4XUJD

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding protein/dna
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujD00
3AV1C 4H9NB 3C1CA 3AZGB 3W97B 5B0YC 5B33A 5CPJD 3RELB 3C1BA 5CPIA 5B1MC 4XZQA 3MNNB 1P34D 3WTPC 5AV5D 1F66B 2NZDD 1P3MC 3AV1A 3UTBD 4DRBA 4J8XD 2FJ7D 1P3FC 5B0YA 3REHC 3AN2D 3AZIC 5B1MA 3KUYB 3X1UB 3W96D 1BH9A 2JSSA 3WTPA 1ZLAD 3W98C 5B24C 5BT1D 3WAAB 3WA9A 4H9OA 5KDMB 3REHA 3AZMC 5B31D 3AZIA 3B6GC 4YS3B 4QLCC 3MGPD 2IO5B 3X1SD 1P34B 1AOIC 3W98A 4WV4B 5AVBB 5B24A 1M1AD 1ID3B 3B6GA 4QLCA 2NQBD 2F8ND 3RELA 1AOIA 4Z5TB 2HUEC 3AZEB 4J8VB 1F66A 4G91B 5AV6D 1B67A 5B31B 3MGPB 5AY8C 3KUYA 1P3GD 3LJAB 5JRGC 5B40D 1P3AC 3UT9D 5B2JC 4WU9B 4G92C 5CPKD 4Z66B 2F8NB 5AY8A 4H9SC 4H9RB 3KXBB 5JRGA 3LZ1D 2PYOB 1P3AA 3O62D 4NFTA 5AVBA 1P3BD 4NE3A 5B2JA 4J8WC 5E5AC 5B0ZD 2YFVA 1TZYD 1P3IC 4AWLB 3NQJA 3X1TB 4LD9D 1P3GB 3MGSC 5B1LD 5AV9C 3NQUB 3AZFB 3MGQC 3UT9B 5AVCC 4J8WA 5CPKB 5E5AA 2HIOC 3C1BD 5CPID 1P3IA 4XZQD 3MGSA 4J8UC 3W99B 4XUJC 5F99C 5AV9A 3X1VB 3MGQA 5AVCA 1KX5C 5JA4A 5B0YD 5B1MD 5B32C 5CP6B 4XUJA 5F99A 4E44A 2PYOA 2LY8A 3REKC 3B6FB 2RVQC 2CWEA 3C1CB 3WA9D 2AROB 2BYMA 4ZBJC 5B33B 3REHD 3AZID 3C1BB 5CPIB 5B32A 4JJNC 3AV2B 4YM6C 3MVDB 1P3KC 3W98D 3AV1B 3REKA 5B0YB 1P3LC 3AZGD 1KX3C 3W97D 3B6GD 5B32G 5B1MB 4QLCD 3AZLC 3RELD 4JJNA 1AOID 3WTPB 3AFAC 4YM6A 1P3KA 5BNXA 3AYWC 3X1VA 1P3MB 1F66D 3LELC 5CHLB 1HQ3C 1P3FB 3REHB 1M18C 1P3LA 1KX3A 3AZIB 2L5AA 3AZLA 4EO5C 3KSYA 1H3OA 3AFAA 3KUYD 1EQZC 3X1UD 3W98B 3AYWA 5B24B 3LELA 3KWQC 3B6FA 3WAAD 3AZMB 2AROA 3B6GB 4Z2MG 4QLCB 3VH6T 1JFIA 1AOIB 4YS3D 3AV2A 5GSUC 1S32B 3MVDA 5AVBD 3KWQA 5G49A 5B2JD 5AV8C 4R8PC 1P3PC 5FUGA 1ID3D 2HUEB 5GSUA 4Z5TD 4KUDC 3AZED 1P3MA 4J8VD 4HGAC 1M19B 4CSRA 1P3FA 1P3ID 1A7WA 5AY8B 3MGSD 5AV9D 5JRGB 1S32C 3LJAD 1P3AB 4KUDA 3MGQD 5B2JB 5AVCD 4WNNA 4G92B 2YFVB 4WU9D 3B0DC 4Z66D 3AZMA 5B2IC 3NQJB 5GXQC 5GT0C 4XUJD 5F99D 1S32A 3KXBD 2PYOD 4J8WB 5E5AB 1M19C 1P3IB 5B2IA 5GXQA 3REJC 1WWIA 3MGSB 3X1TD 2F8NH 5AV9B 3MGRC 3WKJC 3MGQB 3REKD 3VH6A 5AVCB 3AZFD 5JA4B 1M19A 2HIOB 1U35C 4JJND 3LZ0C 3REJA 1KX4C 4J8UB 4KGCC 4XUJB 5F99B 1HTAA 3W99D 3WKJA 3UTAC 3X1VD 1BFMA 2BYKA 5DNNC 4M6BA 1KX5B 2BYMB 1P3LD 1B6WA 5B32B 3AZJC 3AZLD 5CPJC 1U35A 3LZ0A 1KX4A 5C3IC 4WU8C 4H9SA 5CP6D 3UTAA 3AYWD 3REKB 5AV5C 3LELD 4H9QA 2NZDC 3B6FD 3C1CD 3UTBC 4ZBJB 2AROD 4J8XC 2FJ7C 5B33D 3VH6W 3AZJA 4JJNB 4YM6B 3AV2D 4WU8A 1P3KB 3MVDD 5BNXB 4E45A 2NZDA 3AV1D 5BT1C 3UTBA 1P3LB 1KX3B 4J8XA 2HIOA 3AZLB 1H3OB 3AFAB 5GSUD 3WTPD 3X1SC 4J8UA 3AYWB 3LELB 1P3MD 4H9PA 3AZHC 1HQ3B 1M18B 1KX5A 1P3FD 1M1AC 1JFIB 4EO5B 4X23B 2NQBC 1EQZB 3X1SA 4ZUXB 3AZNC 1TAFA 4KUDD 4CAYA 3KWQB 5G49B 5B24D 3AZHA 1BH8B 5AV6C 5FUGB 1M1AA 3AZMD 2F8NK 3A6NC 5GSUB 3AZNA 1S32D 5B40C 4CSRB 3REIC 5AV6A 5AV8B 1WWSA 4R8PB 1P3PB 5BS7C 5B2ID 1F1EA 5GXQD 3A6NA 4X23C 5BO0A 2YFWB 3R45A 4ZUXC 4KUDB 1Q9CA 3LZ1C 5B40A 4HGAB 1P3OC 4WNNB 3O62C 3REIA 1P3BC 1M19D 1HQ3A 1M18A 5BS7A 5B0ZC 3B0BA 1TZYC 4DRAA 3REJD 4X23A 5AY8D 4LD9C 1EQZA 5B1LC 3WKJD 4ZUXA 5JRGD 1P3AD 3LZ1A 5GT3C 3AZKC 1P3OA 1P3BA 3B0DB 1BH8A 5B2IB 5GXQB 1TZYA 1U35D 5GT0B 1KX4D 4XZQC 4LD9A 3UTAD 5GT3A 1N1JA 3AZKA 4J8WD 5E5AD 5AV8A 4R8PA 1P3PA 3AZJD 3REJB 2CV5C 3MGRB 4WU8D 3VH5T 5BNVA 3WKJB 3B0CT 2YFWA 3TU4C 2BYKB 4UUZA 5DNMC 3WA9C 2HIOD 1U35B 4NE5A 3LZ0B 2CV5A 1KX4B 4KGCB 4J8UD 3UTAB 4H9QB 3TU4A 5DNNB 5DNMA 4KHAA 1KX5D 3AZGC 3W97C 3AZJB 5CPJB 5B32D 5C3IB 5GT0A 3RELC 4WU8B 3MNNC 5AV5B 2NZDB 3AZHD 1F66C 2RVQD 3UTBB 4J8XB 2FJ7B 4H9NA 3AN2B 3W97A 3AZGA 4WZSB 3AZND 3W96B 4YM6D 3KUYC 3MGRA 3X1UC 3MNNA 1P3KD 1ZLAB 4H9PB 3WAAC 1KX3D 3A6ND 3X1SB 4YS3C 3AFAD 4KGCA 2IO5C 1TAFB 1P34C 3X1UA 4CAYB 3AZHB 5DNNA 5AVBC 3REID 3V9RB 1HQ3D 1M18D 3WAAA 1M1AB 3VH5A 1R4VA 3AN2C 5KDMA 2NQBB 1ID3C 5CPJA 4X23D 3AZNB 4Z2MH 4YS3A 1EQZD 1P34A 3W96C 4ZUXD 1ZLAC 4Z5TC 5AV5A 1P3OD 3KWQD 3AZEC 5AV6B 4J8VC 4G91C 2FJ7A 3AN2A 5B31C 3A6NB 1ID3A 5BO0B 3MGPC 3R45B 3W96A 1ZLAA 4Z5TA 5B40B 3LJAC 5GT3D 3REIB 3AZEA 3AZKD 4J8VA 5AV8D 4R8PD 4WU9C 1P3PD 4Z66C 5B31A 3MGPA 3VH5W 3B0CW 3LZ1B 3LJAA 3KXBC 3O62B 1P3BB 1P3OB 2PYOC 3V9RA 5B0ZB 4WU9A 1TZYB 5B31G 4Z66A 2CV5D 4LD9B 2NQBA 2F8NA 4AWLC 5B1LB 3X1TC 1P3GC 3TU4D 1KU5A 1N1JB 4H9RA 5GT3B 5DNMD 4NE6A 3KXBA 3AZKB 3AZFC 3UT9C 5CPKC 2F8NG 4XZQB 5GT0D 5BNVB 3X1TA 3WTPE 1P3GA 3W99C 4UUZB 3X1VC 3NQUA 3AZFA 3UT9A 5CPKA 2CV5B 1BH9B 3MGRD 3MNND 3TU4B 5CP6C 3W99A 5DNMB 4KHAB 3O62A 3B6FC 3WA9B 3C1CC 4H9OB 2AROC 5B0ZA 5B33C 5CPIC 3LZ0D 3C1BC 4KGCD 1ULYA 3AV2C 5B1LA 3MVDC 5CP6A 5DNND
