3W98C

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98C00
3X1VD 5B2JB 3AV2A 1EQZD 5AV6A 4NE3A 3REJC 5CPIA 4J8WC 5AVBA 3AZIC 3B6FD 3W97C 2NQBC 1H3OA 1B67A 5CPIC 4WV4B 3A6NC 3MGPC 4JJNC 4WU9A 5CPKA 4E45A 5JRGA 3WAAB 5BNVA 5B1MB 5B2JD 5AV9B 1F1EA 4G92C 1M18D 1AOIB 4H9NA 5AVCB 3AFAA 3KWQA 1BH8B 3X1TB 3C1BA 1M1AB 3WKJD 3X1SD 1TZYA 1P3FB 3WA9B 3B6GC 3UTBB 1KX5B 2LY8A 4KGCA 3WAAD 1P34A 5B1MD 5GT0C 4YS3C 3LZ1B 3AZEC 5AV9D 1AOID 4G91B 5AVCD 4X23C 3W98A 3X1TD 1P3OC 3AZJA 5B32A 1M1AD 1P3FD 5BT1C 2AROD 5B32C 3AZJC 3WA9D 2NZDA 5AVBD 3AYWA 3UTBD 1KX5D 3AZNA 1P3MA 4YM6A 4ZUXB 1N1JA 3LZ1D 4JJNB 5AV8A 5B31G 1P3KB 5B24C 3REIA 1HQ3B 3MGSB 3AZHC 1KX3A 3AN2C 3REIC 5B0YB 5E5AC 2HIOA 3AZLA 1P3GA 5B0ZB 3AZKB 3WTPC 4ZUXD 2CV5C 1P3BD 4XUJA 3UT9A 5B1LC 3UTAC 3O62B 5CP6C 3MGQC 1P3KD 2FJ7B 4XUJC 1P3AC 1HQ3D 3MGSD 3C1CC 4EO5C 1P3IC 1P3LD 1M19C 4H9OA 1P3PB 3MVDC 4H9QA 3NQJA 5GSUB 5F99A 1ID3A 4XZQC 5BNXB 3AZKD 4R8PB 3AV1B 5GT3A 3RELB 1ID3C 5B2IC 3W96B 5DNMB 5AY8A 3O62D 5FUGB 5AV5D 3KXBA 5B33C 3LELB 4LD9C 3LZ0A 3LJAB 3KUYC 2FJ7D 1EQZA 3B6FA 3X1VC 3TU4B 1P3PD 4KUDC 3VH6A 5B40A 5GSUD 3REKC 1KX4B 1F66C 4WNNA 3AV1D 4R8PD 1ULYA 3W96D 5DNMD 4Z5TC 5CPJC 3MGRB 3LELD 3R45A 3LJAD 1ZLAC 5B2JA 2YFVB 5B31C 1M18A 3AZMB 1M18C 2HUEC 1KX4D 3WKJA 3X1SA 3W99D 4J8XC 3MNNC 2IO5B 1S32B 1JFIB 3WKJC 3AZGB 3X1SC 5B32G 4J8VB 3WAAA 3MGRD 5B1MA 5AV9A 3B0DC 1AOIA 4H9SC 5AVCA 5KDMB 3KXBD 1BH8A 3X1TA 3AZMD 3LZ0D 4CSRB 1M1AA 2RVQC 1P3FA 1WWSA 4WU8B 1S32D 2AROA 4H9PB 3WA9A 3UTBA 3AV2C 3AZGD 1KX5A 5AV6C 4HGAC 5B40D 3REHB 5AVBC 4J8VD 3LZ1A 3WTPE 5DNND 2F8NB 4J8UB 4WU9C 5G49B 5CPKC 5JRGC 4WU8D 3X1UB 2PYOB 4H9RB 3AFAC 3KWQC 3REHD 4QLCB 3C1BC 4ZUXA 4J8XB 2BYMB 4Z66B 5C3IC 1P3BA 1TZYC 2F8ND 3AZFB 1P3KA 1P3BC 5BS7A 1HQ3A 3MGSA 1P3LA 5JA4B 5GXQB 4KGCC 5B0YA 1P34C 1P3LC 1U35B 3KSYA 3X1UD 2PYOD 5B0ZA 3AZKA 3W98C 3VH5T 3REJB 4Z66D 