4XUJD

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujD00
4X23D 3AYWB 3LZ0B 3LZ0C 3REHA 5B0ZD 3O62B 3KWQA 3O62C 2BYKA 5GT3D 3MVDB 4R8PB 5F99C 3MVDC 1ZLAD 4R8PC 3AZND 4QLCD 1S32D 1P3PD 3REJB 1P3GD 3REJC 5GXQD 5AV9B 4H9QA 4Z5TC 2AROA 4H9PA 5C3IB 1F1EA 4EO5C 3LZ0D 3MGPB 3AZLA 3O62D 3MGPC 3AZKC 3C1CB 5F99D 3MVDD 3C1CC 4R8PD 3LJAA 1KX5A 4WU8B 4WU8C 1P3OC 4NFTA 3KUYA 1BH9B 3REJD 4ZUXB 3B6GA 2FJ7C 5B33B 5JA4B 1HQ3B 5BS7C 2YFVA 3MGSA 3MGPD 3AZEC 3AZKD 3AZJB 3C1CD 3AZJC 3REKC 3VH5A 4M6BA 1AOIB 4WU8D 4H9SA 1P3LB 3RELA 1P3LC 4CAYA 4CSRA 2FJ7D 5B0YC 3C1BB 1H3OA 5KDMA 1P3MC 3AZED 1HQ3D 5AV8A 2YFWA 5BNXA 4XUJA 5B2IA 3AZJD 4YM6A 3VH6W 3MGRA 3X1SB 3REKD 3KXBB 1P3BA 3X1SC 3WKJB 3WTPE 3KXBC 3X1TA 1P3LD 5AVCB 3TU4A 4WU9A 4WV4B 5JRGA 2NQBC 3W96B 3W96C 3B0BA 1P3MD 3MGQB 3MGQC 3AZGC 1P3AA 1EQZA 1N1JA 3X1SD 3KXBD 3WA9A 3AV2A 3UTBC 1M19A 4JJNB 3AZHC 3W98B 4JJNC 1P34A 3W98C 3W99C 5DNMA 2HUEB 2HUEC 4H9RA 2NQBD 3X1UB 1F66A 1P3FA 3X1UC 3W96D 5AV6A 1ULYA 4J8UB 4J8UC 5CPJA 5E5AC 3MGQD 1B67A 3AZGD 5CPIB 5CPIC 5B31G 3UTAB 2IO5C 4WZSB 3UTBD 4JJND 3W98D 1P3IA 1KX3A 5AVBA 1Q9CA 3AZFA 4HGAC 3X1UD 1U35A 2JSSA 4J8XA 4J8UD 3B0DC 5E5AD 3A6NB 5AV5B 5CPID 5AV5C 2F8NH 4YS3A 4KUDB 4KUDC 5FUGB 2RVQC 3UT9A 3AFAA 5CP6A 3AN2A 3WTPA 5AY8A 5B2JC 5B31A 5BO0A 4KGCA 4J8WB 5B1MC 4QLCB 5AV5D 1KX4A 3AZIB 4Z2MH 1TZYA 3AZIC 4KUDD 2RVQD 4J8VB 4LD9A 4J8VC 3AV1B 3AV1C 1ZLAA 5G49A 5GSUA 5B24C 3WAAA 4NE6A 5F99B 3R45B 3VH5T 4J8WD 5B32G 3AZMC 3X1VA 1P3GA 5GXQA 2NZDA 3AYWA 3AZID 2L5AA 3REHC 4J8VD 3KWQB 4Z5TB 3V9RA 3KWQC 1TAFA 2BYKB 3AV1D 4EO5B 1ID3A 5B24D 3AZKB 3AZMD 3MNNA 4H9QB 5AV9A 1P3KA 5BNVA 1P3OB 2AROB 2AROC 3REHD 3AZLB 2FJ7B 3KWQD 4Z5TD 3AZLC 2CV5A 1KU5A 5B32A 3LJAB 4XZQA 3LJAC 1KX5C 3AZEB 3LZ1A 3KUYB 3KUYC 1BH9A 3REKB 4ZUXA 3B6GB 3B6GC 1P3OD 5B33A 5JA4A 2AROD 1HQ3A 2YFVB 3VH6A 5B0YB 3MGSB 3MGSC 3AZLD 3NQJA 3KSYA 3REIA 4NE3A 3LJAD 1P3MB 1AOIA 4H9SC 3RELC 3KUYD 4CAYB 4ZBJB 4CSRB 4ZBJC 5DNNB 5B40A 3B6GD 5DNNC 1H3OB 4Z66A 3C1BA 3W97A 2HIOA 1BH8A 2NQBB 2YFWB 3MGSD 5AV8C 5B0YD 3B6FA 4XUJC 4H9NB 5B2IC 3MGRB 4YM6C 3MGRC 5GT0A 1JFIA 3X1TB 1P3BC 3WKJA 1WWSA 3X1TC 3AZGB 3RELD 3VH5W 2BYMB 5AVCA 4WU9B 3TU4C 4WU9C 1M18A 5JRGB 4AWLB 3UTBB 5JRGC 4AWLC 5DNND 3AZHB 3W96A 3LELA 4H9OA 3W99B 2F8NG 1P3AC 5CPKA 1EQZB 2PYOA 1EQZC 4YM6D 3MGRD 3WA9B 3AV2B 5E5AB 3X1TD 3AV2C 3WA9C 1M19C 3W98A 1P34C 3TU4D 4WU9D 5DNMC 1BFMA 2IO5B 5JRGD 1F66B 3X1UA 1F66C 3AZHD 1P3FC 4KHAB 5AV6C 3W99D 4HGAB 5CPJC 1P3AD 1M1AA 4Z2MG 1EQZD 3UTAA 3B0DB 3WA9D 3AV2D 4WNNA 1P34D 5B1LA 1KX3B 4E44A 1P3IC 3AZFB 5AVBC 1KX3C 3AZFC 2F8NA 1F66D 1U35C 4NE5A 4J8XC 1WWIA 5CPJD 5B2JB 3A6NA 4YS3C 5B1MB 5FUGA 4X23A 3UT9C 3AFAC 1P3ID 5CP6C 3NQUA 5AVBD 1KX3D 3WTPB 3AZFD 3AN2C 3WTPC 5AY8C 5B0ZA 5B31C 4KGCB 4KGCC 5GT3A 4G91B 4J8WA 4UUZB 4G91C 5B2JD 5B24B 4QLCA 3AZNA 1S32A 1P3PA 1KX4B 1KX4C 4YS3D 4G92C 1TZYB 5B1MD 1TZYC 3AZMB 4LD9B 4LD9C 3UT9D 1ZLAC 5G49B 3LZ0A 3REHB 5GSUB 3WTPD 3AN2D 5GSUC 3WAAB 3WAAC 3O62A 5B31D 4KGCD 2NZDB 5F99A 3MVDA 3X1VB 4R8PA 3X1VC 2NZDC 1P3GC 5GXQC 1KX4D 3AYWC 1TZYD 3REJA 4LD9D 3V9RB 4Z5TA 1TAFB 4H9PB 1ID3B 1ID3C 5GSUD 3WAAD 3MGPA 3AZKA 3C1CA 2NZDD 3X1VD 3MNNB 1KX5B 1A7WA 3MNNC 1P3KB 5BNVB 5AV9C 1P3KC 4WU8A 1P3OA 3AYWD 3AZMA 5C3IC 2FJ7A 2CV5B 2CV5C 1HTAA 5B32B 4XZQB 5B32C 1ID3D 3B0CT 4XZQC 5BS7A 3AZEA 3LZ1B 2CWEA 2F8NK 3LZ1C 3AZJA 3MNND 3REKA 1KX5D 5AV9D 1P3KD 4ZUXC 3RELB 5B33C 1P3LA 1HQ3C 5B0YA 2CV5D 3NQJB 4DRBA 3REIB 3REIC 5CHLB 5KDMB 5B32D 4XZQD 1P3MA 5AV8B 1AOIC 3LZ1D 5BNXB 4XUJB 5B2IB 4YM6B 3X1SA 1P3BB 3KXBA 4ZUXD 5B40B 5DNNA 5B40C 5B33D 4Z66B 3W97B 4Z66C 3C1BC 3TU4B 3W97C 2HIOB 1BH8B 2LY8A 2HIOC 2NQBA 5BT1C 3B6FB 3REID 3B6FC 4H9NA 5GT0B 1JFIB 5GT0C 3WKJC 3MGQA 1AOID 3AZGA 5AV8D 1P3AB 4XUJD 2BYMA 5B2ID 5AVCC 1M18B 1N1JB 1M18C 1P3BD 3UTBA 5B40D 1M19B 3AZHA 3LELB 4JJNA 4H9OB 3LELC 4Z66D 3C1BD 1P34B 3W97D 5DNMB 3W99A 2HIOD 4H9RB 5BT1D 1P3FB 5CPKB 2PYOB 3B6FD 5CPKC 2PYOC 5AV6B 4J8UA 5GT0D 5CPJB 5E5AA 3WKJD 5CPIA 5AVCD 1M18D 1M19D 3LELD 4KHAA 1P3IB 5DNMD 5AVBB 1M1AB 1U35B 1P3FD 1M1AC 1B6WA 5CPKD 2PYOD 4J8XB 3B0CW 5AV6D 3UTAC 4WNNB 5AV5A 4YS3B 5B1LB 5B1LC 4KUDA 2F8NB 3UT9B 3AFAB 5CP6B 3AN2B 5AY8B 5B2JA 3A6NC 1M1AD 5B31B 1U35D 5BO0B 3UTAD 4E45A 5B1MA 4J8XD 4X23B 4X23C 4DRAA 4G92B 3AZIA 5B1LD 3NQUB 2F8ND 5B0ZB 4J8VA 5B0ZC 1R4VA 5GT3B 3AFAD 3AV1A 1ZLAB 5GT3C 5CP6D 4J8WC 4UUZA 3VH6T 3AZNB 5AY8D 3A6ND 5B24A 3AZNC 4QLCC 1S32B 1S32C 1P3PB 1P3PC 3R45A 1P3GB 5GXQB
