3NQUA

Crystal structure of partially trypsinized (cenp-a/h4)2 heterotetramer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
HLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nquA00
5DNMD 2PYOB 4KHAB 5B2ID 5B0ZC 3AZIB 3AZFA 4Z66C 1HQ3D 4Z5TB 5B31G 1P3BC 5B1LA 1P3FD 2HIOC 1P3IB 3C1CA 3UTAA 5B0YB 5GSUD 3B6GB 5CPJA 3W99C 1N1JA 4G91B 5B40D 5C3IC 4H9QA 4DRAA 3UT9A 1P3KD 1TZYA 1BFMA 3AZED 4KUDA 3KUYB 1P3LD 4WZSB 3X1TA 3X1SA 4XZQD 4QLCA 1B67A 3MGQB 3REJB 2NZDB 3KWQD 5GXQA 3VH6W 5JRGD 1P3KB 3B6FA 5B32A 3WAAB 1P3AD 4YM6C 3C1BD 1EQZB 3MVDA 4XZQB 3LELB 2L5AA 1ZLAA 3AZNA 3AZHC 5GT3C 5CPIB 1P3MC 4H9RA 2CV5A 1KX5B 1P34B 5AV9A 4J8VA 3C1BB 1P3OA 3NQJA 3AV2C 3VH5W 5BNXB 3AZJA 3W98B 4WNNA 5DNND 3MGRD 1M18C 3A6NB 1ID3D 3MGPD 3WA9A 4WU8D 4J8XA 1S32D 1P3GD 4Z2MH 3W96D 5AY8D 4LD9B 3UTBC 3LZ0C 1BH9A 3AZLC 4WU9C 5CHLB 3X1VD 1M19A 5G49A 2LY8A 4ZUXC 2NQBC 1U35A 5DNNB 1KX3A 4ZBJC 3R45A 5DNMC 5B0ZD 5B24B 1F66B 3W97B 3AZKB 5AVCB 3TU4A 4Z66D 1P3BD 1HQ3C 2PYOA 4KHAA 4NFTA 2HIOD 3REIC 3AZFD 5CPKC 5B1LD 3REKC 4Z5TA 5GSUC 3AZMC 3AZGB 3W99D 3MNND 3WTPE 5B40C 1AOIB 5B0ZB 3X1UB 1P3BB 5AV8C 2HIOB 3KUYA 2AROA 4X23C 3NQUB 5C3IB 1JFIB 5JRGC 3MGQA 5CP6A 3REJA 3O62C 3V9RA 3RELC 2NZDA 4YM6D 1P3AC 2BYMB 2YFVB 5B32D 3WKJC 3WAAA 4Z2MG 1EQZA 5AV5B 5GT3D 5BNVB 3LELA 1P3MD 3AZND 5AVBA 5E5AA 4J8UC 4AWLC 2F8NB 4JJNB 1KX4A 5AV6B 5CPIA 5BS7A 3LZ1B 3AV2D 1KX5A 1P34A 3AZHB 3MGSB 2IO5C 4YS3A 4HGAC 5GT3B 3MGRC 3KXBB 1P3PB 4J8WA 5BNXA 5F99C 5B33C 1P3GC 3W98A 5B2JA 3A6NA 3W96C 3LZ0D 5AY8C 4WU9D 3UTBD 3AZLD 3REHB 1M18B 5GT0A 4LD9A 3B0CW 3LZ0B 3AZLB 3VH6A 5B24A 3REID 5CPKD 4KGCB 5B31B 5AVCA 3AZFC 4ZUXB 5B1LC 5FUGB 3REKD 3AZMD 2NQBB 3AV1D 3AFAB 3MNNC 5DNMB 3C1CC 3UTAC 1TAFB 5B2IB 3AZGA 1HQ3B 2FJ7A 5AV8D 1P3FB 1AOIA 3UT9C 3KSYA 4KUDC 3X1UA 3REKB 5GSUB 5B1MA 3AZMB 3X1TC 4X23D 3X1SC 1BH8B 5B40B 4QLCC 2AROD 3O62D 3AZEB 3NQUA 3RELD 1P3LB 5GXQC 5CP6D 4XUJD 1JFIA 5B32C 2RVQD 3TU4B 3WKJD 2BYMA 4R8PD 3KWQB 5JRGB 3AZNC 3O62B 4J8UD 1KU5A 1P3AB 5AV5A 3AN2D 5E5AD 1M1AA 3WTPD 4J8VC 1P3OC 2F8NA 3VH6T 3LJAD 4JJNA 5AV6A 3LZ1A 3AZJC 4YS3D 5F99D 4AWLB 5B33D 3AZHA 3MGSA 4J8XC 4J8WD 3KXBA 1P3PA 4H9SA 4HGAB 4DRBA 3MGRB 1ID3B 3AYWA 3MGPB 1M19C 4WU8B 1S32B 4UUZB 5GT0D 1U35C 1P3GB 1KX3C 3REHA 1M18A 3W96B 5AY8B 4CSRB 3TU4C 3AZIA 3X1VB 1A7WA 2YFWB 4EO5B 3AV1C 3C1CD 3UTAD 4KGCA 5B31A 5CPJD 1P3IA 4Z5TC 5B0YA 4ZUXA 2NQBA 5FUGA 3B6GA 3AFAA 4Z66B 3UT9D 5B2IA 1TZYD 3AZFB 4KUDD 3X1TD 5B1LB 1HQ3A 3X1SD 3W99B 3MNNB 1P3FA 4QLCD 1WWIA 5GSUA 2AROC 4M6BA 4H9QB 5B40A 5GXQD 3B6FD 5CP6C 3REJC 4XUJC 1P3KA 4KUDB 4NE6A 5JA4B 2RVQC 3X1TB 3AZEA 2NZDC 1P3LA 3MVDD 4QLCB 4R8PC 4XZQA 1ZLAD 1EQZC 5B32G 4YM6B 3LELC 3AN2C 3KWQA 5AVBC 5E5AC 5B32B 2CV5D 5AV9D 3WTPC 4J8VD 1P3AA 1P3OD 1KX4C 4H9OB 3C1BA 1M1AD 3LJAC 5BS7C 1KX5C 1P34C 1P3MB 3AZNB 3AZJD 1ULYA 4CAYB 4YS3C 3WA9D 4J8XD 2F8NK 4J8WC 3AV2B 3W98C 5B2JC 1M19D 1U35D 1KX3D 5GT0C 4H9NB 4LD9C 5DNNA 3MGRA 1ID3A 3MGPA 1B6WA 4WU8A 3UTBB 1S32A 5BO0B 4WU9B 3TU4D 1F66A 3W97A 2BYKB 3AZKA 2PYOD 3W96A 5AY8A 4ZBJB 5B24C 1HTAA 5AVCC 5G49B 4CSRA 3X1VA 4Z5TD 5CPJC 5BT1C 2YFWA 1P3ID 3B0DC 5B0YD 5KDMB 3B6GD 5B0ZA 1TZYC 3REIB 3AZGC 5CPKB 4Z66A 1P3BA 2FJ7C 1AOIC 3AV1B 2HIOA 3X1UC 3KUYD 3B0CT 5B1MC 3VH5A 3W99A 3MNNA 5AV8B 3MGQD 3B0BA 3REJD 3B6FC 2NZDD 4WV4B 4X23B 3MVDC 2YFVA 5JA4A 3WAAD 2AROB 1EQZD 1ZLAC 3RELB 3LELD 5AVBD 5BNVA 5CP6B 4XUJB 3V9RB 2CV5C 5AV9C 3WKJB 5AV5C 1KX4D 4YM6A 5CPID 2HUEC 1M1AC 4R8PB 1KX5D 1P34D 4H9PB 4J8UB 4JJNC 4H9OA 5AV6C 3AN2B 5GT3A 3LZ1C 5AVBB 5E5AB 3WA9C 1P3MA 3WTPB 3MGSC 3W98D 1H3OB 4CAYA 5B2JD 3A6ND 1KX4B 2IO5B 3LJAB 3KXBC 1P3PC 1F1EA 4NE5A 4G92C 3AV2A 1R4VA 4YS3B 5F99B 4H9SC 5B33B 4LD9D 3AYWC 2JSSA 4J8WB 3VH5T 3REHC 5B2JB 4H9NA 2PYOC 5B24D 3LZ0A 3UTBA 5BO0A 3AZKD 5AVCD 3AZIC 3AZLA 4WU9A 1F66D 3W97D 2BYKA 5BT1D 5GT0B 2F8NH 5DNMA 4KGCC 5B31C 1P3IC 1TAFA 5B0YC 3B6GC 3AZGD 1WWSA 3AFAC 2CWEA 2FJ7D 4G91C 1AOID 5B2IC 5KDMA 3C1CB 3UTAB 3X1UD 3REIA 5CPKA 5B1MD 5CPJB 3KUYC 3REKA 3AZMA 1N1JB 1P3FC 3AV1A 3B0DB 1BH8A 3UT9B 1TZYB 3MGQC 2FJ7B 3X1SB 5AV8A 1P3KC 5B1MB 3AZEC 1P3LC 3WAAC 4X23A 4XZQC 5GXQB 3B6FB 5JRGA 3O62A 5AV5D 3RELA 3KWQC 3MVDB 5CPIC 4XUJA 1ZLAB 2F8ND 3WKJA 3C1BC 4JJND 5AV6D 1Q9CA 3LZ1D 4R8PA 4H9RB 4H9PA 3AZHD 3MGSD 5AV9B 4J8UA 2CV5B 4J8VB 1P3OB 3A6NC 3AN2A 2F8NG 2HUEB 3KXBD 1P3PD 1M1AB 3NQJB 3WTPA 1H3OA 3AZJB 4WNNB 3LJAA 3AYWD 3WA9B 4J8XB 4UUZA 5F99A 3REHD 5B33A 1P3GA 1M18D 5DNNC 1ID3C 3MGPC 4WU8C 1S32C 1BH9B 4E44A 4NE3A 4G92B 3AZID 1M19B 3AZKC 1F66C 3W97C 1U35B 4E45A 1KX3B 3AYWB 3R45B 4KGCD 5B31D 3X1VC 4ZUXD 2NQBD 3AFAD 4EO5C
