AV6 B;  4J8U C;  3REH C;  4H9R A;  3X1S D;  3AZG C;  3AYW B;  3B6F B;  3X1U A;  5AVC A;  3AV2 C;  5B33 A;  1M19 B;  5B0Y B;  1A7W A;  3LJA B;  1U35 C;  5AV5 A;  3AZI A;  1TZY A;  1P3L A;  4J8W C;  3UTA C;  5GSU C;  3WA9 C;  1HQ3 A;  4X23 B;  5DNM D;  5B24 D;  3KWQ B;  5JRG C;  3REI B;  3MGQ A;  2HIO B;  2PYO D;  5AV6 C;  5AV9 B;  1S32 A;  5B1L D;  4E45 A;  3LZ0 C;  3AYW C;  3B6F C;  5F99 A;  4H9P A;  3AZM D;  1M19 C;  5B0Y C;  3LJA C;  4KGC A;  1P3M D;  1ULY A;  1P3B C;  3REJ D;  4X23 C;  3REH A;  3AZG A;  5CPI A;  3MNN B;  3KWQ C;  5GT3 B;  3B6G B;  3REI C;  3AV2 A;  5B2J D;  2HIO C;  4LD9 C;  5AV9 C;  4NFT A;  4J8W A;  2BYM A;  1M18 B;  5GSU A;  3WA9 A;  3V9R A;  3REK D;  4Z5T B;  5JRG A;  3MGP B;  5AV6 A;  4KUD D;  3AZH D;  3MNN C;  5CP6 B;  3LZ0 A;  3AYW A;  5GT3 C;  3B6G C;  4J8X D;  1BH9 A;  3O62 B;  1P3K D;  2PYO C;  4AWL B;  1M18 C;  1P3B A;  1P3L B;  1AOI D;  3KWQ A;  4Z5T C;  3VH6 A;  3REI A;  3MGP C;  3UT9 A;  3REL B;  2HIO A;  4LD9 A;  5B40 B;  5AV9 A;  4J8V D;  4WU8 D;  5CP6 C;  1N1J B;  1P3P B;  3TU4 B;  3X1V D;  3O62 C;  3WAA B;  4XZQ B;  3AZJ D;  4AWL C;  1R4V A;  1ZLA B;  1EQZ B;  3MNN A;  5DNM A;  5JA4 B;  3B6G A;  3W99 D;  3REL C;  5B40 C;  2PYO A;  2ARO D;  4KUD C;  1P3P C;  3X1U D;  1M18 A;  5B33 D;  3TU4 C;  3KXB B;  3WAA C;  3AZI D;  5BNV A;  1TZY D;  4XZQ C;  1JFI A;  1P3L D;  4Z5T A;  3WTP B;  1ZLA C;  2L5A A;  1AOI C;  4G91 B;  5E5A B;  5CP6 A;  1EQZ C;  3MGQ D;  5FUG B;  3X1T B;  3O62 A;  5B2I D;  5B2J A;  1S32 D;  3WTP E;  4JJN B;  2NQB B;  3NQJ B;  1TAF B;  4KGC D;  3R45 B;  3WKJ B;  5B1M B;  3WTP C;  5B32 G;  3REL A;  5B40 A;  3AZG D;  4J8U D;  4G91 C;  4H9S C;  2BYK B;  1N1J A;  3VH6 T;  5AV8 B;  5E5A C;  3AZH A;  1P3P A;  2IO5 B;  3AV2 D;  2CV5 B;  4KUD A;  3X1T C;  3TU4 A;  1P3O B;  5B31 B;  1U35 D;  3WAA A;  3A6N B;  1P3K A;  4J8W D;  3AZN C;  2ARO C;  4JJN C;  5GXQ B;  5GSU D;  4YS3 C;  3UTA D;  3WA9 D;  2NQB C;  3AFA B;  1ZLA A;  1AOI A;  5JA4 A;  3WKJ C;  4CAY A;  5JRG D;  5AV6 D;  2JSS A;  3LZ0 D;  3AYW D;  3B6F D;  5AV8 C;  1M19 D;  3C1C B;  2CV5 C;  5B0Y D;  4HGA B;  3LJA D;  1P3O C;  5B31 C;  4H9O B;  5B2I C;  3B0D B;  3AZJ A;  5GXQ C;  3VH5 A;  1P3B D;  1P3A B;  3AFA C;  4X23 D;  3AZK B;  5E5A A;  5AVB B;  3KWQ D;  3REI D;  3W98 B;  5FUG A;  2HIO D;  3AZF B;  3W99 A;  1B6W A;  5AV9 D;  1BH8 A;  3AZN A;  2ARO A;  4JJN A;  3AZL B;  4YS3 A;  4HGA C;  3B0D C;  3R45 A;  2HUE B;  1F1E A;  1P3A C;  1KX4 B;  3MNN D;  2BYK A;  5AVB C;  5GT3 D;  3B6G