chains in the Genus database with same CATH superfamily
3AV1C 2Y2JA 4H9NB 3C1CA 3AZGB 3W97B 5B0YC 5B33A 3KFUG 5CPJD 3RELB 3C1BA 5CPIA 5B1MC 4XZQA 3MNNB 1P34D 2ZY3A 3WTPC 5AV5D 1F66B 2NZDD 1P3MC 3AV1A 3UTBD 4DRBA 4J8XD 2FJ7D 1P3FC 5B0YA 3REHC 3AN2D 3AZIC 3H0RC 5B1MA 3KUYB 2Y2MA 3X1UB 3W96D 1BH9A 2JSSA 3WTPA 1ZLAD 3W98C 5B24C 5BT1D 3WAAB 3WA9A 4H9OA 5KDMB 3REHA 3AZMC 5B31D 3AZIA 3B6GC 4YS3B 4QLCC 3MGPD 2IO5B 3X1SD 1P34B 1AOIC 3W98A 4WV4B 5AVBB 5B24A 2Y2PA 2Y2GA 1M1AD 1ID3B 3B6GA 4QLCA 2NQBD 2F8ND 3RELA 1AOIA 4Z5TB 2HUEC 3AZEB 4J8VB 1F66A 4G91B 5AV6D 1B67A 5B31B 3MGPB 3H0MC 5AY8C 3KUYA 1P3GD 3LJAB 5JRGC 5B40D 1P3AC 3UT9D 5B2JC 4WU9B 4G92C 5CPKD 4Z66B 2F8NB 5AY8A 4H9SC 4H9RB 3KXBB 5JRGA 3LZ1D 2PYOB 1P3AA 3O62D 4NFTA 5AVBA 1P3BD 4NE3A 5B2JA 4J8WC 5E5AC 5B0ZD 2YFVA 1TZYD 1P3IC 4AWLB 3NQJA 3X1TB 3P5JB 4LD9D 1P3GB 3MGSC 5B1LD 5AV9C 3NQUB 3AZFB 3MGQC 3UT9B 5AVCC 4J8WA 5CPKB 5E5AA 2HIOC 3C1BD 5CPID 1P3IA 4XZQD 3MGSA 4J8UC 3W99B 4XUJC 5F99C 5AV9A 3X1VB 3MGQA 5AVCA 1KX5C 5JA4A 5B0YD 5B1MD 5B32C 5CP6B 4XUJA 5F99A 4E44A 2Y2IA 2Y2OA 2PYOA 2LY8A 2ZY4A 3REKC 3B6FB 2RVQC 2CWEA 3A1KA 3C1CB 3WA9D 2AROB 2BYMA 4ZBJC 5B33B 3REHD 3AZID 3C1BB 5CPIB 1PZRA 5B32A 4JJNC 3AV2B 4YM6C 3MVDB 2BG1A 1P3KC 3W98D 2Y2LA 3AV1B 3REKA 4WJ3C 5B0YB 1P3LC 3AZGD 1KX3C 3W97D 3B6GD 5B32G 5B1MB 4QLCD 3AZLC 3RELD 4JJNA 1AOID 3WTPB 3AFAC 4YM6A 1P3KA 5BNXA 3AYWC 3X1VA 1P3MB 1F66D 3LELC 5CHLB 1HQ3C 1P3FB 3REHB 1M18C 1P3LA 1KX3A 3AZIB 2L5AA 2JE5A 3AZLA 4EO5C 3KSYA 1H3OA 3AFAA 3KUYD 2JCHA 1EQZC 3X1UD 3W98B 2Y2QA 3AYWA 5B24B 3LELA 3KWQC 3B6FA 3WAAD 3AZMB 2AROA 3B6GB 2G5IC 4Z2MG 4QLCB 3VH6T 1JFIA 1AOIB 4YS3D 3AV2A 5GSUC 1S32B 3MVDA 5AVBD 3KWQA 5G49A 5B2JD 5AV8C 4R8PC 1P3PC 5FUGA 1ID3D 2HUEB 5GSUA 4Z5TD 4KUDC 3AZED 1P3MA 4J8VD 4HGAC 1M19B 4CSRA 1P3FA 1P3ID 1A7WA 5AY8B 3MGSD 5AV9D 5JRGB 1S32C 3LJAD 3A1IA 1P3AB 4KUDA 3MGQD 5B2JB 5AVCD 4WNNA 4G92B 2YFVB 4WU9D 3B0DC 4Z66D 3AZMA 5B2IC 3NQJB 2FFFB 5GXQC 5GT0C 4XUJD 5F99D 1S32A 3KXBD 2PYOD 4J8WB 5E5AB 1M19C 3EG5B 1P3IB 5B2IA 5GXQA 3REJC 1WWIA 3IP4C 3MGSB 3X1TD 2F8NH 5AV9B 3MGRC 3WKJC 3MGQB 3REKD 3VH6A 5AVCB 3AZFD 5JA4B 2VQRA 1M19A 3F6TA 2HIOB 3EPKA 1U35C 4JJND 3LZ0C 3REJA 1KX4C 4J8UB 4KGCC 4XUJB 5F99B 1HTAA 3W99D 3WKJA 2ZY2A 3UTAC 3X1VD 1BFMA 2BYKA 5DNNC 3EPHA 4M6BA 1KX5B 2BYMB 1P3LD 1B6WA 5B32B 3AZJC 3AZLD 5CPJC 1U35A 3LZ0A 1KX4A 5C3IC 4WU8C 4H9SA 5CP6D 3UTAA 3AYWD 3REKB 5AV5C 3LELD 4H9QA 2NZDC 3B6FD 3C1CD 3UTBC 4ZBJB 2AROD 4J8XC 2FJ7C 5B33D 3VH6W 3AZJA 4JJNB 4YM6B 3AV2D 4WU8A 1P3KB 3MVDD 5BNXB 4E45A 2W8SA 2NZDA 3AV1D 5BT1C 3UTBA 1P3LB 1KX3B 4J8XA 2HIOA 2J8PA 3AZLB 1H3OB 3AFAB 5GSUD 3WTPD 3X1SC 4J8UA 3AYWB 3LELB 1P3MD 4H9PA 3AZHC 1HQ3B 1M18B 1KX5A 1P3FD 1M1AC 1JFIB 4EO5B 4X23B 2NQBC 1EQZB 3X1SA 4ZUXB 3AZNC 1TAFA 4KUDD 4CAYA 3KWQB 5G49B 5B24D 3AZHA 1BH8B 5AV6C 5FUGB 1M1AA 3AZMD 2F8NK 3A6NC 5GSUB 3AZNA 1S32D 5B40C 4CSRB 3REIC 5AV6A 5AV8B 1WWSA 4R8PB 1P3PB 5BS7C 5B2ID 1F1EA 5GXQD 2RIQA 3A6NA 4X23C 3EPLA 5BO0A 2YFWB 3R45A 4ZUXC 4KUDB 1Q9CA 3LZ1C 5B40A 4HGAB 1P3OC 4WNNB 3O62C 2Y2NA 3REIA 1P3BC 2Y2KA 1HQ3A 1M19D 1M18A 5BS7A 5B0ZC 3B0BA 1TZYC 4DRAA 3REJD 4X23A 5AY8D 4LD9C 1EQZA 5B1LC 3WKJD 4ZUXA 5JRGD 1P3AD 3LZ1A 5GT3C 3AZKC 1P3OA 1P3BA 3B0DB 1BH8A 5B2IB 5GXQB 1TZYA 1U35D 5GT0B 1KX4D 4XZQC 2G5HC 4LD9A 3UTAD 5GT3A 1N1JA 3AZKA 3EPJA 4J8WD 5E5AD 5AV8A 4R8PA 1P3PA 3AZJD 3REJB 2CV5C 2DF4C 3MGRB 4WU8D 3VH5T 5BNVA 3WKJB 3B0CT 2YFWA 3TU4C 2BYKB 4UUZA 5DNMC 3WA9C 2HIOD 1U35B 4NE5A 3LZ0B 2CV5A 1KX4B 4KGCB 4J8UD 3UTAB 4H9QB 3TU4A 5DNNB 5DNMA 2ZM5A 4KHAA 4UPKA 1KX5D 1W2EA 3AZGC 3W97C 3AZJB 5CPJB 5B32D 5C3IB 5GT0A 3RELC 4WU8B 3MNNC 5AV5B 2NZDB 3AZHD 1Z2CB 1F66C 2RVQD 3UTBB 4J8XB 2FJ7B 4H9NA 2XD5A 3AN2B 3W97A 3AZGA 4WZSB 3AZND 3W96B 4YM6D 3KUYC 3MGRA 3X1UC 3MNNA 1P3KD 1ZLAB 4H9PB 2UWXA 3WAAC 1KX3D 3A6ND 3X1SB 4YS3C 3AFAD 4KGCA 2IO5C 1TAFB 1P34C 3X1UA 4CAYB 3AZHB 5DNNA 5AVBC 3REID 3V9RB 1HQ3D 1M18D 3WAAA 1M1AB 3VH5A 1R4VA 3AN2C 5KDMA 2NQBB 1ID3C 5CPJA 4X23D 3AZNB 4Z2MH 4YS3A 1EQZD 1P34A 3W96C 4ZUXD 1ZLAC 4Z5TC 5AV5A 1P3OD 3KWQD 3AZEC 5AV6B 4J8VC 4G91C 2FJ7A 3AN2A 5B31C 3A6NB 1ID3A 5BO0B 3MGPC 3R45B 3W96A 1ZLAA 4Z5TA 5B40B 3LJAC 5GT3D 3REIB 3AZEA 3AZKD 4J8VA 5AV8D 4R8PD 4WU9C 1P3PD 2DQNC 4Z66C 5B31A 3MGPA 3VH5W 3B0CW 3LZ1B 3LJAA 3KXBC 3O62B 1P3BB 1P3OB 2PYOC 3V9RA 5B0ZB 4WU9A 1TZYB 5B31G 4Z66A 2CV5D 3AL0C 4LD9B 2NQBA 2F8NA 4AWLC 5B1LB 3X1TC 1P3GC 3FDDA 3TU4D 1KU5A 1N1JB 4H9RA 5GT3B 5DNMD 4NE6A 3KXBA 3AZKB 3AZFC 3UT9C 5CPKC 2ZY5A 1T3UA 2F8NG 4XZQB 5GT0D 5BNVB 3X1TA 3WTPE 1P3GA 3W99C 4UUZB 3X1VC 3NQUA 4DQYB 3AZFA 3UT9A 2XD1A 5CPKA 3H0LC 2CV5B 1BH9B 3MGRD 3MNND 3TU4B 5CP6C 3W99A 5DNMB 4KHAB 3O62A 3B6FC 3WA9B 3C1CC 4H9OB 2AROC 5B0ZA 5B33C 5CPIC 3LZ0D 3C1BC 4KGCD 1ULYA 2Y2HA 3AV2C 2F2AC 5B1LA 3MVDC 5CP6A 5DNND