chains in the Genus database with same CATH superfamily
5DNMD 2PYOB 4KHAB 5B2ID 5B0ZC 3AZIB 3AZFA 4Z66C 1HQ3D 4Z5TB 5B31G 1P3BC 5B1LA 1P3FD 2HIOC 1P3IB 3C1CA 3UTAA 2XD5A 5B0YB 5GSUD 3B6GB 5CPJA 3W99C 1N1JA 4G91B 5B40D 5C3IC 4H9QA 4DRAA 3UT9A 1P3KD 1TZYA 1BFMA 3AZED 4KUDA 3KUYB 1P3LD 4WZSB 3X1TA 3H0LC 3X1SA 4XZQD 4QLCA 1B67A 3MGQB 3REJB 2NZDB 3KWQD 5GXQA 3VH6W 5JRGD 1P3KB 3B6FA 5B32A 2Y2IA 3WAAB 1P3AD 4YM6C 3C1BD 1EQZB 3MVDA 4XZQB 3LELB 2L5AA 1ZLAA 3AZNA 3AZHC 5GT3C 5CPIB 1P3MC 4H9RA 2CV5A 1KX5B 1P34B 2VQRA 5AV9A 4J8VA 2DQNC 3C1BB 1P3OA 2XD1A 3NQJA 3AV2C 3VH5W 5BNXB 3AZJA 3W98B 4WNNA 5DNND 3MGRD 1M18C 3A6NB 1ID3D 3MGPD 3WA9A 4WU8D 4J8XA 1S32D 1P3GD 4Z2MH 3W96D 5AY8D 4LD9B 3UTBC 3LZ0C 1BH9A 3H0RC 3AZLC 4WU9C 5CHLB 3X1VD 1M19A 5G49A 2LY8A 4ZUXC 2NQBC 1U35A 5DNNB 1KX3A 4ZBJC 3FDDA 3R45A 5DNMC 5B0ZD 5B24B 1F66B 3W97B 3AZKB 5AVCB 3TU4A 4Z66D 1P3BD 1HQ3C 2PYOA 4KHAA 4NFTA 2HIOD 3F6TA 3REIC 3AZFD 5CPKC 5B1LD 3EPLA 4Z5TA 5GSUC 3REKC 3AZMC 3W99D 3MNND 3AZGB 2Y2HA 3WTPE 5B40C 1AOIB 3A1IA 5B0ZB 3X1UB 1P3BB 2Y2PA 5AV8C 2HIOB 3KUYA 2AROA 4X23C 3NQUB 5C3IB 2W8SA 1JFIB 5JRGC 3MGQA 5CP6A 2BG1A 3REJA 3O62C 1W2EA 3V9RA 3RELC 4WJ3C 2NZDA 4YM6D 1P3AC 2BYMB 2ZM5A 2YFVB 5B32D 3A1KA 3WKJC 3WAAA 4Z2MG 1EQZA 5AV5B 5GT3D 5BNVB 3LELA 1P3MD 2UWXA 5AVBA 5E5AA 3AZND 4J8UC 4AWLC 2F8NB 4JJNB 1KX4A 5AV6B 5CPIA 5BS7A 2ZY5A 3LZ1B 3AV2D 1KX5A 1P34A 3AZHB 3MGSB 2IO5C 4YS3A 4HGAC 5GT3B 3MGRC 3KXBB 1P3PB 4J8WA 5BNXA 5F99C 5B33C 1P3GC 3W98A 5B2JA 3A6NA 3W96C 3LZ0D 5AY8C 4WU9D 3UTBD 3AZLD 3REHB 1M18B 5GT0A 4LD9A 3B0CW 2Y2KA 3LZ0B 3AZLB 3VH6A 5B24A 3REID 5CPKD 4KGCB 5B31B 5AVCA 3AZFC 4ZUXB 5B1LC 5FUGB 3REKD 3AZMD 2NQBB 3AV1D 3AFAB 3MNNC 5DNMB 3C1CC 3UTAC 1TAFB 5B2IB 3AZGA 1HQ3B 2FJ7A 5AV8D 1P3FB 1AOIA 3UT9C 3KSYA 4KUDC 3X1UA 3REKB 5GSUB 5B1MA 3AZMB 3X1TC 4X23D 3X1SC 1BH8B 5B40B 4QLCC 2AROD 3O62D 3AZEB 3NQUA 3RELD 1P3LB 2Y2LA 1PZRA 5GXQC 5CP6D 4XUJD 1JFIA 5B32C 2RVQD 3TU4B 3WKJD 3IP4C 2BYMA 4R8PD 3KWQB 2F2AC 5JRGB 3AZNC 3O62B 4J8UD 1KU5A 1P3AB 5AV5A 3AN2D 5E5AD 1M1AA 3WTPD 4J8VC 1P3OC 2F8NA 3VH6T 3LJAD 4JJNA 5AV6A 3LZ1A 3AZJC 4YS3D 5F99D 4AWLB 5B33D 3AZHA 3MGSA 4J8XC 4J8WD 3KXBA 1P3PA 4H9SA 4HGAB 4DRBA 3MGRB 1ID3B 3AYWA 3MGPB 1M19C 2ZY4A 4WU8B 1S32B 4UUZB 5GT0D 1U35C 1P3GB 1KX3C 3REHA 1M18A 3W96B 5AY8B 4CSRB 3TU4C 3AZIA 3X1VB 1A7WA 2YFWB 4EO5B 3AV1C 3C1CD 3UTAD 4KGCA 5B31A 5CPJD 1P3IA 4Z5TC 5B0YA 4ZUXA 2NQBA 5FUGA 3B6GA 3AFAA 4Z66B 3UT9D 5B2IA 1TZYD 3AZFB 4KUDD 3EPKA 3X1TD 5B1LB 1HQ3A 3X1SD 3W99B 3MNNB 1P3FA 4QLCD 1WWIA 5GSUA 2AROC 4M6BA 3AL0C 4H9QB 5B40A 5GXQD 3B6FD 5CP6C 3REJC 4XUJC 1P3KA 4KUDB 4NE6A 5JA4B 2RVQC 3X1TB 3AZEA 2NZDC 1P3LA 3MVDD 4QLCB 4R8PC 4XZQA 1ZLAD 1EQZC 5B32G 4YM6B 3LELC 3AN2C 3KWQA 5AVBC 5E5AC 5B32B 2CV5D 5AV9D 3WTPC 4J8VD 1P3AA 1P3OD 1KX4C 4H9OB 3C1BA 1M1AD 3LJAC 5BS7C 1KX5C 1P34C 1P3MB 3AZNB 3AZJD 1ULYA 4CAYB 4YS3C 3WA9D 4J8XD 2F8NK 3KFUG 4J8WC 1T3UA 2RIQA 3AV2B 3W98C 5B2JC 1M19D 1U35D 1KX3D 5GT0C 2Y2MA 4H9NB 4LD9C 5DNNA 3MGRA 1ID3A 3MGPA 2J8PA 1B6WA 4WU8A 3UTBB 1S32A 5BO0B 4WU9B 3TU4D 1F66A 3W97A 2BYKB 3AZKA 4DQYB 2PYOD 3W96A 5AY8A 4ZBJB 5B24C 1HTAA 5AVCC 5G49B 4CSRA 3X1VA 4Z5TD 5CPJC 5BT1C 2YFWA 1P3ID 3B0DC 5B0YD 5KDMB 3B6GD 5B0ZA 1TZYC 3REIB 3AZGC 5CPKB 4Z66A 1P3BA 2FJ7C 1AOIC 2JE5A 2Y2GA 3AV1B 2HIOA 2ZY2A 3X1UC 3KUYD 3B0CT 5B1MC 3VH5A 2DF4C 3MNNA 3W99A 5AV8B 3MGQD 3B0BA 3REJD 3B6FC 3EG5B 2NZDD 4WV4B 4X23B 3MVDC 2YFVA 5JA4A 3WAAD 2AROB 3EPJA 1EQZD 1ZLAC 2ZY3A 3RELB 3LELD 5AVBD 5BNVA 5CP6B 4XUJB 3V9RB 2CV5C 5AV9C 3WKJB 5AV5C 2G5IC 1KX4D 4YM6A 5CPID 2HUEC 1M1AC 4R8PB 1KX5D 1P34D 2Y2OA 4H9PB 2JCHA 4J8UB 4H9OA 4JJNC 5AV6C 3AN2B 5GT3A 3LZ1C 5AVBB 5E5AB 3WA9C 3H0MC 1P3MA 3WTPB 3MGSC 3W98D 1H3OB 4CAYA 5B2JD 3A6ND 1KX4B 2IO5B 2FFFB 3LJAB 3KXBC 1P3PC 1F1EA 4NE5A 4G92C 3AV2A 1R4VA 4YS3B 5F99B 4H9SC 5B33B 4LD9D 3AYWC 2JSSA 4J8WB 3VH5T 3REHC 5B2JB 4H9NA 2PYOC 5B24D 3LZ0A 3UTBA 5BO0A 3AZKD 5AVCD 3AZIC 3AZLA 4WU9A 1F66D 3W97D 2BYKA 5BT1D 5GT0B 2F8NH 2Y2QA 5DNMA 4KGCC 5B31C 1P3IC 1TAFA 5B0YC 3B6GC 3AZGD 1WWSA 3AFAC 2CWEA 2FJ7D 3P5JB 4G91C 1AOID 5B2IC 5KDMA 3C1CB 3UTAB 3X1UD 3REIA 5CPKA 5B1MD 5CPJB 3KUYC 3REKA 3AZMA 1N1JB 1P3FC 3AV1A 3B0DB 1BH8A 3UT9B 2Y2JA 1TZYB 3MGQC 2FJ7B 3X1SB 5AV8A 1P3KC 5B1MB 3AZEC 1P3LC 3WAAC 4X23A 4XZQC 5GXQB 3EPHA 3B6FB 5JRGA 3O62A 5AV5D 3RELA 3KWQC 3MVDB 5CPIC 4XUJA 1ZLAB 2F8ND 3WKJA 3C1BC 4JJND 5AV6D 1Q9CA 3LZ1D 4R8PA 4H9RB 4H9PA 3AZHD 3MGSD 5AV9B 4J8UA 2CV5B 4J8VB 2G5HC 1P3OB 3A6NC 3AN2A 2F8NG 2HUEB 3KXBD 1P3PD 1M1AB 3NQJB 3WTPA 1H3OA 3AZJB 4WNNB 3LJAA 3AYWD 3WA9B 4J8XB 4UUZA 5F99A 3REHD 5B33A 1P3GA 1M18D 5DNNC 1ID3C 2Y2NA 3MGPC 4WU8C 1S32C 1BH9B 4E44A 4NE3A 4G92B 3AZID 1M19B 3AZKC 1F66C 3W97C 1U35B 4E45A 1KX3B 1Z2CB 3AYWB 4UPKA 3R45B 4KGCD 5B31D 3X1VC 4ZUXD 2NQBD 3AFAD 4EO5C