D;  3W98 C;  2YFW A;  2CV5 A;  5CPJ B;  5B31 A;  3AZF C;  5B2I A;  1M18 D;  4QLC B;  4UUZ B;  4Z5T D;  3MGP D;  1H3O A;  1KX4 C;  5CP6 D;  4J8U A;  5CPJ C;  3O62 D;  4H9O A;  1U35 A;  4WU9 B;  3UTA A;  2F8N G;  4QLC C;  5AVB A;  3VH5 T;  4XUJ B;  3REL D;  5B40 D;  3AZF A;  5DNN B;  4E44 A;  1P3P D;  3B6F A;  3TU4 D;  1P34 B;  2F8N K;  1M19 A;  3WAA D;  5B0Y A;  3LJA A;  4XZQ D;  4WU9 C;  2NZD B;  1P3G B;  1ZLA D;  1KX4 A;  1EQZ D;  4X23 A;  3LEL B;  5CHL B;  2FJ7 B;  4CSR B;  5DNN C;  3MGS B;  4DRA A;  3B0C W;  5BT1 C;  1P34 C;  2F8N H;  4UUZ A;  3WTP D;  1WWS A;  1P3G C;  5BS7 C;  5E5A D;  5B32 B;  3LEL C;  3X1T D;  5GT3 A;  2FJ7 C;  3MGS C;  4WU9 A;  5G49 B;  4R8P B;  3AZN D;  4JJN D;  3W96 B;  4YS3 D;  2NQB D;  4WNN B;  1WWI A;  3WKJ D;  5BO0 B;  5B1M D;  4H9N B;  3MGP A;  1Q9C A;  3KUY B;  5AV8 D;  5B32 C;  2CV5 D;  1P3O D;  5B31 D;  5C3I B;  3A6N D;  4R8P C;  5GXQ D;  3W96 C;  2RVQ C;  1P3G A;  1KX5 B;  3AFA D;  5BS7 A;  1KX3 B;  3KXB C;  3C1B B;  2FJ7 A;  3NQU B;  3MGS A;  3KUY C;  5GT0 B;  3C1C D;  5C3I C;  4XZQ A;  1P3A D;  3AN2 B;  1KX5 C;  3MVD B;  3AZK D;  5KDM B;  1KX3 C;  5AY8 B;  5AVB D;  3MGR B;  1EQZ A;  4Z66 B;  5B32 A;  3W98 D;  4YM6 B;  5B1M C;  4H9R B;  3C1B C;  3AZF D;  5AVC B;  5GT0 C;  4R8P A;  3W96 A;  3AZL D;  5AV5 B;  2IO5 C;  3KXB A;  5B0Z B;  1P3I B;  3LZ1 B;  3A6N C;  1HQ3 B;  3WTP A;  3AN2 C;  5CPK B;  1B67 A;  3MVD C;  1KX4 D;  4H9Q B;  5AY8 C;  3MGR C;  4H9S A;  5BNX B;  4Z66 C;  5CPJ D;  4YM6 C;  1F66 B;  3X1T A;  5AVC C;  4H9P B;  5F99 B;  5AV5 C;  3C1C C;  2NQB A;  3NQJ A;  4QLC D;  1KX3 A;  5B0Z C;  1P3I C;  1TAF A;  3LZ1 C;  3WKJ A;  3REH B;  5B1M A;  5CPI B;  5CPK C;  2F8N B;  2YFV B;  3NQU A;  3AZK C;  5GT0 A;  5AV8 A;  1F66 C;  1P3O A;  2BYM B;  5F99 C;  4WU9 D;  5GSU B;  2CWE A;  3A6N A;  3V9R B;  3UTB B;  5GXQ A;  3AZL C;  3MVD A;  1KU5 A;  5AY8 A;  3AFA A;  3MGR A;  4Z66 A;  1M1A B;  1ID3 B;  2HUE C;  4Z2M G;  4YM6 A;  5CPI C;  5B31 G;  3LZ0 B;  5DNN D;  5BT1 D;  1BH9 B;  4WV4 B;  3AZE B;  1P34 D;  3C1C A;  1P3F B;  5B0Z A;  3AV1 B;  1P3I A;  1P3B B;  3LZ1 A;  2NZD D;  3UTB C;  1P3G D;  4ZUX B;  5CPK A;  1P3A A;  4H9Q A;  3AZK A;  3UT9 B;  5BNX A;  3LEL D;  1M1A C;  1ID3 C;  4LD9 B;  1F66 A;  3W97 B;  3W98 A;  2FJ7 D;  3MGS D;  3X1S B;  4WZS B;  3AZE C;  3AZL A;  1P3F C;  3AV1 C;  4Z2M H;  4ZUX C;  2F8N A;  5DNM B;  2YFV A;  5B24 B;  3UT9 C;  5B32 D;  4XUJ C;  3W97 C;  2PYO B;  5CPJ A;  3X1S C;  5B1L B;  3VH5 W;  4R8P D;  3UTB A;  3W96 D;  