4J8WB 3AZIB 2NQBB 3W97B 3O62A 5AV5A 2NZDC 3AZFD 5CPIB 3AYWC 2FJ7A 3A6NB 3MGPB 3AZNC 1P3MC 5AV5C 4YM6C 5GXQD 1TAFB 1P3PA 1U35D 3B0CW 5GSUA 5AV8C 5BNXA 3AV1A 4R8PA 3RELA 4G92B 1KX3C 5BNVB 3W96A 5DNMA 4J8WD 3AZID 2NQBD 4CAYB 3W97D 5FUGA 3LELA 3LJAA 3A6ND 2HIOC 4KHAB 3AZLC 1P3GC 3B6GB 4JJND 1BH9B 3TU4A 3UT9C 1KX4A 1WWIA 3W99A 5GT0B 4YS3B 5BO0B 5B0YD 3AZEB 3W99C 4X23B 1P3OB 3MGRA 5B0ZD 5F99C 2YFVA 3AZJB 5B32B 3B6GD 5GT3C 3AZMA 5AY8C 3KXBC 4YS3D 5GT0D 3LZ0C 1S32A 1JFIA 3AZED 1EQZC 3AZGA 4X23D 5B24B 3B6FC 4J8VA 1P3OD 4AWLC 3AZHB 3AN2B 5B40C 3REIB 3RELD 5DNNA 5KDMA 5E5AB 5DNNC 4CSRA 3WTPB 4WU8A 1BFMA 4H9PA 2CV5B 4ZBJC 5B2JC 3TU4D 5B1LB 3UTAB 5CP6B 3MGQB 3REHA 5B24D 4XUJB 3UT9B 3VH6W 1P3AB 3C1CB 1P3IB 3AZHD 4EO5B 1M19B 3AN2D 3NQUB 2F8NA 3MVDB 4XZQB 3B0BA 4H9OB 5G49A 1ID3B 3WTPD 3WAAC 5B2IB 5B1MC 3V9RB 2CV5D 3UTAD 4NFTA 3X1UA 5AV9C 1AOIC 5CP6D 2JSSA 3VH5A 5B33B 5AVCC 4H9RA 3MGQD 3KUYB 2PYOA 4LD9B 4QLCA 1B6WA 3X1TC 1P3AD 3C1CD 1P3ID 1M19D 2BYKB 1M1AC 2BYMA 4Z66A 4E44A 3X1VB 1P3FC 4KUDB 3MVDD 2AROC 3WA9C 2F8NK 3AZFA 3REKB 3UTBC 1KX5C 4XZQD 1F66B 5GXQA 5B2ID 1U35A 4Z5TB 3LZ1C 1R4VA 5CPJB 4G91C 5B33D 4LD9D 3KUYD 1ZLAB 4DRBA 5B31B 3R45B 3REJA 4J8WA 3AZIA 2NQBA 3W97A 4KUDD 1M18B 2HUEB 4NE6A 4UUZB 3REKD 1F66D 3A6NA 3MGPA 3MNNB 4JJNA 3WKJB 3X1SB 1TAFA 4ZUXC 4J8UD 3VH6T 4Z5TD 5CPJD 1KU5A 2YFWB 1P3KC 1ZLAD 5BS7C 5B31D 3B0DB 1HQ3C 3MGSC 4CAYA 5B0YC 4QLCD 4J8XD 3MNND 4Z2MH 4KHAA 3B6GA 4Z2MG 5B0ZC 3AZKC 3AV2B 1BH9A 5AV6B 4HGAB 2AROB 5AVBB 3O62C 1H3OB 5GT0A 4YS3A 2FJ7C 5BO0A 3AZEA 4X23A 4WU9B 1P3OA 1P3PC 2CWEA 5CPKB 2RVQD 5GSUC 5JRGB 1HTAA 3REJD 3AV1C 4R8PC 3AV2D 3RELC 5AV6D 4H9NB 5CPID 3W96C 5DNMC 3AFAB 3KWQB 3MGPD 3C1BB 2F8NH 3LELC 3LJAC 2F8NG 5C3IB 1TZYB 4M6BA 5B24A 1P3BB 3TU4C 4WU9D 3AZHA 5CPKD 4KGCB 3AN2A 1KX4C 5JRGD 1P34B 1P3LB 1Q9CA 5E5AA 3AFAD 3KWQD 3W98B 3WTPA 3C1BD 4DRAA 3MGRC 