chains in the Genus database with same CATH topology
5DNMD 2PYOB 4KHAB 5B2ID 5B0ZC 3AZIB 3AZFA 4Z66C 1HQ3D 4Z5TB 5B31G 1P3BC 5B1LA 1P3FD 2HIOC 1P3IB 3C1CA 3UTAA 2XD5A 5B0YB 5GSUD 3B6GB 5CPJA 3W99C 1N1JA 4G91B 5B40D 5C3IC 4H9QA 4DRAA 3UT9A 1P3KD 1TZYA 1BFMA 3AZED 4KUDA 3KUYB 1P3LD 4WZSB 3X1TA 3H0LC 3X1SA 4XZQD 4QLCA 1B67A 3MGQB 3REJB 2NZDB 3KWQD 5GXQA 3VH6W 5JRGD 1P3KB 3B6FA 5B32A 2Y2IA 3WAAB 1P3AD 4YM6C 3C1BD 1EQZB 3MVDA 4XZQB 3LELB 2L5AA 1ZLAA 3AZNA 3AZHC 5GT3C 5CPIB 1P3MC 4H9RA 2CV5A 1KX5B 1P34B 2VQRA 5AV9A 4J8VA 2DQNC 3C1BB 1P3OA 2XD1A 3NQJA 3AV2C 3VH5W 5BNXB 3AZJA 3W98B 4WNNA 5DNND 3MGRD 1M18C 3A6NB 1ID3D 3MGPD 3WA9A 4WU8D 4J8XA 1S32D 1P3GD 4Z2MH 3W96D 5AY8D 4LD9B 3UTBC 3LZ0C 1BH9A 3H0RC 3AZLC 4WU9C 5CHLB 3X1VD 1M19A 5G49A 2LY8A 4ZUXC 2NQBC 1U35A 5DNNB 1KX3A 4ZBJC 3FDDA 3R45A 5DNMC 5B0ZD 5B24B 1F66B 3W97B 3AZKB 5AVCB 3TU4A 4Z66D 1P3BD 1HQ3C 2PYOA 4KHAA 4NFTA 2HIOD 3F6TA 3REIC 3AZFD 5CPKC 5B1LD 3EPLA 4Z5TA 5GSUC 3REKC 3AZMC 3W99D 3MNND 3AZGB 2Y2HA 3WTPE 5B40C 1AOIB 3A1IA 5B0ZB 3X1UB 1P3BB 2Y2PA 5AV8C 2HIOB 3KUYA 2AROA 4X23C 3NQUB 5C3IB 2W8SA 1JFIB 5JRGC 3MGQA 5CP6A 2BG1A 3REJA 3O62C 1W2EA 3V9RA 3RELC 4WJ3C 2NZDA 4YM6D 1P3AC 2BYMB 2ZM5A 2YFVB 5B32D 3A1KA 3WKJC 3WAAA 4Z2MG 1EQZA 5AV5B 5GT3D 5BNVB 3LELA 1P3MD 2UWXA 5AVBA 5E5AA 3AZND 4J8UC 4AWLC 2F8NB 4JJNB 1KX4A 5AV6B 5CPIA 5BS7A 2ZY5A 3LZ1B 3AV2D 1KX5A 1P34A 3AZHB 3MGSB 2IO5C 4YS3A 4HGAC 5GT3B 3MGRC 3KXBB 1P3PB 4J8WA 5BNXA 5F99C 5B33C 1P3GC 3W98A 5B2JA 3A6NA 3W96C 3LZ0D 5AY8C 4WU9D 3UTBD 3AZLD 3REHB 1M18B 5GT0A 4LD9A 3B0CW 2Y2KA 3LZ0B 3AZLB 3VH6A 5B24A 3REID 5CPKD 4KGCB 5B31B 5AVCA 3AZFC 4ZUXB 5B1LC 5FUGB 3REKD 3AZMD 2NQBB 3AV1D 3AFAB 3MNNC 5DNMB 3C1CC 3UTAC 1TAFB 5B2IB 3AZGA 1HQ3B 2FJ7A 5AV8D 1P3FB 1AOIA 3UT9C 3KSYA 4KUDC 3X1UA 3REKB 5GSUB 5B1MA 3AZMB 3X1TC 4X23D 3X1SC 1BH8B 5B40B 4QLCC 2AROD 3O62D 3AZEB 3NQUA 3RELD 1P3LB 2Y2LA 1PZRA 5GXQC 5CP6D 4XUJD 1JFIA 5B32C 2RVQD 3TU4B 3WKJD 3IP4C 2BYMA 4R8PD 3KWQB 2F2AC 5JRGB 3AZNC 3O62B 4J8UD 1KU5A 1P3AB 5AV5A 3AN2D 5E5AD 1M1AA 3WTPD 4J8VC 1P3OC 2F8NA 3VH6T 3LJAD 4JJNA 5AV6A 3LZ1A 3AZJC 4YS3D 5F99D 4AWLB 5B33D 3AZHA 3MGSA 4J8XC 4J8WD 3KXBA 1P3PA 4H9SA 4HGAB 4DRBA 3MGRB 1ID3B 3AYWA 3MGPB 1M19C 2ZY4A 4WU8B 1S32B 4UUZB 5GT0D 1U35C 1P3GB 1KX3C 3REHA 1M18A 3W96B 5AY8B 4CSRB 3TU4C 3AZIA 3X1VB 1A7WA 2YFWB 4EO5B 3AV1C 3C1CD 3UTAD 4KGCA 5B31A 5CPJD 1P3IA 4Z5TC 5B0YA 4ZUXA 2NQBA 5FUGA 3B6GA 3AFAA 4Z66B 3UT9D 5B2IA 1TZYD 3AZFB 4KUDD 3EPKA 3X1TD 5B1LB 1HQ3A 3X1SD 3W99B 3MNNB 1P3FA 4QLCD 1WWIA 5GSUA 2AROC 4M6BA 3AL0C 4H9QB 5B40A 5GXQD 3B6FD 5CP6C 3REJC 4XUJC 1P3KA 4KUDB 4NE6A 5JA4B 2RVQC 3X1TB 3AZEA 2NZDC 1P3LA 3MVDD 4QLCB 4R8PC 4XZQA 1ZLAD 1EQZC 5B32G 4YM6B 3LELC 3AN2C 3KWQA 5AVBC 5E5AC 5B32B 2CV5D 5AV9D 3WTPC 4J8VD 1P3AA 1P3OD 1KX4C 4H9OB 3C1BA 1M1AD 3LJAC 5BS7C 1KX5C 1P34C 1P3MB 3AZNB 3AZJD 1ULYA 4CAYB 4YS3C 3WA9D 4J8XD 2F8NK 3KFUG 4J8WC 1T3UA 2RIQA 3AV2B 3W98C 5B2JC 1M19D 1U35D 1KX3D 5GT0C 2Y2MA 4H9NB 4LD9C 5DNNA 3MGRA 1ID3A 3MGPA 2J8PA 1B6WA 4WU8A 3UTBB 1S32A 5BO0B 4WU9B 3TU4D 1F66A 3W97A 2BYKB 3AZKA 4DQYB 2PYOD 3W96A 5AY8A 4ZBJB 5B24C 1HTAA 5AVCC 5G49B 4CSRA 3X1VA 4Z5TD 5CPJC 5BT1C 2YFWA 1P3ID 3B0DC 5B0YD 5KDMB 3B6GD 5B0ZA 1TZYC 3REIB 3AZGC 5CPKB 4Z66A 1P3BA 2FJ7C 1AOIC 2JE5A 2Y2GA 3AV1B 2HIOA 2ZY2A 3X1UC 3KUYD 3B0CT 5B1MC 3VH5A 2DF4C 3MNNA 3W99A 5AV8B 3MGQD 3B0BA 3REJD 3B6FC 3EG5B 2NZDD 4WV4B 4X23B 3MVDC 2YFVA 5JA4A 3WAAD 2AROB 3EPJA 1EQZD 1ZLAC 2ZY3A 3RELB 3LELD 5AVBD 5BNVA 5CP6B 4XUJB 3V9RB 2CV5C 5AV9C 3WKJB 5AV5C 2G5IC 1KX4D 4YM6A 5CPID 2HUEC 1M1AC 4R8PB 1KX5D 1P34D 2Y2OA 4H9PB 2JCHA 4J8UB 4H9OA 4JJNC 5AV6C 3AN2B 5GT3A 3LZ1C 5AVBB 5E5AB 3WA9C 3H0MC 1P3MA 3WTPB 3MGSC 3W98D 1H3OB 4CAYA 5B2JD 3A6ND 1KX4B 2IO5B 2FFFB 3LJAB 3KXBC 1P3PC 1F1EA 4NE5A 4G92C 3AV2A 1R4VA 