2RVQ D;  3AZM B;  5BNV B;  1JFI B;  3KXB D;  3B0C T;  1P3M B;  4QLC A;  1M1A A;  1ID3 A;  3REJ B;  2NZD C;  5DNM C;  5B24 C;  3KUY D;  3AZE A;  5B2J B;  3KSY A;  1P3F A;  5B1L C;  3AV1 A;  3AZM C;  4ZUX A;  1KX5 D;  3B0B A;  4ZBJ B;  4DRB A;  1KX3 D;  1P3M C;  3REK B;  4XUJ A;  3REJ C;  3W97 A;  3C1B D;  4KUD B;  3AZH B;  3X1S A;  5DNN A;  5GT0 D;  4J8X B;  5B2J C;  1P34 A;  1P3K B;  2NZD A;  3AN2 D;  1AOI B;  4NE6 A;  4ZBJ C;  3MVD D;  4CAY B;  5AY8 D;  5B24 A;  3REK C;  3MGR D;  4Z66 D;  4YM6 D;  3LEL A;  2LY8 A;  3AZH C;  4WU8 B;  5B1L A;  4J8V B;  5AVC D;  4CSR A;  4J8X C;  4KHA B;  5AV5 D;  3AZM A;  3X1V B;  1P3K C;  3AZJ B;  5B0Z D;  1P3I D;  1P3M A;  3LZ1 D;  1HQ3 D;  4G92 B;  3REJ A;  5CPK D;  3W99 B;  1F66 D;  1BH8 B;  4J8V C;  3AZN B;  2ARO B;  4WU8 C;  5F99 D;  3X1U B;  4YS3 B;  5B33 B;  5G49 A;  3X1V C;  3AZI B;  1TZY B;  4WNN A;  3AZJ C;  3VH6 W;  3REK A;  4G92 C; 
#chains in the Genus database with same CATH topology
 3REH D;  5BO0 A;  2FFF B;  4H9N A;  5CPI D;  2F8N D;  2Y2I A;  2YFW B;  1HTA A;  4EO5 B;  3MGQ B;  3KUY A;  3W99 C;  4J8X A;  3KFU G;  5B2I B;  1S32 B;  2Y2M A;  3X1U C;  3UTB D;  5B33 C;  3AZI C;  1KX5 A;  1TZY C;  4KGC B;  1P3L C;  1H3O B;  4NE5 A;  1M1A D;  1ID3 D;  1HQ3 C;  3AZG B;  4J8U B;  3C1B A;  4WU8 A;  4J8V A;  2BG1 A;  4EO5 C;  3MGQ C;  3AV2 B;  4KHA A;  3AZE D;  3X1V A;  1U35 B;  1S32 C;  1P3F D;  3AV1 D;  4J8W B;  3UTA B;  3WA9 B;  4ZUX D;  2RIQ A;  4M6B A;  4NE3 A;  3AN2 A;  4KGC C;  1BFM A;  2G5H C;  3UT9 D;  5KDM A;  5JRG B;  4LD9 D;  4XUJ D;  3W97 D;  5AV6 B;  4J8U C;  3REH C;  4H9R A;  3X1S D;  3AZG C;  3AYW B;  2ZY5 A;  3B6F B;  3X1U A;  5AVC A;  3AV2 C;  5B33 A;  1M19 B;  5B0Y B;  1A7W A;  3LJA B;  2JCH A;  1U35 C;  5AV5 A;  3AZI A;  1TZY A;  1P3L A;  4J8W C;  3UTA C;  5GSU C;  3WA9 C;  1HQ3 A;  4X23 B;  3H0M C;  5DNM D;  5B24 D;  3KWQ B;  5JRG C;  3REI B;  2G5I C;  3MGQ A;  2HIO B;  2PYO D;  5AV6 C;  5AV9 B;  1S32 A;  5B1L D;  4E45 A;  3LZ0 C;  3AYW C;  3B6F C;  1Z2C B;  4H9P A;  5F99 A;  3AZM D;  5B0Y C;  1M19 C;  3LJA C;  4KGC A;  1P3M D;  1ULY A;  1P3B C;  3REJ D;  4X23 C;  3REH A;  3AZG A;  5CPI A;  3MNN B;  3KWQ C;  5GT3 B;  3B6G B;  3REI C;  3AV2 A;  5B2J D;  2HIO C;  4LD9 C;  5AV9 C;  4NFT A;  4J8W A;  2BYM A;  1M18 B;  5GSU A;  3WA9 A;  3V9R A;  3REK D;  4Z5T B;  5JRG A;  3MGP B;  5AV6 A;  4KUD D;  3AZH D;  3EPK A;  3MNN C;  5CP6 B;  3LZ0 A;  3AYW A;  5GT3 C;  3B6G C;  4J8X D;  1BH9 A;  3O62 B;  1P3K D;  2PYO C;  4AWL B;  1M18 