2CV5A 1TZYD 5B1LA 3UTAA 2NZDB 5CP6A 3MGQA 3AYWB 1P3AA 4NE5A 3C1CA 5AV5B 3AZMC 3AZNB 1P3IA 4YM6B 1P3MB 1M19A 4KGCD 1P34D 1N1JB 3NQUA 4WZSB 3MVDA 2IO5C 1S32C 5AV8B 4XZQA 3AZGC 1A7WA 4J8VC 3W98D 3B0CT 5BT1D 5B32D 3AZJD 1KX3B 5B2IA 3V9RA 2NZDD 5B33A 4LD9A 3AYWD 3KUYA 3AZND 1P3MD 2HIOB 2BYKA 4YM6D 3AZLB 1P3GB 3X1VA 4WU8C 4KUDA 3REKA 5AV8D 1F66A 3REHC 3REID 1KX3D 3W99B 4J8UA 4Z5TA 5CPJA 5E5AD 4J8UC 4H9QB 3NQJB 1ZLAA 5CHLB 5F99B 5B31A 2HIOD 3AZLD 1P3GD 5B1LD 5GT3B 4UUZA 4XUJD 3UT9D 3X1UC 5AY8B 3KXBB 4J8XA 3MNNA 2PYOC 3LZ0B 4QLCC 1EQZB 4Z66C 3B6FB 4AWLB 5JA4A 5B40B 2YFWA 3AZFC 5F99D 1ID3D 4WNNB 4H9SA 5GXQC 5GT3D 5DNNB 2L5AA 1U35C 3VH5W 5AY8D 4ZBJB
chains in the Genus database with same CATH superfamily
3X1VD 5B2JB 3AV2A 1EQZD 5AV6A 4NE3A 3REJC 5CPIA 4J8WC 5AVBA 3AZIC 3B6FD 3W97C 1T3UA 2NQBC 1H3OA 1B67A 5CPIC 2RIQA 4WV4B 3A6NC 3MGPC 4JJNC 4WU9A 5CPKA 3EPHA 4E45A 5JRGA 3WAAB 2DQNC 5BNVA 5B1MB 5B2JD 5AV9B 1F1EA 4G92C 1M18D 1AOIB 4H9NA 5AVCB 3AFAA 3KWQA 1BH8B 3X1TB 3AL0C 3C1BA 1M1AB 3WKJD 3X1SD 1TZYA 1P3FB 3A1KA 3WA9B 3B6GC 3UTBB 1KX5B 2LY8A 4KGCA 2W8SA 3WAAD 1P34A 5B1MD 5GT0C 4YS3C 3LZ1B 3AZEC 5AV9D 1AOID 4G91B 5AVCD 4X23C 3W98A 3X1TD 1P3OC 3AZJA 5B32A 1M1AD 1P3FD 5BT1C 2AROD 5B32C 3AZJC 3WA9D 2NZDA 5AVBD 3AYWA 3UTBD 1KX5D 3AZNA 1P3MA 4YM6A 4ZUXB 1N1JA 3LZ1D 2ZM5A 4JJNB 5AV8A 5B31G 1P3KB 5B24C 3REIA 1W2EA 1HQ3B 3H0RC 3MGSB 3AZHC 1KX3A 3AN2C 3EPJA 3REIC 5B0YB 5E5AC 2HIOA 3AZLA 1P3GA 2G5IC 5B0ZB 3AZKB 3WTPC 4ZUXD 2CV5C 1P3BD 4XUJA 3UT9A 5B1LC 3UTAC 3O62B 5CP6C 3MGQC 1P3KD 2FJ7B 4XUJC 1P3AC 1HQ3D 3MGSD 3C1CC 4EO5C 1P3IC 1P3LD 1M19C 3KFUG 4H9OA 1P3PB 3MVDC 2G5HC 4H9QA 3NQJA 5GSUB 5F99A 1ID3A 4XZQC 5BNXB 2DF4C 3AZKD 4R8PB 3AV1B 5GT3A 3RELB 1ID3C 4UPKA 5B2IC 3W96B 5DNMB 2VQRA 5AY8A 3O62D 5FUGB 5AV5D 3KXBA 5B33C 3LELB 4LD9C 3LZ0A 3LJAB 3KUYC 2Y2GA 2FJ7D 1EQZA 2JCHA 2Y2JA 3B6FA 3X1VC 