4XUJD

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujD00
3AZLA 1TZYB 1KX4D 5GXQB 4J8UD 5CP6A 1ULYA 5AV9A 3AV1A 3C1BD 4J8XC 3AN2D 5BT1C 4X23D 1P3PB 2YFWA 5B32G 3VH6A 1F1EA 4HGAC 2BYMA 3R45A 3MVDD 4J8WD 5FUGB 3LZ0D 5AV8D 4XZQD 2F8ND 3LZ1B 1ZLAC 5B0ZC 3O62D 3C1CD 3UTBC 3W97A 5DNMC 1P3MA 1AOIB 1A7WA 4H9NB 4YM6A 5GSUD 3UT9C 3AZNA 4QLCC 1KX4B 3A6NA 3LELB 1P3PC 5B1MB 3AN2B 2IO5B 1P3LB 1P34C 5B32D 4ZBJB 1M18C 4J8VA 5BO0A 5B0YA 3AZJA 5CP6B 3MVDB 4J8WB 3TU4A 5B24A 3X1UB 3AZHB 3WTPE 3WA9A 3AV2D 2F8NB 1AOIC 2HIOA 3O62B 2NZDB 1P3OB 1KX4C 3MGQB 4J8UC 3VH5W 3RELB 3C1BC 4ZUXB 3AN2C 2IO5C 3MGRD 3X1SD 3MGSD 4X23C 5F99A 2FJ7A 3WTPA 3X1VA 3AZKD 3MVDC 4J8WC 3LZ0C 5AV8C 3REHD 4XZQC 4WNNA 4E45A 3O62C 4H9QB 3C1CC 4NFTA 1P3BB 1F66D 5GSUC 5B0YB 4LD9B 5BNXA 3NQUB 4KGCA 5GT0A 5B31G 3WAAA 5B32C 4AWLB 5JRGD 4WU8D 3AZEA 1M1AB 4Z66B 1KX5D 4Z5TD 4CAYA 3AFAB 5CPID 3W96D 3B6GB 3KWQB 3AV2C 4H9OA 5CPJD 5AY8A 5BS7C 5C3IC 1P3FD 5DNNA 5KDMB 5B33D 1F66B 3UTAD 1ID3D 1WWSA 3W98A 3AZGA 3MGRC 1EQZA 3X1SC 5JA4B 3MGSC 5B31D 1HQ3A 5CHLB 1P3ID 3W99A 1M1AC 4NE3A 3MNNB 2CWEA 3AZKC 1M19A 2CV5A 5AV6D 5JRGB 5AVBA 4WU9D 3REHC 3X1TA 4KUDB 1KX3A 4Z5TB 2HUEC 5AVCB 5GT0B 1N1JB 3AZFB 1BFMA 5E5AA 4J8XA 1F66C 1TZYD 5GXQD 4WV4B 3VH6T 2NQBB 1U35B 3REJD 2PYOB 5B31B 1P3IB 5JRGC 4WU8C 2BYKA 1ZLAA 5B0ZA 3UTBA 4YS3A 5CPKA 5DNMA 1P3GB 1KX5C 4Z5TC 2F8NH 3W96C 3LZ1D 1Q9CA 3UT9A 1P3AA 4QLCA 5CPJC 3KUYD 1P3FC 4KHAA 4EO5B 5B33C 5B2ID 3AZMB 1P34A 1M18A 3UTAC 1ID3C 3LELD 3AYWA 5B1MD 5B31C 1TAFA 3KXBB 1P3IC 1P3LD 3REKB 4R8PB 5B1LB 3AZIB 1P3KB 3REJB 4G92C 5AV6C 3AZLD 4WU9C 5CP6D 4XUJB 3X1UD 3VH5A 4G91B 3AZHD 4J8UA 5G49B 3C1BA 2NZDD 3KUYB 4DRAA 1P3OD 1TZYC 4X23A 5GXQC 3MGQD 3RELD 4YS3B 4ZUXD 5BNVA 5B2IB 4H9SC 3MGPA 1JFIA 4UUZA 5AV5B 3LZ0A 3REJC 5AV8A 4XZQA 1S32B 3WKJB 3C1CA 3B6FB 3AZLB 1HTAA 3LZ1C 5GSUA 5AV9B 3AV1B 3KUYC 1P3BD 2YFWB 5B2IC 5B0YD 5B32A 4LD9D 3AZJD 3B0BA 2BYMB 3R45B 3LELC 5B24D 5B1MC 5GT3A 4WZSB 1P3LC 4ZBJC 3NQJA 3LJAA 3AZLC 3AV2A 4Z66D 1M1AD 3W97B 1P3MB 2AROA 5B40A 1B67A 5CP6C 3AFAD 4YM6B 3X1UC 3AZHC 3AZNB 3B6GD 3KWQD 3A6NB 2FJ7D 2NZDC 3MGRA 3X1SA 1P3OC 3WTPD 3REIA 3MGQC 2YFVA 1BH9A 3RELC 4J8VB 5BO0B 4ZUXC 3AZKA 3AZJB 2F8NK 3TU4B 5B24B 3REHA 3WA9B 3MNND 2HIOB 4CSRA 1H3OA 4KUDD 5GT3B 5AVCD 5GT0D 3AZFD 5F99B 1P3BC 2FJ7B 3LJAB 5B0YC 4LD9C 3WTPB 3AZJC 3X1VB 5B40B 4WU8A 5B24C 2NQBD 1KX5A 1U35D 4WNNB 5CPIA 4AWLC 3W96A 2PYOD 4JJNA 2HIOC 5DNND 5B2JA 4Z66C 5CPJA 1P3GD 1P3FA 3AFAC 4H9PA 5B33A 5BNXB 3KWQC 3B6GC 3UTAA 1ID3A 2FJ7C 4KGCB 3WAAB 3W99D 3WTPC 3AZMD 3AZEB 5AV6A 1KX3D 4CAYB 3KXBD 4WU9A 3V9RA 3REKD 4R8PD 5B1LD 3AZID 3MNNC 4H9RA 5E5AD 1P3KD 3VH5T 4H9OB 5AY8B 5DNNB 4XUJD 4KUDC 1TZYA 5AVCC 5GT0C 3AZFC 1BH8A 4E44A 3W98B 2L5AA 3AZGB 1EQZB 4H9SA 1HQ3B 1P3PA 3W99B 4YS3D 5CPKD 1M19B 2CV5B 1B6WA 5AVBB 2NQBC 5FUGA 5AV5D 3X1TB 1U35C 1P3AD 1KX3B 4M6BA 1S32D 2PYOC 3LZ1A 3WKJD 5DNNC 5E5AB 4J8XB 3B6FD 1P3GC 1AOIA 4H9NA 5AV9D 3AV1D 3AYWD 1KX4A 4HGAB 3LELA 3W99C 5B1MA 3AN2A 4EO5C 1P3LA 3AZMC 2BYKB 1ZLAB 5B0ZB 3UTBB 5CPKB 5DNMB 1KX3C 3KXBC 3MVDA 3REKC 4R8PC 5B1LC 4J8WA 3AZIC 1BH8B 3X1UA 5E5AC 3AZHA 3UT9B 1P3AB 1P3KC 4QLCB 2F8NA 3W97D 1P3MD 3O62A 4KHAB 2NZDA 3KSYA 4XUJC 1P3OA 4YM6D 4G91C 3MGQA 3AZND 1P34B 3RELA 3MGPD 1M18B 3A6ND 4ZUXA 3AYWB 1TAFB 4YS3C 4J8VD 5CPKC 5AV5C 1P3AC 4DRBA 3TU4D 1S32C 4J8UB 3WA9D 3WKJC 4H9QA 3C1BB 3B6FC 2HIOD 4X23B 5BS7A 1P3BA 5AV9C 3AV1C 3AYWC 4LD9A 5GT3D 5BNVB 3NQUA 3MGPB 1JFIB 4UUZB 5F99D 3LZ0B 5AV8B 4XZQB 3LJAD 3MGSA 3X1VD 3VH6W 2AROD 5B40D 3C1CB 3B0CW 4Z66A 1M1AA 2LY8A 3AFAA 5GSUB 3B6GA 3KWQA 3W97C 3REID 1P3MC 4YM6C 2RVQD 5KDMA 3AZNC 5B32B 3MGPC 1F66A 3A6NC 4NE6A 4KGCD 3WAAD 5JA4A 4J8VC 3MNNA 3AZED 3NQJB 3AV2B 5C3IB 2AROB 5JRGA 3TU4C 4KUDA 3WA9C 4Z5TA 5AVCA 5AY8D 1N1JA 3AZFA 3MGRB 4NE5A 3X1SB 3MGSB 1WWIA 3REIB 2YFVB 1BH9B 5GT3C 3AZKB 3W98D 3AZGD 1EQZD 2NQBA 5F99C 4JJND 1HQ3D 3REHB 1U35A 3LJAC 5B2JD 3X1VC 2HUEB 2PYOA 5B31A 1P3IA 2AROC 5B40C 1M19D 2CV5D 1R4VA 5AVBD 4CSRB 1P3GA 1H3OB 3X1TD 3B0DB 4Z2MH 4J8XD 3REIC 4Z2MG 5BT1D 2RVQC 3AZMA 4WU8B 5GXQA 4KGCC 3WAAC 1KX5B 5CPIB 3KXBA 3REKA 4R8PA 5B1LA 3W96B 4JJNB 3AZIA 3AZEC 1P3KA 1ZLAD 1KU5A 5B2JB 5B0ZD 3REJA 3UTBD 5CPJB 5DNMD 1P3FB 3B0DC 4H9PB 4XUJA 5B33B 3UT9D 4QLCD 5AY8C 3B0CT 3UTAB 1ID3B 5G49A 1P3PD 2JSSA 3KUYA 1P34D 1M18D 3W98C 4G92B 5CPIC 5B2IA 5AV6B 3AZGC 1EQZC 4WU9B 4JJNC 1HQ3C 5AV5A 3V9RB 2F8NG 5B2JC 4H9RB 1S32A 1M19C 3WKJA 2CV5C 1AOID 5AVBC 3B6FA 3X1TC