C;  1P3B A;  1P3L B;  1AOI D;  4UPK A;  3KWQ A;  3FDD A;  4Z5T C;  3VH6 A;  3MGP C;  3REI A;  3UT9 A;  3REL B;  2HIO A;  4LD9 A;  5B40 B;  5AV9 A;  4J8V D;  4WU8 D;  5CP6 C;  1N1J B;  1P3P B;  2Y2P A;  3TU4 B;  3X1V D;  3O62 C;  2Y2J A;  3WAA B;  4XZQ B;  3AZJ D;  4AWL C;  2VQR A;  1R4V A;  1ZLA B;  1EQZ B;  3MNN A;  5DNM A;  5JA4 B;  3B6G A;  3W99 D;  3REL C;  5B40 C;  2PYO A;  2ARO D;  4KUD C;  1P3P C;  3X1U D;  1M18 A;  5B33 D;  3TU4 C;  3KXB B;  2XD1 A;  3WAA C;  3AZI D;  5BNV A;  1TZY D;  4XZQ C;  1JFI A;  1P3L D;  4Z5T A;  3WTP B;  1ZLA C;  2L5A A;  1AOI C;  4G91 B;  5E5A B;  5CP6 A;  1EQZ C;  3MGQ D;  5FUG B;  3X1T B;  3O62 A;  5B2I D;  5B2J A;  1S32 D;  2DF4 C;  3WTP E;  4JJN B;  2NQB B;  3NQJ B;  1TAF B;  4KGC D;  3R45 B;  3WKJ B;  5B1M B;  3WTP C;  5B32 G;  3REL A;  5B40 A;  3AZG D;  4J8U D;  4G91 C;  4H9S C;  2BYK B;  1N1J A;  3VH6 T;  5AV8 B;  5E5A C;  3AZH A;  1P3P A;  2IO5 B;  3AV2 D;  2CV5 B;  4KUD A;  3X1T C;  3TU4 A;  1P3O B;  5B31 B;  1U35 D;  3WAA A;  2J8P A;  3A6N B;  1P3K A;  4J8W D;  3AZN C;  2ARO C;  4JJN C;  5GXQ B;  5GSU D;  4YS3 C;  3UTA D;  3WA9 D;  2NQB C;  3AFA B;  1ZLA A;  1AOI A;  5JA4 A;  1PZR A;  4CAY A;  5JRG D;  3WKJ C;  2ZY2 A;  5AV6 D;  2JSS A;  3LZ0 D;  3AYW D;  3B6F D;  5AV8 C;  3F6T A;  1M19 D;  3C1C B;  2CV5 C;  5B0Y D;  4HGA B;  3LJA D;  1P3O C;  5B31 C;  4H9O B;  5B2I C;  3B0D B;  3AZJ A;  5GXQ C;  3VH5 A;  1P3B D;  1P3A B;  3AFA C;  4X23 D;  3AZK B;  2Y2N A;  5E5A A;  5AVB B;  3KWQ D;  3REI D;  3W98 B;  5FUG A;  2HIO D;  3AZF B;  3W99 A;  1B6W A;  5AV9 D;  1BH8 A;  3AZN A;  2ARO A;  4JJN A;  3AZL B;  4YS3 A;  4HGA C;  3B0D C;  3R45 A;  2HUE B;  1F1E A;  1P3A C;  1KX4 B;  3EG5 B;  3MNN D;  2BYK A;  5AVB C;  5GT3 D;  3B6G D;  3W98 C;  2YFW A;  2CV5 A;  2Y2L A;  5CPJ B;  5B31 A;  3AZF C;  5B2I A;  3EPJ A;  1M18 D;  4QLC B;  4UUZ B;  4Z5T D;  3MGP D;  1H3O A;  1KX4 C;  5CP6 D;  4J8U A;  3A1I A;  5CPJ C;  3O62 D;  4H9O A;  1U35 A;  4WU9 B;  3UTA A;  2F8N G;  3H0L C;  4QLC C;  5AVB A;  3VH5 T;  4XUJ B;  3REL D;  5B40 D;  3AZF A;  5DNN B;  4E44 A;  1P3P D;  3B6F A;  3TU4 D;  1P34 B;  2F8N K;  1M19 A;  3WAA D;  2Y2G A;  5B0Y A;  3LJA A;  4XZQ D;  4WU9 C;  2NZD B;  1P3G B;  1ZLA D;  1KX4 A;  1EQZ D;  4X23 A;  3LEL B;  3EPH A;  5CHL B;  2FJ7 B;  4CSR B;  5DNN C;  3MGS B;  4DRA A;  3B0C W;  5BT1 C;  1P34 C;  3EPL A;  2F8N H;  4UUZ A;  3WTP D;  1WWS A;  1P3G C;  5BS7 C;  5E5A D;  5B32 B;  3LEL C;  3X1T D;  5GT3 A;  2FJ7 C;  3MGS C;  4WU9 A;  5G49 B;  