chains in the Genus database with same CATH topology
3AV1C 2Y2JA 4H9NB 3C1CA 3AZGB 3W97B 5B0YC 5B33A 3KFUG 5CPJD 3RELB 3C1BA 5CPIA 5B1MC 4XZQA 3MNNB 1P34D 2ZY3A 3WTPC 5AV5D 1F66B 2NZDD 1P3MC 3AV1A 3UTBD 4DRBA 4J8XD 2FJ7D 1P3FC 5B0YA 3REHC 3AN2D 3AZIC 3H0RC 5B1MA 3KUYB 2Y2MA 3X1UB 3W96D 1BH9A 2JSSA 3WTPA 1ZLAD 3W98C 5B24C 5BT1D 3WAAB 3WA9A 4H9OA 5KDMB 3REHA 3AZMC 5B31D 3AZIA 3B6GC 4YS3B 4QLCC 3MGPD 2IO5B 3X1SD 1P34B 1AOIC 3W98A 4WV4B 5AVBB 5B24A 2Y2PA 2Y2GA 1M1AD 1ID3B 3B6GA 4QLCA 2NQBD 2F8ND 3RELA 1AOIA 4Z5TB 2HUEC 3AZEB 4J8VB 1F66A 4G91B 5AV6D 1B67A 5B31B 3MGPB 3H0MC 5AY8C 3KUYA 1P3GD 3LJAB 5JRGC 5B40D 1P3AC 3UT9D 5B2JC 4WU9B 4G92C 5CPKD 4Z66B 2F8NB 5AY8A 4H9SC 4H9RB 3KXBB 5JRGA 3LZ1D 2PYOB 1P3AA 3O62D 4NFTA 5AVBA 1P3BD 4NE3A 5B2JA 4J8WC 5E5AC 5B0ZD 2YFVA 1TZYD 1P3IC 4AWLB 3NQJA 3X1TB 3P5JB 4LD9D 1P3GB 3MGSC 5B1LD 5AV9C 3NQUB 3AZFB 3MGQC 3UT9B 5AVCC 4J8WA 5CPKB 5E5AA 2HIOC 3C1BD 5CPID 1P3IA 4XZQD 3MGSA 4J8UC 3W99B 4XUJC 5F99C 5AV9A 3X1VB 3MGQA 5AVCA 1KX5C 5JA4A 5B0YD 5B1MD 5B32C 5CP6B 4XUJA 5F99A 4E44A 2Y2IA 2Y2OA 2PYOA 2LY8A 2ZY4A 3REKC 3B6FB 2RVQC 2CWEA 3A1KA 3C1CB 3WA9D 2AROB 2BYMA 4ZBJC 5B33B 3REHD 3AZID 3C1BB 5CPIB 1PZRA 5B32A 4JJNC 3AV2B 4YM6C 3MVDB 2BG1A 1P3KC 3W98D 2Y2LA 3AV1B 3REKA 4WJ3C 5B0YB 1P3LC 3AZGD 1KX3C 3W97D 3B6GD 5B32G 5B1MB 4QLCD 3AZLC 3RELD 4JJNA 1AOID 3WTPB 3AFAC 4YM6A 1P3KA 5BNXA 3AYWC 3X1VA 1P3MB 1F66D 3LELC 5CHLB 1HQ3C 1P3FB 3REHB 1M18C 1P3LA 1KX3A 3AZIB 2L5AA 2JE5A 3AZLA 4EO5C 3KSYA 1H3OA 3AFAA 3KUYD 2JCHA 1EQZC 3X1UD 3W98B 2Y2QA 3AYWA 5B24B 3LELA 3KWQC 3B6FA 3WAAD 3AZMB 2AROA 3B6GB 2G5IC 4Z2MG 4QLCB 3VH6T 1JFIA 1AOIB 4YS3D 3AV2A 5GSUC 1S32B 3MVDA 5AVBD 3KWQA 5G49A 5B2JD 5AV8C 4R8PC 1P3PC 5FUGA 1ID3D 2HUEB 5GSUA 4Z5TD 4KUDC 3AZED 1P3MA 4J8VD 4HGAC 1M19B 4CSRA 1P3FA 1P3ID 1A7WA 5AY8B 3MGSD 5AV9D 5JRGB 1S32C 3LJAD 3A1IA 1P3AB 4KUDA 3MGQD 5B2JB 5AVCD 4WNNA 4G92B 2YFVB 4WU9D 3B0DC 4Z66D 3AZMA 5B2IC 3NQJB 2FFFB 5GXQC 5GT0C 4XUJD 5F99D 1S32A 3KXBD 2PYOD 4J8WB 5E5AB 1M19C 3EG5B 1P3IB 5B2IA 5GXQA 3REJC 1WWIA 3IP4C 3MGSB 3X1TD 2F8NH 5AV9B 3MGRC 3WKJC 3MGQB 3REKD 3VH6A 5AVCB 3AZFD 5JA4B 2VQRA 1M19A 3F6TA 2HIOB 3EPKA 1U35C 4JJND 3LZ0C 3REJA 1KX4C 4J8UB 4KGCC 4XUJB 5F99B 1HTAA 3W99D 3WKJA 2ZY2A 3UTAC 3X1VD 1BFMA 2BYKA 5DNNC 3EPHA 4M6BA 1KX5B 2BYMB 1P3LD 1B6WA 5B32B 3AZJC 3AZLD 5CPJC 1U35A 3LZ0A 1KX4A 5C3IC 4WU8C 4H9SA 5CP6D 3UTAA 3AYWD 3REKB 5AV5C 3LELD 4H9QA 2NZDC 3B6FD 3C1CD 3UTBC 4ZBJB 2AROD 4J8XC 2FJ7C 5B33D 3VH6W 3AZJA 4JJNB 4YM6B 3AV2D 4WU8A 1P3KB 3MVDD 5BNXB 4E45A 2W8SA 2NZDA 3AV1D 5BT1C 3UTBA 1P3LB 1KX3B 4J8XA 2HIOA 2J8PA 3AZLB 1H3OB 3AFAB 5GSUD 3WTPD 3X1SC 4J8UA 3AYWB 3LELB 1P3MD 4H9PA 3AZHC 1HQ3B 1M18B 1KX5A 1P3FD 1M1AC 1JFIB 4EO5B 4X23B 2NQBC 1EQZB 3X1SA 4ZUXB 3AZNC 1TAFA 4KUDD 4CAYA 3KWQB 5G49B 5B24D 3AZHA 1BH8B 5AV6C 5FUGB 1M1AA 3AZMD 2F8NK 3A6NC 5GSUB 3AZNA 1S32D 5B40C 4CSRB 3REIC 5AV6A 5AV8B 1WWSA 4R8PB 1P3PB 5BS7C 5B2ID 1F1EA 5GXQD 2RIQA 3A6NA 4X23C 3EPLA 5BO0A 2YFWB 3R45A 4ZUXC 4KUDB 1Q9CA 3LZ1C 5B40A 4HGAB 1P3OC 4WNNB 3O62C 2Y2NA 3REIA 1P3BC 2Y2KA 1HQ3A 1M19D 1M18A 5BS7A 5B0ZC 3B0BA 1TZYC 4DRAA 3REJD 4X23A 5AY8D 4LD9C 1EQZA 5B1LC 3WKJD 4ZUXA 5JRGD 1P3AD 3LZ1A 5GT3C 3AZKC 1P3OA 1P3BA 3B0DB 1BH8A 5B2IB 5GXQB 1TZYA 1U35D 5GT0B 1KX4D 4XZQC 2G5HC 4LD9A 3UTAD 5GT3A 1N1JA 3AZKA 3EPJA 4J8WD 5E5AD 5AV8A 4R8PA 1P3PA 3AZJD 3REJB 2CV5C 2DF4C 3MGRB 4WU8D 3VH5T 5BNVA 3WKJB 3B0CT 2YFWA 3TU4C 2BYKB 4UUZA 5DNMC 3WA9C 2HIOD 1U35B 4NE5A 3LZ0B 2CV5A 1KX4B 4KGCB 4J8UD 3UTAB 4H9QB 3TU4A 5DNNB 5DNMA 2ZM5A 4KHAA 4UPKA 1KX5D 1W2EA 3AZGC 3W97C 3AZJB 5CPJB 5B32D 5C3IB 5GT0A 3RELC 4WU8B 3MNNC 5AV5B 2NZDB 3AZHD 1Z2CB 1F66C 2RVQD 3UTBB 4J8XB 2FJ7B 4H9NA 2XD5A 3AN2B 3W97A 3AZGA 4WZSB 3AZND 3W96B 4YM6D 3KUYC 3MGRA 3X1UC 3MNNA 1P3KD 1ZLAB 4H9PB 2UWXA 3WAAC 1KX3D 3A6ND 3X1SB 4YS3C 3AFAD 