chains in the Genus database with same CATH superfamily
3AZLA 1TZYB 1KX4D 5GXQB 4J8UD 5CP6A 1ULYA 5AV9A 3AV1A 3C1BD 4J8XC 3AN2D 5BT1C 4X23D 1P3PB 2YFWA 5B32G 3VH6A 1F1EA 4HGAC 2BYMA 3R45A 3MVDD 4J8WD 5FUGB 3LZ0D 5AV8D 4XZQD 2F8ND 3LZ1B 1ZLAC 5B0ZC 3O62D 3C1CD 3UTBC 3W97A 5DNMC 1P3MA 1AOIB 1A7WA 4H9NB 4YM6A 5GSUD 2Y2LA 3UT9C 3AZNA 4QLCC 1KX4B 3A6NA 3LELB 1P3PC 5B1MB 3AN2B 2IO5B 1P3LB 1P34C 5B32D 4ZBJB 1M18C 4J8VA 5BO0A 5B0YA 3H0LC 3AZJA 5CP6B 3MVDB 2ZY3A 4J8WB 3TU4A 5B24A 3X1UB 3AZHB 3H0RC 3WTPE 3WA9A 3AV2D 2F8NB 1AOIC 2HIOA 3O62B 2NZDB 1P3OB 1KX4C 3MGQB 4J8UC 3VH5W 3RELB 3C1BC 4ZUXB 3AN2C 2IO5C 3MGRD 3X1SD 3MGSD 4X23C 5F99A 2FJ7A 3F6TA 3WTPA 3X1VA 3AZKD 3MVDC 4J8WC 3LZ0C 5AV8C 3REHD 4XZQC 4WNNA 2XD1A 4E45A 3O62C 4H9QB 3C1CC 4NFTA 1P3BB 1F66D 5GSUC 5B0YB 4LD9B 5BNXA 3NQUB 2Y2MA 4KGCA 5GT0A 5B31G 3WAAA 5B32C 4AWLB 5JRGD 4WU8D 2Y2NA 3EPKA 3AZEA 1M1AB 4Z66B 1KX5D 4Z5TD 2G5IC 4CAYA 3AFAB 5CPID 3W96D 3B6GB 3KWQB 3AV2C 4H9OA 5CPJD 5AY8A 5BS7C 5C3IC 1P3FD 5DNNA 3EPHA 5KDMB 5B33D 1F66B 3UTAD 1ID3D 1WWSA 3W98A 3AZGA 3MGRC 1EQZA 3X1SC 5JA4B 3MGSC 2XD5A 1HQ3A 5CHLB 5B31D 1P3ID 2ZY2A 1M1AC 4NE3A 3MNNB 2CWEA 3W99A 3AZKC 1M19A 2FFFB 2CV5A 5AV6D 5JRGB 5AVBA 4WU9D 3REHC 3X1TA 4KUDB 1KX3A 4Z5TB 2HUEC 5AVCB 5GT0B 1N1JB 3AZFB 1BFMA 5E5AA 4J8XA 3EG5B 1F66C 1TZYD 5GXQD 4WV4B 3EPJA 3VH6T 2NQBB 1PZRA 1U35B 3REJD 2PYOB 5B31B 1P3IB 5JRGC 4WU8C 2JE5A 2BYKA 1ZLAA 5B0ZA 3UTBA 4YS3A 5CPKA 5DNMA 1P3GB 1KX5C 4Z5TC 2F8NH 3W96C 3LZ1D 1Q9CA 3UT9A 1P3AA 4QLCA 5CPJC 3KUYD 1P3FC 4KHAA 2DF4C 4EO5B 5B33C 5B2ID 3AZMB 1P34A 1M18A 3UTAC 1ID3C 3LELD 1T3UA 3AYWA 5B1MD 5B31C 1TAFA 3KXBB 1P3IC 1P3LD 3REKB 4R8PB 5B1LB 3AZIB 1P3KB 3REJB 4G92C 2ZY4A 5AV6C 3AZLD 4WU9C 5CP6D 4XUJB 3X1UD 3VH5A 4G91B 3AZHD 4J8UA 5G49B 3C1BA 2NZDD 3KUYB 4DRAA 1P3OD 1TZYC 4X23A 5GXQC 3MGQD 3RELD 4YS3B 4ZUXD 5BNVA 5B2IB 4H9SC 2VQRA 3MGPA 1JFIA 4UUZA 5AV5B 3LZ0A 3REJC 5AV8A 4XZQA 1S32B 2Y2QA 3WKJB 3C1CA 3B6FB 3AZLB 1HTAA 3LZ1C 5GSUA 5AV9B 2Y2IA 3AV1B 3KUYC 1P3BD 2YFWB 5B2IC 5B0YD 5B32A 4LD9D 3AZJD 3B0BA 3FDDA 2BYMB 2Y2JA 3R45B 3LELC 5B24D 5B1MC 5GT3A 4WZSB 3A1IA 1P3LC 4ZBJC 3NQJA 3LJAA 3AZLC 3AV2A 4Z66D 1M1AD 3W97B 1P3MB 2AROA 5B40A 1B67A 5CP6C 3AFAD 4YM6B 3X1UC 3AZHC 3AZNB 3B6GD 3KWQD 2Y2GA 3A6NB 3KFUG 2FJ7D 2NZDC 3MGRA 3X1SA 1P3OC 3WTPD 3REIA 3MGQC 2YFVA 1BH9A 3RELC 4J8VB 5BO0B 4ZUXC 3AZKA 3AZJB 2F8NK 3TU4B 5B24B 3REHA 3WA9B 3MNND 2HIOB 2Y2KA 4CSRA 4WJ3C 1H3OA 4KUDD 3H0MC 5GT3B 5AVCD 5GT0D 3AZFD 5F99B 1P3BC 2FJ7B 3LJAB 5B0YC 4LD9C 3WTPB 3AZJC 3X1VB 5B40B 4WU8A 4UPKA 5B24C 2NQBD 1KX5A 1U35D 4WNNB 5CPIA 4AWLC 3W96A 2PYOD 4JJNA 2HIOC 5DNND 5B2JA 4Z66C 5CPJA 1P3GD 1P3FA 3AFAC 4H9PA 5B33A 5BNXB 3KWQC 3B6GC 3UTAA 1ID3A 2BG1A 2FJ7C 4KGCB 3WAAB 3W99D 3WTPC 3AZMD 3AZEB 5AV6A 1KX3D 4CAYB 3KXBD 4WU9A 3V9RA 3REKD 4R8PD 5B1LD 3AZID 3MNNC 4H9RA 5E5AD 1P3KD 3VH5T 4H9OB 5AY8B 5DNNB 2ZY5A 4XUJD 4KUDC 1TZYA 5AVCC 5GT0C 3AZFC 1BH8A 4E44A 3W98B 2L5AA 3AZGB 1EQZB 4H9SA 1HQ3B 1P3PA 3W99B 4YS3D 5CPKD 1M19B 3IP4C 2CV5B 1B6WA 5AVBB 2NQBC 5FUGA 5AV5D 2F2AC 3X1TB 1U35C 1P3AD 1KX3B 4M6BA 1S32D 2PYOC 3LZ1A 3WKJD 5DNNC 5E5AB 4J8XB 3B6FD 1P3GC 1AOIA 4H9NA 5AV9D 3AV1D 3AYWD 1KX4A 2J8PA 4HGAB 3LELA 3P5JB 3W99C 5B1MA 3A1KA 3AN2A 4EO5C 1P3LA 2G5HC 3AZMC 2BYKB 1ZLAB 5B0ZB 3UTBB 4DQYB 5DNMB 5CPKB 1KX3C 3KXBC 3MVDA 3REKC 4R8PC 5B1LC 4J8WA 3AZIC 1BH8B 3X1UA 5E5AC 3AZHA 3UT9B 1P3AB 1P3KC 4QLCB 2F8NA 3W97D 1P3MD 3O62A 4KHAB 2NZDA 3KSYA 4XUJC 1P3OA 4YM6D 4G91C 3MGQA 3AZND 1P34B 3RELA 3MGPD 1M18B 3A6ND 4ZUXA 3AYWB 1TAFB 4YS3C 4J8VD 5CPKC 2Y2HA 5AV5C 1P3AC 4DRBA 3TU4D 1S32C 4J8UB 3WA9D 3WKJC 4H9QA 3C1BB 3B6FC 2HIOD 3EPLA 4X23B 5BS7A 1P3BA 3AL0C 5AV9C 3AV1C 3AYWC 4LD9A 5GT3D 5BNVB 3NQUA 3MGPB 1JFIB 4UUZB 5F99D 3LZ0B 5AV8B 4XZQB 3LJAD 3MGSA 3X1VD 3VH6W 2AROD 5B40D 3C1CB 3B0CW 4Z66A 1M1AA 2LY8A 3AFAA 5GSUB 3B6GA 3KWQA 3W97C 3REID 1P3MC 2RIQA 1W2EA 4YM6C 2RVQD 5KDMA 3AZNC 5B32B 3MGPC 1F66A 3A6NC 2UWXA 4NE6A 3WAAD 4KGCD 5JA4A 4J8VC 3MNNA 3AZED 3NQJB 3AV2B 5C3IB 2AROB 5JRGA 3TU4C 2DQNC 4KUDA 3WA9C 4Z5TA 5AVCA 5AY8D 1N1JA 3AZFA 3MGRB 4NE5A 3X1SB 3MGSB 1WWIA 3REIB 2ZM5A 2YFVB 1BH9B 5GT3C 3AZKB 3W98D 2W8SA 3AZGD 1EQZD 2NQBA 5F99C 4JJND 1HQ3D 3REHB 1U35A 3LJAC 5B2JD 3X1VC 2HUEB 2PYOA 5B31A 1P3IA 2AROC 5B40C 1M19D 2CV5D 1R4VA 5AVBD 4CSRB 1P3GA 1H3OB 3X1TD 3B0DB 4Z2MH 4J8XD 3REIC 4Z2MG 5BT1D 2RVQC 2Y2PA 3AZMA 4WU8B 5GXQA 4KGCC 3WAAC 1KX5B 5CPIB 3KXBA 3REKA 4R8PA 5B1LA 3W96B 4JJNB 3AZIA 3AZEC 1P3KA 1ZLAD 1KU5A 5B2JB 5B0ZD 3REJA 3UTBD 5CPJB 5DNMD 1P3FB 3B0DC 4H9PB 4XUJA 5B33B 3UT9D 4QLCD 5AY8C 3B0CT 3UTAB 1ID3B 5G49A 1Z2CB 1P3PD 2JSSA 3KUYA 1P34D 1M18D 3W98C 4G92B 5CPIC 5B2IA 5AV6B 3AZGC 2Y2OA 1EQZC 4WU9B 4JJNC 1HQ3C 2JCHA 5AV5A 3V9RB 2F8NG 5B2JC 4H9RB 1S32A 1M19C 3WKJA 2CV5C 1AOID 5AVBC 3B6FA 3X1TC