4R8P B;  3AZN D;  4JJN D;  3W96 B;  4YS3 D;  2NQB D;  4WNN B;  1WWI A;  3WKJ D;  5BO0 B;  5B1M D;  4H9N B;  3MGP A;  2JE5 A;  1Q9C A;  3KUY B;  5AV8 D;  5B32 C;  2CV5 D;  1P3O D;  5B31 D;  5C3I B;  3A6N D;  4R8P C;  5GXQ D;  3W96 C;  2RVQ C;  1P3G A;  1KX5 B;  3AFA D;  5BS7 A;  1KX3 B;  3KXB C;  3C1B B;  2FJ7 A;  3NQU B;  3MGS A;  3KUY C;  2ZY4 A;  5GT0 B;  2Y2O A;  3C1C D;  5C3I C;  4XZQ A;  1P3A D;  3AN2 B;  1KX5 C;  3MVD B;  3AZK D;  5KDM B;  1KX3 C;  5AY8 B;  5AVB D;  3MGR B;  1EQZ A;  4Z66 B;  5B32 A;  3W98 D;  4YM6 B;  5B1M C;  4H9R B;  3C1B C;  3AZF D;  5AVC B;  5GT0 C;  4R8P A;  3W96 A;  3AZL D;  5AV5 B;  2IO5 C;  3KXB A;  5B0Z B;  1P3I B;  3LZ1 B;  3A6N C;  1HQ3 B;  3WTP A;  3AN2 C;  5CPK B;  1B67 A;  3MVD C;  1KX4 D;  2DQN C;  4H9Q B;  5AY8 C;  3MGR C;  4H9S A;  2UWX A;  5BNX B;  4Z66 C;  5CPJ D;  4YM6 C;  1F66 B;  3X1T A;  5AVC C;  4H9P B;  5F99 B;  5AV5 C;  3C1C C;  2NQB A;  3NQJ A;  4QLC D;  1KX3 A;  5B0Z C;  1P3I C;  1TAF A;  3LZ1 C;  3WKJ A;  3REH B;  5B1M A;  5CPI B;  5CPK C;  2F8N B;  2YFV B;  3NQU A;  3AZK C;  5GT0 A;  5AV8 A;  1F66 C;  1P3O A;  2BYM B;  5F99 C;  5GSU B;  2CWE A;  4WU9 D;  3A6N A;  3V9R B;  3UTB B;  5GXQ A;  3IP4 C;  3MVD A;  3AZL C;  1KU5 A;  5AY8 A;  3P5J B;  3AFA A;  3MGR A;  4Z66 A;  1M1A B;  1ID3 B;  2HUE C;  4Z2M G;  4YM6 A;  5CPI C;  5B31 G;  3LZ0 B;  5DNN D;  5BT1 D;  1BH9 B;  4WV4 B;  3AZE B;  1P34 D;  2Y2H A;  3C1C A;  1P3F B;  5B0Z A;  3AV1 B;  1P3I A;  1P3B B;  3LZ1 A;  2NZD D;  3UTB C;  1P3G D;  4ZUX B;  5CPK A;  3AL0 C;  1P3A A;  4H9Q A;  3AZK A;  3UT9 B;  4DQY B;  5BNX A;  2Y2K A;  3LEL D;  1M1A C;  1ID3 C;  2ZY3 A;  3A1K A;  4LD9 B;  1F66 A;  3W97 B;  3W98 A;  2FJ7 D;  3H0R C;  3MGS D;  3X1S B;  4WZS B;  3AZE C;  2Y2Q A;  3AZL A;  1P3F C;  2F2A C;  3AV1 C;  4Z2M H;  4ZUX C;  2F8N A;  5DNM B;  2YFV A;  5B24 B;  3UT9 C;  5B32 D;  4XUJ C;  3W97 C;  2PYO B;  5CPJ A;  3X1S C;  5B1L B;  3VH5 W;  4R8P D;  3UTB A;  3W96 D;  2RVQ D;  3AZM B;  5BNV B;  1JFI B;  2XD5 A;  3KXB D;  3B0C T;  1P3M B;  4QLC A;  1M1A A;  1W2E A;  1ID3 A;  3REJ B;  2NZD C;  5DNM C;  5B24 C;  3KUY D;  3AZE A;  5B2J B;  3KSY A;  1P3F A;  5B1L C;  3AV1 A;  3AZM C;  4ZUX A;  1KX5 D;  3B0B A;  4ZBJ B;  4DRB A;  1KX3 D;  1P3M C;  3REK B;  4XUJ A;  2W8S A;  3REJ C;  3W97 A;  3C1B D;  4KUD B;  3AZH B;  3X1S A;  5DNN A;  5GT0 D;  4J8X B;  2ZM5 A;  5B2J C;  1P34 A;  1P3K B;  4WJ3 C;  2NZD A;  3AN2 D;  1AOI B;  4NE6 A;  4ZBJ C;  3MVD D;  4CAY B;  5AY8 D;  5B24 A;  3REK C;  3MGR