4YS3B 5F99B 4H9SC 5B33B 4LD9D 3AYWC 2JSSA 4J8WB 3VH5T 3REHC 5B2JB 4H9NA 2PYOC 5B24D 3LZ0A 3UTBA 5BO0A 3AZKD 5AVCD 3AZIC 3AZLA 4WU9A 1F66D 3W97D 2BYKA 5BT1D 5GT0B 2F8NH 2Y2QA 5DNMA 4KGCC 5B31C 1P3IC 1TAFA 5B0YC 3B6GC 3AZGD 1WWSA 3AFAC 2CWEA 2FJ7D 3P5JB 4G91C 1AOID 5B2IC 5KDMA 3C1CB 3UTAB 3X1UD 3REIA 5CPKA 5B1MD 5CPJB 3KUYC 3REKA 3AZMA 1N1JB 1P3FC 3AV1A 3B0DB 1BH8A 3UT9B 2Y2JA 1TZYB 3MGQC 2FJ7B 3X1SB 5AV8A 1P3KC 5B1MB 3AZEC 1P3LC 3WAAC 4X23A 4XZQC 5GXQB 3EPHA 3B6FB 5JRGA 3O62A 5AV5D 3RELA 3KWQC 3MVDB 5CPIC 4XUJA 1ZLAB 2F8ND 3WKJA 3C1BC 4JJND 5AV6D 1Q9CA 3LZ1D 4R8PA 4H9RB 4H9PA 3AZHD 3MGSD 5AV9B 4J8UA 2CV5B 4J8VB 2G5HC 1P3OB 3A6NC 3AN2A 2F8NG 2HUEB 3KXBD 1P3PD 1M1AB 3NQJB 3WTPA 1H3OA 3AZJB 4WNNB 3LJAA 3AYWD 3WA9B 4J8XB 4UUZA 5F99A 3REHD 5B33A 1P3GA 1M18D 5DNNC 1ID3C 2Y2NA 3MGPC 4WU8C 1S32C 1BH9B 4E44A 4NE3A 4G92B 3AZID 1M19B 3AZKC 1F66C 3W97C 1U35B 4E45A 1KX3B 1Z2CB 3AYWB 4UPKA 3R45B 4KGCD 5B31D 3X1VC 4ZUXD 2NQBD 3AFAD 4EO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM D;  2PYO B;  4KHA B;  5B2I D;  5B0Z C;  3AZI B;  3AZF A;  4Z66 C;  1HQ3 D;  4Z5T B;  5B31 G;  1P3B C;  5B1L A;  1P3F D;  2HIO C;  1P3I B;  3C1C A;  3UTA A;  5B0Y B;  5GSU D;  3B6G B;  5CPJ A;  3W99 C;  1N1J A;  4G91 B;  5B40 D;  5C3I C;  4H9Q A;  4DRA A;  3UT9 A;  1P3K D;  1TZY A;  1BFM A;  3AZE D;  4KUD A;  3KUY B;  1P3L D;  4WZS B;  3X1T A;  3X1S A;  4XZQ D;  4QLC A;  1B67 A;  3MGQ B;  3REJ B;  2NZD B;  3KWQ D;  5GXQ A;  3VH6 W;  5JRG D;  1P3K B;  3B6F A;  5B32 A;  3WAA B;  1P3A D;  4YM6 C;  3C1B D;  1EQZ B;  3MVD A;  4XZQ B;  3LEL B;  2L5A A;  1ZLA A;  3AZN A;  3AZH C;  5GT3 C;  5CPI B;  1P3M C;  4H9R A;  2CV5 A;  1KX5 B;  1P34 B;  5AV9 A;  4J8V A;  3C1B B;  1P3O A;  3NQJ A;  3AV2 C;  3VH5 W;  5BNX B;  3AZJ A;  3W98 B;  4WNN A;  5DNN D;  3MGR D;  1M18 C;  3A6N B;  1ID3 D;  3MGP D;  3WA9 A;  4WU8 D;  4J8X A;  1S32 D;  1P3G D;  4Z2M H;  3W96 D;  5AY8 D;  4LD9 B;  3UTB C;  3LZ0 C;  1BH9 A;  3AZL C;  4WU9 C;  5CHL B;  3X1V D;  1M19 A;  5G49 A;  2LY8 A;  4ZUX C;  2NQB C;  1U35 A;  5DNN B;  1KX3 A;  4ZBJ C;  3R45 A;  5DNM C;  5B0Z D;  5B24 B;  1F66 B;  3W97 B;  3AZK B;  5AVC B;  3TU4 A;  4Z66 D;  1P3B D;  1HQ3 C;  2PYO A;  4KHA A;  4NFT A;  2HIO D;  3REI C;  3AZF D;  5CPK C;  5B1L D;  3REK C;  4Z5T A;  5GSU C;  3AZM C;  3AZG B;  3W99 D;  3MNN D;  3WTP E;  5B40 C;  1AOI B;  5B0Z B;  3X1U B;  1P3B B;  5AV8 C;  2HIO B;  3KUY A;  2ARO A;  4X23 C;  3NQU B;  5C3I B;  1JFI B;  5JRG C;  3MGQ A;  5CP6 A;  3REJ A;  3O62 C;  3V9R A;  3REL C;  2NZD A;  4YM6 D;  1P3A C;  2BYM B;  2YFV B;  5B32 D;  3WKJ C;  3WAA A;  4Z2M G;  1EQZ A;  5AV5 B;  5GT3 D;  5BNV B;  3LEL A;  1P3M D;  3AZN D;  5AVB A;  5E5A A;  4J8U C;  4AWL C;  2F8N B;  4JJN B;  1KX4 A;  5AV6 B;  5CPI A;  5BS7 A;  3LZ1 B;  3AV2 D;  1KX5 A;  1P34 A;  3AZH B;  3MGS B;  2IO5 C;  4YS3 A;  4HGA C;  5GT3 B;  3MGR C;  3KXB B;  1P3P B;  4J8W A;  5BNX A;  5F99 C;  5B33 C;  1P3G C;  3W98 A;  5B2J A;  3A6N A;  3W96 C;  3LZ0 D;  5AY8 C;  4WU9 D;  3UTB D;  3AZL D;  3REH B;  1M18 B;  5GT0 A;  4LD9 A;  3B0C W;  3LZ0 B;  3AZL B;  3VH6 A;  5B24 A;  3REI D;  5CPK D;  4KGC B;  5B31 B;  5AVC A;  3AZF C;  4ZUX B;  5B1L C;  5FUG B;  3REK D;  3AZM D;  2NQB B;  3AV1 D;  3AFA B;  3MNN C;  5DNM B;  3C1C C;  3UTA C;  1TAF B;  5B2I B;  3AZG A;  1HQ3 B;  2FJ7 A;  5AV8 D;  1P3F B;  1AOI A;  3UT9 C;  3KSY A;  4KUD C;  3X1U A;  3REK B;  5GSU B;  5B1M A;  3AZM B;  3X1T C;  4X23 D;  3X1S C;  1BH8 B;  5B40 B;  4QLC C;  2ARO D;  3O62 D;  3AZE B;  3NQU A;  3REL D;  1P3L B;  5GXQ C;  5CP6 D;  4XUJ D;  1JFI A;  5B32 C;  2RVQ D;  3TU4 B;  3WKJ D;  2BYM A;  4R8P D;  3KWQ B;  5JRG B;  3AZN C;  3O62 B;  4J8U D;  1KU5 A;  1P3A B;  5AV5 A;  3AN2 D;  5E5A D;  1M1A A;  3WTP D;  4J8V C;  1P3O C;  2F8N A;  3VH6 T;  3LJA D;  4JJN A;  5AV6 A;  3LZ1 A;  3AZJ C;  4YS3 D;  5F99 D;  4AWL B;  5B33 D;  3AZH A;  3MGS A;  4J8X C;  4J8W D;  3KXB A;  1P3P A;  4H9S A;  4HGA B;  4DRB A;  3MGR B;  1ID3 B;  3AYW A;  3MGP B;  1M19 C;  4WU8 B;  1S32 B;  4UUZ B;  5GT0 D;  1U35 C;  1P3G B;  1KX3 C;  3REH A;  1M18 A;  3W96 B;  5AY8 B;  4CSR B;  3TU4 C;  3AZI A;  3X1V B;  1A7W A;  2YFW B;  4EO5 B;  3AV1 C;  3C1C D;  3UTA D;  4KGC A;  5B31 A;  5CPJ D;  1P3I A;  4Z5T C;  5B0Y A;  4ZUX A;  2NQB A;  5FUG A;  3B6G A;  3AFA A;  4Z66 B;  3UT9 D;  5B2I A;  1TZY D;  3AZF