chains in the Genus database with same CATH topology
3AZLA 1TZYB 1KX4D 5GXQB 4J8UD 5CP6A 1ULYA 5AV9A 3AV1A 3C1BD 4J8XC 3AN2D 5BT1C 4X23D 1P3PB 2YFWA 5B32G 3VH6A 1F1EA 4HGAC 2BYMA 3R45A 3MVDD 4J8WD 5FUGB 3LZ0D 5AV8D 4XZQD 2F8ND 3LZ1B 1ZLAC 5B0ZC 3O62D 3C1CD 3UTBC 3W97A 5DNMC 1P3MA 1AOIB 1A7WA 4H9NB 4YM6A 5GSUD 2Y2LA 3UT9C 3AZNA 4QLCC 1KX4B 3A6NA 3LELB 1P3PC 5B1MB 3AN2B 2IO5B 1P3LB 1P34C 5B32D 4ZBJB 1M18C 4J8VA 5BO0A 5B0YA 3H0LC 3AZJA 5CP6B 3MVDB 2ZY3A 4J8WB 3TU4A 5B24A 3X1UB 3AZHB 3H0RC 3WTPE 3WA9A 3AV2D 2F8NB 1AOIC 2HIOA 3O62B 2NZDB 1P3OB 1KX4C 3MGQB 4J8UC 3VH5W 3RELB 3C1BC 4ZUXB 3AN2C 2IO5C 3MGRD 3X1SD 3MGSD 4X23C 5F99A 2FJ7A 3F6TA 3WTPA 3X1VA 3AZKD 3MVDC 4J8WC 3LZ0C 5AV8C 3REHD 4XZQC 4WNNA 2XD1A 4E45A 3O62C 4H9QB 3C1CC 4NFTA 1P3BB 1F66D 5GSUC 5B0YB 4LD9B 5BNXA 3NQUB 2Y2MA 4KGCA 5GT0A 5B31G 3WAAA 5B32C 4AWLB 5JRGD 4WU8D 2Y2NA 3EPKA 3AZEA 1M1AB 4Z66B 1KX5D 4Z5TD 2G5IC 4CAYA 3AFAB 5CPID 3W96D 3B6GB 3KWQB 3AV2C 4H9OA 5CPJD 5AY8A 5BS7C 5C3IC 1P3FD 5DNNA 3EPHA 5KDMB 5B33D 1F66B 3UTAD 1ID3D 1WWSA 3W98A 3AZGA 3MGRC 1EQZA 3X1SC 5JA4B 3MGSC 2XD5A 1HQ3A 5CHLB 5B31D 1P3ID 2ZY2A 1M1AC 4NE3A 3MNNB 2CWEA 3W99A 3AZKC 1M19A 2FFFB 2CV5A 5AV6D 5JRGB 5AVBA 4WU9D 3REHC 3X1TA 4KUDB 1KX3A 4Z5TB 2HUEC 5AVCB 5GT0B 1N1JB 3AZFB 1BFMA 5E5AA 4J8XA 3EG5B 1F66C 1TZYD 5GXQD 4WV4B 3EPJA 3VH6T 2NQBB 1PZRA 1U35B 3REJD 2PYOB 5B31B 1P3IB 5JRGC 4WU8C 2JE5A 2BYKA 1ZLAA 5B0ZA 3UTBA 4YS3A 5CPKA 5DNMA 1P3GB 1KX5C 4Z5TC 2F8NH 3W96C 3LZ1D 1Q9CA 3UT9A 1P3AA 4QLCA 5CPJC 3KUYD 1P3FC 4KHAA 2DF4C 4EO5B 5B33C 5B2ID 3AZMB 1P34A 1M18A 3UTAC 1ID3C 3LELD 1T3UA 3AYWA 5B1MD 5B31C 1TAFA 3KXBB 1P3IC 1P3LD 3REKB 4R8PB 5B1LB 3AZIB 1P3KB 3REJB 4G92C 2ZY4A 5AV6C 3AZLD 4WU9C 5CP6D 4XUJB 3X1UD 3VH5A 4G91B 3AZHD 4J8UA 5G49B 3C1BA 2NZDD 3KUYB 4DRAA 1P3OD 1TZYC 4X23A 5GXQC 3MGQD 3RELD 4YS3B 4ZUXD 5BNVA 5B2IB 4H9SC 2VQRA 3MGPA 1JFIA 4UUZA 5AV5B 3LZ0A 3REJC 5AV8A 4XZQA 1S32B 2Y2QA 3WKJB 3C1CA 3B6FB 3AZLB 1HTAA 3LZ1C 5GSUA 5AV9B 2Y2IA 3AV1B 3KUYC 1P3BD 2YFWB 5B2IC 5B0YD 5B32A 4LD9D 3AZJD 3B0BA 3FDDA 2BYMB 2Y2JA 3R45B 3LELC 5B24D 5B1MC 5GT3A 4WZSB 3A1IA 1P3LC 4ZBJC 3NQJA 3LJAA 3AZLC 3AV2A 4Z66D 1M1AD 3W97B 1P3MB 2AROA 5B40A 1B67A 5CP6C 3AFAD 4YM6B 3X1UC 3AZHC 3AZNB 3B6GD 3KWQD 2Y2GA 3A6NB 3KFUG 2FJ7D 2NZDC 3MGRA 3X1SA 1P3OC 3WTPD 3REIA 3MGQC 2YFVA 1BH9A 3RELC 4J8VB 5BO0B 4ZUXC 3AZKA 3AZJB 2F8NK 3TU4B 5B24B 3REHA 3WA9B 3MNND 2HIOB 2Y2KA 4CSRA 4WJ3C 1H3OA 4KUDD 3H0MC 5GT3B 5AVCD 5GT0D 3AZFD 5F99B 1P3BC 2FJ7B 3LJAB 5B0YC 4LD9C 3WTPB 3AZJC 3X1VB 5B40B 4WU8A 4UPKA 5B24C 2NQBD 1KX5A 1U35D 4WNNB 5CPIA 4AWLC 3W96A 2PYOD 4JJNA 2HIOC 5DNND 5B2JA 4Z66C 5CPJA 1P3GD 1P3FA 3AFAC 4H9PA 5B33A 5BNXB 3KWQC 3B6GC 3UTAA 1ID3A 2BG1A 2FJ7C 4KGCB 3WAAB 3W99D 3WTPC 3AZMD 3AZEB 5AV6A 1KX3D 4CAYB 3KXBD 4WU9A 3V9RA 3REKD 4R8PD 5B1LD 3AZID 3MNNC 4H9RA 5E5AD 1P3KD 3VH5T 4H9OB 5AY8B 5DNNB 2ZY5A 4XUJD 4KUDC 1TZYA 5AVCC 5GT0C 3AZFC 1BH8A 4E44A 3W98B 2L5AA 3AZGB 1EQZB 4H9SA 1HQ3B 1P3PA 3W99B 4YS3D 5CPKD 1M19B 3IP4C 2CV5B 1B6WA 5AVBB 2NQBC 5FUGA 5AV5D 2F2AC 3X1TB 1U35C 1P3AD 1KX3B 4M6BA 1S32D 2PYOC 3LZ1A 3WKJD 5DNNC 5E5AB 4J8XB 3B6FD 1P3GC 1AOIA 4H9NA 5AV9D 3AV1D 3AYWD 1KX4A 2J8PA 4HGAB 3LELA 3P5JB 3W99C 5B1MA 3A1KA 3AN2A 4EO5C 1P3LA 2G5HC 3AZMC 2BYKB 1ZLAB 5B0ZB 3UTBB 4DQYB 5DNMB 5CPKB 1KX3C 3KXBC 3MVDA 3REKC 4R8PC 5B1LC 4J8WA 3AZIC 1BH8B 3X1UA 5E5AC 3AZHA 3UT9B 1P3AB 1P3KC 4QLCB 2F8NA 3W97D 1P3MD 3O62A 4KHAB 2NZDA 3KSYA 4XUJC 1P3OA 4YM6D 4G91C 3MGQA 3AZND 1P34B 3RELA 3MGPD 1M18B 3A6ND 4ZUXA 3AYWB 1TAFB 4YS3C 4J8VD 5CPKC 2Y2HA 5AV5C 1P3AC 4DRBA 3TU4D 1S32C 4J8UB 3WA9D 3WKJC 4H9QA 3C1BB 3B6FC 2HIOD 3EPLA 4X23B 5BS7A 1P3BA 3AL0C 5AV9C 3AV1C 3AYWC 4LD9A 5GT3D 5BNVB 3NQUA 3MGPB 1JFIB 4UUZB 5F99D 3LZ0B 5AV8B 4XZQB 3LJAD 3MGSA 3X1VD 3VH6W 2AROD 5B40D 3C1CB 3B0CW 4Z66A 1M1AA 2LY8A 3AFAA 5GSUB 3B6GA 3KWQA 3W97C 3REID 1P3MC 2RIQA 1W2EA 