chains in the Genus database with same CATH superfamily
4X23D 3AYWB 3LZ0B 3LZ0C 3REHA 5B0ZD 3O62B 3KWQA 3O62C 2BYKA 5GT3D 3MVDB 4R8PB 5F99C 2DQNC 3MVDC 4R8PC 4DQYB 1ZLAD 3AZND 4QLCD 1S32D 1P3PD 3REJB 1P3GD 3REJC 5GXQD 5AV9B 4H9QA 4Z5TC 2AROA 4H9PA 5C3IB 1F1EA 4EO5C 3LZ0D 3MGPB 3AZLA 3O62D 3MGPC 3AZKC 3C1CB 5F99D 3MVDD 3C1CC 4R8PD 3LJAA 1KX5A 4WU8B 4WU8C 1P3OC 4NFTA 3KUYA 3R45A 1BH9B 3REJD 4ZUXB 3B6GA 2FJ7C 5B33B 5JA4B 1HQ3B 5BS7C 2YFVA 3MGSA 3MGPD 3AZEC 3AZKD 3AZJB 3C1CD 3AZJC 3H0MC 3REKC 3VH5A 4M6BA 1AOIB 4WU8D 4H9SA 1P3LB 3RELA 1P3LC 4CAYA 4CSRA 2FJ7D 5B0YC 3C1BB 1H3OA 5KDMA 1P3MC 3AZED 1HQ3D 5AV8A 2YFWA 5BNXA 4XUJA 5B2IA 3AZJD 4YM6A 3VH6W 3MGRA 3X1SB 3REKD 3KXBB 1P3BA 3X1SC 3WKJB 3WTPE 3KXBC 3X1TA 1P3LD 5AVCB 3TU4A 4WU9A 4WV4B 5JRGA 2NQBC 3W96B 3W96C 3B0BA 1P3MD 3MGQB 3MGQC 3AZGC 1P3AA 1EQZA 1N1JA 3X1SD 3KXBD 3WA9A 3AV2A 3UTBC 1M19A 4JJNB 3AZHC 3W98B 4JJNC 1P34A 3W98C 5DNMA 3W99C 2HUEB 2HUEC 4H9RA 2NQBD 3X1UB 1F66A 1P3FA 3X1UC 3W96D 3EPJA 5AV6A 1ULYA 4J8UB 4J8UC 5CPJA 5E5AC 3MGQD 1B67A 3AZGD 5CPIB 5CPIC 5B31G 3UTAB 2IO5C 4WZSB 3UTBD 4JJND 3W98D 1P3IA 1KX3A 5AVBA 1Q9CA 3AZFA 2VQRA 4HGAC 3X1UD 1U35A 2JSSA 1W2EA 4J8XA 4J8UD 3B0DC 5E5AD 3A6NB 5AV5B 2ZM5A 5CPID 5AV5C 2F8NH 4YS3A 3EPLA 4KUDB 4KUDC 5FUGB 2RVQC 3EPKA 3EPHA 3UT9A 3AFAA 5CP6A 2W8SA 3AN2A 3WTPA 5AY8A 2BG1A 5B2JC 2ZY2A 5B31A 5BO0A 4KGCA 2Y2PA 3A1KA 4J8WB 5B1MC 4QLCB 5AV5D 1KX4A 3AZIB 4Z2MH 1TZYA 3AZIC 4KUDD 2RVQD 4J8VB 4LD9A 4J8VC 3H0RC 3AV1B 3AV1C 1ZLAA 2ZY5A 5G49A 5GSUA 5B24C 3WAAA 4NE6A 5F99B 3R45B 3VH5T 4J8WD 5B32G 3AZMC 3X1VA 1P3GA 5GXQA 3AL0C 2NZDA 3AYWA 3AZID 2L5AA 3REHC 4J8VD 3KWQB 4Z5TB 3V9RA 2J8PA 3KWQC 1TAFA 2BYKB 3AV1D 4EO5B 1ID3A 2G5IC 5B24D 3AZKB 3AZMD 2Y2LA 3MNNA 4H9QB 5AV9A 1P3KA 5BNVA 1P3OB 2AROB 2AROC 3F6TA 3REHD 3AZLB 2FJ7B 3KWQD 4Z5TD 3AZLC 2CV5A 1KU5A 5B32A 3LJAB 4XZQA 3LJAC 1KX5C 3AZEB 3LZ1A 3KUYB 3KUYC 1BH9A 3REKB 4ZUXA 3B6GB 3B6GC 1P3OD 5B33A 5JA4A 2AROD 1HQ3A 2YFVB 3VH6A 5B0YB 3MGSB 3MGSC 3AZLD 3NQJA 3KSYA 3REIA 4NE3A 3LJAD 1P3MB 1AOIA 4H9SC 3RELC 3KUYD 4CAYB 4ZBJB 4CSRB 3KFUG 4ZBJC 5DNNB 5B40A 2Y2OA 3B6GD 5DNNC 1H3OB 4Z66A 3C1BA 3W97A 3A1IA 2HIOA 1BH8A 2NQBB 2YFWB 3MGSD 2UWXA 5AV8C 5B0YD 3B6FA 4XUJC 4H9NB 5B2IC 3MGRB 4YM6C 3MGRC 5GT0A 1JFIA 3X1TB 1P3BC 3WKJA 1WWSA 3X1TC 3AZGB 3RELD 3VH5W 2BYMB 5AVCA 4WU9B 2Y2NA 3TU4C 4WU9C 1M18A 5JRGB 2Y2HA 4AWLB 3UTBB 5JRGC 4AWLC 5DNND 3AZHB 3W96A 3LELA 1Z2CB 4H9OA 3W99B 2F8NG 1P3AC 5CPKA 1EQZB 2PYOA 1EQZC 4YM6D 3MGRD 2XD5A 3WA9B 3AV2B 5E5AB 3X1TD 3AV2C 3WA9C 1M19C 3W98A 1P34C 2Y2GA 4WU9D 3TU4D 5DNMC 1BFMA 2IO5B 5JRGD 1F66B 3X1UA 1F66C 3AZHD 1P3FC 4KHAB 5AV6C 3W99D 4HGAB 5CPJC 1P3AD 1M1AA 4Z2MG 1EQZD 3UTAA 3B0DB 3WA9D 3AV2D 4WNNA 2G5HC 1P34D 5B1LA 1KX3B 4E44A 1P3IC 3AZFB 5AVBC 2XD1A 1KX3C 3AZFC 2F8NA 1F66D 1U35C 4NE5A 4J8XC 1WWIA 5CPJD 5B2JB 3A6NA 4YS3C 5B1MB 5FUGA 4X23A 3UT9C 3AFAC 1P3ID 5CP6C 3NQUA 5AVBD 1KX3D 3WTPB 3AZFD 3AN2C 3WTPC 2RIQA 5AY8C 5B0ZA 5B31C 4KGCB 4KGCC 5GT3A 4G91B 4J8WA 4UUZB 4G91C 5B2JD 5B24B 4QLCA 3AZNA 1S32A 1P3PA 1KX4B 1KX4C 4YS3D 4G92C 1TZYB 5B1MD 1TZYC 3AZMB 4LD9B 1T3UA 4LD9C 3UT9D 1ZLAC 5G49B 3LZ0A 3REHB 5GSUB 3WTPD 3AN2D 5GSUC 3WAAB 3WAAC 3O62A 5B31D 4KGCD 2NZDB 2JCHA 5F99A 3MVDA 3X1VB 4R8PA 3X1VC 2NZDC 1P3GC 5GXQC 1KX4D 3AYWC 1TZYD 3REJA 4LD9D 3P5JB 4Z5TA 3V9RB 1TAFB 4H9PB 1ID3B 2Y2KA 1ID3C 2Y2QA 5GSUD 3WAAD 3MGPA 1PZRA 3AZKA 3C1CA 2NZDD 3X1VD 3MNNB 1KX5B 1A7WA 3MNNC 3EG5B 1P3KB 5BNVB 5AV9C 1P3KC 4WU8A 1P3OA 3AYWD 3AZMA 5C3IC 2FJ7A 2CV5B 2CV5C 1HTAA 5B32B 4XZQB 5B32C 1ID3D 3B0CT 4XZQC 3FDDA 5BS7A 3AZEA 3LZ1B 2CWEA 2F8NK 3LZ1C 2ZY3A 3AZJA 3MNND 3REKA 1KX5D 5AV9D 1P3KD 4ZUXC 3RELB 5B33C 1P3LA 2Y2MA 2JE5A 1HQ3C 5B0YA 2CV5D 3NQJB 4DRBA 3REIB 3REIC 5CHLB 5KDMB 5B32D 4XZQD 1P3MA 5AV8B 1AOIC 3LZ1D 5BNXB 4XUJB 5B2IB 4YM6B 3X1SA 1P3BB 3KXBA 4ZUXD 5B40B 5DNNA 5B40C 5B33D 4Z66B 4UPKA 4Z66C 3C1BC 3TU4B 3W97B 3W97C 2HIOB 1BH8B 2LY8A 2HIOC 2NQBA 5BT1C 3B6FB 3REID 3B6FC 4H9NA 5GT0B 1JFIB 3IP4C 5GT0C 3WKJC 3MGQA 1AOID 3AZGA 5AV8D 1P3AB 4XUJD 2BYMA 5B2ID 5AVCC 1M18B 1N1JB 1M18C 1P3BD 3UTBA 5B40D 1M19B 3AZHA 3LELB 4JJNA 4H9OB 3LELC 4Z66D 3C1BD 1P34B 3W97D 5DNMB 3W99A 2HIOD 4H9RB 4WJ3C 5BT1D 1P3FB 5CPKB 2PYOB 3B6FD 5CPKC 2PYOC 5AV6B 4J8UA 5GT0D 5CPJB 5E5AA 3WKJD 5CPIA 3H0LC 5AVCD 1M18D 1M19D 3LELD 4KHAA 1P3IB 5DNMD 5AVBB 1M1AB 1U35B 1P3FD 1M1AC 1B6WA 5CPKD 2PYOD 4J8XB 3B0CW 5AV6D 3UTAC 4WNNB 2Y2JA 5AV5A 4YS3B 5B1LB 5B1LC 4KUDA 2F8NB 3UT9B 3AFAB 5CP6B 3AN2B 5AY8B 5B2JA 3A6NC 1M1AD 5B31B 1U35D 5BO0B 3UTAD 4E45A 5B1MA 4J8XD 2F2AC 2Y2IA 4X23B 4X23C 4DRAA 4G92B 3AZIA 5B1LD 3NQUB 2FFFB 2F8ND 5B0ZB 4J8VA 5B0ZC 1R4VA 5GT3B 3AFAD 3AV1A 1ZLAB 5GT3C 5CP6D 4J8WC 4UUZA 3VH6T 3AZNB 5AY8D 3A6ND 5B24A 3AZNC 4QLCC 1S32B 1S32C 1P3PB 1P3PC 2ZY4A 1P3GB 5GXQB 2DF4C