B;  4KUD D;  3X1T D;  5B1L B;  1HQ3 A;  3X1S D;  3W99 B;  3MNN B;  1P3F A;  4QLC D;  1WWI A;  5GSU A;  2ARO C;  4M6B A;  4H9Q B;  5B40 A;  5GXQ D;  3B6F D;  5CP6 C;  3REJ C;  4XUJ C;  1P3K A;  4KUD B;  4NE6 A;  5JA4 B;  2RVQ C;  3X1T B;  3AZE A;  2NZD C;  1P3L A;  3MVD D;  4QLC B;  4R8P C;  4XZQ A;  1ZLA D;  1EQZ C;  5B32 G;  4YM6 B;  3LEL C;  3AN2 C;  3KWQ A;  5AVB C;  5E5A C;  5B32 B;  2CV5 D;  5AV9 D;  3WTP C;  4J8V D;  1P3A A;  1P3O D;  1KX4 C;  4H9O B;  3C1B A;  1M1A D;  3LJA C;  5BS7 C;  1KX5 C;  1P34 C;  1P3M B;  3AZN B;  3AZJ D;  1ULY A;  4CAY B;  4YS3 C;  3WA9 D;  4J8X D;  2F8N K;  4J8W C;  3AV2 B;  3W98 C;  5B2J C;  1M19 D;  1U35 D;  1KX3 D;  5GT0 C;  4H9N B;  4LD9 C;  5DNN A;  3MGR A;  1ID3 A;  3MGP A;  1B6W A;  4WU8 A;  3UTB B;  1S32 A;  5BO0 B;  4WU9 B;  3TU4 D;  1F66 A;  3W97 A;  2BYK B;  3AZK A;  2PYO D;  3W96 A;  5AY8 A;  4ZBJ B;  5B24 C;  1HTA A;  5AVC C;  5G49 B;  4CSR A;  3X1V A;  4Z5T D;  5CPJ C;  5BT1 C;  2YFW A;  1P3I D;  3B0D C;  5B0Y D;  5KDM B;  3B6G D;  5B0Z A;  1TZY C;  3REI B;  3AZG C;  5CPK B;  4Z66 A;  1P3B A;  2FJ7 C;  1AOI C;  3AV1 B;  2HIO A;  3X1U C;  3KUY D;  3B0C T;  5B1M C;  3VH5 A;  3W99 A;  3MNN A;  5AV8 B;  3MGQ D;  3B0B A;  3REJ D;  3B6F C;  2NZD D;  4WV4 B;  4X23 B;  3MVD C;  2YFV A;  5JA4 A;  3WAA D;  2ARO B;  1EQZ D;  1ZLA C;  3REL B;  3LEL D;  5AVB D;  5BNV A;  5CP6 B;  4XUJ B;  3V9R B;  2CV5 C;  5AV9 C;  3WKJ B;  5AV5 C;  1KX4 D;  4YM6 A;  5CPI D;  2HUE C;  1M1A C;  4R8P B;  1KX5 D;  1P34 D;  4H9P B;  4J8U B;  4JJN C;  4H9O A;  5AV6 C;  3AN2 B;  5GT3 A;  3LZ1 C;  5AVB B;  5E5A B;  3WA9 C;  1P3M A;  3WTP B;  3MGS C;  3W98 D;  1H3O B;  4CAY A;  5B2J D;  3A6N D;  1KX4 B;  2IO5 B;  3LJA B;  3KXB C;  1P3P C;  1F1E A;  4NE5 A;  4G92 C;  3AV2 A;  1R4V A;  4YS3 B;  5F99 B;  4H9S C;  5B33 B;  4LD9 D;  3AYW C;  2JSS A;  4J8W B;  3VH5 T;  3REH C;  5B2J B;  4H9N A;  2PYO C;  5B24 D;  3LZ0 A;  3UTB A;  5BO0 A;  3AZK D;  5AVC D;  3AZI C;  3AZL A;  4WU9 A;  1F66 D;  3W97 D;  2BYK A;  5BT1 D;  5GT0 B;  2F8N H;  5DNM A;  4KGC C;  5B31 C;  1P3I C;  1TAF A;  5B0Y C;  3B6G C;  3AZG D;  1WWS A;  3AFA C;  2CWE A;  2FJ7 D;  4G91 C;  1AOI D;  5B2I C;  5KDM A;  3C1C B;  3UTA B;  3X1U D;  3REI A;  5CPK A;  5B1M D;  5CPJ B;  3KUY C;  3REK A;  3AZM A;  1N1J B;  1P3F C;  3AV1 A;  3B0D B;  1BH8 A;  3UT9 B;  1TZY B;  3MGQ C;  2FJ7 B;  3X1S B;  5AV8 A;  1P3K C;  5B1M B;  3AZE C;  1P3L C;  3WAA C;  4X23 A;  4XZQ C;  5GXQ B;  3B6F B;  5JRG A;  3O62 A;  5AV5 D;  3REL A;  3KWQ C;  3MVD B;  5CPI C;  4XUJ A;  1ZLA B;  2F8N D;  3WKJ A;  3C1B C;  4JJN D;  5AV6 D;  1Q9C A;  3LZ1 D;  4R8P A;  4H9R B;  4H9P A;  3AZH D;  3MGS D;  5AV9 B;  4J8U A;  2CV5 B;  4J8V B;  1P3O B;  3A6N C;  3AN2 A;  2F8N G;  2HUE B;  3KXB D;  1P3P D;  1M1A B;  3NQJ B;  3WTP A;  1H3O A;  3AZJ B;  4WNN B;  3LJA A;  3AYW D;  3WA9 B;  4J8X B;  4UUZ A;  5F99 A;  3REH D;  5B33 A;  1P3G A;  1M18 D;  5DNN C;  1ID3 C;  3MGP C;  4WU8 C;  1S32 C;  1BH9 B;  4E44 A;  4NE3 A;  4G92 B;  3AZI D;  1M19 B;  3AZK C;  1F66 C;  3W97 C;  1U35 B;  4E45 A;  1KX3 B;  3AYW B;  3R45 B;  4KGC D;  5B31 D;  3X1V C;  4ZUX D;  2NQB D;  3AFA D;  4EO5 C; 
#chains in the Genus database with same CATH topology
 5DNM D;  2PYO B;  4KHA B;  5B2I D;  5B0Z C;  3AZI B;  3AZF A;  4Z66 C;  1HQ3 D;  4Z5T B;  5B31 G;  1P3B C;  5B1L A;  1P3F D;  2HIO C;  1P3I B;  3C1C A;  3UTA A;  2XD5 A;  5B0Y B;  5GSU D;  3B6G B;  5CPJ A;  3W99 C;  1N1J A;  4G91 B;  5B40 D;  5C3I C;  4H9Q A;  4DRA A;  3UT9 A;  1P3K D;  1TZY A;  1BFM A;  3AZE D;  4KUD A;  3KUY B;  1P3L D;  4WZS B;  3X1T A;  3H0L C;  3X1S A;  4XZQ D;  4QLC A;  1B67 A;  3MGQ B;  3REJ B;  2NZD B;  3KWQ D;  5GXQ A;  3VH6 W;  5JRG D;  1P3K B;  3B6F A;  5B32 A;  2Y2I A;  3WAA B;  1P3A D;  4YM6 C;  3C1B D;  1EQZ B;  3MVD A;  4XZQ B;  3LEL B;  2L5A A;  1ZLA A;  3AZN A;  3AZH C;  5GT3 C;  5CPI B;  1P3M C;  4H9R A;  2CV5 A;  1KX5 B;  1P34 B;  2VQR A;  5AV9 A;  4J8V A;  2DQN C;  3C1B B;  1P3O A;  2XD1 A;  3NQJ A;  3AV2 C;  3VH5 W;  5BNX B;  3AZJ A;  3W98 B;  4WNN A;  5DNN D;  3MGR D;  1M18 C;  3A6N B;  1ID3 D;  3MGP D;  3WA9 A;  4WU8 D;  4J8X A;  1S32 D;  1P3G D;  4Z2M H;  3W96 D;  5AY8 D;  4LD9 B;  3UTB C;  3LZ0 C;  1BH9 A;  3H0R C;  3AZL C;  4WU9 C;  5CHL B;  3X1V D;  1M19 A;  5G49 A;  2LY8 A;  4ZUX C;  2NQB C;  1U35 A;  5DNN B;  1KX3 A;  4ZBJ C;  3FDD A;  3R45 A;  5DNM C;  5B0Z D;  5B24 B;  1F66 B;  3W97 B;  3AZK B;  5AVC B;  3TU4 A;  4Z66 D;  1P3B D;  1HQ3 C;  2PYO A;  4KHA A;  4NFT A;  2HIO D;  3F6T A;  3REI C;  3AZF D;  5CPK C;  5B1L D;  3EPL A;  4Z5T A;  5GSU C;  3REK C;  3AZM C;  3W99 D;  3MNN D;  3AZG B;  2Y2H A;  3WTP E;  5B40 C;  1AOI B;  3A1I A;  5B0Z B;  3X1U B;  1P3B B;  2Y2P A;  5AV8 C;  2HIO B;  3KUY A;  2ARO A;  4X23 C;  3NQU B;  5C3I B;  2W8S A;  1JFI B;  5JRG C;  3MGQ A;  5CP6 A;  2BG1 A;  3REJ A;  3O62 C;  1W2E A;  3V9R A;  3REL C;  4WJ3 C;  2NZD A;  4YM6 D;  1P3A C;  2BYM B;  2ZM5 A;  2YFV B;  5B32 D;  3A1K A;  3WKJ C;  3WAA A;  4Z2M G;  1EQZ A;  5AV5 B;  5GT3 D;  5BNV B;  3LEL A;  1P3M D;  2UWX A;  5AVB A;  5E5A A;  3AZN D;  4J8U C;  4AWL C;  2F8N B;  4JJN B;  1KX4 A;  5AV6 B;  5CPI A;  5BS7 A;  2ZY5 A;  3LZ1 B;  3AV2 D;  1KX5 A;  1P34 A;  3AZH B;  3MGS B;  2IO5 C;  4YS3 A;  4HGA C;  5GT3 B;  3MGR C;  3KXB B;  1P3P B;  4J8W A;  5BNX A;  5F99 C;  5B33 C;  1P3G C;  3W98 A;  5B2J A;  3A6N A;  3W96 C;  3LZ0 D;  5AY8 C;  4WU9 D;  3UTB D;  3AZL D;  3REH B;  1M18 B;  5GT0 A;  4LD9 A;  3B0C W;  2Y2K A;  3LZ0 B;  3AZL B;  3VH6 A;  5B24 A;  3REI D;  5CPK D;  4KGC B;  5B31 B;  5AVC A;  3AZF C;  4ZUX B;  5B1L C;  5FUG B;  3REK D;  3AZM D;  2NQB B;  3AV1 D;  3AFA B;  3MNN C;  5DNM B;  3C1C C;  3UTA C;  1TAF B;  5B2I B;  3AZG A;  1HQ3 B;  2FJ7 A;  5AV8 D;  1P3F B;  1AOI A;  3UT9 C;  3KSY A;  4KUD C;  3X1U A;  3REK B;  5GSU B;  5B1M A;  3AZM B;  3X1T C;  4X23 D;  3X1S C;  1BH8 B;  5B40 B;  4QLC C;  2ARO D;  3O62 D;  3AZE B;  3NQU A;  3REL D;  1P3L B;  2Y2L A;  1PZR A;  5GXQ C;  5CP6 D;  4XUJ D;  1JFI A;  5B32 C;  2RVQ D;  3TU4 B;  3WKJ D;  3IP4 C;  2BYM A;  4R8P D;  3KWQ B;  2F2A C;  5JRG B;  3AZN C;  3O62 B;  4J8U D;  1KU5 A;  1P3A B;  5AV5 A;  3AN2 D;  5E5A D;  1M1A A;  3WTP D;  4J8V C;  1P3O C;  2F8N A;  3VH6 T;  3LJA D;  4JJN A;  5AV6 A;  3LZ1 A;  3AZJ C;  4YS3 D;  5F99 D;  4AWL B;  5B33 D;  3AZH A;  3MGS A;  4J8X C;  4J8W D;  3KXB A;  1P3P A;  4H9S A;  4HGA B;  4DRB A;  3MGR B;  1ID3 B;  3AYW A;  3MGP B;  1M19 C;  2ZY4 A;  4WU8 B;  1S32 B;  4UUZ B;  5GT0 D;  1U35 C;  1P3G B;  1KX3 C;  3REH A;  1M18 A;  3W96 B;  5AY8 B;  4CSR B;  3TU4 C;  3AZI A;  3X1V B;  1A7W A;  2YFW B;  4EO5 B;  3AV1 C;  3C1C D;  3UTA D;  4KGC A;  5B31 A;  5CPJ D;  1P3I A;  4Z5T C;  5B0Y A;  4ZUX A;  2NQB A;  5FUG A;  3B6G A;  3AFA A;  4Z66 B;  3UT9 D;  5B2I A;  1TZY D;  3AZF B;  4KUD D;  3EPK A;  3X1T D;  5B1L B;  1HQ3 A;  3X1S D;  3W99 B;  3MNN B;  1P3F A;  4QLC D;  1WWI A;  5GSU A;  2ARO C;  4M6B A;  3AL0 C;  4H9Q B;  5B40 A;  5GXQ D;  3B6F D;  5CP6 C;  3REJ C;  4XUJ C;  1P3K A;  4KUD B;  4NE6 A;  5JA4 B;  2RVQ C;  3X1T B;  3AZE A;  2NZD C;  1P3L A;  3MVD D;  4QLC B;  4R8P C;  4XZQ A;  1ZLA D;  1EQZ C;  5B32 G;  4YM6 B;  3LEL C;  3AN2 C;  3KWQ A;  5AVB C;  5E5A C;  5B32 B;  2CV5 D;  5AV9 D;  3WTP C;  4J8V D;  1P3A A;  1P3O D;  1KX4 C;  4H9O B;  3C1B A;  1M1A D;  3LJA C;  5BS7 C;  1KX5 C;  1P34 C;  1P3M B;  3AZN B;  3AZJ D;  1ULY A;  4CAY B;  4YS3 C;  3WA9 D;  4J8X D;  2F8N K;  3KFU G;  4J8W C;  1T3U A;  2RIQ A;  3AV2 B;  3W98 C;  5B2J C;  1M19 D;  1U35 D;  1KX3 D;  5GT0 C;  2Y2M A;  4H9N B;  4LD9 C;  5DNN A;  3MGR A;  1ID3 A;  3MGP A;  2J8P A;  1B6W A;  4WU8 A;  3UTB B;  1S32 A;  5BO0 B;  4WU9 B;  3TU4 D;  1F66 A;  3W97 A;  2BYK B;  3AZK A;  4DQY B;  2PYO D;  3W96 A;  5AY8 A;  4ZBJ B;  5B24 C;  1HTA A;  5AVC C;  5G49 B;  4CSR A;  3X1V A;  4Z5T D;  5CPJ C;  5BT1 C;  2YFW A;  1P3I D;  3B0D C;  5B0Y D;  5KDM B;  3B6G D;  5B0Z A;  1TZY C;  3REI B;  3AZG C;  5CPK B;  4Z66 A;  1P3B A;  2FJ7 C;  1AOI C;  2JE5 A;  2Y2G A;  3AV1 B;  2HIO A;  2ZY2 A;  3X1U C;  3KUY D;  3B0C T;  5B1M C;  3VH5 A;  2DF4 C;  3MNN A;  3W99 A;  5AV8 B;  3MGQ D;  3B0B A;  3REJ D;  3B6F C;  3EG5 B;  2NZD D;  4WV4 B;  4X23 B;  3MVD C;  2YFV A;  5JA4 A;  3WAA D;  2ARO B;  3EPJ A;  1EQZ D;  1ZLA C;  2ZY3 A;  3REL B;  3LEL D;  5AVB D;  5BNV A;  5CP6 B;  4XUJ B;  3V9R B;  2CV5 C;  5AV9 C;  3WKJ B;  5AV5 C;  2G5I C;  1KX4 D;  4YM6 A;  5CPI D;  2HUE C;  1M1A C;  4R8P B;  1KX5 D;  1P34 D;  2Y2O A;  4H9P B;  2JCH A;  4J8U B;  4H9O A;  4JJN C;  5AV6 C;  3AN2 B;  5GT3 A;  3LZ1 C;  5AVB B;  5E5A B;  3WA9 C;  3H0M C;  1P3M A;  3WTP B;  3MGS C;  3W98 D;  1H3O B;  4CAY A;  5B2J D;  3A6N D;  