4YM6C 2RVQD 5KDMA 3AZNC 5B32B 3MGPC 1F66A 3A6NC 2UWXA 4NE6A 3WAAD 4KGCD 5JA4A 4J8VC 3MNNA 3AZED 3NQJB 3AV2B 5C3IB 2AROB 5JRGA 3TU4C 2DQNC 4KUDA 3WA9C 4Z5TA 5AVCA 5AY8D 1N1JA 3AZFA 3MGRB 4NE5A 3X1SB 3MGSB 1WWIA 3REIB 2ZM5A 2YFVB 1BH9B 5GT3C 3AZKB 3W98D 2W8SA 3AZGD 1EQZD 2NQBA 5F99C 4JJND 1HQ3D 3REHB 1U35A 3LJAC 5B2JD 3X1VC 2HUEB 2PYOA 5B31A 1P3IA 2AROC 5B40C 1M19D 2CV5D 1R4VA 5AVBD 4CSRB 1P3GA 1H3OB 3X1TD 3B0DB 4Z2MH 4J8XD 3REIC 4Z2MG 5BT1D 2RVQC 2Y2PA 3AZMA 4WU8B 5GXQA 4KGCC 3WAAC 1KX5B 5CPIB 3KXBA 3REKA 4R8PA 5B1LA 3W96B 4JJNB 3AZIA 3AZEC 1P3KA 1ZLAD 1KU5A 5B2JB 5B0ZD 3REJA 3UTBD 5CPJB 5DNMD 1P3FB 3B0DC 4H9PB 4XUJA 5B33B 3UT9D 4QLCD 5AY8C 3B0CT 3UTAB 1ID3B 5G49A 1Z2CB 1P3PD 2JSSA 3KUYA 1P34D 1M18D 3W98C 4G92B 5CPIC 5B2IA 5AV6B 3AZGC 2Y2OA 1EQZC 4WU9B 4JJNC 1HQ3C 2JCHA 5AV5A 3V9RB 2F8NG 5B2JC 4H9RB 1S32A 1M19C 3WKJA 2CV5C 1AOID 5AVBC 3B6FA 3X1TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  1TZY B;  1KX4 D;  5GXQ B;  4J8U D;  5CP6 A;  1ULY A;  5AV9 A;  3AV1 A;  3C1B D;  4J8X C;  3AN2 D;  5BT1 C;  4X23 D;  1P3P B;  2YFW A;  5B32 G;  3VH6 A;  1F1E A;  4HGA C;  2BYM A;  3R45 A;  3MVD D;  4J8W D;  5FUG B;  3LZ0 D;  5AV8 D;  4XZQ D;  2F8N D;  3LZ1 B;  1ZLA C;  5B0Z C;  3O62 D;  3C1C D;  3UTB C;  3W97 A;  5DNM C;  1P3M A;  1AOI B;  1A7W A;  4H9N B;  4YM6 A;  5GSU D;  3UT9 C;  3AZN A;  4QLC C;  1KX4 B;  3A6N A;  3LEL B;  1P3P C;  5B1M B;  3AN2 B;  2IO5 B;  1P3L B;  1P34 C;  5B32 D;  4ZBJ B;  1M18 C;  4J8V A;  5BO0 A;  5B0Y A;  3AZJ A;  5CP6 B;  3MVD B;  4J8W B;  3TU4 A;  5B24 A;  3X1U B;  3AZH B;  3WTP E;  3WA9 A;  3AV2 D;  2F8N B;  1AOI C;  2HIO A;  3O62 B;  2NZD B;  1P3O B;  1KX4 C;  3MGQ B;  4J8U C;  3VH5 W;  3REL B;  3C1B C;  4ZUX B;  3AN2 C;  2IO5 C;  3MGR D;  3X1S D;  3MGS D;  4X23 C;  5F99 A;  2FJ7 A;  3WTP A;  3X1V A;  3AZK D;  3MVD C;  4J8W C;  3LZ0 C;  5AV8 C;  3REH D;  4XZQ C;  4WNN A;  4E45 A;  3O62 C;  4H9Q B;  3C1C C;  4NFT A;  1P3B B;  1F66 D;  5GSU C;  5B0Y B;  4LD9 B;  5BNX A;  3NQU B;  4KGC A;  5GT0 A;  5B31 G;  3WAA A;  5B32 C;  4AWL B;  5JRG D;  4WU8 D;  3AZE A;  1M1A B;  4Z66 B;  1KX5 D;  4Z5T D;  4CAY A;  3AFA B;  5CPI D;  3W96 D;  3B6G B;  3KWQ B;  3AV2 C;  4H9O A;  5CPJ D;  5AY8 A;  5BS7 C;  5C3I C;  1P3F D;  5DNN A;  5KDM B;  5B33 D;  1F66 B;  3UTA D;  1ID3 D;  1WWS A;  3W98 A;  3AZG A;  3MGR C;  1EQZ A;  3X1S C;  5JA4 B;  3MGS C;  5B31 D;  1HQ3 A;  5CHL B;  1P3I D;  3W99 A;  1M1A C;  4NE3 A;  3MNN B;  2CWE A;  3AZK C;  1M19 A;  2CV5 A;  5AV6 D;  5JRG B;  5AVB A;  4WU9 D;  3REH C;  3X1T A;  4KUD B;  1KX3 A;  4Z5T B;  2HUE C;  5AVC B;  5GT0 B;  1N1J B;  3AZF B;  1BFM A;  5E5A A;  4J8X A;  1F66 C;  1TZY D;  5GXQ D;  4WV4 B;  3VH6 T;  2NQB B;  1U35 B;  3REJ D;  2PYO B;  5B31 B;  1P3I B;  5JRG C;  4WU8 C;  2BYK A;  1ZLA A;  5B0Z A;  3UTB A;  4YS3 A;  5CPK A;  5DNM A;  1P3G B;  1KX5 C;  4Z5T C;  2F8N H;  3W96 C;  3LZ1 D;  1Q9C A;  3UT9 A;  1P3A A;  4QLC A;  5CPJ C;  3KUY D;  1P3F C;  4KHA A;  4EO5 B;  5B33 C;  5B2I D;  3AZM B;  1P34 A;  1M18 A;  3UTA C;  1ID3 C;  3LEL D;  3AYW A;  5B1M D;  5B31 C;  1TAF A;  3KXB B;  1P3I C;  1P3L D;  3REK B;  4R8P B;  5B1L B;  3AZI B;  1P3K B;  3REJ B;  4G92 C;  5AV6 C;  3AZL D;  4WU9 C;  5CP6 D;  4XUJ B;  3X1U D;  3VH5 A;  4G91 B;  3AZH D;  4J8U A;  5G49 B;  3C1B A;  2NZD D;  3KUY B;  4DRA A;  1P3O D;  1TZY C;  4X23 A;  5GXQ C;  3MGQ D;  3REL D;  4YS3 B;  4ZUX D;  5BNV A;  5B2I B;  4H9S C;  3MGP A;  1JFI A;  4UUZ A;  5AV5 B;  3LZ0 A;  3REJ C;  5AV8 A;  4XZQ A;  1S32 B;  3WKJ B;  3C1C A;  3B6F B;  3AZL B;  1HTA A;  3LZ1 C;  5GSU A;  5AV9 B;  3AV1 B;  3KUY C;  1P3B D;  2YFW B;  5B2I C;  5B0Y D;  5B32 A;  4LD9 D;  3AZJ D;  3B0B A;  2BYM B;  3R45 B;  3LEL C;  5B24 D;  5B1M C;  5GT3 A;  4WZS B;  1P3L C;  4ZBJ C;  3NQJ A;  3LJA A;  3AZL C;  3AV2 A;  4Z66 D;  1M1A D;  3W97 B;  1P3M B;  2ARO A;  5B40 A;  1B67 A;  5CP6 C;  3AFA D;  4YM6 B;  3X1U C;  3AZH C;  3AZN B;  3B6G D;  3KWQ D;  3A6N B;  2FJ7 D;  2NZD C;  3MGR A;  3X1S A;  1P3O C;  3WTP D;  3REI A;  3MGQ C;  2YFV A;  1BH9 A;  3REL C;  4J8V B;  5BO0 B;  4ZUX C;  3AZK A;  3AZJ B;  2F8N K;  3TU4 B;  5B24 B;  3REH A;  3WA9 B;  3MNN D;  2HIO B;  4CSR A;  1H3O A;  4KUD D;  5GT3 B;  5AVC D;  5GT0 D;  3AZF D;  5F99 B;  1P3B C;  2FJ7 B;  3LJA B;  5B0Y C;  4LD9 C;  3WTP B;  3AZJ C;  3X1V B;  5B40 