chains in the Genus database with same CATH topology
4X23D 3AYWB 3LZ0B 3LZ0C 3REHA 5B0ZD 3O62B 3KWQA 3O62C 2BYKA 5GT3D 3MVDB 4R8PB 5F99C 2DQNC 3MVDC 4R8PC 4DQYB 1ZLAD 3AZND 4QLCD 1S32D 1P3PD 3REJB 1P3GD 3REJC 5GXQD 5AV9B 4H9QA 4Z5TC 2AROA 4H9PA 5C3IB 1F1EA 4EO5C 3LZ0D 3MGPB 3AZLA 3O62D 3MGPC 3AZKC 3C1CB 5F99D 3MVDD 3C1CC 4R8PD 3LJAA 1KX5A 4WU8B 4WU8C 1P3OC 4NFTA 3KUYA 3R45A 1BH9B 3REJD 4ZUXB 3B6GA 2FJ7C 5B33B 5JA4B 1HQ3B 5BS7C 2YFVA 3MGSA 3MGPD 3AZEC 3AZKD 3AZJB 3C1CD 3AZJC 3H0MC 3REKC 3VH5A 4M6BA 1AOIB 4WU8D 4H9SA 1P3LB 3RELA 1P3LC 4CAYA 4CSRA 2FJ7D 5B0YC 3C1BB 1H3OA 5KDMA 1P3MC 3AZED 1HQ3D 5AV8A 2YFWA 5BNXA 4XUJA 5B2IA 3AZJD 4YM6A 3VH6W 3MGRA 3X1SB 3REKD 3KXBB 1P3BA 3X1SC 3WKJB 3WTPE 3KXBC 3X1TA 1P3LD 5AVCB 3TU4A 4WU9A 4WV4B 5JRGA 2NQBC 3W96B 3W96C 3B0BA 1P3MD 3MGQB 3MGQC 3AZGC 1P3AA 1EQZA 1N1JA 3X1SD 3KXBD 3WA9A 3AV2A 3UTBC 1M19A 4JJNB 3AZHC 3W98B 4JJNC 1P34A 3W98C 5DNMA 3W99C 2HUEB 2HUEC 4H9RA 2NQBD 3X1UB 1F66A 1P3FA 3X1UC 3W96D 3EPJA 5AV6A 1ULYA 4J8UB 4J8UC 5CPJA 5E5AC 3MGQD 1B67A 3AZGD 5CPIB 5CPIC 5B31G 3UTAB 2IO5C 4WZSB 3UTBD 4JJND 3W98D 1P3IA 1KX3A 5AVBA 1Q9CA 3AZFA 2VQRA 4HGAC 3X1UD 1U35A 2JSSA 1W2EA 4J8XA 4J8UD 3B0DC 5E5AD 3A6NB 5AV5B 2ZM5A 5CPID 5AV5C 2F8NH 4YS3A 3EPLA 4KUDB 4KUDC 5FUGB 2RVQC 3EPKA 3EPHA 3UT9A 3AFAA 5CP6A 2W8SA 3AN2A 3WTPA 5AY8A 2BG1A 5B2JC 2ZY2A 5B31A 5BO0A 4KGCA 2Y2PA 3A1KA 4J8WB 5B1MC 4QLCB 5AV5D 1KX4A 3AZIB 4Z2MH 1TZYA 3AZIC 4KUDD 2RVQD 4J8VB 4LD9A 4J8VC 3H0RC 3AV1B 3AV1C 1ZLAA 2ZY5A 5G49A 5GSUA 5B24C 3WAAA 4NE6A 5F99B 3R45B 3VH5T 4J8WD 5B32G 3AZMC 3X1VA 1P3GA 5GXQA 3AL0C 2NZDA 3AYWA 3AZID 2L5AA 3REHC 4J8VD 3KWQB 4Z5TB 3V9RA 2J8PA 3KWQC 1TAFA 2BYKB 3AV1D 4EO5B 1ID3A 2G5IC 5B24D 3AZKB 3AZMD 2Y2LA 3MNNA 4H9QB 5AV9A 1P3KA 5BNVA 1P3OB 2AROB 2AROC 3F6TA 3REHD 3AZLB 2FJ7B 3KWQD 4Z5TD 3AZLC 2CV5A 1KU5A 5B32A 3LJAB 4XZQA 3LJAC 1KX5C 3AZEB 3LZ1A 3KUYB 3KUYC 1BH9A 3REKB 4ZUXA 3B6GB 3B6GC 1P3OD 5B33A 5JA4A 2AROD 1HQ3A 2YFVB 3VH6A 5B0YB 3MGSB 3MGSC 3AZLD 3NQJA 3KSYA 3REIA 4NE3A 3LJAD 1P3MB 1AOIA 4H9SC 3RELC 3KUYD 4CAYB 4ZBJB 4CSRB 3KFUG 4ZBJC 5DNNB 5B40A 2Y2OA 3B6GD 5DNNC 1H3OB 4Z66A 3C1BA 3W97A 3A1IA 2HIOA 1BH8A 2NQBB 2YFWB 3MGSD 2UWXA 5AV8C 5B0YD 3B6FA 4XUJC 4H9NB 5B2IC 3MGRB 4YM6C 3MGRC 5GT0A 1JFIA 3X1TB 1P3BC 3WKJA 1WWSA 3X1TC 3AZGB 3RELD 3VH5W 2BYMB 5AVCA 4WU9B 2Y2NA 3TU4C 4WU9C 1M18A 5JRGB 2Y2HA 4AWLB 3UTBB 5JRGC 4AWLC 5DNND 3AZHB 3W96A 3LELA 1Z2CB 4H9OA 3W99B 2F8NG 1P3AC 5CPKA 1EQZB 2PYOA 1EQZC 4YM6D 3MGRD 2XD5A 3WA9B 3AV2B 5E5AB 3X1TD 3AV2C 3WA9C 1M19C 3W98A 1P34C 2Y2GA 4WU9D 3TU4D 5DNMC 1BFMA 2IO5B 5JRGD 1F66B 3X1UA 1F66C 3AZHD 1P3FC 4KHAB 5AV6C 3W99D 4HGAB 5CPJC 1P3AD 1M1AA 4Z2MG 1EQZD 3UTAA 3B0DB 3WA9D 3AV2D 4WNNA 2G5HC 1P34D 5B1LA 1KX3B 4E44A 1P3IC 3AZFB 5AVBC 2XD1A 1KX3C 3AZFC 2F8NA 1F66D 1U35C 4NE5A 4J8XC 1WWIA 5CPJD 5B2JB 3A6NA 4YS3C 5B1MB 5FUGA 4X23A 3UT9C 3AFAC 1P3ID 5CP6C 3NQUA 5AVBD 1KX3D 3WTPB 3AZFD 3AN2C 3WTPC 2RIQA 5AY8C 5B0ZA 5B31C 4KGCB 4KGCC 5GT3A 4G91B 4J8WA 4UUZB 4G91C 5B2JD 5B24B 4QLCA 3AZNA 1S32A 1P3PA 1KX4B 1KX4C 4YS3D 4G92C 1TZYB 5B1MD 1TZYC 3AZMB 4LD9B 1T3UA 4LD9C 3UT9D 1ZLAC 5G49B 3LZ0A 3REHB 5GSUB 3WTPD 3AN2D 5GSUC 3WAAB 3WAAC 3O62A 5B31D 4KGCD 2NZDB 2JCHA 5F99A 3MVDA 3X1VB 4R8PA 3X1VC 2NZDC 1P3GC 5GXQC 1KX4D 3AYWC 1TZYD 3REJA 4LD9D 3P5JB 4Z5TA 3V9RB 1TAFB 4H9PB 1ID3B 2Y2KA 1ID3C 2Y2QA 5GSUD 3WAAD 3MGPA 1PZRA 3AZKA 3C1CA 2NZDD 3X1VD 3MNNB 1KX5B 1A7WA 3MNNC 3EG5B 1P3KB 5BNVB 5AV9C 1P3KC 4WU8A 1P3OA 3AYWD 3AZMA 5C3IC 2FJ7A 2CV5B 2CV5C 1HTAA 5B32B 4XZQB 5B32C 1ID3D 3B0CT 4XZQC 3FDDA 5BS7A 3AZEA 3LZ1B 2CWEA 2F8NK 3LZ1C 2ZY3A 3AZJA 3MNND 3REKA 1KX5D 5AV9D 1P3KD 4ZUXC 3RELB 5B33C 1P3LA 2Y2MA 2JE5A 1HQ3C 5B0YA 2CV5D 3NQJB 4DRBA 3REIB 3REIC 5CHLB 5KDMB 5B32D 4XZQD 1P3MA 5AV8B 1AOIC 3LZ1D 5BNXB 4XUJB 5B2IB 4YM6B 3X1SA 1P3BB 3KXBA 4ZUXD 5B40B 5DNNA 5B40C 5B33D 4Z66B 4UPKA 4Z66C 3C1BC 