4KGCA 2IO5C 1TAFB 1P34C 3X1UA 4CAYB 3AZHB 5DNNA 5AVBC 3REID 3V9RB 1HQ3D 1M18D 3WAAA 1M1AB 3VH5A 1R4VA 3AN2C 5KDMA 2NQBB 1ID3C 5CPJA 4X23D 3AZNB 4Z2MH 4YS3A 1EQZD 1P34A 3W96C 4ZUXD 1ZLAC 4Z5TC 5AV5A 1P3OD 3KWQD 3AZEC 5AV6B 4J8VC 4G91C 2FJ7A 3AN2A 5B31C 3A6NB 1ID3A 5BO0B 3MGPC 3R45B 3W96A 1ZLAA 4Z5TA 5B40B 3LJAC 5GT3D 3REIB 3AZEA 3AZKD 4J8VA 5AV8D 4R8PD 4WU9C 1P3PD 2DQNC 4Z66C 5B31A 3MGPA 3VH5W 3B0CW 3LZ1B 3LJAA 3KXBC 3O62B 1P3BB 1P3OB 2PYOC 3V9RA 5B0ZB 4WU9A 1TZYB 5B31G 4Z66A 2CV5D 3AL0C 4LD9B 2NQBA 2F8NA 4AWLC 5B1LB 3X1TC 1P3GC 3FDDA 3TU4D 1KU5A 1N1JB 4H9RA 5GT3B 5DNMD 4NE6A 3KXBA 3AZKB 3AZFC 3UT9C 5CPKC 2ZY5A 1T3UA 2F8NG 4XZQB 5GT0D 5BNVB 3X1TA 3WTPE 1P3GA 3W99C 4UUZB 3X1VC 3NQUA 4DQYB 3AZFA 3UT9A 2XD1A 5CPKA 3H0LC 2CV5B 1BH9B 3MGRD 3MNND 3TU4B 5CP6C 3W99A 5DNMB 4KHAB 3O62A 3B6FC 3WA9B 3C1CC 4H9OB 2AROC 5B0ZA 5B33C 5CPIC 3LZ0D 3C1BC 4KGCD 1ULYA 2Y2HA 3AV2C 2F2AC 5B1LA 3MVDC 5CP6A 5DNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 C;  4H9N B;  3C1C A;  3AZG B;  3W97 B;  5B0Y C;  5B33 A;  5CPJ D;  3REL B;  3C1B A;  5CPI A;  5B1M C;  4XZQ A;  3MNN B;  1P34 D;  3WTP C;  5AV5 D;  1F66 B;  2NZD D;  1P3M C;  3AV1 A;  3UTB D;  4DRB A;  4J8X D;  2FJ7 D;  1P3F C;  5B0Y A;  3REH C;  3AN2 D;  3AZI C;  5B1M A;  3KUY B;  3X1U B;  3W96 D;  1BH9 A;  2JSS A;  3WTP A;  1ZLA D;  3W98 C;  5B24 C;  5BT1 D;  3WAA B;  3WA9 A;  4H9O A;  5KDM B;  3REH A;  3AZM C;  5B31 D;  3AZI A;  3B6G C;  4YS3 B;  4QLC C;  3MGP D;  2IO5 B;  3X1S D;  1P34 B;  1AOI C;  3W98 A;  4WV4 B;  5AVB B;  5B24 A;  1M1A D;  1ID3 B;  3B6G A;  4QLC A;  2NQB D;  2F8N D;  3REL A;  1AOI A;  4Z5T B;  2HUE C;  3AZE B;  4J8V B;  1F66 A;  4G91 B;  5AV6 D;  1B67 A;  5B31 B;  3MGP B;  5AY8 C;  3KUY A;  1P3G D;  3LJA B;  5JRG C;  5B40 D;  1P3A C;  3UT9 D;  5B2J C;  4WU9 B;  4G92 C;  5CPK D;  4Z66 B;  2F8N B;  5AY8 A;  4H9S C;  4H9R B;  3KXB B;  5JRG A;  3LZ1 D;  2PYO B;  1P3A A;  3O62 D;  4NFT A;  5AVB A;  1P3B D;  4NE3 A;  5B2J A;  4J8W C;  5E5A C;  5B0Z D;  2YFV A;  1TZY D;  1P3I C;  4AWL B;  3NQJ A;  3X1T B;  4LD9 D;  1P3G B;  3MGS C;  5B1L D;  5AV9 C;  3NQU B;  3AZF B;  3MGQ C;  3UT9 B;  5AVC C;  4J8W A;  5CPK B;  5E5A A;  2HIO C;  3C1B D;  5CPI D;  1P3I A;  4XZQ D;  3MGS A;  4J8U C;  3W99 B;  4XUJ C;  5F99 C;  5AV9 A;  3X1V B;  3MGQ A;  5AVC A;  1KX5 C;  5JA4 A;  5B0Y D;  5B1M D;  5B32 C;  5CP6 B;  4XUJ A;  5F99 A;  4E44 A;  2PYO A;  2LY8 A;  3REK C;  3B6F B;  2RVQ C;  2CWE A;  3C1C B;  3WA9 D;  2ARO B;  2BYM A;  4ZBJ C;  5B33 B;  3REH D;  3AZI D;  3C1B B;  5CPI B;  5B32 A;  4JJN C;  3AV2 B;  4YM6 C;  3MVD B;  1P3K C;  3W98 D;  3AV1 B;  3REK A;  5B0Y B;  1P3L C;  3AZG D;  1KX3 C;  3W97 D;  3B6G D;  5B32 G;  5B1M B;  4QLC D;  3AZL C;  3REL D;  4JJN A;  1AOI D;  3WTP B;  3AFA C;  4YM6 A;  1P3K A;  5BNX A;  3AYW C;  3X1V A;  1P3M B;  1F66 D;  3LEL C;  5CHL B;  1HQ3 C;  1P3F B;  3REH B;  1M18 C;  1P3L A;  1KX3 A;  3AZI B;  2L5A A;  3AZL A;  4EO5 C;  3KSY A;  1H3O A;  3AFA A;  3KUY D;  1EQZ C;  3X1U D;  3W98 B;  3AYW A;  5B24 B;  3LEL A;  3KWQ C;  3B6F A;  3WAA D;  3AZM B;  2ARO A;  3B6G B;  4Z2M G;  4QLC B;  3VH6 T;  1JFI A;  1AOI B;  4YS3 D;  3AV2 A;  5GSU C;  1S32 B;  3MVD A;  5AVB D;  3KWQ A;  5G49 A;  5B2J D;  5AV8 C;  4R8P C;  1P3P C;  5FUG A;  1ID3 D;  2HUE B;  5GSU A;  4Z5T D;  4KUD C;  3AZE D;  1P3M A;  4J8V D;  4HGA C;  1M19 B;  4CSR A;  1P3F A;  1P3I D;  1A7W A;  5AY8 B;  3MGS D;  5AV9 D;  5JRG B;  1S32 C;  3LJA D;  1P3A B;  4KUD A;  3MGQ D;  5B2J B;  5AVC D;  4WNN A;  4G92 B;  2YFV B;  4WU9 D;  3B0D C;  4Z66 D;  3AZM A;  5B2I C;  3NQJ B;  5GXQ C;  5GT0 C;  4XUJ D;  5F99 D;  1S32 A;  3KXB D;  2PYO D;  4J8W B;  5E5A B;  1M19 C;  1P3I B;  5B2I A;  5GXQ A;  3REJ C;  1WWI A;  3MGS B;  3X1T D;  2F8N H;  5AV9 B;  3MGR C;  3WKJ C;  3MGQ B;  3REK D;  3VH6 A;  5AVC B;  3AZF D;  5JA4 B;  1M19 A;  2HIO B;  1U35 C;  4JJN D;  3LZ0 C;  3REJ A;  1KX4 C;  4J8U B;  4KGC C;  4XUJ B;  5F99 B;  1HTA A;  3W99 D;  3WKJ A;  3UTA C;  3X1V D;  1BFM A;  2BYK A;  5DNN C;  4M6B A;  1KX5 B;  2BYM B;  1P3L D;  1B6W A;  5B32 B;  3AZJ C;  3AZL D;  5CPJ C;  1U35 A;  3LZ0 A;  1KX4 A;  5C3I C;  4WU8 C;  4H9S A;  5CP6 D;  3UTA A;  3AYW D;  3REK B;  5AV5 C;  3LEL D;  4H9Q A;  2NZD C;  3B6F D;  3C1C D;  3UTB C;  4ZBJ B;  2ARO D;  4J8X C;  2FJ7 C;  5B33 D;  3VH6 W;  3AZJ A;  4JJN