1KX4 B;  2IO5 B;  2FFF B;  3LJA B;  3KXB C;  1P3P C;  1F1E A;  4NE5 A;  4G92 C;  3AV2 A;  1R4V A;  4YS3 B;  5F99 B;  4H9S C;  5B33 B;  4LD9 D;  3AYW C;  2JSS A;  4J8W B;  3VH5 T;  3REH C;  5B2J B;  4H9N A;  2PYO C;  5B24 D;  3LZ0 A;  3UTB A;  5BO0 A;  3AZK D;  5AVC D;  3AZI C;  3AZL A;  4WU9 A;  1F66 D;  3W97 D;  2BYK A;  5BT1 D;  5GT0 B;  2F8N H;  2Y2Q A;  5DNM A;  4KGC C;  5B31 C;  1P3I C;  1TAF A;  5B0Y C;  3B6G C;  3AZG D;  1WWS A;  3AFA C;  2CWE A;  2FJ7 D;  3P5J B;  4G91 C;  1AOI D;  5B2I C;  5KDM A;  3C1C B;  3UTA B;  3X1U D;  3REI A;  5CPK A;  5B1M D;  5CPJ B;  3KUY C;  3REK A;  3AZM A;  1N1J B;  1P3F C;  3AV1 A;  3B0D B;  1BH8 A;  3UT9 B;  2Y2J A;  1TZY B;  3MGQ C;  2FJ7 B;  3X1S B;  5AV8 A;  1P3K C;  5B1M B;  3AZE C;  1P3L C;  3WAA C;  4X23 A;  4XZQ C;  5GXQ B;  3EPH A;  3B6F B;  5JRG A;  3O62 A;  5AV5 D;  3REL A;  3KWQ C;  3MVD B;  5CPI C;  4XUJ A;  1ZLA B;  2F8N D;  3WKJ A;  3C1B C;  4JJN D;  5AV6 D;  1Q9C A;  3LZ1 D;  4R8P A;  4H9R B;  4H9P A;  3AZH D;  3MGS D;  5AV9 B;  4J8U A;  2CV5 B;  4J8V B;  2G5H C;  1P3O B;  3A6N C;  3AN2 A;  2F8N G;  2HUE B;  3KXB D;  1P3P D;  1M1A B;  3NQJ B;  3WTP A;  1H3O A;  3AZJ B;  4WNN B;  3LJA A;  3AYW D;  3WA9 B;  4J8X B;  4UUZ A;  5F99 A;  3REH D;  5B33 A;  1P3G A;  1M18 D;  5DNN C;  1ID3 C;  2Y2N A;  3MGP C;  4WU8 C;  1S32 C;  1BH9 B;  4E44 A;  4NE3 A;  4G92 B;  3AZI D;  1M19 B;  3AZK C;  1F66 C;  3W97 C;  1U35 B;  4E45 A;  1KX3 B;  1Z2C B;  3AYW B;  4UPK A;  3R45 B;  4KGC D;  5B31 D;  3X1V C;  4ZUX D;  2NQB D;  3AFA D;  4EO5 C; 
#chains in the Genus database with same CATH homology
 5DNM D;  2PYO B;  4KHA B;  5B2I D;  5B0Z C;  3AZI B;  3AZF A;  4Z66 C;  1HQ3 D;  4Z5T B;  5B31 G;  1P3B C;  5B1L A;  1P3F D;  2HIO C;  1P3I B;  3C1C A;  3UTA A;  2XD5 A;  5B0Y B;  5GSU D;  3B6G B;  5CPJ A;  3W99 C;  1N1J A;  4G91 B;  5B40 D;  5C3I C;  4H9Q A;  4DRA A;  3UT9 A;  1P3K D;  1TZY A;  1BFM A;  3AZE D;  4KUD A;  3KUY B;  1P3L D;  4WZS B;  3X1T A;  3H0L C;  3X1S A;  4XZQ D;  4QLC A;  1B67 A;  3MGQ B;  3REJ B;  2NZD B;  3KWQ D;  5GXQ A;  3VH6 W;  5JRG D;  1P3K B;  3B6F A;  5B32 A;  2Y2I A;  3WAA B;  1P3A D;  4YM6 C;  3C1B D;  1EQZ B;  3MVD A;  4XZQ B;  3LEL B;  2L5A A;  1ZLA A;  3AZN A;  3AZH C;  5GT3 C;  5CPI B;  1P3M C;  4H9R A;  2CV5 A;  1KX5 B;  1P34 B;  2VQR A;  5AV9 A;  4J8V A;  2DQN C;  3C1B B;  1P3O A;  2XD1 A;  3NQJ A;  3AV2 C;  3VH5 W;  5BNX B;  3AZJ A;  3W98 B;  4WNN A;  5DNN D;  3MGR D;  1M18 C;  3A6N B;  1ID3 D;  3MGP D;  3WA9 A;  4WU8 D;  4J8X A;  1S32 D;  1P3G D;  4Z2M H;  3W96 D;  5AY8 D;  4LD9 B;  3UTB C;  3LZ0 C;  1BH9 A;  3H0R C;  3AZL C;  4WU9 C;  5CHL B;  3X1V D;  1M19 A;  5G49 A;  2LY8 A;  4ZUX C;  2NQB C;  1U35 A;  5DNN B;  1KX3 A;  4ZBJ C;  3FDD A;  3R45 A;  5DNM C;  5B0Z D;  5B24 B;  1F66 B;  3W97 B;  3AZK B;  5AVC B;  3TU4 A;  4Z66 D;  1P3B D;  1HQ3 C;  2PYO A;  4KHA A;  4NFT A;  2HIO D;  3F6T A;  3REI C;  3AZF D;  5CPK C;  5B1L D;  3EPL A;  4Z5T A;  5GSU C;  3REK C;  3AZM C;  3W99 D;  3MNN D;  3AZG B;  2Y2H A;  3WTP E;  5B40 C;  1AOI B;  3A1I A;  5B0Z B;  3X1U B;  1P3B B;  2Y2P A;  5AV8 C;  2HIO B;  3KUY A;  2ARO A;  4X23 C;  3NQU B;  5C3I B;  2W8S A;  1JFI B;  5JRG C;  3MGQ A;  5CP6 A;  2BG1 A;  3REJ A;  3O62 C;  1W2E A;  3V9R A;  3REL C;  4WJ3 C;  2NZD A;  4YM6 D;  1P3A C;  2BYM B;  2ZM5 A;  2YFV B;  5B32 D;  3A1K A;  3WKJ C;  3WAA A;  4Z2M G;  1EQZ A;  5AV5 B;  5GT3 D;  5BNV B;  3LEL A;  1P3M D;  2UWX A;  5AVB A;  5E5A A;  3AZN D;  4J8U C;  4AWL C;  2F8N B;  4JJN B;  1KX4 A;  5AV6 B;  5CPI A;  5BS7 A;  2ZY5 A;  3LZ1 B;  3AV2 D;  1KX5 A;  1P34 A;  3AZH B;  3MGS B;  2IO5 C;  4YS3 A;  4HGA C;  5GT3 B;  3MGR C;  3KXB B;  1P3P B;  4J8W A;  5BNX A;  5F99 C;  5B33 C;  1P3G C;  3W98 A;  5B2J A;  3A6N A;  3W96 C;  3LZ0 D;  5AY8 C;  4WU9 D;  3UTB D;  3AZL D;  3REH B;  1M18 B;  5GT0 A;  4LD9 A;  3B0C W;  2Y2K A;  3LZ0 B;  3AZL B;  3VH6 A;  5B24 A;  3REI D;  5CPK D;  4KGC B;  5B31 B;  5AVC A;  3AZF C;  4ZUX B;  5B1L C;  5FUG B;  3REK D;  3AZM D;  2NQB B;  3AV1 D;  3AFA B;  3MNN C;  5DNM B;  3C1C C;  3UTA C;  1TAF B;  5B2I B;  3AZG A;  1HQ3 B;  2FJ7 A;  5AV8 D;  1P3F B;  1AOI A;  3UT9 C;  3KSY A;  4KUD C;  3X1U A;  3REK B;  5GSU B;  5B1M A;  3AZM B;  3X1T C;  4X23 D;  3X1S C;  1BH8 B;  5B40 B;  4QLC C;  2ARO D;  3O62 D;  3AZE B;  3NQU A;  3REL D;  