3TU4B 3W97B 3W97C 2HIOB 1BH8B 2LY8A 2HIOC 2NQBA 5BT1C 3B6FB 3REID 3B6FC 4H9NA 5GT0B 1JFIB 3IP4C 5GT0C 3WKJC 3MGQA 1AOID 3AZGA 5AV8D 1P3AB 4XUJD 2BYMA 5B2ID 5AVCC 1M18B 1N1JB 1M18C 1P3BD 3UTBA 5B40D 1M19B 3AZHA 3LELB 4JJNA 4H9OB 3LELC 4Z66D 3C1BD 1P34B 3W97D 5DNMB 3W99A 2HIOD 4H9RB 4WJ3C 5BT1D 1P3FB 5CPKB 2PYOB 3B6FD 5CPKC 2PYOC 5AV6B 4J8UA 5GT0D 5CPJB 5E5AA 3WKJD 5CPIA 3H0LC 5AVCD 1M18D 1M19D 3LELD 4KHAA 1P3IB 5DNMD 5AVBB 1M1AB 1U35B 1P3FD 1M1AC 1B6WA 5CPKD 2PYOD 4J8XB 3B0CW 5AV6D 3UTAC 4WNNB 2Y2JA 5AV5A 4YS3B 5B1LB 5B1LC 4KUDA 2F8NB 3UT9B 3AFAB 5CP6B 3AN2B 5AY8B 5B2JA 3A6NC 1M1AD 5B31B 1U35D 5BO0B 3UTAD 4E45A 5B1MA 4J8XD 2F2AC 2Y2IA 4X23B 4X23C 4DRAA 4G92B 3AZIA 5B1LD 3NQUB 2FFFB 2F8ND 5B0ZB 4J8VA 5B0ZC 1R4VA 5GT3B 3AFAD 3AV1A 1ZLAB 5GT3C 5CP6D 4J8WC 4UUZA 3VH6T 3AZNB 5AY8D 3A6ND 5B24A 3AZNC 4QLCC 1S32B 1S32C 1P3PB 1P3PC 2ZY4A 1P3GB 5GXQB 2DF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 D;  3AYW B;  3LZ0 B;  3LZ0 C;  3REH A;  5B0Z D;  3O62 B;  3KWQ A;  3O62 C;  2BYK A;  5GT3 D;  3MVD B;  4R8P B;  5F99 C;  3MVD C;  1ZLA D;  4R8P C;  3AZN D;  4QLC D;  1S32 D;  1P3P D;  3REJ B;  1P3G D;  3REJ C;  5GXQ D;  5AV9 B;  4H9Q A;  4Z5T C;  2ARO A;  4H9P A;  5C3I B;  1F1E A;  4EO5 C;  3LZ0 D;  3MGP B;  3AZL A;  3O62 D;  3MGP C;  3AZK C;  3C1C B;  5F99 D;  3MVD D;  3C1C C;  4R8P D;  3LJA A;  1KX5 A;  4WU8 B;  4WU8 C;  1P3O C;  4NFT A;  3KUY A;  1BH9 B;  3REJ D;  4ZUX B;  3B6G A;  2FJ7 C;  5B33 B;  5JA4 B;  1HQ3 B;  5BS7 C;  2YFV A;  3MGS A;  3MGP D;  3AZE C;  3AZK D;  3AZJ B;  3C1C D;  3AZJ C;  3REK C;  3VH5 A;  4M6B A;  1AOI B;  4WU8 D;  4H9S A;  1P3L B;  3REL A;  1P3L C;  4CAY A;  4CSR A;  2FJ7 D;  5B0Y C;  3C1B B;  1H3O A;  5KDM A;  1P3M C;  3AZE D;  1HQ3 D;  5AV8 A;  2YFW A;  5BNX A;  4XUJ A;  5B2I A;  3AZJ D;  4YM6 A;  3VH6 W;  3MGR A;  3X1S B;  3REK D;  3KXB B;  1P3B A;  3X1S C;  3WKJ B;  3WTP E;  3KXB C;  3X1T A;  1P3L D;  5AVC B;  3TU4 A;  4WU9 A;  4WV4 B;  5JRG A;  2NQB C;  3W96 B;  3W96 C;  3B0B A;  1P3M D;  3MGQ B;  3MGQ C;  3AZG C;  1P3A A;  1EQZ A;  1N1J A;  3X1S D;  3KXB D;  3WA9 A;  3AV2 A;  3UTB C;  1M19 A;  4JJN B;  3AZH C;  3W98 B;  4JJN C;  1P34 A;  3W98 C;  3W99 C;  5DNM A;  2HUE B;  2HUE C;  4H9R A;  2NQB D;  3X1U B;  1F66 A;  1P3F A;  3X1U C;  3W96 D;  5AV6 A;  1ULY A;  4J8U B;  4J8U C;  5CPJ A;  5E5A C;  3MGQ D;  1B67 A;  3AZG D;  5CPI B;  5CPI C;  5B31 G;  3UTA B;  2IO5 C;  4WZS B;  3UTB D;  4JJN D;  3W98 D;  1P3I A;  1KX3 A;  5AVB A;  1Q9C A;  3AZF A;  4HGA C;  3X1U D;  1U35 A;  2JSS A;  4J8X A;  4J8U D;  3B0D C;  5E5A D;  3A6N B;  5AV5 B;  5CPI D;  5AV5 C;  2F8N H;  4YS3 A;  4KUD B;  4KUD C;  5FUG B;  2RVQ C;  3UT9 A;  3AFA A;  5CP6 A;  3AN2 A;  3WTP A;  5AY8 A;  5B2J C;  5B31 A;  5BO0 A;  4KGC A;  4J8W B;  5B1M C;  4QLC B;  5AV5 D;  1KX4 A;  3AZI B;  4Z2M H;  1TZY A;  3AZI C;  4KUD D;  2RVQ D;  4J8V B;  4LD9 A;  4J8V C;  3AV1 B;  3AV1 C;  1ZLA A;  5G49 A;  5GSU A;  5B24 C;  3WAA A;  4NE6 A;  5F99 B;  3R45 B;  3VH5 T;  4J8W D;  5B32 G;  3AZM C;  3X1V A;  1P3G A;  5GXQ A;  2NZD A;  3AYW A;  3AZI D;  2L5A A;  3REH C;  4J8V D;  3KWQ B;  4Z5T B;  3V9R A;  3KWQ C;  1TAF A;  2BYK B;  3AV1 D;  4EO5 B;  1ID3 A;  5B24 D;  3AZK B;  3AZM D;  3MNN A;  4H9Q B;  5AV9 A;  1P3K A;  5BNV A;  1P3O B;  2ARO B;  2ARO C;  3REH D;  3AZL B;  2FJ7 B;  3KWQ D;  4Z5T D;  3AZL C;  2CV5 A;  1KU5 A;  5B32 A;  3LJA B;  4XZQ A;  3LJA C;  1KX5 C;  3AZE B;  3LZ1 A;  3KUY B;  3KUY C;  1BH9 A;  3REK B;  4ZUX A;  3B6G B;  3B6G C;  1P3O D;  5B33 A;  5JA4 A;  2ARO D;  1HQ3 A;  2YFV B;  3VH6 A;  5B0Y B;  3MGS B;  3MGS C;  3AZL D;  3NQJ A;  3KSY A;  3REI A;  4NE3 A;  3LJA D;  1P3M B;  1AOI A;  4H9S C;  3REL C;  3KUY D;  4CAY B;  4ZBJ B;  4CSR B;  4ZBJ C;  5DNN B;  5B40 A;  3B6G D;  5DNN C;  1H3O B;  4Z66 A;  3C1B A;  3W97 A;  2HIO A;  1BH8 A;  2NQB B;  2YFW B;  3MGS D;  5AV8 C;  5B0Y D;  3B6F A;  4XUJ C;  4H9N B;  5B2I C;  3MGR B;  4YM6 C;  3MGR C;  5GT0 A;  1JFI A;  3X1T B;  1P3B C;  3WKJ A;  1WWS A;  3X1T C;  3AZG B;  3REL D;  3VH5 W;  2BYM B;  5AVC A;  4WU9 B;  3TU4 C;  4WU9 C;  1M18 A;  5JRG B;  4AWL B;  3UTB B;  5JRG C;  4AWL C;  5DNN D;  3AZH B;  3W96 A;  3LEL A;  4H9O A;  3W99 B;  2F8N G;  1P3A C;  5CPK A;  1EQZ B;  2PYO A;  1EQZ C;  4YM6 D;  3MGR D;  3WA9 B;  3AV2 B;  5E5A B;  3X1T D;  3AV2 C;  3WA9 