B;  4YM6 B;  3AV2 D;  4WU8 A;  1P3K B;  3MVD D;  5BNX B;  4E45 A;  2NZD A;  3AV1 D;  5BT1 C;  3UTB A;  1P3L B;  1KX3 B;  4J8X A;  2HIO A;  3AZL B;  1H3O B;  3AFA B;  5GSU D;  3WTP D;  3X1S C;  4J8U A;  3AYW B;  3LEL B;  1P3M D;  4H9P A;  3AZH C;  1HQ3 B;  1M18 B;  1KX5 A;  1P3F D;  1M1A C;  1JFI B;  4EO5 B;  4X23 B;  2NQB C;  1EQZ B;  3X1S A;  4ZUX B;  3AZN C;  1TAF A;  4KUD D;  4CAY A;  3KWQ B;  5G49 B;  5B24 D;  3AZH A;  1BH8 B;  5AV6 C;  5FUG B;  1M1A A;  3AZM D;  2F8N K;  3A6N C;  5GSU B;  3AZN A;  1S32 D;  5B40 C;  4CSR B;  3REI C;  5AV6 A;  5AV8 B;  1WWS A;  4R8P B;  1P3P B;  5BS7 C;  5B2I D;  1F1E A;  5GXQ D;  3A6N A;  4X23 C;  5BO0 A;  2YFW B;  3R45 A;  4ZUX C;  4KUD B;  1Q9C A;  3LZ1 C;  5B40 A;  4HGA B;  1P3O C;  4WNN B;  3O62 C;  3REI A;  1P3B C;  1M19 D;  1HQ3 A;  1M18 A;  5BS7 A;  5B0Z C;  3B0B A;  1TZY C;  4DRA A;  3REJ D;  4X23 A;  5AY8 D;  4LD9 C;  1EQZ A;  5B1L C;  3WKJ D;  4ZUX A;  5JRG D;  1P3A D;  3LZ1 A;  5GT3 C;  3AZK C;  1P3O A;  1P3B A;  3B0D B;  1BH8 A;  5B2I B;  5GXQ B;  1TZY A;  1U35 D;  5GT0 B;  1KX4 D;  4XZQ C;  4LD9 A;  3UTA D;  5GT3 A;  1N1J A;  3AZK A;  4J8W D;  5E5A D;  5AV8 A;  4R8P A;  1P3P A;  3AZJ D;  3REJ B;  2CV5 C;  3MGR B;  4WU8 D;  3VH5 T;  5BNV A;  3WKJ B;  3B0C T;  2YFW A;  3TU4 C;  2BYK B;  4UUZ A;  5DNM C;  3WA9 C;  2HIO D;  1U35 B;  4NE5 A;  3LZ0 B;  2CV5 A;  1KX4 B;  4KGC B;  4J8U D;  3UTA B;  4H9Q B;  3TU4 A;  5DNN B;  5DNM A;  4KHA A;  1KX5 D;  3AZG C;  3W97 C;  3AZJ B;  5CPJ B;  5B32 D;  5C3I B;  5GT0 A;  3REL C;  4WU8 B;  3MNN C;  5AV5 B;  2NZD B;  3AZH D;  1F66 C;  2RVQ D;  3UTB B;  4J8X B;  2FJ7 B;  4H9N A;  3AN2 B;  3W97 A;  3AZG A;  4WZS B;  3AZN D;  3W96 B;  4YM6 D;  3KUY C;  3MGR A;  3X1U C;  3MNN A;  1P3K D;  1ZLA B;  4H9P B;  3WAA C;  1KX3 D;  3A6N D;  3X1S B;  4YS3 C;  3AFA D;  4KGC A;  2IO5 C;  1TAF B;  1P34 C;  3X1U A;  4CAY B;  3AZH B;  5DNN A;  5AVB C;  3REI D;  3V9R B;  1HQ3 D;  1M18 D;  3WAA A;  1M1A B;  3VH5 A;  1R4V A;  3AN2 C;  5KDM A;  2NQB B;  1ID3 C;  5CPJ A;  4X23 D;  3AZN B;  4Z2M H;  4YS3 A;  1EQZ D;  1P34 A;  3W96 C;  4ZUX D;  1ZLA C;  4Z5T C;  5AV5 A;  1P3O D;  3KWQ D;  3AZE C;  5AV6 B;  4J8V C;  4G91 C;  2FJ7 A;  3AN2 A;  5B31 C;  3A6N B;  1ID3 A;  5BO0 B;  3MGP C;  3R45 B;  3W96 A;  1ZLA A;  4Z5T A;  5B40 B;  3LJA C;  5GT3 D;  3REI B;  3AZE A;  3AZK D;  4J8V A;  5AV8 D;  4R8P D;  4WU9 C;  1P3P D;  4Z66 C;  5B31 A;  3MGP A;  3VH5 W;  3B0C W;  3LZ1 B;  3LJA A;  3KXB C;  3O62 B;  1P3B B;  1P3O B;  2PYO C;  3V9R A;  5B0Z B;  4WU9 A;  1TZY B;  5B31 G;  4Z66 A;  2CV5 D;  4LD9 B;  2NQB A;  2F8N A;  4AWL C;  5B1L B;  3X1T C;  1P3G C;  3TU4 D;  1KU5 A;  1N1J B;  4H9R A;  5GT3 B;  5DNM D;  4NE6 A;  3KXB A;  3AZK B;  3AZF C;  3UT9 C;  5CPK C;  2F8N G;  4XZQ B;  5GT0 D;  5BNV B;  3X1T A;  3WTP E;  1P3G A;  3W99 C;  4UUZ B;  3X1V C;  3NQU A;  3AZF A;  3UT9 A;  5CPK A;  2CV5 B;  1BH9 B;  3MGR D;  3MNN D;  3TU4 B;  5CP6 C;  3W99 A;  5DNM B;  4KHA B;  3O62 A;  3B6F C;  3WA9 B;  3C1C C;  4H9O B;  2ARO C;  5B0Z A;  5B33 C;  5CPI C;  3LZ0 D;  3C1B C;  4KGC D;  1ULY A;  3AV2 C;  5B1L A;  3MVD C;  5CP6 A;  5DNN D; 
#chains in the Genus database with same CATH topology
 3AV1 C;  2Y2J A;  4H9N B;  3C1C A;  3AZG B;  3W97 B;  5B0Y C;  5B33 A;  3KFU G;  5CPJ D;  3REL B;  3C1B A;  5CPI A;  5B1M C;  4XZQ A;  3MNN B;  1P34 D;  2ZY3 A;  3WTP C;  5AV5 D;  1F66 B;  2NZD D;  1P3M C;  3AV1 A;  3UTB D;  4DRB A;  4J8X D;  2FJ7 D;  1P3F C;  5B0Y A;  3REH C;  3AN2 D;  3AZI C;  3H0R C;  5B1M A;  3KUY B;  2Y2M A;  3X1U B;  3W96 D;  1BH9 A;  2JSS A;  3WTP A;  1ZLA D;  3W98 C;  5B24 C;  5BT1 D;  3WAA B;  3WA9 A;  4H9O A;  5KDM B;  3REH A;  3AZM C;  5B31 D;  3AZI A;  3B6G C;  4YS3 B;  4QLC C;  3MGP D;  2IO5 B;  3X1S D;  1P34 B;  1AOI C;  3W98 A;  4WV4 B;  5AVB B;  5B24 A;  2Y2P A;  2Y2G A;  1M1A D;  1ID3 B;  3B6G A;  4QLC A;  2NQB D;  2F8N D;  3REL A;  1AOI A;  4Z5T B;  2HUE C;  3AZE B;  4J8V B;  1F66 A;  4G91 B;  5AV6 D;  1B67 A;  5B31 B;  3MGP B;  3H0M C;  5AY8 C;  3KUY A;  1P3G D;  3LJA B;  5JRG C;  5B40 D;  1P3A C;  3UT9 D;  5B2J C;  4WU9 B;  4G92 C;  5CPK D;  4Z66 B;  2F8N B;  5AY8 A;  4H9S C;  4H9R B;  3KXB B;  5JRG A;  3LZ1 D;  2PYO B;  1P3A A;  3O62 D;  4NFT A;  5AVB A;  1P3B D;  4NE3 A;  5B2J A;  4J8W C;  5E5A C;  5B0Z D;  2YFV A;  1TZY D;  1P3I C;  