B;  4WU8 A;  5B24 C;  2NQB D;  1KX5 A;  1U35 D;  4WNN B;  5CPI A;  4AWL C;  3W96 A;  2PYO D;  4JJN A;  2HIO C;  5DNN D;  5B2J A;  4Z66 C;  5CPJ A;  1P3G D;  1P3F A;  3AFA C;  4H9P A;  5B33 A;  5BNX B;  3KWQ C;  3B6G C;  3UTA A;  1ID3 A;  2FJ7 C;  4KGC B;  3WAA B;  3W99 D;  3WTP C;  3AZM D;  3AZE B;  5AV6 A;  1KX3 D;  4CAY B;  3KXB D;  4WU9 A;  3V9R A;  3REK D;  4R8P D;  5B1L D;  3AZI D;  3MNN C;  4H9R A;  5E5A D;  1P3K D;  3VH5 T;  4H9O B;  5AY8 B;  5DNN B;  4XUJ D;  4KUD C;  1TZY A;  5AVC C;  5GT0 C;  3AZF C;  1BH8 A;  4E44 A;  3W98 B;  2L5A A;  3AZG B;  1EQZ B;  4H9S A;  1HQ3 B;  1P3P A;  3W99 B;  4YS3 D;  5CPK D;  1M19 B;  2CV5 B;  1B6W A;  5AVB B;  2NQB C;  5FUG A;  5AV5 D;  3X1T B;  1U35 C;  1P3A D;  1KX3 B;  4M6B A;  1S32 D;  2PYO C;  3LZ1 A;  3WKJ D;  5DNN C;  5E5A B;  4J8X B;  3B6F D;  1P3G C;  1AOI A;  4H9N A;  5AV9 D;  3AV1 D;  3AYW D;  1KX4 A;  4HGA B;  3LEL A;  3W99 C;  5B1M A;  3AN2 A;  4EO5 C;  1P3L A;  3AZM C;  2BYK B;  1ZLA B;  5B0Z B;  3UTB B;  5CPK B;  5DNM B;  1KX3 C;  3KXB C;  3MVD A;  3REK C;  4R8P C;  5B1L C;  4J8W A;  3AZI C;  1BH8 B;  3X1U A;  5E5A C;  3AZH A;  3UT9 B;  1P3A B;  1P3K C;  4QLC B;  2F8N A;  3W97 D;  1P3M D;  3O62 A;  4KHA B;  2NZD A;  3KSY A;  4XUJ C;  1P3O A;  4YM6 D;  4G91 C;  3MGQ A;  3AZN D;  1P34 B;  3REL A;  3MGP D;  1M18 B;  3A6N D;  4ZUX A;  3AYW B;  1TAF B;  4YS3 C;  4J8V D;  5CPK C;  5AV5 C;  1P3A C;  4DRB A;  3TU4 D;  1S32 C;  4J8U B;  3WA9 D;  3WKJ C;  4H9Q A;  3C1B B;  3B6F C;  2HIO D;  4X23 B;  5BS7 A;  1P3B A;  5AV9 C;  3AV1 C;  3AYW C;  4LD9 A;  5GT3 D;  5BNV B;  3NQU A;  3MGP B;  1JFI B;  4UUZ B;  5F99 D;  3LZ0 B;  5AV8 B;  4XZQ B;  3LJA D;  3MGS A;  3X1V D;  3VH6 W;  2ARO D;  5B40 D;  3C1C B;  3B0C W;  4Z66 A;  1M1A A;  2LY8 A;  3AFA A;  5GSU B;  3B6G A;  3KWQ A;  3W97 C;  3REI D;  1P3M C;  4YM6 C;  2RVQ D;  5KDM A;  3AZN C;  5B32 B;  3MGP C;  1F66 A;  3A6N C;  4NE6 A;  4KGC D;  3WAA D;  5JA4 A;  4J8V C;  3MNN A;  3AZE D;  3NQJ B;  3AV2 B;  5C3I B;  2ARO B;  5JRG A;  3TU4 C;  4KUD A;  3WA9 C;  4Z5T A;  5AVC A;  5AY8 D;  1N1J A;  3AZF A;  3MGR B;  4NE5 A;  3X1S B;  3MGS B;  1WWI A;  3REI B;  2YFV B;  1BH9 B;  5GT3 C;  3AZK B;  3W98 D;  3AZG D;  1EQZ D;  2NQB A;  5F99 C;  4JJN D;  1HQ3 D;  3REH B;  1U35 A;  3LJA C;  5B2J D;  3X1V C;  2HUE B;  2PYO A;  5B31 A;  1P3I A;  2ARO C;  5B40 C;  1M19 D;  2CV5 D;  1R4V A;  5AVB D;  4CSR B;  1P3G A;  1H3O B;  3X1T D;  3B0D B;  4Z2M H;  4J8X D;  3REI C;  4Z2M G;  5BT1 D;  2RVQ C;  3AZM A;  4WU8 B;  5GXQ A;  4KGC C;  3WAA C;  1KX5 B;  5CPI B;  3KXB A;  3REK A;  4R8P A;  5B1L A;  3W96 B;  4JJN B;  3AZI A;  3AZE C;  1P3K A;  1ZLA D;  1KU5 A;  5B2J B;  5B0Z D;  3REJ A;  3UTB D;  5CPJ B;  5DNM D;  1P3F B;  3B0D C;  4H9P B;  4XUJ A;  5B33 B;  3UT9 D;  4QLC D;  5AY8 C;  3B0C T;  3UTA B;  1ID3 B;  5G49 A;  1P3P D;  2JSS A;  3KUY A;  1P34 D;  1M18 D;  3W98 C;  4G92 B;  5CPI C;  5B2I A;  5AV6 B;  3AZG C;  1EQZ C;  4WU9 B;  4JJN C;  1HQ3 C;  5AV5 A;  3V9R B;  2F8N G;  5B2J C;  4H9R B;  1S32 A;  1M19 C;  3WKJ A;  2CV5 C;  1AOI D;  5AVB C;  3B6F A;  3X1T C; 
#chains in the Genus database with same CATH topology
 3AZL A;  1TZY B;  1KX4 D;  5GXQ B;  4J8U D;  5CP6 A;  1ULY A;  5AV9 A;  3AV1 A;  3C1B D;  4J8X C;  3AN2 D;  5BT1 C;  4X23 D;  1P3P B;  2YFW A;  5B32 G;  3VH6 A;  1F1E A;  4HGA C;  2BYM A;  3R45 A;  3MVD D;  4J8W D;  5FUG B;  3LZ0 D;  5AV8 D;  4XZQ D;  2F8N D;  3LZ1 B;  1ZLA C;  5B0Z C;  3O62 D;  3C1C D;  3UTB C;  3W97 A;  5DNM C;  1P3M A;  1AOI B;  1A7W A;  4H9N B;  4YM6 A;  5GSU D;  2Y2L A;  3UT9 C;  3AZN A;  4QLC C;  1KX4 B;  3A6N A;  3LEL B;  1P3P C;  5B1M B;  3AN2 B;  2IO5 B;  1P3L B;  1P34 C;  5B32 D;  4ZBJ B;  1M18 C;  4J8V A;  5BO0 A;  5B0Y A;  3H0L C;  3AZJ A;  5CP6 B;  3MVD B;  2ZY3 A;  4J8W B;  3TU4 A;  5B24 A;  3X1U B;  3AZH B;  3H0R C;  3WTP E;  3WA9 A;  3AV2 D;  2F8N B;  1AOI C;  2HIO A;  3O62 B;  2NZD B;  1P3O B;  1KX4 C;  3MGQ B;  4J8U C;  3VH5 W;  3REL B;  3C1B C;  4ZUX B;  3AN2 C;  2IO5 C;  3MGR D;  3X1S D;  3MGS D;  4X23 C;  5F99 A;  2FJ7 A;  3F6T A;  3WTP A;  3X1V A;  3AZK D;  3MVD C;  4J8W C;  3LZ0 C;  5AV8 C;  3REH D;  4XZQ C;  4WNN A;  2XD1 A;  4E45 A;  3O62 C;  4H9Q B;  3C1C C;  4NFT A;  1P3B B;  1F66 D;  5GSU C;  5B0Y B;  4LD9 B;  5BNX A;  3NQU B;  2Y2M A;  4KGC A;  5GT0 A;  5B31 G;  3WAA A;  5B32 C;  4AWL B;  5JRG D;  4WU8 D;  2Y2N A;  3EPK A;  3AZE A;  1M1A B;  4Z66 B;  1KX5 D;  4Z5T D;  2G5I C;  4CAY A;  3AFA B;  5CPI D;  3W96 D;  3B6G B;  3KWQ B;  3AV2 C;  4H9O A;  5CPJ D;  5AY8 A;  5BS7 C;  5C3I C;  1P3F D;  5DNN A;  3EPH A;  5KDM B;  5B33 D;  1F66 B;  3UTA D;  1ID3 D;  1WWS A;  3W98 A;  3AZG A;  3MGR C;  1EQZ A;  3X1S C;  5JA4 B;  3MGS C;  2XD5 A;  1HQ3 A;  5CHL B;  5B31 D;  1P3I D;  2ZY2 A;  1M1A C;  4NE3 A;  3MNN B;  2CWE A;  3W99 A;  3AZK C;  1M19 A;  2FFF B;  2CV5 A;  5AV6 D;  5JRG B;  5AVB A;  4WU9 D;  3REH C;  3X1T A;  4KUD B;  1KX3 A;  4Z5T B;  2HUE C;  5AVC B;  5GT0 B;  1N1J B;  3AZF B;  1BFM A;  5E5A A;  4J8X A;  3EG5 B;  1F66 C;  1TZY D;  5GXQ D;  4WV4 B;  3EPJ A;  3VH6 T;  2NQB B;  1PZR A;  1U35 B;  3REJ D;  2PYO B;  5B31 B;  1P3I B;  5JRG C;  4WU8 C;  2JE5 A;  2BYK A;  1ZLA A;  5B0Z A;  3UTB A;  4YS3 A;  5CPK A;  5DNM A;  1P3G B;  1KX5 C;  4Z5T C;  2F8N H;  3W96 C;  3LZ1 D;  1Q9C A;  3UT9 A;  1P3A A;  4QLC A;  5CPJ C;  3KUY D;  1P3F C;  4KHA A;  2DF4 C;  4EO5 B;  5B33 C;  5B2I D;  3AZM B;  1P34 A;  1M18 A;  3UTA C;  1ID3 C;  3LEL D;  1T3U A;  3AYW A;  5B1M D;  5B31 C;  1TAF A;  3KXB B;  1P3I C;  1P3L D;  3REK B;  4R8P B;  5B1L B;  3AZI B;  1P3K B;  3REJ B;  4G92 C;  2ZY4 A;  5AV6 C;  3AZL D;  4WU9 C;  5CP6 D;  4XUJ B;  3X1U D;  3VH5 A;  4G91 B;  3AZH D;  4J8U A;  5G49 B;  3C1B A;  2NZD D;  3KUY B;  4DRA A;  1P3O D;  1TZY C;  4X23 A;  5GXQ C;  3MGQ D;  3REL D;  4YS3 B;  4ZUX D;  5BNV A;  5B2I B;  4H9S C;  2VQR A;  3MGP A;  1JFI A;  4UUZ A;  5AV5 B;  3LZ0 A;  3REJ C;  5AV8 A;  4XZQ A;  1S32 B;  2Y2Q A;  3WKJ B;  3C1C A;  3B6F B;  3AZL B;  1HTA A;  3LZ1 C;  5GSU A;  5AV9 B;  2Y2I A;  3AV1 B;  3KUY C;  1P3B D;  2YFW B;  5B2I C;  5B0Y D;  5B32 A;  4LD9 D;  3AZJ D;  3B0B A;  3FDD A;  2BYM B;  2Y2J A;  3R45 B;  3LEL C;  5B24 D;  5B1M C;  5GT3 A;  4WZS B;  3A1I A;  1P3L C;  4ZBJ C;  3NQJ A;  3LJA A;  3AZL C;  3AV2 A;  4Z66 D;  1M1A D;  3W97 B;  1P3M B;  2ARO A;  5B40 A;  1B67 A;  5CP6 C;  3AFA D;  4YM6 B;  3X1U C;  3AZH C;  3AZN B;  3B6G D;  3KWQ D;  2Y2G A;  3A6N B;  3KFU G;  2FJ7 D;  2NZD C;  3MGR A;  3X1S A;  1P3O C;  3WTP D;  3REI A;  3MGQ C;  2YFV A;  1BH9 A;  3REL C;  4J8V B;  5BO0 B;  4ZUX C;  3AZK A;  3AZJ B;  2F8N K;  3TU4 B;  5B24 B;  3REH A;  3WA9 B;  3MNN D;  2HIO B;  2Y2K A;  4CSR A;  4WJ3 C;  1H3O A;  4KUD D;  3H0M C;  5GT3 B;  5AVC D;  5GT0 D;  3AZF D;  5F99 B;  1P3B C;  2FJ7 B;  3LJA B;  5B0Y C;  4LD9 C;  3WTP B;  3AZJ C;  3X1V B;  5B40 B;  4WU8 A;  4UPK A;  5B24 C;  2NQB D;  1KX5 A;  1U35 D;  4WNN B;  5CPI A;  4AWL C;  3W96 A;  2PYO D;  4JJN A;  2HIO C;  5DNN D;  5B2J A;  4Z66 C;  5CPJ A;  1P3G D;  1P3F A;  3AFA C;  4H9P A;  5B33 A;  5BNX B;  3KWQ C;  3B6G C;  3UTA A;  1ID3 A;  2BG1 A;  2FJ7 C;  4KGC B;  3WAA B;  3W99 D;  3WTP C;  3AZM D;  3AZE B;  5AV6 A;  1KX3 D;  4CAY B;  3KXB D;  4WU9 A;  3V9R A;  3REK D;  4R8P D;  5B1L D;  3AZI D;  3MNN C;  4H9R A;  5E5A D;  1P3K D;  3VH5 T;  4H9O B;  5AY8 B;  5DNN B;  2ZY5 A;  4XUJ D;  4KUD C;  1TZY A;  5AVC C;  5GT0 C;  3AZF C;  1BH8 A;  4E44 A;  3W98 B;  2L5A A;  3AZG B;  1EQZ B;  4H9S A;  1HQ3 B;  1P3P A;  3W99 B;  4YS3 D;  5CPK D;  1M19 B;  3IP4 C;  2CV5 B;  1B6W A;  5AVB B;  2NQB C;  5FUG A;  5AV5 D;  2F2A C;  3X1T B;  1U35 C;  1P3A D;  1KX3 B;  4M6B A;  1S32 D;  2PYO C;  3LZ1 A;  3WKJ D;  5DNN C;  5E5A B;  4J8X B;  3B6F D;  1P3G C;  1AOI A;  4H9N A;  5AV9 D;  3AV1 D;  3AYW D;  1KX4 A;  2J8P A;  4HGA B;  3LEL A;  3P5J B;  3W99 C;  5B1M A;  3A1K A;  3AN2 A;  4EO5 C;  1P3L A;  2G5H C;  3AZM C;  2BYK B;  1ZLA B;  5B0Z B;  3UTB B;  4DQY B;  5DNM B;  5CPK B;  1KX3 C;  3KXB C;  3MVD A;  3REK C;  4R8P C;  5B1L C;  4J8W A;  3AZI C;  1BH8 B;  3X1U A;  5E5A C;  3AZH A;  3UT9 B;  1P3A B;  1P3K C;  4QLC B;  2F8N A;  3W97 D;  1P3M D;  3O62 A;  4KHA B;  2NZD A;  3KSY A;  4XUJ C;  1P3O A;  4YM6 D;  4G91 C;  3MGQ A;  3AZN D;  1P34 B;  3REL A;  3MGP D;  1M18 B;  3A6N D;  4ZUX A;  3AYW B;  1TAF B;  4YS3 C;  4J8V D;  5CPK C;  2Y2H A;  5AV5 C;  1P3A C;  4DRB A;  3TU4 D;  1S32 C;  4J8U B;  3WA9 D;  3WKJ C;  4H9Q A;  3C1B B;  3B6F C;  2HIO D;  3EPL A;  4X23 B;  5BS7 A;  1P3B A;  3AL0 C;  5AV9 C;  3AV1 C;  3AYW C;  4LD9 A;  5GT3 D;  5BNV B;  3NQU A;  3MGP B;  1JFI B;  4UUZ B;  5F99 D;  3LZ0 B;  5AV8 B;  4XZQ B;  3LJA D;  3MGS A;  3X1V D;  3VH6 W;  2ARO D;  5B40 D;  3C1C B;  3B0C W;  4Z66 A;  1M1A A;  2LY8 A;  3AFA A;  5GSU B;  3B6G A;  3KWQ A;  3W97 C;  3REI D;  1P3M C;  2RIQ A;  1W2E A;  4YM6 C;  2RVQ D;  5KDM A;  3AZN C;  5B32 B;  3MGP C;  1F66 A;  3A6N C;  2UWX A;  4NE6 A;  3WAA D;  4KGC D;  5JA4 A;  4J8V C;  3MNN A;  3AZE D;  3NQJ B;  3AV2 B;  5C3I B;  2ARO B;  5JRG A;  3TU4 C;  2DQN C;  4KUD A;  3WA9 C;  4Z5T A;  5AVC A;  5AY8 D;  1N1J A;  3AZF A;  3MGR B;  4NE5 A;  3X1S B;  3MGS B;  1WWI A;  3REI B;  2ZM5 A;  2YFV B;  1BH9 B;  5GT3 C;  3AZK B;  3W98 D;  2W8S A;  3AZG D;  1EQZ D;  2NQB A;  5F99 C;  4JJN D;  1HQ3 D;  3REH B;  1U35 A;  3LJA C;  5B2J D;  3X1V C;  2HUE B;  2PYO A;  5B31 A;  1P3I A;  2ARO C;  5B40 C;  1M19 D;  2CV5 D;  1R4V A;  5AVB D;  4CSR B;  1P3G A;  1H3O B;  3X1T D;  3B0D B;  4Z2M H;  4J8X D;  3REI C;  4Z2M G;  5BT1 D;  2RVQ C;  2Y2P A;  3AZM A;  4WU8 B;  5GXQ A;  4KGC C;  3WAA C;  1KX5 B;  5CPI B;  3KXB A;  3REK A;  4R8P A;  5B1L A;  3W96 B;  4JJN B;  3AZI A;  3AZE C;  1P3K A;  1ZLA D;  1KU5 A;  5B2J B;  5B0Z D;  3REJ A;  3UTB D;  5CPJ B;  5DNM D;  1P3F B;  3B0D C;  4H9P B;  4XUJ A;  5B33 B;  3UT9 D;  4QLC D;  5AY8 C;  3B0C T;  3UTA B;  1ID3 B;  5G49 A;  1Z2C B;  1P3P D;  2JSS A;  3KUY A;  1P34 D;  1M18 D;  3W98 C;  4G92 B;  5CPI C;  5B2I A;  5AV6 B;  3AZG C;  2Y2O A;  1EQZ C;  4WU9 B;  4JJN C;  1HQ3 C;  2JCH A;  5AV5 A;  3V9R B;  2F8N G;  5B2J C;  4H9R B;  1S32 A;  1M19 C;  3WKJ A;  2CV5 C;  1AOI D;  5AVB C;  3B6F A;  3X1T C; 
#chains in the Genus database with same CATH homology
 3AZL A;  1TZY B;  1KX4 D;  5GXQ B;  4J8U D;  5CP6 A;  1ULY A;  5AV9 A;  3AV1 A;  3C1B D;  4J8X C;  3AN2 D;  5BT1 C;  4X23 D;  1P3P B;  2YFW A;  5B32 G;  3VH6 A;  1F1E A;  4HGA C;  2BYM A;  3R45 A;  3MVD D;  4J8W D;  5FUG B;  3LZ0 D;  5AV8 D;  4XZQ D;  2F8N D;  3LZ1 B;  1ZLA C;  5B0Z C;  3O62 D;  3C1C D;  3UTB C;  3W97 A;  5DNM C;  1P3M A;  1AOI B;  1A7W A;  4H9N B;  4YM6 A;  5GSU D;  2Y2L A;  3UT9 C;  3AZN A;  4QLC C;  1KX4 B;  3A6N A;  3LEL B;  1P3P C;  5B1M B;  3AN2 B;  2IO5 B;  1P3L B;  1P34 C;  5B32 D;  4ZBJ B;  1M18 C;  4J8V A;  5BO0 A;  5B0Y A;  3H0L C;  3AZJ A;  5CP6 B;  3MVD B;  2ZY3 A;  4J8W B;  3TU4 A;  5B24 A;  3X1U B;  3AZH B;  3H0R C;  3WTP E;  3WA9 A;  3AV2 D;  2F8N B;  1AOI C;  2HIO A;  3O62 B;  2NZD B;  1P3O B;  1KX4 C;  3MGQ B;  4J8U C;  3VH5 W;  3REL B;  3C1B C;  4ZUX B;  3AN2 C;  2IO5 C;  3MGR D;  3X1S D;  3MGS D;  4X23 C;  5F99 A;  2FJ7 A;  3F6T A;  3WTP A;  3X1V A;  3AZK D;  3MVD C;  4J8W C;  3LZ0 C;  5AV8 C;  3REH D;  4XZQ C;  4WNN A;  2XD1 A;  4E45 A;  3O62 C;  4H9Q B;  3C1C C;  4NFT A;  1P3B B;  1F66 D;  5GSU C;  5B0Y B;  4LD9 B;  5BNX A;  3NQU B;  2Y2M A;  4KGC A;  5GT0 A;  5B31 G;  3WAA A;  5B32 C;  4AWL B;  5JRG D;  4WU8 D;  2Y2N A;  3EPK A;  3AZE A;  1M1A B;  4Z66 B;  1KX5 D;  4Z5T D;  2G5I C;  4CAY A;  3AFA B;  5CPI D;  3W96 D;  3B6G B;  3KWQ B;  3AV2 C;  4H9O A;  5CPJ D;  5AY8 A;  5BS7 C;  5C3I C;  1P3F D;  5DNN A;  3EPH A;  5KDM B;  5B33 D;  1F66 B;  3UTA D;  1ID3 D;  1WWS A;  3W98 A;  3AZG A;  3MGR C;  1EQZ A;  3X1S C;  5JA4 B;  3MGS C;  2XD5 A;  1HQ3 A;  5CHL B;  5B31 D;  1P3I D;  2ZY2 A;  1M1A C;  4NE3 A;  3MNN B;  2CWE A;  3W99 A;  3AZK C;  1M19 A;  2FFF B;  2CV5 A;  5AV6 D;  5JRG B;  5AVB A;  4WU9 D;  3REH C;  3X1T A;  4KUD B;  1KX3 A;  4Z5T B;  2HUE C;  5AVC B;  5GT0 B;  1N1J B;  3AZF B;  1BFM A;  5E5A A;  4J8X A;  3EG5 B;  1F66 C;  1TZY D;  5GXQ D;  4WV4 B;  3EPJ A;  3VH6 T;  2NQB B;  1PZR A;  1U35 B;  3REJ D;  2PYO B;  5B31 B;  1P3I B;  5JRG C;  4WU8 C;  2JE5 A;  2BYK A;  1ZLA A;  5B0Z A;  3UTB A;  4YS3 A;  5CPK A;  5DNM A;  1P3G B;  1KX5 C;  4Z5T C;  2F8N H;  3W96 C;  3LZ1 D;  1Q9C A;  3UT9 A;  1P3A A;  4QLC A;  5CPJ C;  3KUY D;  1P3F C;  4KHA A;  2DF4 C;  4EO5 B;  5B33 C;  5B2I D;  3AZM B;  1P34 A;  1M18 A;  3UTA C;  1ID3 C;  3LEL D;  1T3U A;  3AYW A;  5B1M D;  5B31 C;  1TAF A;  3KXB B;  1P3I C;  1P3L D;  3REK B;  4R8P B;  5B1L B;  3AZI B;  1P3K B;  3REJ B;  4G92 C;  2ZY4 A;  5AV6 C;  3AZL D;  4WU9 C;  5CP6 D;  4XUJ B;  3X1U D;  3VH5 A;  4G91 B;  3AZH D;  4J8U A;  5G49 B;  3C1B A;  2NZD D;  3KUY B;  4DRA A;  1P3O D;  1TZY C;  4X23 A;  5GXQ C;  3MGQ D;  3REL D;  4YS3 B;  4ZUX D;  5BNV A;  5B2I B;  4H9S C;  2VQR A;  3MGP A;  1JFI A;  4UUZ A;  5AV5 B;  