C;  1M19 C;  3W98 A;  1P34 C;  3TU4 D;  4WU9 D;  5DNM C;  1BFM A;  2IO5 B;  5JRG D;  1F66 B;  3X1U A;  1F66 C;  3AZH D;  1P3F C;  4KHA B;  5AV6 C;  3W99 D;  4HGA B;  5CPJ C;  1P3A D;  1M1A A;  4Z2M G;  1EQZ D;  3UTA A;  3B0D B;  3WA9 D;  3AV2 D;  4WNN A;  1P34 D;  5B1L A;  1KX3 B;  4E44 A;  1P3I C;  3AZF B;  5AVB C;  1KX3 C;  3AZF C;  2F8N A;  1F66 D;  1U35 C;  4NE5 A;  4J8X C;  1WWI A;  5CPJ D;  5B2J B;  3A6N A;  4YS3 C;  5B1M B;  5FUG A;  4X23 A;  3UT9 C;  3AFA C;  1P3I D;  5CP6 C;  3NQU A;  5AVB D;  1KX3 D;  3WTP B;  3AZF D;  3AN2 C;  3WTP C;  5AY8 C;  5B0Z A;  5B31 C;  4KGC B;  4KGC C;  5GT3 A;  4G91 B;  4J8W A;  4UUZ B;  4G91 C;  5B2J D;  5B24 B;  4QLC A;  3AZN A;  1S32 A;  1P3P A;  1KX4 B;  1KX4 C;  4YS3 D;  4G92 C;  1TZY B;  5B1M D;  1TZY C;  3AZM B;  4LD9 B;  4LD9 C;  3UT9 D;  1ZLA C;  5G49 B;  3LZ0 A;  3REH B;  5GSU B;  3WTP D;  3AN2 D;  5GSU C;  3WAA B;  3WAA C;  3O62 A;  5B31 D;  4KGC D;  2NZD B;  5F99 A;  3MVD A;  3X1V B;  4R8P A;  3X1V C;  2NZD C;  1P3G C;  5GXQ C;  1KX4 D;  3AYW C;  1TZY D;  3REJ A;  4LD9 D;  3V9R B;  4Z5T A;  1TAF B;  4H9P B;  1ID3 B;  1ID3 C;  5GSU D;  3WAA D;  3MGP A;  3AZK A;  3C1C A;  2NZD D;  3X1V D;  3MNN B;  1KX5 B;  1A7W A;  3MNN C;  1P3K B;  5BNV B;  5AV9 C;  1P3K C;  4WU8 A;  1P3O A;  3AYW D;  3AZM A;  5C3I C;  2FJ7 A;  2CV5 B;  2CV5 C;  1HTA A;  5B32 B;  4XZQ B;  5B32 C;  1ID3 D;  3B0C T;  4XZQ C;  5BS7 A;  3AZE A;  3LZ1 B;  2CWE A;  2F8N K;  3LZ1 C;  3AZJ A;  3MNN D;  3REK A;  1KX5 D;  5AV9 D;  1P3K D;  4ZUX C;  3REL B;  5B33 C;  1P3L A;  1HQ3 C;  5B0Y A;  2CV5 D;  3NQJ B;  4DRB A;  3REI B;  3REI C;  5CHL B;  5KDM B;  5B32 D;  4XZQ D;  1P3M A;  5AV8 B;  1AOI C;  3LZ1 D;  5BNX B;  4XUJ B;  5B2I B;  4YM6 B;  3X1S A;  1P3B B;  3KXB A;  4ZUX D;  5B40 B;  5DNN A;  5B40 C;  5B33 D;  4Z66 B;  3W97 B;  4Z66 C;  3C1B C;  3TU4 B;  3W97 C;  2HIO B;  1BH8 B;  2LY8 A;  2HIO C;  2NQB A;  5BT1 C;  3B6F B;  3REI D;  3B6F C;  4H9N A;  5GT0 B;  1JFI B;  5GT0 C;  3WKJ C;  3MGQ A;  1AOI D;  3AZG A;  5AV8 D;  1P3A B;  4XUJ D;  2BYM A;  5B2I D;  5AVC C;  1M18 B;  1N1J B;  1M18 C;  1P3B D;  3UTB A;  5B40 D;  1M19 B;  3AZH A;  3LEL B;  4JJN A;  4H9O B;  3LEL C;  4Z66 D;  3C1B D;  1P34 B;  3W97 D;  5DNM B;  3W99 A;  2HIO D;  4H9R B;  5BT1 D;  1P3F B;  5CPK B;  2PYO B;  3B6F D;  5CPK C;  2PYO C;  5AV6 B;  4J8U A;  5GT0 D;  5CPJ B;  5E5A A;  3WKJ D;  5CPI A;  5AVC D;  1M18 D;  1M19 D;  3LEL D;  4KHA A;  1P3I B;  5DNM D;  5AVB B;  1M1A B;  1U35 B;  1P3F D;  1M1A C;  1B6W A;  5CPK D;  2PYO D;  4J8X B;  3B0C W;  5AV6 D;  3UTA C;  4WNN B;  5AV5 A;  4YS3 B;  5B1L B;  5B1L C;  4KUD A;  2F8N B;  3UT9 B;  3AFA B;  5CP6 B;  3AN2 B;  5AY8 B;  5B2J A;  3A6N C;  1M1A D;  5B31 B;  1U35 D;  5BO0 B;  3UTA D;  4E45 A;  5B1M A;  4J8X D;  4X23 B;  4X23 C;  4DRA A;  4G92 B;  3AZI A;  5B1L D;  3NQU B;  2F8N D;  5B0Z B;  4J8V A;  5B0Z C;  1R4V A;  5GT3 B;  3AFA D;  3AV1 A;  1ZLA B;  5GT3 C;  5CP6 D;  4J8W C;  4UUZ A;  3VH6 T;  3AZN B;  5AY8 D;  3A6N D;  5B24 A;  3AZN C;  4QLC C;  1S32 B;  1S32 C;  1P3P B;  1P3P C;  3R45 A;  1P3G B;  5GXQ B; 
#chains in the Genus database with same CATH topology
 4X23 D;  3AYW B;  3LZ0 B;  3LZ0 C;  3REH A;  5B0Z D;  3O62 B;  3KWQ A;  3O62 C;  2BYK A;  5GT3 D;  3MVD B;  4R8P B;  5F99 C;  2DQN C;  3MVD C;  4R8P C;  4DQY B;  1ZLA D;  3AZN D;  4QLC D;  1S32 D;  1P3P D;  3REJ B;  1P3G D;  3REJ C;  5GXQ D;  5AV9 B;  4H9Q A;  4Z5T C;  2ARO A;  4H9P A;  5C3I B;  1F1E A;  4EO5 C;  3LZ0 D;  3MGP B;  3AZL A;  3O62 D;  3MGP C;  3AZK C;  3C1C B;  5F99 D;  3MVD D;  3C1C C;  4R8P D;  3LJA A;  1KX5 A;  4WU8 B;  4WU8 C;  1P3O C;  4NFT A;  3KUY A;  3R45 A;  1BH9 B;  3REJ D;  4ZUX B;  3B6G A;  2FJ7 C;  5B33 B;  5JA4 B;  1HQ3 B;  5BS7 C;  2YFV A;  3MGS A;  3MGP D;  3AZE C;  3AZK D;  3AZJ B;  3C1C D;  3AZJ C;  3H0M C;  3REK C;  3VH5 A;  4M6B A;  1AOI B;  4WU8 D;  4H9S A;  1P3L B;  3REL A;  1P3L C;  4CAY A;  4CSR A;  2FJ7 D;  5B0Y C;  3C1B B;  1H3O A;  5KDM A;  1P3M C;  3AZE D;  1HQ3 D;  5AV8 A;  2YFW A;  5BNX A;  4XUJ A;  5B2I A;  3AZJ D;  4YM6 A;  3VH6 W;  3MGR A;  3X1S B;  3REK D;  3KXB B;  1P3B A;  3X1S C;  3WKJ B;  3WTP E;  3KXB C;  3X1T A;  1P3L D;  5AVC B;  3TU4 A;  4WU9 A;  4WV4 B;  5JRG A;  2NQB C;  3W96 B;  3W96 C;  3B0B A;  1P3M D;  3MGQ B;  3MGQ C;  3AZG C;  1P3A A;  