4AWL B;  3NQJ A;  3X1T B;  3P5J B;  4LD9 D;  1P3G B;  3MGS C;  5B1L D;  5AV9 C;  3NQU B;  3AZF B;  3MGQ C;  3UT9 B;  5AVC C;  4J8W A;  5CPK B;  5E5A A;  2HIO C;  3C1B D;  5CPI D;  1P3I A;  4XZQ D;  3MGS A;  4J8U C;  3W99 B;  4XUJ C;  5F99 C;  5AV9 A;  3X1V B;  3MGQ A;  5AVC A;  1KX5 C;  5JA4 A;  5B0Y D;  5B1M D;  5B32 C;  5CP6 B;  4XUJ A;  5F99 A;  4E44 A;  2Y2I A;  2Y2O A;  2PYO A;  2LY8 A;  2ZY4 A;  3REK C;  3B6F B;  2RVQ C;  2CWE A;  3A1K A;  3C1C B;  3WA9 D;  2ARO B;  2BYM A;  4ZBJ C;  5B33 B;  3REH D;  3AZI D;  3C1B B;  5CPI B;  1PZR A;  5B32 A;  4JJN C;  3AV2 B;  4YM6 C;  3MVD B;  2BG1 A;  1P3K C;  3W98 D;  2Y2L A;  3AV1 B;  3REK A;  4WJ3 C;  5B0Y B;  1P3L C;  3AZG D;  1KX3 C;  3W97 D;  3B6G D;  5B32 G;  5B1M B;  4QLC D;  3AZL C;  3REL D;  4JJN A;  1AOI D;  3WTP B;  3AFA C;  4YM6 A;  1P3K A;  5BNX A;  3AYW C;  3X1V A;  1P3M B;  1F66 D;  3LEL C;  5CHL B;  1HQ3 C;  1P3F B;  3REH B;  1M18 C;  1P3L A;  1KX3 A;  3AZI B;  2L5A A;  2JE5 A;  3AZL A;  4EO5 C;  3KSY A;  1H3O A;  3AFA A;  3KUY D;  2JCH A;  1EQZ C;  3X1U D;  3W98 B;  2Y2Q A;  3AYW A;  5B24 B;  3LEL A;  3KWQ C;  3B6F A;  3WAA D;  3AZM B;  2ARO A;  3B6G B;  2G5I C;  4Z2M G;  4QLC B;  3VH6 T;  1JFI A;  1AOI B;  4YS3 D;  3AV2 A;  5GSU C;  1S32 B;  3MVD A;  5AVB D;  3KWQ A;  5G49 A;  5B2J D;  5AV8 C;  4R8P C;  1P3P C;  5FUG A;  1ID3 D;  2HUE B;  5GSU A;  4Z5T D;  4KUD C;  3AZE D;  1P3M A;  4J8V D;  4HGA C;  1M19 B;  4CSR A;  1P3F A;  1P3I D;  1A7W A;  5AY8 B;  3MGS D;  5AV9 D;  5JRG B;  1S32 C;  3LJA D;  3A1I A;  1P3A B;  4KUD A;  3MGQ D;  5B2J B;  5AVC D;  4WNN A;  4G92 B;  2YFV B;  4WU9 D;  3B0D C;  4Z66 D;  3AZM A;  5B2I C;  3NQJ B;  2FFF B;  5GXQ C;  5GT0 C;  4XUJ D;  5F99 D;  1S32 A;  3KXB D;  2PYO D;  4J8W B;  5E5A B;  1M19 C;  3EG5 B;  1P3I B;  5B2I A;  5GXQ A;  3REJ C;  1WWI A;  3IP4 C;  3MGS B;  3X1T D;  2F8N H;  5AV9 B;  3MGR C;  3WKJ C;  3MGQ B;  3REK D;  3VH6 A;  5AVC B;  3AZF D;  5JA4 B;  2VQR A;  1M19 A;  3F6T A;  2HIO B;  3EPK A;  1U35 C;  4JJN D;  3LZ0 C;  3REJ A;  1KX4 C;  4J8U B;  4KGC C;  4XUJ B;  5F99 B;  1HTA A;  3W99 D;  3WKJ A;  2ZY2 A;  3UTA C;  3X1V D;  1BFM A;  2BYK A;  5DNN C;  3EPH A;  4M6B A;  1KX5 B;  2BYM B;  1P3L D;  1B6W A;  5B32 B;  3AZJ C;  3AZL D;  5CPJ C;  1U35 A;  3LZ0 A;  1KX4 A;  5C3I C;  4WU8 C;  4H9S A;  5CP6 D;  3UTA A;  3AYW D;  3REK B;  5AV5 C;  3LEL D;  4H9Q A;  2NZD C;  3B6F D;  3C1C D;  3UTB C;  4ZBJ B;  2ARO D;  4J8X C;  2FJ7 C;  5B33 D;  3VH6 W;  3AZJ A;  4JJN B;  4YM6 B;  3AV2 D;  4WU8 A;  1P3K B;  3MVD D;  5BNX B;  4E45 A;  2W8S A;  2NZD A;  3AV1 D;  5BT1 C;  3UTB A;  1P3L B;  1KX3 B;  4J8X A;  2HIO A;  2J8P A;  3AZL B;  1H3O B;  3AFA B;  5GSU D;  3WTP D;  3X1S C;  4J8U A;  3AYW B;  3LEL B;  1P3M D;  4H9P A;  3AZH C;  1HQ3 B;  1M18 B;  1KX5 A;  1P3F D;  1M1A C;  1JFI B;  4EO5 B;  4X23 B;  2NQB C;  1EQZ B;  3X1S A;  4ZUX B;  3AZN C;  1TAF A;  4KUD D;  4CAY A;  3KWQ B;  5G49 B;  5B24 D;  3AZH A;  1BH8 B;  5AV6 C;  5FUG B;  1M1A A;  3AZM D;  2F8N K;  3A6N C;  5GSU B;  3AZN A;  1S32 D;  5B40 C;  4CSR B;  3REI C;  5AV6 A;  5AV8 B;  1WWS A;  4R8P B;  1P3P B;  5BS7 C;  5B2I D;  1F1E A;  5GXQ D;  2RIQ A;  3A6N A;  4X23 C;  3EPL A;  5BO0 A;  2YFW B;  3R45 A;  4ZUX C;  4KUD B;  1Q9C A;  3LZ1 C;  5B40 A;  4HGA B;  1P3O C;  4WNN B;  3O62 C;  2Y2N A;  3REI A;  1P3B C;  2Y2K A;  1HQ3 A;  1M19 D;  1M18 A;  5BS7 A;  5B0Z C;  3B0B A;  1TZY C;  4DRA A;  3REJ D;  4X23 A;  5AY8 D;  4LD9 C;  1EQZ A;  5B1L C;  3WKJ D;  4ZUX A;  5JRG D;  1P3A D;  3LZ1 A;  5GT3 C;  3AZK C;  1P3O A;  1P3B A;  3B0D B;  1BH8 A;  5B2I B;  5GXQ B;  1TZY A;  1U35 D;  5GT0 B;  1KX4 D;  4XZQ C;  2G5H C;  4LD9 A;  3UTA D;  5GT3 A;  1N1J A;  3AZK A;  3EPJ A;  4J8W D;  5E5A D;  5AV8 A;  4R8P A;  1P3P A;  3AZJ D;  3REJ B;  2CV5 C;  2DF4 C;  3MGR B;  4WU8 D;  3VH5 T;  5BNV A;  3WKJ B;  3B0C T;  2YFW A;  3TU4 C;  2BYK B;  4UUZ A;  5DNM C;  3WA9 C;  2HIO D;  1U35 B;  4NE5 A;  3LZ0 B;  2CV5 A;  1KX4 B;  4KGC B;  4J8U D;  3UTA B;  4H9Q B;  3TU4 A;  5DNN B;  5DNM A;  2ZM5 A;  4KHA A;  4UPK A;  1KX5 D;  1W2E A;  3AZG C;  3W97 C;  3AZJ B;  5CPJ B;  5B32 D;  5C3I B;  5GT0 A;  3REL C;  4WU8 B;  3MNN C;  5AV5 B;  2NZD B;  3AZH D;  1Z2C B;  1F66 C;  2RVQ D;  3UTB B;  4J8X B;  2FJ7 B;  4H9N A;  2XD5 A;  3AN2 B;  3W97 A;  3AZG A;  4WZS B;  3AZN D;  3W96 