3LZ0 A;  3REJ C;  5AV8 A;  4XZQ A;  1S32 B;  2Y2Q A;  3WKJ B;  3C1C A;  3B6F B;  3AZL B;  1HTA A;  3LZ1 C;  5GSU A;  5AV9 B;  2Y2I A;  3AV1 B;  3KUY C;  1P3B D;  2YFW B;  5B2I C;  5B0Y D;  5B32 A;  4LD9 D;  3AZJ D;  3B0B A;  3FDD A;  2BYM B;  2Y2J A;  3R45 B;  3LEL C;  5B24 D;  5B1M C;  5GT3 A;  4WZS B;  3A1I A;  1P3L C;  4ZBJ C;  3NQJ A;  3LJA A;  3AZL C;  3AV2 A;  4Z66 D;  1M1A D;  3W97 B;  1P3M B;  2ARO A;  5B40 A;  1B67 A;  5CP6 C;  3AFA D;  4YM6 B;  3X1U C;  3AZH C;  3AZN B;  3B6G D;  3KWQ D;  2Y2G A;  3A6N B;  3KFU G;  2FJ7 D;  2NZD C;  3MGR A;  3X1S A;  1P3O C;  3WTP D;  3REI A;  3MGQ C;  2YFV A;  1BH9 A;  3REL C;  4J8V B;  5BO0 B;  4ZUX C;  3AZK A;  3AZJ B;  2F8N K;  3TU4 B;  5B24 B;  3REH A;  3WA9 B;  3MNN D;  2HIO B;  2Y2K A;  4CSR A;  4WJ3 C;  1H3O A;  4KUD D;  3H0M C;  5GT3 B;  5AVC D;  5GT0 D;  3AZF D;  5F99 B;  1P3B C;  2FJ7 B;  3LJA B;  5B0Y C;  4LD9 C;  3WTP B;  3AZJ C;  3X1V B;  5B40 B;  4WU8 A;  4UPK A;  5B24 C;  2NQB D;  1KX5 A;  1U35 D;  4WNN B;  5CPI A;  4AWL C;  3W96 A;  2PYO D;  4JJN A;  2HIO C;  5DNN D;  5B2J A;  4Z66 C;  5CPJ A;  1P3G D;  1P3F A;  3AFA C;  4H9P A;  5B33 A;  5BNX B;  3KWQ C;  3B6G C;  3UTA A;  1ID3 A;  2BG1 A;  2FJ7 C;  4KGC B;  3WAA B;  3W99 D;  3WTP C;  3AZM D;  3AZE B;  5AV6 A;  1KX3 D;  4CAY B;  3KXB D;  4WU9 A;  3V9R A;  3REK D;  4R8P D;  5B1L D;  3AZI D;  3MNN C;  4H9R A;  5E5A D;  1P3K D;  3VH5 T;  4H9O B;  5AY8 B;  5DNN B;  2ZY5 A;  4XUJ D;  4KUD C;  1TZY A;  5AVC C;  5GT0 C;  3AZF C;  1BH8 A;  4E44 A;  3W98 B;  2L5A A;  3AZG B;  1EQZ B;  4H9S A;  1HQ3 B;  1P3P A;  3W99 B;  4YS3 D;  5CPK D;  1M19 B;  3IP4 C;  2CV5 B;  1B6W A;  5AVB B;  2NQB C;  5FUG A;  5AV5 D;  2F2A C;  3X1T B;  1U35 C;  1P3A D;  1KX3 B;  4M6B A;  1S32 D;  2PYO C;  3LZ1 A;  3WKJ D;  5DNN C;  5E5A B;  4J8X B;  3B6F D;  1P3G C;  1AOI A;  4H9N A;  5AV9 D;  3AV1 D;  3AYW D;  1KX4 A;  2J8P A;  4HGA B;  3LEL A;  3P5J B;  3W99 C;  5B1M A;  3A1K A;  3AN2 A;  4EO5 C;  1P3L A;  2G5H C;  3AZM C;  2BYK B;  1ZLA B;  5B0Z B;  3UTB B;  4DQY B;  5DNM B;  5CPK B;  1KX3 C;  3KXB C;  3MVD A;  3REK C;  4R8P C;  5B1L C;  4J8W A;  3AZI C;  1BH8 B;  3X1U A;  5E5A C;  3AZH A;  3UT9 B;  1P3A B;  1P3K C;  4QLC B;  2F8N A;  3W97 D;  1P3M D;  3O62 A;  4KHA B;  2NZD A;  3KSY A;  4XUJ C;  1P3O A;  4YM6 D;  4G91 C;  3MGQ A;  3AZN D;  1P34 B;  3REL A;  3MGP D;  1M18 B;  3A6N D;  4ZUX A;  3AYW B;  1TAF B;  4YS3 C;  4J8V D;  5CPK C;  2Y2H A;  5AV5 C;  1P3A C;  4DRB A;  3TU4 D;  1S32 C;  4J8U B;  3WA9 D;  3WKJ C;  4H9Q A;  3C1B B;  3B6F C;  2HIO D;  3EPL A;  4X23 B;  5BS7 A;  1P3B A;  3AL0 C;  5AV9 C;  3AV1 C;  3AYW C;  4LD9 A;  5GT3 D;  5BNV B;  3NQU A;  3MGP B;  1JFI B;  4UUZ B;  5F99 D;  3LZ0 B;  5AV8 B;  4XZQ B;  3LJA D;  3MGS A;  3X1V D;  3VH6 W;  2ARO D;  5B40 D;  3C1C B;  3B0C W;  4Z66 A;  1M1A A;  2LY8 A;  3AFA A;  5GSU B;  3B6G A;  3KWQ A;  3W97 C;  3REI D;  1P3M C;  2RIQ A;  1W2E A;  4YM6 C;  2RVQ D;  5KDM A;  3AZN C;  5B32 B;  3MGP C;  1F66 A;  3A6N C;  2UWX A;  4NE6 A;  3WAA D;  4KGC D;  5JA4 A;  4J8V C;  3MNN A;  3AZE D;  3NQJ B;  3AV2 B;  5C3I B;  2ARO B;  5JRG A;  3TU4 C;  2DQN C;  4KUD A;  3WA9 C;  4Z5T A;  5AVC A;  5AY8 D;  1N1J A;  3AZF A;  3MGR B;  4NE5 A;  3X1S B;  3MGS B;  1WWI A;  3REI B;  2ZM5 A;  2YFV B;  1BH9 B;  5GT3 C;  3AZK B;  3W98 D;  2W8S A;  3AZG D;  1EQZ D;  2NQB A;  5F99 C;  4JJN D;  1HQ3 D;  3REH B;  1U35 A;  3LJA C;  5B2J D;  3X1V C;  2HUE B;  2PYO A;  5B31 A;  1P3I A;  2ARO C;  5B40 C;  1M19 D;  2CV5 D;  1R4V A;  5AVB D;  4CSR B;  1P3G A;  1H3O B;  3X1T D;  3B0D B;  4Z2M H;  4J8X D;  3REI C;  4Z2M G;  5BT1 D;  2RVQ C;  2Y2P A;  3AZM A;  4WU8 B;  5GXQ A;  4KGC C;  3WAA C;  1KX5 B;  5CPI B;  3KXB A;  3REK A;  4R8P A;  5B1L A;  3W96 B;  4JJN B;  3AZI A;  3AZE C;  1P3K A;  1ZLA D;  1KU5 A;  5B2J B;  5B0Z D;  3REJ A;  3UTB D;  5CPJ B;  5DNM D;  1P3F B;  3B0D C;  4H9P B;  4XUJ A;  5B33 B;  3UT9 D;  4QLC D;  5AY8 C;  3B0C T;  3UTA B;  1ID3 B;  5G49 A;  1Z2C B;  1P3P D;  2JSS A;  3KUY A;  1P34 D;  1M18 D;  3W98 C;  4G92 B;  5CPI C;  5B2I A;  5AV6 B;  3AZG C;  2Y2O A;  1EQZ C;  4WU9 B;  4JJN C;  1HQ3 C;  2JCH A;  5AV5 A;  3V9R B;  2F8N G;  5B2J C;  4H9R B;  1S32 A;  1M19 C;  3WKJ A;  2CV5 C;  1AOI D;  5AVB C;  3B6F A;  3X1T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...