2ZY4A 3TU4B 1P3PD 4KUDC 3VH6A 5B40A 5GSUD 3REKC 1KX4B 2Y2IA 1F66C 4WNNA 3AV1D 4R8PD 1ULYA 3W96D 5DNMD 4Z5TC 4WJ3C 5CPJC 3MGRB 3LELD 3R45A 3LJAD 1ZLAC 5B2JA 2YFVB 5B31C 1M18A 3AZMB 1M18C 2HUEC 3EPLA 3EPKA 1KX4D 3WKJA 3X1SA 3W99D 4J8XC 3MNNC 2IO5B 2J8PA 1S32B 1JFIB 3WKJC 3AZGB 3X1SC 5B32G 4J8VB 3WAAA 3MGRD 2Y2LA 5B1MA 5AV9A 3B0DC 1AOIA 4H9SC 5AVCA 5KDMB 3KXBD 1BH8A 3X1TA 3AZMD 3LZ0D 4CSRB 1M1AA 2RVQC 1P3FA 1WWSA 4WU8B 1S32D 2AROA 4H9PB 3WA9A 3UTBA 3AV2C 3AZGD 1KX5A 5AV6C 4HGAC 5B40D 3REHB 5AVBC 4J8VD 3LZ1A 3WTPE 5DNND 2F8NB 4J8UB 4WU9C 5G49B 5CPKC 2ZY5A 5JRGC 4WU8D 3X1UB 2PYOB 4H9RB 3AFAC 3KWQC 3REHD 4QLCB 3C1BC 4ZUXA 4J8XB 2BYMB 4Z66B 5C3IC 1P3BA 1TZYC 2F8ND 3AZFB 1P3KA 1P3BC 5BS7A 2ZY3A 1HQ3A 3MGSA 1P3LA 5JA4B 5GXQB 4KGCC 5B0YA 1P34C 1P3LC 1U35B 3KSYA 2UWXA 3X1UD 2PYOD 5B0ZA 3AZKA 3W98C 3VH5T 2ZY2A 3REJB 4Z66D 4J8WB 3AZIB 2NQBB 3W97B 3O62A 5AV5A 2NZDC 3AZFD 5CPIB 3AYWC 2FJ7A 3A6NB 3MGPB 3AZNC 1P3MC 5AV5C 4YM6C 5GXQD 1TAFB 1P3PA 1U35D 3B0CW 5GSUA 5AV8C 3FDDA 5BNXA 3AV1A 4R8PA 4DQYB 4G92B 3RELA 1KX3C 5BNVB 3W96A 5DNMA 4J8WD 3AZID 2NQBD 4CAYB 3W97D 5FUGA 3LELA 3LJAA 3A6ND 2HIOC 4KHAB 3AZLC 1P3GC 3B6GB 4JJND 1BH9B 3TU4A 3UT9C 1KX4A 1WWIA 3W99A 5GT0B 4YS3B 5BO0B 5B0YD 3AZEB 3W99C 4X23B 1P3OB 2JE5A 3MGRA 5B0ZD 5F99C 2YFVA 3AZJB 5B32B 2FFFB 3B6GD 5GT3C 3AZMA 5AY8C 3KXBC 4YS3D 5GT0D 3LZ0C 1S32A 1JFIA 3AZED 1EQZC 3AZGA 4X23D 5B24B 3B6FC 4J8VA 1P3OD 4AWLC 3AZHB 3AN2B 5B40C 3REIB 3RELD 5DNNA 5KDMA 5E5AB 5DNNC 4CSRA 3WTPB 4WU8A 1BFMA 4H9PA 2CV5B 4ZBJC 5B2JC 3TU4D 5B1LB 3UTAB 5CP6B 3MGQB 3REHA 5B24D 4XUJB 3UT9B 3F6TA 3VH6W 1P3AB 3C1CB 1P3IB 3AZHD 4EO5B 1M19B 3AN2D 3NQUB 2F8NA 3MVDB 4XZQB 3B0BA 4H9OB 5G49A 1ID3B 3WTPD 3WAAC 5B2IB 5B1MC 3V9RB 2CV5D 3UTAD 4NFTA 3X1UA 5AV9C 1AOIC 5CP6D 2JSSA 3VH5A 5B33B 4H9RA 5AVCC 3MGQD 3KUYB 2PYOA 4LD9B 4QLCA 1B6WA 3X1TC 1P3AD 3C1CD 1P3ID 1M19D 