B;  4YM6 D;  3KUY C;  3MGR A;  3X1U C;  3MNN A;  1P3K D;  1ZLA B;  4H9P B;  2UWX A;  3WAA C;  1KX3 D;  3A6N D;  3X1S B;  4YS3 C;  3AFA D;  4KGC A;  2IO5 C;  1TAF B;  1P34 C;  3X1U A;  4CAY B;  3AZH B;  5DNN A;  5AVB C;  3REI D;  3V9R B;  1HQ3 D;  1M18 D;  3WAA A;  1M1A B;  3VH5 A;  1R4V A;  3AN2 C;  5KDM A;  2NQB B;  1ID3 C;  5CPJ A;  4X23 D;  3AZN B;  4Z2M H;  4YS3 A;  1EQZ D;  1P34 A;  3W96 C;  4ZUX D;  1ZLA C;  4Z5T C;  5AV5 A;  1P3O D;  3KWQ D;  3AZE C;  5AV6 B;  4J8V C;  4G91 C;  2FJ7 A;  3AN2 A;  5B31 C;  3A6N B;  1ID3 A;  5BO0 B;  3MGP C;  3R45 B;  3W96 A;  1ZLA A;  4Z5T A;  5B40 B;  3LJA C;  5GT3 D;  3REI B;  3AZE A;  3AZK D;  4J8V A;  5AV8 D;  4R8P D;  4WU9 C;  1P3P D;  2DQN C;  4Z66 C;  5B31 A;  3MGP A;  3VH5 W;  3B0C W;  3LZ1 B;  3LJA A;  3KXB C;  3O62 B;  1P3B B;  1P3O B;  2PYO C;  3V9R A;  5B0Z B;  4WU9 A;  1TZY B;  5B31 G;  4Z66 A;  2CV5 D;  3AL0 C;  4LD9 B;  2NQB A;  2F8N A;  4AWL C;  5B1L B;  3X1T C;  1P3G C;  3FDD A;  3TU4 D;  1KU5 A;  1N1J B;  4H9R A;  5GT3 B;  5DNM D;  4NE6 A;  3KXB A;  3AZK B;  3AZF C;  3UT9 C;  5CPK C;  2ZY5 A;  1T3U A;  2F8N G;  4XZQ B;  5GT0 D;  5BNV B;  3X1T A;  3WTP E;  1P3G A;  3W99 C;  4UUZ B;  3X1V C;  3NQU A;  4DQY B;  3AZF A;  3UT9 A;  2XD1 A;  5CPK A;  3H0L C;  2CV5 B;  1BH9 B;  3MGR D;  3MNN D;  3TU4 B;  5CP6 C;  3W99 A;  5DNM B;  4KHA B;  3O62 A;  3B6F C;  3WA9 B;  3C1C C;  4H9O B;  2ARO C;  5B0Z A;  5B33 C;  5CPI C;  3LZ0 D;  3C1B C;  4KGC D;  1ULY A;  2Y2H A;  3AV2 C;  2F2A C;  5B1L A;  3MVD C;  5CP6 A;  5DNN D; 
#chains in the Genus database with same CATH homology
 3AV1 C;  2Y2J A;  4H9N B;  3C1C A;  3AZG B;  3W97 B;  5B0Y C;  5B33 A;  3KFU G;  5CPJ D;  3REL B;  3C1B A;  5CPI A;  5B1M C;  4XZQ A;  3MNN B;  1P34 D;  2ZY3 A;  3WTP C;  5AV5 D;  1F66 B;  2NZD D;  1P3M C;  3AV1 A;  3UTB D;  4DRB A;  4J8X D;  2FJ7 D;  1P3F C;  5B0Y A;  3REH C;  3AN2 D;  3AZI C;  3H0R C;  5B1M A;  3KUY B;  2Y2M A;  3X1U B;  3W96 D;  1BH9 A;  2JSS A;  3WTP A;  1ZLA D;  3W98 C;  5B24 C;  5BT1 D;  3WAA B;  3WA9 A;  4H9O A;  5KDM B;  3REH A;  3AZM C;  5B31 D;  3AZI A;  3B6G C;  4YS3 B;  4QLC C;  3MGP D;  2IO5 B;  3X1S D;  1P34 B;  1AOI C;  3W98 A;  4WV4 B;  5AVB B;  5B24 A;  2Y2P A;  2Y2G A;  1M1A D;  1ID3 B;  3B6G A;  4QLC A;  2NQB D;  2F8N D;  3REL A;  1AOI A;  4Z5T B;  2HUE C;  3AZE B;  4J8V B;  1F66 A;  4G91 B;  5AV6 D;  1B67 A;  5B31 B;  3MGP B;  3H0M C;  5AY8 C;  3KUY A;  1P3G D;  3LJA B;  5JRG C;  5B40 D;  1P3A C;  3UT9 D;  5B2J C;  4WU9 B;  4G92 C;  5CPK D;  4Z66 B;  2F8N B;  5AY8 A;  4H9S C;  4H9R B;  3KXB B;  5JRG A;  3LZ1 D;  2PYO B;  1P3A A;  3O62 D;  4NFT A;  5AVB A;  1P3B D;  4NE3 A;  5B2J A;  4J8W C;  5E5A C;  5B0Z D;  2YFV A;  1TZY D;  1P3I C;  4AWL B;  3NQJ A;  3X1T B;  3P5J B;  4LD9 D;  1P3G B;  3MGS C;  5B1L D;  5AV9 C;  3NQU B;  3AZF B;  3MGQ C;  3UT9 B;  5AVC C;  4J8W A;  5CPK B;  5E5A A;  2HIO C;  3C1B D;  5CPI D;  1P3I A;  4XZQ D;  3MGS A;  4J8U C;  3W99 B;  4XUJ C;  5F99 C;  5AV9 A;  3X1V B;  3MGQ A;  5AVC A;  1KX5 C;  5JA4 A;  5B0Y D;  5B1M D;  5B32 C;  5CP6 B;  4XUJ A;  5F99 A;  4E44 A;  2Y2I A;  2Y2O A;  2PYO A;  2LY8 A;  2ZY4 A;  3REK C;  3B6F B;  2RVQ C;  2CWE A;  3A1K A;  3C1C B;  3WA9 D;  2ARO B;  2BYM A;  4ZBJ C;  5B33 B;  3REH D;  3AZI D;  3C1B B;  5CPI B;  1PZR A;  5B32 A;  4JJN C;  3AV2 B;  4YM6 C;  3MVD B;  2BG1 A;  1P3K C;  3W98 D;  2Y2L A;  3AV1 B;  3REK A;  4WJ3 C;  5B0Y B;  1P3L C;  3AZG D;  1KX3 C;  3W97 D;  3B6G D;  5B32 G;  5B1M B;  4QLC D;  3AZL C;  3REL D;  4JJN A;  1AOI D;  3WTP B;  3AFA C;  4YM6 A;  1P3K A;  5BNX A;  3AYW C;  3X1V A;  1P3M B;  1F66 D;  3LEL C;  5CHL B;  1HQ3 C;  1P3F B;  3REH B;  1M18 C;  1P3L A;  1KX3 A;  3AZI B;  2L5A A;  2JE5 A;  3AZL A;  4EO5 C;  3KSY A;  1H3O A;  3AFA A;  3KUY D;  2JCH A;  1EQZ C;  3X1U D;  3W98 B;  2Y2Q A;  3AYW A;  5B24 B;  3LEL A;  3KWQ C;  3B6F A;  3WAA D;  3AZM B;  2ARO A;  3B6G B;  2G5I C;  4Z2M G;  4QLC B;  3VH6 T;  1JFI A;  1AOI B;  4YS3 D;  3AV2 A;  5GSU C;  1S32 B;  3MVD A;  5AVB D;  3KWQ A;  5G49 A;  5B2J D;  5AV8 C;  4R8P C;  1P3P C;  5FUG A;  1ID3 D;  2HUE B;  5GSU A;  4Z5T D;  4KUD C;  3AZE D;  1P3M A;  4J8V D;  4HGA C;  1M19 B;  4CSR A;  1P3F A;  1P3I D;  1A7W A;  5AY8 B;  3MGS D;  5AV9 D;  5JRG B;  1S32 C;  3LJA D;  3A1I A;  1P3A B;  4KUD A;  3MGQ D;  5B2J B;  5AVC D;  