D;  4Z66 D;  4YM6 D;  3LEL A;  2LY8 A;  1T3U A;  3AZH C;  4WU8 B;  5B1L A;  4J8V B;  5AVC D;  4CSR A;  4J8X C;  4KHA B;  5AV5 D;  3AZM A;  3X1V B;  1P3K C;  3AZJ B;  5B0Z D;  1P3I D;  1P3M A;  3LZ1 D;  1HQ3 D;  4G92 B;  3REJ A;  5CPK D;  3W99 B;  1F66 D;  1BH8 B;  4J8V C;  3AZN B;  2ARO B;  4WU8 C;  5F99 D;  3X1U B;  4YS3 B;  5B33 B;  5G49 A;  3X1V C;  3AZI B;  1TZY B;  4WNN A;  3AZJ C;  3VH6 W;  3REK A;  4G92 C; 
#chains in the Genus database with same CATH homology
 3REH D;  5BO0 A;  2FFF B;  4H9N A;  5CPI D;  2F8N D;  2Y2I A;  2YFW B;  1HTA A;  4EO5 B;  3MGQ B;  3KUY A;  3W99 C;  4J8X A;  3KFU G;  5B2I B;  1S32 B;  2Y2M A;  3X1U C;  3UTB D;  5B33 C;  3AZI C;  1KX5 A;  1TZY C;  4KGC B;  1P3L C;  1H3O B;  4NE5 A;  1M1A D;  1ID3 D;  1HQ3 C;  3AZG B;  4J8U B;  3C1B A;  4WU8 A;  4J8V A;  2BG1 A;  4EO5 C;  3MGQ C;  3AV2 B;  4KHA A;  3AZE D;  3X1V A;  1U35 B;  1S32 C;  1P3F D;  3AV1 D;  4J8W B;  3UTA B;  3WA9 B;  4ZUX D;  2RIQ A;  4M6B A;  4NE3 A;  3AN2 A;  4KGC C;  1BFM A;  2G5H C;  3UT9 D;  5KDM A;  5JRG B;  4LD9 D;  4XUJ D;  3W97 D;  5AV6 B;  4J8U C;  3REH C;  4H9R A;  3X1S D;  3AZG C;  3AYW B;  2ZY5 A;  3B6F B;  3X1U A;  5AVC A;  3AV2 C;  5B33 A;  1M19 B;  5B0Y B;  1A7W A;  3LJA B;  2JCH A;  1U35 C;  5AV5 A;  3AZI A;  1TZY A;  1P3L A;  4J8W C;  3UTA C;  5GSU C;  3WA9 C;  1HQ3 A;  4X23 B;  3H0M C;  5DNM D;  5B24 D;  3KWQ B;  5JRG C;  3REI B;  2G5I C;  3MGQ A;  2HIO B;  2PYO D;  5AV6 C;  5AV9 B;  1S32 A;  5B1L D;  4E45 A;  3LZ0 C;  3AYW C;  3B6F C;  1Z2C B;  4H9P A;  5F99 A;  3AZM D;  5B0Y C;  1M19 C;  3LJA C;  4KGC A;  1P3M D;  1ULY A;  1P3B C;  3REJ D;  4X23 C;  3REH A;  3AZG A;  5CPI A;  3MNN B;  3KWQ C;  5GT3 B;  3B6G B;  3REI C;  3AV2 A;  5B2J D;  2HIO C;  4LD9 C;  5AV9 C;  4NFT A;  4J8W A;  2BYM A;  1M18 B;  5GSU A;  3WA9 A;  3V9R A;  3REK D;  4Z5T B;  5JRG A;  3MGP B;  5AV6 A;  4KUD D;  3AZH D;  3EPK A;  3MNN C;  5CP6 B;  3LZ0 A;  3AYW A;  5GT3 C;  3B6G C;  4J8X D;  1BH9 A;  3O62 B;  1P3K D;  2PYO C;  4AWL B;  1M18 C;  1P3B A;  1P3L B;  1AOI D;  4UPK A;  3KWQ A;  3FDD A;  4Z5T C;  3VH6 A;  3MGP C;  3REI A;  3UT9 A;  3REL B;  2HIO A;  4LD9 A;  5B40 B;  5AV9 A;  4J8V D;  4WU8 D;  5CP6 C;  1N1J B;  1P3P B;  2Y2P A;  3TU4 B;  3X1V D;  3O62 C;  2Y2J A;  3WAA B;  4XZQ B;  3AZJ D;  4AWL C;  2VQR A;  1R4V A;  1ZLA B;  1EQZ B;  3MNN A;  5DNM A;  5JA4 B;  3B6G A;  3W99 D;  3REL C;  5B40 C;  2PYO A;  2ARO D;  4KUD C;  1P3P C;  3X1U D;  1M18 A;  5B33 D;  3TU4 C;  3KXB B;  2XD1 A;  3WAA C;  