2BYKB 1M1AC 2BYMA 3IP4C 4E44A 4Z66A 3X1VB 1P3FC 4KUDB 3MVDD 2AROC 3WA9C 2F8NK 3AZFA 3REKB 3UTBC 1KX5C 4XZQD 1F66B 1Z2CB 5GXQA 5B2ID 1U35A 4Z5TB 3LZ1C 1R4VA 5CPJB 4G91C 5B33D 4LD9D 3KUYD 1ZLAB 4DRBA 5B31B 2Y2MA 3P5JB 3R45B 3REJA 4J8WA 3AZIA 2NQBA 3W97A 4KUDD 1M18B 2HUEB 4NE6A 4UUZB 2BG1A 3REKD 1F66D 3A6NA 3MGPA 3MNNB 4JJNA 3WKJB 3A1IA 3X1SB 1TAFA 4ZUXC 4J8UD 3VH6T 4Z5TD 5CPJD 1KU5A 2Y2OA 2YFWB 1P3KC 1ZLAD 5BS7C 5B31D 3B0DB 1HQ3C 3MGSC 4CAYA 5B0YC 4QLCD 4J8XD 3MNND 4Z2MH 4KHAA 3B6GA 4Z2MG 5B0ZC 3AZKC 3AV2B 1BH9A 5AV6B 4HGAB 2AROB 5AVBB 3O62C 1H3OB 5GT0A 4YS3A 3H0LC 2FJ7C 5BO0A 3AZEA 2XD5A 4X23A 4WU9B 1P3OA 2Y2HA 1P3PC 2CWEA 5CPKB 2RVQD 5GSUC 5JRGB 1HTAA 2F2AC 3REJD 3AV1C 4R8PC 3AV2D 3RELC 5AV6D 4H9NB 5CPID 3W96C 5DNMC 3AFAB 3KWQB 3MGPD 3C1BB 2F8NH 3LELC 2Y2PA 3LJAC 2F8NG 5C3IB 1TZYB 4M6BA 5B24A 1P3BB 3TU4C 4WU9D 3AZHA 5CPKD 4KGCB 3AN2A 1KX4C 5JRGD 2Y2QA 1P34B 1P3LB 1Q9CA 5E5AA 3AFAD 3KWQD 3W98B 3WTPA 3C1BD 4DRAA 3MGRC 2CV5A 1TZYD 5B1LA 3UTAA 2NZDB 5CP6A 3MGQA 3AYWB 1P3AA 4NE5A 3C1CA 5AV5B 3AZMC 3AZNB 1P3IA 4YM6B 1P3MB 1M19A 4KGCD 1P34D 1N1JB 3NQUA 4WZSB 3MVDA 2IO5C 1S32C 5AV8B 4XZQA 3AZGC 1A7WA 4J8VC 3W98D 3B0CT 5BT1D 5B32D 3AZJD 1KX3B 5B2IA 3V9RA 2NZDD 5B33A 4LD9A 3AYWD 3KUYA 3AZND 1P3MD 2HIOB 2BYKA 4YM6D 3AZLB 1P3GB 3X1VA 4WU8C 4KUDA 2Y2NA 3REKA 5AV8D 1F66A 3REHC 3REID 1KX3D 3W99B 4J8UA 4Z5TA 5CPJA 5E5AD 4J8UC 4H9QB 3NQJB 1ZLAA 5CHLB 5F99B 5B31A 2HIOD 3AZLD 1P3GD 5B1LD 5GT3B 4UUZA 4XUJD 3UT9D 3X1UC 5AY8B 3KXBB 3H0MC 4J8XA 3MNNA 2PYOC 3LZ0B 4QLCC 1EQZB 3EG5B 4Z66C 2Y2KA 3B6FB 4AWLB 1PZRA 5JA4A 5B40B 2YFWA 3AZFC 5F99D 1ID3D 2XD1A 4H9SA 4WNNB 5GXQC 5GT3D 5DNNB 2L5AA 1U35C 3VH5W 5AY8D 4ZBJB
chains in the Genus database with same CATH topology