1EQZ A;  1N1J A;  3X1S D;  3KXB D;  3WA9 A;  3AV2 A;  3UTB C;  1M19 A;  4JJN B;  3AZH C;  3W98 B;  4JJN C;  1P34 A;  3W98 C;  5DNM A;  3W99 C;  2HUE B;  2HUE C;  4H9R A;  2NQB D;  3X1U B;  1F66 A;  1P3F A;  3X1U C;  3W96 D;  3EPJ A;  5AV6 A;  1ULY A;  4J8U B;  4J8U C;  5CPJ A;  5E5A C;  3MGQ D;  1B67 A;  3AZG D;  5CPI B;  5CPI C;  5B31 G;  3UTA B;  2IO5 C;  4WZS B;  3UTB D;  4JJN D;  3W98 D;  1P3I A;  1KX3 A;  5AVB A;  1Q9C A;  3AZF A;  2VQR A;  4HGA C;  3X1U D;  1U35 A;  2JSS A;  1W2E A;  4J8X A;  4J8U D;  3B0D C;  5E5A D;  3A6N B;  5AV5 B;  2ZM5 A;  5CPI D;  5AV5 C;  2F8N H;  4YS3 A;  3EPL A;  4KUD B;  4KUD C;  5FUG B;  2RVQ C;  3EPK A;  3EPH A;  3UT9 A;  3AFA A;  5CP6 A;  2W8S A;  3AN2 A;  3WTP A;  5AY8 A;  2BG1 A;  5B2J C;  2ZY2 A;  5B31 A;  5BO0 A;  4KGC A;  2Y2P A;  3A1K A;  4J8W B;  5B1M C;  4QLC B;  5AV5 D;  1KX4 A;  3AZI B;  4Z2M H;  1TZY A;  3AZI C;  4KUD D;  2RVQ D;  4J8V B;  4LD9 A;  4J8V C;  3H0R C;  3AV1 B;  3AV1 C;  1ZLA A;  2ZY5 A;  5G49 A;  5GSU A;  5B24 C;  3WAA A;  4NE6 A;  5F99 B;  3R45 B;  3VH5 T;  4J8W D;  5B32 G;  3AZM C;  3X1V A;  1P3G A;  5GXQ A;  3AL0 C;  2NZD A;  3AYW A;  3AZI D;  2L5A A;  3REH C;  4J8V D;  3KWQ B;  4Z5T B;  3V9R A;  2J8P A;  3KWQ C;  1TAF A;  2BYK B;  3AV1 D;  4EO5 B;  1ID3 A;  2G5I C;  5B24 D;  3AZK B;  3AZM D;  2Y2L A;  3MNN A;  4H9Q B;  5AV9 A;  1P3K A;  5BNV A;  1P3O B;  2ARO B;  2ARO C;  3F6T A;  3REH D;  3AZL B;  2FJ7 B;  3KWQ D;  4Z5T D;  3AZL C;  2CV5 A;  1KU5 A;  5B32 A;  3LJA B;  4XZQ A;  3LJA C;  1KX5 C;  3AZE B;  3LZ1 A;  3KUY B;  3KUY C;  1BH9 A;  3REK B;  4ZUX A;  3B6G B;  3B6G C;  1P3O D;  5B33 A;  5JA4 A;  2ARO D;  1HQ3 A;  2YFV B;  3VH6 A;  5B0Y B;  3MGS B;  3MGS C;  3AZL D;  3NQJ A;  3KSY A;  3REI A;  4NE3 A;  3LJA D;  1P3M B;  1AOI A;  4H9S C;  3REL C;  3KUY D;  4CAY B;  4ZBJ B;  4CSR B;  3KFU G;  4ZBJ C;  5DNN B;  5B40 A;  2Y2O A;  3B6G D;  5DNN C;  1H3O B;  4Z66 A;  3C1B A;  3W97 A;  3A1I A;  2HIO A;  1BH8 A;  2NQB B;  2YFW B;  3MGS D;  2UWX A;  5AV8 C;  5B0Y D;  3B6F A;  4XUJ C;  4H9N B;  5B2I C;  3MGR B;  4YM6 C;  3MGR C;  5GT0 A;  1JFI A;  3X1T B;  1P3B C;  3WKJ A;  1WWS A;  3X1T C;  3AZG B;  3REL D;  3VH5 W;  2BYM B;  5AVC A;  4WU9 B;  2Y2N A;  3TU4 C;  4WU9 C;  1M18 A;  5JRG B;  2Y2H A;  4AWL B;  3UTB B;  5JRG C;  4AWL C;  5DNN D;  3AZH B;  3W96 A;  3LEL A;  1Z2C B;  4H9O A;  3W99 B;  2F8N G;  1P3A C;  5CPK A;  1EQZ B;  2PYO A;  1EQZ C;  4YM6 D;  3MGR D;  2XD5 A;  3WA9 B;  3AV2 B;  5E5A B;  3X1T D;  3AV2 C;  3WA9 C;  1M19 C;  3W98 A;  1P34 C;  2Y2G A;  4WU9 D;  3TU4 D;  5DNM C;  1BFM A;  2IO5 B;  5JRG D;  1F66 B;  3X1U A;  1F66 C;  3AZH D;  1P3F C;  4KHA B;  5AV6 C;  3W99 D;  4HGA B;  5CPJ C;  1P3A D;  1M1A A;  4Z2M G;  1EQZ D;  3UTA A;  3B0D B;  3WA9 D;  3AV2 D;  4WNN A;  2G5H C;  1P34 D;  5B1L A;  1KX3 B;  4E44 A;  1P3I C;  3AZF B;  5AVB C;  2XD1 A;  1KX3 C;  3AZF C;  2F8N A;  1F66 D;  1U35 C;  4NE5 A;  4J8X C;  1WWI A;  5CPJ D;  5B2J B;  3A6N A;  4YS3 C;  5B1M B;  5FUG A;  4X23 A;  3UT9 C;  3AFA C;  1P3I D;  5CP6 C;  3NQU A;  5AVB D;  1KX3 D;  3WTP B;  3AZF D;  3AN2 C;  3WTP C;  2RIQ A;  5AY8 C;  5B0Z A;  5B31 C;  4KGC B;  4KGC C;  5GT3 A;  4G91 B;  4J8W A;  4UUZ B;  4G91 C;  5B2J D;  5B24 B;  4QLC A;  3AZN A;  1S32 A;  1P3P A;  1KX4 B;  1KX4 C;  4YS3 D;  4G92 C;  1TZY B;  5B1M D;  1TZY C;  3AZM B;  4LD9 B;  1T3U A;  4LD9 C;  3UT9 D;  1ZLA C;  5G49 B;  3LZ0 A;  3REH B;  5GSU B;  3WTP D;  3AN2 D;  5GSU C;  3WAA B;  3WAA C;  3O62 A;  5B31 D;  4KGC D;  2NZD B;  2JCH A;  5F99 A;  3MVD A;  3X1V B;  4R8P A;  3X1V C;  2NZD C;  1P3G C;  5GXQ C;  1KX4 D;  3AYW C;  1TZY D;  3REJ A;  4LD9 D;  3P5J B;  4Z5T A;  3V9R B;  1TAF B;  4H9P B;  1ID3 B;  2Y2K A;  1ID3 C;  2Y2Q A;  5GSU D;  3WAA D;  3MGP A;  1PZR A;  3AZK A;  3C1C A;  2NZD D;  3X1V D;  3MNN B;  1KX5 B;  1A7W A;  3MNN C;  3EG5 B;  1P3K B;  5BNV B;  5AV9 C;  1P3K C;  4WU8 A;  1P3O A;  3AYW D;  3AZM A;  5C3I C;  2FJ7 A;  2CV5 B;  2CV5 C;  1HTA A;  5B32 B;  4XZQ B;  5B32 C;  1ID3 D;  3B0C T;  4XZQ C;  3FDD A;  5BS7 A;  3AZE A;  3LZ1 B;  2CWE A;  2F8N K;  3LZ1 C;  2ZY3 A;  3AZJ A;  3MNN D;  3REK A;  1KX5 D;  5AV9 D;  1P3K D;  4ZUX C;  3REL B;  5B33 C;  1P3L A;  2Y2M A;  2JE5 A;  1HQ3 C;  5B0Y A;  2CV5 D;  3NQJ B;  4DRB A;  3REI B;  3REI C;  5CHL B;  5KDM B;  5B32 D;  4XZQ D;  1P3M A;  5AV8 B;  1AOI C;  3LZ1 D;  5BNX B;  4XUJ B;  5B2I B;  4YM6 B;  3X1S A;  1P3B B;  3KXB A;  4ZUX D;  5B40 B;  5DNN A;  5B40 C;  5B33 D;  4Z66 B;  4UPK A;  4Z66 C;  3C1B C;  3TU4 B;  3W97 B;  3W97 C;  2HIO B;  1BH8 B;  2LY8 A;  2HIO C;  2NQB A;  5BT1 C;  3B6F B;  3REI D;  3B6F C;  4H9N A;  5GT0 B;  1JFI B;  3IP4 C;  5GT0 C;  3WKJ C;  3MGQ A;  1AOI D;  3AZG A;  5AV8 D;  1P3A B;  4XUJ D;  2BYM A;  5B2I D;  5AVC C;  1M18 B;  1N1J B;  1M18 C;  1P3B D;  3UTB A;  5B40 D;  1M19 B;  3AZH A;  3LEL B;  4JJN A;  4H9O B;  3LEL C;  4Z66 D;  3C1B D;  1P34 B;  3W97 D;  5DNM B;  3W99 A;  2HIO D;  4H9R B;  4WJ3 C;  5BT1 D;  1P3F B;  5CPK B;  2PYO B;  3B6F D;  5CPK C;  2PYO C;  5AV6 B;  4J8U A;  5GT0 D;  5CPJ B;  5E5A A;  3WKJ D;  5CPI A;  3H0L C;  5AVC D;  1M18 D;  1M19 D;  3LEL D;  4KHA A;  1P3I B;  5DNM D;  5AVB B;  1M1A B;  1U35 B;  1P3F D;  1M1A C;  1B6W A;  5CPK D;  2PYO D;  4J8X B;  3B0C W;  5AV6 D;  3UTA C;  4WNN B;  2Y2J A;  5AV5 A;  4YS3 B;  5B1L B;  5B1L C;  4KUD A;  2F8N B;  3UT9 B;  3AFA B;  5CP6 B;  3AN2 B;  5AY8 B;  5B2J A;  3A6N C;  1M1A D;  5B31 B;  1U35 D;  5BO0 B;  3UTA D;  4E45 A;  5B1M A;  4J8X D;  2F2A C;  2Y2I A;  4X23 B;  4X23 C;  4DRA A;  4G92 B;  3AZI A;  5B1L D;  3NQU B;  2FFF B;  2F8N D;  5B0Z B;  4J8V A;  5B0Z C;  1R4V A;  5GT3 B;  3AFA D;  3AV1 A;  1ZLA B;  5GT3 C;  5CP6 D;  4J8W C;  4UUZ A;  3VH6 T;  3AZN B;  5AY8 D;  3A6N D;  5B24 A;  3AZN C;  4QLC C;  1S32 B;  1S32 C;  1P3P B;  1P3P C;  2ZY4 A;  1P3G B;  5GXQ B;  2DF4 C; 
#chains in the Genus database with same CATH homology
 4X23 D;  3AYW B;  3LZ0 B;  3LZ0 C;  3REH A;  5B0Z D;  3O62 B;  3KWQ A;  3O62 C;  2BYK A;  5GT3 D;  3MVD B;  4R8P B;  5F99 C;  2DQN C;  3MVD C;  4R8P C;  4DQY B;  1ZLA D;  3AZN D;  4QLC D;  1S32 D;  1P3P D;  3REJ B;  1P3G D;  3REJ C;  5GXQ D;  5AV9 B;  4H9Q A;  4Z5T C;  2ARO A;  4H9P A;  5C3I B;  1F1E A;  4EO5 C;  3LZ0 D;  3MGP B;  3AZL A;  3O62 D;  3MGP C;  3AZK C;  3C1C B;  5F99 D;  3MVD D;  3C1C C;  4R8P D;  3LJA A;  1KX5 A;  4WU8 B;  4WU8 C;  1P3O C;  4NFT A;  3KUY A;  3R45 A;  1BH9 B;  3REJ D;  4ZUX B;  3B6G A;  2FJ7 C;  5B33 B;  5JA4 B;  1HQ3 B;  5BS7 C;  2YFV A;  3MGS A;  3MGP D;  3AZE C;  3AZK D;  3AZJ B;  3C1C D;  3AZJ C;  3H0M C;  3REK C;  3VH5 A;  4M6B A;  1AOI B;  4WU8 D;  4H9S A;  1P3L B;  3REL A;  1P3L C;  4CAY A;  4CSR A;  2FJ7 D;  5B0Y C;  3C1B B;  1H3O A;  5KDM A;  1P3M C;  3AZE D;  1HQ3 D;  5AV8 A;  2YFW A;  5BNX A;  4XUJ A;  5B2I A;  3AZJ D;  4YM6 A;  3VH6 W;  3MGR A;  3X1S B;  3REK D;  3KXB B;  1P3B A;  3X1S C;  3WKJ B;  3WTP E;  3KXB C;  3X1T A;  1P3L D;  5AVC B;  3TU4 A;  4WU9 A;  4WV4 B;  5JRG A;  2NQB C;  3W96 B;  3W96 C;  3B0B A;  1P3M D;  3MGQ B;  3MGQ C;  3AZG C;  1P3A A;  1EQZ A;  1N1J A;  3X1S D;  3KXB D;  3WA9 A;  3AV2 A;  3UTB C;  1M19 A;  4JJN B;  3AZH C;  3W98 B;  4JJN C;  1P34 A;  3W98 C;  5DNM A;  3W99 C;  2HUE B;  2HUE C;  4H9R A;  2NQB D;  3X1U B;  1F66 A;  1P3F A;  3X1U C;  3W96 D;  3EPJ A;  5AV6 A;  1ULY A;  4J8U B;  4J8U C;  5CPJ A;  5E5A C;  3MGQ D;  1B67 A;  3AZG D;  5CPI B;  5CPI C;  5B31 G;  3UTA B;  2IO5 C;  4WZS B;  3UTB D;  4JJN D;  3W98 D;  1P3I A;  1KX3 A;  5AVB A;  1Q9C A;  3AZF A;  2VQR A;  4HGA C;  3X1U D;  1U35 A;  2JSS A;  1W2E A;  4J8X A;  4J8U D;  3B0D C;  5E5A D;  3A6N B;  5AV5 B;  2ZM5 A;  5CPI D;  5AV5 C;  2F8N H;  4YS3 A;  3EPL A;  4KUD B;  4KUD C;  5FUG B;  2RVQ C;  3EPK A;  3EPH A;  3UT9 A;  3AFA A;  5CP6 A;  2W8S A;  3AN2 A;  3WTP A;  5AY8 A;  2BG1 A;  5B2J C;  2ZY2 A;  5B31 A;  5BO0 A;  4KGC A;  2Y2P A;  3A1K A;  4J8W B;  5B1M C;  4QLC B;  5AV5 D;  1KX4 A;  3AZI B;  4Z2M H;  1TZY A;  3AZI C;  4KUD D;  2RVQ D;  4J8V B;  4LD9 A;  4J8V C;  3H0R C;  3AV1 B;  3AV1 C;  1ZLA A;  2ZY5 A;  5G49 A;  5GSU A;  5B24 C;  3WAA A;  4NE6 A;  5F99 B;  3R45 B;  3VH5 T;  4J8W D;  5B32 G;  3AZM C;  3X1V A;  1P3G A;  5GXQ A;  3AL0 C;  2NZD A;  3AYW A;  3AZI D;  2L5A A;  3REH C;  4J8V D;  3KWQ B;  4Z5T B;  3V9R A;  2J8P A;  3KWQ C;  1TAF A;  2BYK B;  3AV1 D;  4EO5 B;  1ID3 A;  2G5I C;  5B24 D;  3AZK B;  3AZM D;  2Y2L A;  3MNN A;  4H9Q B;  5AV9 A;  1P3K A;  5BNV A;  1P3O B;  2ARO B;  2ARO C;  3F6T A;  3REH D;  3AZL B;  2FJ7 B;  3KWQ D;  4Z5T D;  3AZL C;  2CV5 A;  1KU5 A;  5B32 A;  3LJA B;  4XZQ A;  3LJA C;  1KX5 C;  3AZE B;  3LZ1 A;  3KUY B;  3KUY C;  