3AZI D;  5BNV A;  1TZY D;  4XZQ C;  1JFI A;  1P3L D;  4Z5T A;  3WTP B;  1ZLA C;  2L5A A;  1AOI C;  4G91 B;  5E5A B;  5CP6 A;  1EQZ C;  3MGQ D;  5FUG B;  3X1T B;  3O62 A;  5B2I D;  5B2J A;  1S32 D;  2DF4 C;  3WTP E;  4JJN B;  2NQB B;  3NQJ B;  1TAF B;  4KGC D;  3R45 B;  3WKJ B;  5B1M B;  3WTP C;  5B32 G;  3REL A;  5B40 A;  3AZG D;  4J8U D;  4G91 C;  4H9S C;  2BYK B;  1N1J A;  3VH6 T;  5AV8 B;  5E5A C;  3AZH A;  1P3P A;  2IO5 B;  3AV2 D;  2CV5 B;  4KUD A;  3X1T C;  3TU4 A;  1P3O B;  5B31 B;  1U35 D;  3WAA A;  2J8P A;  3A6N B;  1P3K A;  4J8W D;  3AZN C;  2ARO C;  4JJN C;  5GXQ B;  5GSU D;  4YS3 C;  3UTA D;  3WA9 D;  2NQB C;  3AFA B;  1ZLA A;  1AOI A;  5JA4 A;  1PZR A;  4CAY A;  5JRG D;  3WKJ C;  2ZY2 A;  5AV6 D;  2JSS A;  3LZ0 D;  3AYW D;  3B6F D;  5AV8 C;  3F6T A;  1M19 D;  3C1C B;  2CV5 C;  5B0Y D;  4HGA B;  3LJA D;  1P3O C;  5B31 C;  4H9O B;  5B2I C;  3B0D B;  3AZJ A;  5GXQ C;  3VH5 A;  1P3B D;  1P3A B;  3AFA C;  4X23 D;  3AZK B;  2Y2N A;  5E5A A;  5AVB B;  3KWQ D;  3REI D;  3W98 B;  5FUG A;  2HIO D;  3AZF B;  3W99 A;  1B6W A;  5AV9 D;  1BH8 A;  3AZN A;  2ARO A;  4JJN A;  3AZL B;  4YS3 A;  4HGA C;  3B0D C;  3R45 A;  2HUE B;  1F1E A;  1P3A C;  1KX4 B;  3EG5 B;  3MNN D;  2BYK A;  5AVB C;  5GT3 D;  3B6G D;  3W98 C;  2YFW A;  2CV5 A;  2Y2L A;  5CPJ B;  5B31 A;  3AZF C;  5B2I A;  3EPJ A;  1M18 D;  4QLC B;  4UUZ B;  4Z5T D;  3MGP D;  1H3O A;  1KX4 C;  5CP6 D;  4J8U A;  3A1I A;  5CPJ C;  3O62 D;  4H9O A;  1U35 A;  4WU9 B;  3UTA A;  2F8N G;  3H0L C;  4QLC C;  5AVB A;  3VH5 T;  4XUJ B;  3REL D;  5B40 D;  3AZF A;  5DNN B;  4E44 A;  1P3P D;  3B6F A;  3TU4 D;  1P34 B;  2F8N K;  1M19 A;  3WAA D;  2Y2G A;  5B0Y A;  3LJA A;  4XZQ D;  4WU9 C;  2NZD B;  1P3G B;  1ZLA D;  1KX4 A;  1EQZ D;  4X23 A;  3LEL B;  3EPH A;  5CHL B;  2FJ7 B;  4CSR B;  5DNN C;  3MGS B;  4DRA A;  3B0C W;  5BT1 C;  1P34 C;  3EPL A;  2F8N H;  4UUZ A;  3WTP D;  1WWS A;  1P3G C;  5BS7 C;  5E5A D;  5B32 B;  3LEL C;  3X1T D;  5GT3 A;  2FJ7 C;  3MGS C;  4WU9 A;  5G49 B;  4R8P B;  3AZN D;  4JJN D;  3W96 B;  4YS3 D;  2NQB D;  4WNN B;  1WWI A;  3WKJ D;  5BO0 B;  5B1M D;  4H9N B;  3MGP A;  2JE5 A;  1Q9C A;  3KUY B;  5AV8 D;  5B32 C;  2CV5 D;  1P3O D;  5B31 D;  5C3I B;  3A6N D;  4R8P C;  5GXQ D;  3W96 C;  2RVQ C;  1P3G A;  1KX5 B;  3AFA D;  5BS7 A;  1KX3 B;  3KXB C;  3C1B B;  2FJ7 A;  3NQU B;  3MGS A;  3KUY C;  2ZY4 A;  5GT0 B;  2Y2O A;  3C1C D;  5C3I C;  4XZQ A;  1P3A D;  3AN2 B;  1KX5 C;  3MVD B;  3AZK D;  5KDM B;  1KX3 C;  5AY8 B;  5AVB