3X1VD 5B2JB 3AV2A 1EQZD 5AV6A 4NE3A 3REJC 5CPIA 4J8WC 5AVBA 3AZIC 3B6FD 3W97C 1T3UA 2NQBC 1H3OA 1B67A 5CPIC 2RIQA 4WV4B 3A6NC 3MGPC 4JJNC 4WU9A 5CPKA 3EPHA 4E45A 5JRGA 3WAAB 2DQNC 5BNVA 5B1MB 5B2JD 5AV9B 1F1EA 4G92C 1M18D 1AOIB 4H9NA 5AVCB 3AFAA 3KWQA 1BH8B 3X1TB 3AL0C 3C1BA 1M1AB 3WKJD 3X1SD 1TZYA 1P3FB 3A1KA 3WA9B 3B6GC 3UTBB 1KX5B 2LY8A 4KGCA 2W8SA 3WAAD 1P34A 5B1MD 5GT0C 4YS3C 3LZ1B 3AZEC 5AV9D 1AOID 4G91B 5AVCD 4X23C 3W98A 3X1TD 1P3OC 3AZJA 5B32A 1M1AD 1P3FD 5BT1C 2AROD 5B32C 3AZJC 3WA9D 2NZDA 5AVBD 3AYWA 3UTBD 1KX5D 3AZNA 1P3MA 4YM6A 4ZUXB 1N1JA 3LZ1D 2ZM5A 4JJNB 5AV8A 5B31G 1P3KB 5B24C 3REIA 1W2EA 1HQ3B 3H0RC 3MGSB 3AZHC 1KX3A 3AN2C 3EPJA 3REIC 5B0YB 5E5AC 2HIOA 3AZLA 1P3GA 2G5IC 5B0ZB 3AZKB 3WTPC 4ZUXD 2CV5C 1P3BD 4XUJA 3UT9A 5B1LC 3UTAC 3O62B 5CP6C 3MGQC 1P3KD 2FJ7B 4XUJC 1P3AC 1HQ3D 3MGSD 3C1CC 4EO5C 1P3IC 1P3LD 1M19C 3KFUG 4H9OA 1P3PB 3MVDC 2G5HC 4H9QA 3NQJA 5GSUB 5F99A 1ID3A 4XZQC 5BNXB 2DF4C 3AZKD 4R8PB 3AV1B 5GT3A 3RELB 1ID3C 4UPKA 5B2IC 3W96B 5DNMB 2VQRA 5AY8A 3O62D 5FUGB 5AV5D 3KXBA 5B33C 3LELB 4LD9C 3LZ0A 3LJAB 3KUYC 2Y2GA 2FJ7D 1EQZA 2JCHA 2Y2JA 3B6FA 3X1VC 2ZY4A 3TU4B 1P3PD 4KUDC 3VH6A 5B40A 5GSUD 3REKC 1KX4B 2Y2IA 1F66C 4WNNA 3AV1D 4R8PD 1ULYA 3W96D 5DNMD 4Z5TC 4WJ3C 5CPJC 3MGRB 3LELD 3R45A 3LJAD 1ZLAC 5B2JA 2YFVB 5B31C 1M18A 3AZMB 1M18C 2HUEC 3EPLA 3EPKA 1KX4D 3WKJA 3X1SA 3W99D 4J8XC 3MNNC 2IO5B 2J8PA 1S32B 1JFIB 3WKJC 3AZGB 3X1SC 5B32G 4J8VB 3WAAA 3MGRD 2Y2LA 5B1MA 5AV9A 3B0DC 1AOIA 4H9SC 5AVCA 5KDMB 3KXBD 1BH8A 3X1TA 3AZMD 3LZ0D 4CSRB 1M1AA 2RVQC 1P3FA 1WWSA 4WU8B 1S32D 2AROA 4H9PB 3WA9A 3UTBA 3AV2C 3AZGD 1KX5A 5AV6C 4HGAC 5B40D 3REHB 5AVBC 4J8VD 3LZ1A 3WTPE 5DNND 2F8NB 4J8UB 4WU9C 5G49B 5CPKC 2ZY5A 5JRGC 4WU8D 3X1UB 2PYOB 4H9RB 3AFAC 3KWQC 3REHD 4QLCB 3C1BC 4ZUXA 4J8XB 2BYMB 4Z66B 5C3IC 1P3BA 1TZYC 2F8ND 3AZFB 1P3KA 1P3BC 5BS7A 2ZY3A 1HQ3A 3MGSA 1P3LA 5JA4B 5GXQB 4KGCC 5B0YA 1P34C 1P3LC 1U35B 3KSYA 2UWXA 3X1UD 2PYOD 5B0ZA 3AZKA 3W98C 3VH5T 2ZY2A 3REJB 4Z66D 4J8WB 3AZIB 