1BH9 A;  3REK B;  4ZUX A;  3B6G B;  3B6G C;  1P3O D;  5B33 A;  5JA4 A;  2ARO D;  1HQ3 A;  2YFV B;  3VH6 A;  5B0Y B;  3MGS B;  3MGS C;  3AZL D;  3NQJ A;  3KSY A;  3REI A;  4NE3 A;  3LJA D;  1P3M B;  1AOI A;  4H9S C;  3REL C;  3KUY D;  4CAY B;  4ZBJ B;  4CSR B;  3KFU G;  4ZBJ C;  5DNN B;  5B40 A;  2Y2O A;  3B6G D;  5DNN C;  1H3O B;  4Z66 A;  3C1B A;  3W97 A;  3A1I A;  2HIO A;  1BH8 A;  2NQB B;  2YFW B;  3MGS D;  2UWX A;  5AV8 C;  5B0Y D;  3B6F A;  4XUJ C;  4H9N B;  5B2I C;  3MGR B;  4YM6 C;  3MGR C;  5GT0 A;  1JFI A;  3X1T B;  1P3B C;  3WKJ A;  1WWS A;  3X1T C;  3AZG B;  3REL D;  3VH5 W;  2BYM B;  5AVC A;  4WU9 B;  2Y2N A;  3TU4 C;  4WU9 C;  1M18 A;  5JRG B;  2Y2H A;  4AWL B;  3UTB B;  5JRG C;  4AWL C;  5DNN D;  3AZH B;  3W96 A;  3LEL A;  1Z2C B;  4H9O A;  3W99 B;  2F8N G;  1P3A C;  5CPK A;  1EQZ B;  2PYO A;  1EQZ C;  4YM6 D;  3MGR D;  2XD5 A;  3WA9 B;  3AV2 B;  5E5A B;  3X1T D;  3AV2 C;  3WA9 C;  1M19 C;  3W98 A;  1P34 C;  2Y2G A;  4WU9 D;  3TU4 D;  5DNM C;  1BFM A;  2IO5 B;  5JRG D;  1F66 B;  3X1U A;  1F66 C;  3AZH D;  1P3F C;  4KHA B;  5AV6 C;  3W99 D;  4HGA B;  5CPJ C;  1P3A D;  1M1A A;  4Z2M G;  1EQZ D;  3UTA A;  3B0D B;  3WA9 D;  3AV2 D;  4WNN A;  2G5H C;  1P34 D;  5B1L A;  1KX3 B;  4E44 A;  1P3I C;  3AZF B;  5AVB C;  2XD1 A;  1KX3 C;  3AZF C;  2F8N A;  1F66 D;  1U35 C;  4NE5 A;  4J8X C;  1WWI A;  5CPJ D;  5B2J B;  3A6N A;  4YS3 C;  5B1M B;  5FUG A;  4X23 A;  3UT9 C;  3AFA C;  1P3I D;  5CP6 C;  3NQU A;  5AVB D;  1KX3 D;  3WTP B;  3AZF D;  3AN2 C;  3WTP C;  2RIQ A;  5AY8 C;  5B0Z A;  5B31 C;  4KGC B;  4KGC C;  5GT3 A;  4G91 B;  4J8W A;  4UUZ B;  4G91 C;  5B2J D;  5B24 B;  4QLC A;  3AZN A;  1S32 A;  1P3P A;  1KX4 B;  1KX4 C;  4YS3 D;  4G92 C;  1TZY B;  5B1M D;  1TZY C;  3AZM B;  4LD9 B;  1T3U A;  4LD9 C;  3UT9 D;  1ZLA C;  5G49 B;  3LZ0 A;  3REH B;  5GSU B;  3WTP D;  3AN2 D;  5GSU C;  3WAA B;  3WAA C;  3O62 A;  5B31 D;  4KGC D;  2NZD B;  2JCH A;  5F99 A;  3MVD A;  3X1V B;  4R8P A;  3X1V C;  2NZD C;  1P3G C;  5GXQ C;  1KX4 D;  3AYW C;  1TZY D;  3REJ A;  4LD9 D;  3P5J B;  4Z5T A;  3V9R B;  1TAF B;  4H9P B;  1ID3 B;  2Y2K A;  1ID3 C;  2Y2Q A;  5GSU D;  3WAA D;  3MGP A;  1PZR A;  3AZK A;  3C1C A;  2NZD D;  3X1V D;  3MNN B;  1KX5 B;  1A7W A;  3MNN C;  3EG5 B;  1P3K B;  5BNV B;  5AV9 C;  1P3K C;  4WU8 A;  1P3O A;  3AYW D;  3AZM A;  5C3I C;  2FJ7 A;  2CV5 B;  2CV5 C;  1HTA A;  5B32 B;  4XZQ B;  5B32 C;  1ID3 D;  3B0C T;  4XZQ C;  3FDD A;  5BS7 A;  3AZE A;  3LZ1 B;  2CWE A;  2F8N K;  3LZ1 C;  2ZY3 A;  3AZJ A;  3MNN D;  3REK A;  1KX5 D;  5AV9 D;  1P3K D;  4ZUX C;  3REL B;  5B33 C;  1P3L A;  2Y2M A;  2JE5 A;  1HQ3 C;  5B0Y A;  2CV5 D;  3NQJ B;  4DRB A;  3REI B;  3REI C;  5CHL B;  5KDM B;  5B32 D;  4XZQ D;  1P3M A;  5AV8 B;  1AOI C;  3LZ1 D;  5BNX B;  4XUJ B;  5B2I B;  4YM6 B;  3X1S A;  1P3B B;  3KXB A;  4ZUX D;  5B40 B;  5DNN A;  5B40 C;  5B33 D;  4Z66 B;  4UPK A;  4Z66 C;  3C1B C;  3TU4 B;  3W97 B;  3W97 C;  2HIO B;  1BH8 B;  2LY8 A;  2HIO C;  2NQB A;  5BT1 C;  3B6F B;  3REI D;  3B6F C;  4H9N A;  5GT0 B;  1JFI B;  3IP4 C;  5GT0 C;  3WKJ C;  3MGQ A;  1AOI D;  3AZG A;  5AV8 D;  1P3A B;  4XUJ D;  2BYM A;  5B2I D;  5AVC C;  1M18 B;  1N1J B;  1M18 C;  1P3B D;  3UTB A;  5B40 D;  1M19 B;  3AZH A;  3LEL B;  4JJN A;  4H9O B;  3LEL C;  4Z66 D;  3C1B D;  1P34 B;  3W97 D;  5DNM B;  3W99 A;  2HIO D;  4H9R B;  4WJ3 C;  5BT1 D;  1P3F B;  5CPK B;  2PYO B;  3B6F D;  5CPK C;  2PYO C;  5AV6 B;  4J8U A;  5GT0 D;  5CPJ B;  5E5A A;  3WKJ D;  5CPI A;  3H0L C;  5AVC D;  1M18 D;  1M19 D;  3LEL D;  4KHA A;  1P3I B;  5DNM D;  5AVB B;  1M1A B;  1U35 B;  1P3F D;  1M1A C;  1B6W A;  5CPK D;  2PYO D;  4J8X B;  3B0C W;  5AV6 D;  3UTA C;  4WNN B;  2Y2J A;  5AV5 A;  4YS3 B;  5B1L B;  5B1L C;  4KUD A;  2F8N B;  3UT9 B;  3AFA B;  5CP6 B;  3AN2 B;  5AY8 B;  5B2J A;  3A6N C;  1M1A D;  5B31 B;  1U35 D;  5BO0 B;  3UTA D;  4E45 A;  5B1M A;  4J8X D;  2F2A C;  2Y2I A;  4X23 B;  4X23 C;  4DRA A;  4G92 B;  3AZI A;  5B1L D;  3NQU B;  2FFF B;  2F8N D;  5B0Z B;  4J8V A;  5B0Z C;  1R4V A;  5GT3 B;  3AFA D;  3AV1 A;  1ZLA B;  5GT3 C;  5CP6 D;  4J8W C;  4UUZ A;  3VH6 T;  3AZN B;  5AY8 D;  3A6N D;  5B24 A;  3AZN C;  4QLC C;  1S32 B;  1S32 C;  1P3P B;  1P3P C;  2ZY4 A;  1P3G B;  5GXQ B;  2DF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...