D;  3MGR B;  1EQZ A;  4Z66 B;  5B32 A;  3W98 D;  4YM6 B;  5B1M C;  4H9R B;  3C1B C;  3AZF D;  5AVC B;  5GT0 C;  4R8P A;  3W96 A;  3AZL D;  5AV5 B;  2IO5 C;  3KXB A;  5B0Z B;  1P3I B;  3LZ1 B;  3A6N C;  1HQ3 B;  3WTP A;  3AN2 C;  5CPK B;  1B67 A;  3MVD C;  1KX4 D;  2DQN C;  4H9Q B;  5AY8 C;  3MGR C;  4H9S A;  2UWX A;  5BNX B;  4Z66 C;  5CPJ D;  4YM6 C;  1F66 B;  3X1T A;  5AVC C;  4H9P B;  5F99 B;  5AV5 C;  3C1C C;  2NQB A;  3NQJ A;  4QLC D;  1KX3 A;  5B0Z C;  1P3I C;  1TAF A;  3LZ1 C;  3WKJ A;  3REH B;  5B1M A;  5CPI B;  5CPK C;  2F8N B;  2YFV B;  3NQU A;  3AZK C;  5GT0 A;  5AV8 A;  1F66 C;  1P3O A;  2BYM B;  5F99 C;  5GSU B;  2CWE A;  4WU9 D;  3A6N A;  3V9R B;  3UTB B;  5GXQ A;  3IP4 C;  3MVD A;  3AZL C;  1KU5 A;  5AY8 A;  3P5J B;  3AFA A;  3MGR A;  4Z66 A;  1M1A B;  1ID3 B;  2HUE C;  4Z2M G;  4YM6 A;  5CPI C;  5B31 G;  3LZ0 B;  5DNN D;  5BT1 D;  1BH9 B;  4WV4 B;  3AZE B;  1P34 D;  2Y2H A;  3C1C A;  1P3F B;  5B0Z A;  3AV1 B;  1P3I A;  1P3B B;  3LZ1 A;  2NZD D;  3UTB C;  1P3G D;  4ZUX B;  5CPK A;  3AL0 C;  1P3A A;  4H9Q A;  3AZK A;  3UT9 B;  4DQY B;  5BNX A;  2Y2K A;  3LEL D;  1M1A C;  1ID3 C;  2ZY3 A;  3A1K A;  4LD9 B;  1F66 A;  3W97 B;  3W98 A;  2FJ7 D;  3H0R C;  3MGS D;  3X1S B;  4WZS B;  3AZE C;  2Y2Q A;  3AZL A;  1P3F C;  2F2A C;  3AV1 C;  4Z2M H;  4ZUX C;  2F8N A;  5DNM B;  2YFV A;  5B24 B;  3UT9 C;  5B32 D;  4XUJ C;  3W97 C;  2PYO B;  5CPJ A;  3X1S C;  5B1L B;  3VH5 W;  4R8P D;  3UTB A;  3W96 D;  2RVQ D;  3AZM B;  5BNV B;  1JFI B;  2XD5 A;  3KXB D;  3B0C T;  1P3M B;  4QLC A;  1M1A A;  1W2E A;  1ID3 A;  3REJ B;  2NZD C;  5DNM C;  5B24 C;  3KUY D;  3AZE A;  5B2J B;  3KSY A;  1P3F A;  5B1L C;  3AV1 A;  3AZM C;  4ZUX A;  1KX5 D;  3B0B A;  4ZBJ B;  4DRB A;  1KX3 D;  1P3M C;  3REK B;  4XUJ A;  2W8S A;  3REJ C;  3W97 A;  3C1B D;  4KUD B;  3AZH B;  3X1S A;  5DNN A;  5GT0 D;  4J8X B;  2ZM5 A;  5B2J C;  1P34 A;  1P3K B;  4WJ3 C;  2NZD A;  3AN2 D;  1AOI B;  4NE6 A;  4ZBJ C;  3MVD D;  4CAY B;  5AY8 D;  5B24 A;  3REK C;  3MGR D;  4Z66 D;  4YM6 D;  3LEL A;  2LY8 A;  1T3U A;  3AZH C;  4WU8 B;  5B1L A;  4J8V B;  5AVC D;  4CSR A;  4J8X C;  4KHA B;  5AV5 D;  3AZM A;  3X1V B;  1P3K C;  3AZJ B;  5B0Z D;  1P3I D;  1P3M A;  3LZ1 D;  1HQ3 D;  4G92 B;  3REJ A;  5CPK D;  3W99 B;  1F66 D;  1BH8 B;  4J8V C;  3AZN B;  2ARO B;  4WU8 C;  5F99 D;  3X1U B;  4YS3 B;  5B33 B;  5G49 A;  3X1V C;  3AZI B;  1TZY B;  4WNN A;  3AZJ C;  3VH6 W;  3REK A;  4G92 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...