4WNN A;  4G92 B;  2YFV B;  4WU9 D;  3B0D C;  4Z66 D;  3AZM A;  5B2I C;  3NQJ B;  2FFF B;  5GXQ C;  5GT0 C;  4XUJ D;  5F99 D;  1S32 A;  3KXB D;  2PYO D;  4J8W B;  5E5A B;  1M19 C;  3EG5 B;  1P3I B;  5B2I A;  5GXQ A;  3REJ C;  1WWI A;  3IP4 C;  3MGS B;  3X1T D;  2F8N H;  5AV9 B;  3MGR C;  3WKJ C;  3MGQ B;  3REK D;  3VH6 A;  5AVC B;  3AZF D;  5JA4 B;  2VQR A;  1M19 A;  3F6T A;  2HIO B;  3EPK A;  1U35 C;  4JJN D;  3LZ0 C;  3REJ A;  1KX4 C;  4J8U B;  4KGC C;  4XUJ B;  5F99 B;  1HTA A;  3W99 D;  3WKJ A;  2ZY2 A;  3UTA C;  3X1V D;  1BFM A;  2BYK A;  5DNN C;  3EPH A;  4M6B A;  1KX5 B;  2BYM B;  1P3L D;  1B6W A;  5B32 B;  3AZJ C;  3AZL D;  5CPJ C;  1U35 A;  3LZ0 A;  1KX4 A;  5C3I C;  4WU8 C;  4H9S A;  5CP6 D;  3UTA A;  3AYW D;  3REK B;  5AV5 C;  3LEL D;  4H9Q A;  2NZD C;  3B6F D;  3C1C D;  3UTB C;  4ZBJ B;  2ARO D;  4J8X C;  2FJ7 C;  5B33 D;  3VH6 W;  3AZJ A;  4JJN B;  4YM6 B;  3AV2 D;  4WU8 A;  1P3K B;  3MVD D;  5BNX B;  4E45 A;  2W8S A;  2NZD A;  3AV1 D;  5BT1 C;  3UTB A;  1P3L B;  1KX3 B;  4J8X A;  2HIO A;  2J8P A;  3AZL B;  1H3O B;  3AFA B;  5GSU D;  3WTP D;  3X1S C;  4J8U A;  3AYW B;  3LEL B;  1P3M D;  4H9P A;  3AZH C;  1HQ3 B;  1M18 B;  1KX5 A;  1P3F D;  1M1A C;  1JFI B;  4EO5 B;  4X23 B;  2NQB C;  1EQZ B;  3X1S A;  4ZUX B;  3AZN C;  1TAF A;  4KUD D;  4CAY A;  3KWQ B;  5G49 B;  5B24 D;  3AZH A;  1BH8 B;  5AV6 C;  5FUG B;  1M1A A;  3AZM D;  2F8N K;  3A6N C;  5GSU B;  3AZN A;  1S32 D;  5B40 C;  4CSR B;  3REI C;  5AV6 A;  5AV8 B;  1WWS A;  4R8P B;  1P3P B;  5BS7 C;  5B2I D;  1F1E A;  5GXQ D;  2RIQ A;  3A6N A;  4X23 C;  3EPL A;  5BO0 A;  2YFW B;  3R45 A;  4ZUX C;  4KUD B;  1Q9C A;  3LZ1 C;  5B40 A;  4HGA B;  1P3O C;  4WNN B;  3O62 C;  2Y2N A;  3REI A;  1P3B C;  2Y2K A;  1HQ3 A;  1M19 D;  1M18 A;  5BS7 A;  5B0Z C;  3B0B A;  1TZY C;  4DRA A;  3REJ D;  4X23 A;  5AY8 D;  4LD9 C;  1EQZ A;  5B1L C;  3WKJ D;  4ZUX A;  5JRG D;  1P3A D;  3LZ1 A;  5GT3 C;  3AZK C;  1P3O A;  1P3B A;  3B0D B;  1BH8 A;  5B2I B;  5GXQ B;  1TZY A;  1U35 D;  5GT0 B;  1KX4 D;  4XZQ C;  2G5H C;  4LD9 A;  3UTA D;  5GT3 A;  1N1J A;  3AZK A;  3EPJ A;  4J8W D;  5E5A D;  5AV8 A;  4R8P A;  1P3P A;  3AZJ D;  3REJ B;  2CV5 C;  2DF4 C;  3MGR B;  4WU8 D;  3VH5 T;  5BNV A;  3WKJ B;  3B0C T;  2YFW A;  3TU4 C;  2BYK B;  4UUZ A;  5DNM C;  3WA9 C;  2HIO D;  1U35 B;  4NE5 A;  3LZ0 B;  2CV5 A;  1KX4 B;  4KGC B;  4J8U D;  3UTA B;  4H9Q B;  3TU4 A;  5DNN B;  5DNM A;  2ZM5 A;  4KHA A;  4UPK A;  1KX5 D;  1W2E A;  3AZG C;  3W97 C;  3AZJ B;  5CPJ B;  5B32 D;  5C3I B;  5GT0 A;  3REL C;  4WU8 B;  3MNN C;  5AV5 B;  2NZD B;  3AZH D;  1Z2C B;  1F66 C;  2RVQ D;  3UTB B;  4J8X B;  2FJ7 B;  4H9N A;  2XD5 A;  3AN2 B;  3W97 A;  3AZG A;  4WZS B;  3AZN D;  3W96 B;  4YM6 D;  3KUY C;  3MGR A;  3X1U C;  3MNN A;  1P3K D;  1ZLA B;  4H9P B;  2UWX A;  3WAA C;  1KX3 D;  3A6N D;  3X1S B;  4YS3 C;  3AFA D;  4KGC A;  2IO5 C;  1TAF B;  1P34 C;  3X1U A;  4CAY B;  3AZH B;  5DNN A;  5AVB C;  3REI D;  3V9R B;  1HQ3 D;  1M18 D;  3WAA A;  1M1A B;  3VH5 A;  1R4V A;  3AN2 C;  5KDM A;  2NQB B;  1ID3 C;  5CPJ A;  4X23 D;  3AZN B;  4Z2M H;  4YS3 A;  1EQZ D;  1P34 A;  3W96 C;  4ZUX D;  1ZLA C;  4Z5T C;  5AV5 A;  1P3O D;  3KWQ D;  3AZE C;  5AV6 B;  4J8V C;  4G91 C;  2FJ7 A;  3AN2 A;  5B31 C;  3A6N B;  1ID3 A;  5BO0 B;  3MGP C;  3R45 B;  3W96 A;  1ZLA A;  4Z5T A;  5B40 B;  3LJA C;  5GT3 D;  3REI B;  3AZE A;  3AZK D;  4J8V A;  5AV8 D;  4R8P D;  4WU9 C;  1P3P D;  2DQN C;  4Z66 C;  5B31 A;  3MGP A;  3VH5 W;  3B0C W;  3LZ1 B;  3LJA A;  3KXB C;  3O62 B;  1P3B B;  1P3O B;  2PYO C;  3V9R A;  5B0Z B;  4WU9 A;  1TZY B;  5B31 G;  4Z66 A;  2CV5 D;  3AL0 C;  4LD9 B;  2NQB A;  2F8N A;  4AWL C;  5B1L B;  3X1T C;  1P3G C;  3FDD A;  3TU4 D;  1KU5 A;  1N1J B;  4H9R A;  5GT3 B;  5DNM D;  4NE6 A;  3KXB A;  3AZK B;  3AZF C;  3UT9 C;  5CPK C;  2ZY5 A;  1T3U A;  2F8N G;  4XZQ B;  5GT0 D;  5BNV B;  3X1T A;  3WTP E;  1P3G A;  3W99 C;  4UUZ B;  3X1V C;  3NQU A;  4DQY B;  3AZF A;  3UT9 A;  2XD1 A;  5CPK A;  3H0L C;  2CV5 B;  1BH9 B;  3MGR D;  3MNN D;  3TU4 B;  5CP6 C;  3W99 A;  5DNM B;  4KHA B;  3O62 A;  3B6F C;  3WA9 B;  3C1C C;  4H9O B;  2ARO C;  5B0Z A;  5B33 C;  5CPI C;  3LZ0 D;  3C1B C;  4KGC D;  1ULY A;  2Y2H A;  3AV2 C;  2F2A C;  5B1L A;  3MVD C;  5CP6 A;  5DNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...