1P3L B;  2Y2L A;  1PZR A;  5GXQ C;  5CP6 D;  4XUJ D;  1JFI A;  5B32 C;  2RVQ D;  3TU4 B;  3WKJ D;  3IP4 C;  2BYM A;  4R8P D;  3KWQ B;  2F2A C;  5JRG B;  3AZN C;  3O62 B;  4J8U D;  1KU5 A;  1P3A B;  5AV5 A;  3AN2 D;  5E5A D;  1M1A A;  3WTP D;  4J8V C;  1P3O C;  2F8N A;  3VH6 T;  3LJA D;  4JJN A;  5AV6 A;  3LZ1 A;  3AZJ C;  4YS3 D;  5F99 D;  4AWL B;  5B33 D;  3AZH A;  3MGS A;  4J8X C;  4J8W D;  3KXB A;  1P3P A;  4H9S A;  4HGA B;  4DRB A;  3MGR B;  1ID3 B;  3AYW A;  3MGP B;  1M19 C;  2ZY4 A;  4WU8 B;  1S32 B;  4UUZ B;  5GT0 D;  1U35 C;  1P3G B;  1KX3 C;  3REH A;  1M18 A;  3W96 B;  5AY8 B;  4CSR B;  3TU4 C;  3AZI A;  3X1V B;  1A7W A;  2YFW B;  4EO5 B;  3AV1 C;  3C1C D;  3UTA D;  4KGC A;  5B31 A;  5CPJ D;  1P3I A;  4Z5T C;  5B0Y A;  4ZUX A;  2NQB A;  5FUG A;  3B6G A;  3AFA A;  4Z66 B;  3UT9 D;  5B2I A;  1TZY D;  3AZF B;  4KUD D;  3EPK A;  3X1T D;  5B1L B;  1HQ3 A;  3X1S D;  3W99 B;  3MNN B;  1P3F A;  4QLC D;  1WWI A;  5GSU A;  2ARO C;  4M6B A;  3AL0 C;  4H9Q B;  5B40 A;  5GXQ D;  3B6F D;  5CP6 C;  3REJ C;  4XUJ C;  1P3K A;  4KUD B;  4NE6 A;  5JA4 B;  2RVQ C;  3X1T B;  3AZE A;  2NZD C;  1P3L A;  3MVD D;  4QLC B;  4R8P C;  4XZQ A;  1ZLA D;  1EQZ C;  5B32 G;  4YM6 B;  3LEL C;  3AN2 C;  3KWQ A;  5AVB C;  5E5A C;  5B32 B;  2CV5 D;  5AV9 D;  3WTP C;  4J8V D;  1P3A A;  1P3O D;  1KX4 C;  4H9O B;  3C1B A;  1M1A D;  3LJA C;  5BS7 C;  1KX5 C;  1P34 C;  1P3M B;  3AZN B;  3AZJ D;  1ULY A;  4CAY B;  4YS3 C;  3WA9 D;  4J8X D;  2F8N K;  3KFU G;  4J8W C;  1T3U A;  2RIQ A;  3AV2 B;  3W98 C;  5B2J C;  1M19 D;  1U35 D;  1KX3 D;  5GT0 C;  2Y2M A;  4H9N B;  4LD9 C;  5DNN A;  3MGR A;  1ID3 A;  3MGP A;  2J8P A;  1B6W A;  4WU8 A;  3UTB B;  1S32 A;  5BO0 B;  4WU9 B;  3TU4 D;  1F66 A;  3W97 A;  2BYK B;  3AZK A;  4DQY B;  2PYO D;  3W96 A;  5AY8 A;  4ZBJ B;  5B24 C;  1HTA A;  5AVC C;  5G49 B;  4CSR A;  3X1V A;  4Z5T D;  5CPJ C;  5BT1 C;  2YFW A;  1P3I D;  3B0D C;  5B0Y D;  5KDM B;  3B6G D;  5B0Z A;  1TZY C;  3REI B;  3AZG C;  5CPK B;  4Z66 A;  1P3B A;  2FJ7 C;  1AOI C;  2JE5 A;  2Y2G A;  3AV1 B;  2HIO A;  2ZY2 A;  3X1U C;  3KUY D;  3B0C T;  5B1M C;  3VH5 A;  2DF4 C;  3MNN A;  3W99 A;  5AV8 B;  3MGQ D;  3B0B A;  3REJ D;  3B6F C;  3EG5 B;  2NZD D;  4WV4 B;  4X23 B;  3MVD C;  2YFV A;  5JA4 A;  3WAA D;  2ARO B;  3EPJ A;  1EQZ D;  1ZLA C;  2ZY3 A;  3REL B;  3LEL D;  5AVB D;  5BNV A;  5CP6 B;  4XUJ B;  3V9R B;  2CV5 C;  5AV9 C;  3WKJ B;  5AV5 C;  2G5I C;  1KX4 D;  4YM6 A;  5CPI D;  2HUE C;  1M1A C;  4R8P B;  1KX5 D;  1P34 D;  2Y2O A;  4H9P B;  2JCH A;  4J8U B;  4H9O A;  4JJN C;  5AV6 C;  3AN2 B;  5GT3 A;  3LZ1 C;  5AVB B;  5E5A B;  3WA9 C;  3H0M C;  1P3M A;  3WTP B;  3MGS C;  3W98 D;  1H3O B;  4CAY A;  5B2J D;  3A6N D;  1KX4 B;  2IO5 B;  2FFF B;  3LJA B;  3KXB C;  1P3P C;  1F1E A;  4NE5 A;  4G92 C;  3AV2 A;  1R4V A;  4YS3 B;  5F99 B;  4H9S C;  5B33 B;  4LD9 D;  3AYW C;  2JSS A;  4J8W B;  3VH5 T;  3REH C;  5B2J B;  4H9N A;  2PYO C;  5B24 D;  3LZ0 A;  3UTB A;  5BO0 A;  3AZK D;  5AVC D;  3AZI C;  3AZL A;  4WU9 A;  1F66 D;  3W97 D;  2BYK A;  5BT1 D;  5GT0 B;  2F8N H;  2Y2Q A;  5DNM A;  4KGC C;  5B31 C;  1P3I C;  1TAF A;  5B0Y C;  3B6G C;  3AZG D;  1WWS A;  3AFA C;  2CWE A;  2FJ7 D;  3P5J B;  4G91 C;  1AOI D;  5B2I C;  5KDM A;  3C1C B;  3UTA B;  3X1U D;  3REI A;  5CPK A;  5B1M D;  5CPJ B;  3KUY C;  3REK A;  3AZM A;  1N1J B;  1P3F C;  3AV1 A;  3B0D B;  1BH8 A;  3UT9 B;  2Y2J A;  1TZY B;  3MGQ C;  2FJ7 B;  3X1S B;  5AV8 A;  1P3K C;  5B1M B;  3AZE C;  1P3L C;  3WAA C;  4X23 A;  4XZQ C;  5GXQ B;  3EPH A;  3B6F B;  5JRG A;  3O62 A;  5AV5 D;  3REL A;  3KWQ C;  3MVD B;  5CPI C;  4XUJ A;  1ZLA B;  2F8N D;  3WKJ A;  3C1B C;  4JJN D;  5AV6 D;  1Q9C A;  3LZ1 D;  4R8P A;  4H9R B;  4H9P A;  3AZH D;  3MGS D;  5AV9 B;  4J8U A;  2CV5 B;  4J8V B;  2G5H C;  1P3O B;  3A6N C;  3AN2 A;  2F8N G;  2HUE B;  3KXB D;  1P3P D;  1M1A B;  3NQJ B;  3WTP A;  1H3O A;  3AZJ B;  4WNN B;  3LJA A;  3AYW D;  3WA9 B;  4J8X B;  4UUZ A;  5F99 A;  3REH D;  5B33 A;  1P3G A;  1M18 D;  5DNN C;  1ID3 C;  2Y2N A;  3MGP C;  4WU8 C;  1S32 C;  1BH9 B;  4E44 A;  4NE3 A;  4G92 B;  3AZI D;  1M19 B;  3AZK C;  1F66 C;  3W97 C;  1U35 B;  4E45 A;  1KX3 B;  1Z2C B;  3AYW B;  4UPK A;  3R45 B;  4KGC D;  5B31 D;  3X1V C;  4ZUX D;  2NQB D;  3AFA D;  4EO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...