2NQBB 3W97B 3O62A 5AV5A 2NZDC 3AZFD 5CPIB 3AYWC 2FJ7A 3A6NB 3MGPB 3AZNC 1P3MC 5AV5C 4YM6C 5GXQD 1TAFB 1P3PA 1U35D 3B0CW 5GSUA 5AV8C 3FDDA 5BNXA 3AV1A 4R8PA 4DQYB 4G92B 3RELA 1KX3C 5BNVB 3W96A 5DNMA 4J8WD 3AZID 2NQBD 4CAYB 3W97D 5FUGA 3LELA 3LJAA 3A6ND 2HIOC 4KHAB 3AZLC 1P3GC 3B6GB 4JJND 1BH9B 3TU4A 3UT9C 1KX4A 1WWIA 3W99A 5GT0B 4YS3B 5BO0B 5B0YD 3AZEB 3W99C 4X23B 1P3OB 2JE5A 3MGRA 5B0ZD 5F99C 2YFVA 3AZJB 5B32B 2FFFB 3B6GD 5GT3C 3AZMA 5AY8C 3KXBC 4YS3D 5GT0D 3LZ0C 1S32A 1JFIA 3AZED 1EQZC 3AZGA 4X23D 5B24B 3B6FC 4J8VA 1P3OD 4AWLC 3AZHB 3AN2B 5B40C 3REIB 3RELD 5DNNA 5KDMA 5E5AB 5DNNC 4CSRA 3WTPB 4WU8A 1BFMA 4H9PA 2CV5B 4ZBJC 5B2JC 3TU4D 5B1LB 3UTAB 5CP6B 3MGQB 3REHA 5B24D 4XUJB 3UT9B 3F6TA 3VH6W 1P3AB 3C1CB 1P3IB 3AZHD 4EO5B 1M19B 3AN2D 3NQUB 2F8NA 3MVDB 4XZQB 3B0BA 4H9OB 5G49A 1ID3B 3WTPD 3WAAC 5B2IB 5B1MC 3V9RB 2CV5D 3UTAD 4NFTA 3X1UA 5AV9C 1AOIC 5CP6D 2JSSA 3VH5A 5B33B 4H9RA 5AVCC 3MGQD 3KUYB 2PYOA 4LD9B 4QLCA 1B6WA 3X1TC 1P3AD 3C1CD 1P3ID 1M19D 2BYKB 1M1AC 2BYMA 3IP4C 4E44A 4Z66A 3X1VB 1P3FC 4KUDB 3MVDD 2AROC 3WA9C 2F8NK 3AZFA 3REKB 3UTBC 1KX5C 4XZQD 1F66B 1Z2CB 5GXQA 5B2ID 1U35A 4Z5TB 3LZ1C 1R4VA 5CPJB 4G91C 5B33D 4LD9D 3KUYD 1ZLAB 4DRBA 5B31B 2Y2MA 3P5JB 3R45B 3REJA 4J8WA 3AZIA 2NQBA 3W97A 4KUDD 1M18B 2HUEB 4NE6A 4UUZB 2BG1A 3REKD 1F66D 3A6NA 3MGPA 3MNNB 4JJNA 3WKJB 3A1IA 3X1SB 1TAFA 4ZUXC 4J8UD 3VH6T 4Z5TD 5CPJD 1KU5A 2Y2OA 2YFWB 1P3KC 1ZLAD 5BS7C 5B31D 3B0DB 1HQ3C 3MGSC 4CAYA 5B0YC 4QLCD 4J8XD 3MNND 4Z2MH 4KHAA 3B6GA 4Z2MG 5B0ZC 3AZKC 3AV2B 1BH9A 5AV6B 4HGAB 2AROB 5AVBB 3O62C 1H3OB 5GT0A 4YS3A 3H0LC 2FJ7C 5BO0A 3AZEA 2XD5A 4X23A 4WU9B 1P3OA 2Y2HA 1P3PC 2CWEA 5CPKB 2RVQD 5GSUC 5JRGB 1HTAA 2F2AC 3REJD 3AV1C 4R8PC 3AV2D 3RELC 5AV6D 4H9NB 5CPID 3W96C 5DNMC 3AFAB 3KWQB 3MGPD 3C1BB 2F8NH 3LELC 2Y2PA 3LJAC 2F8NG 5C3IB 1TZYB 4M6BA 5B24A 1P3BB 3TU4C 4WU9D 3AZHA 5CPKD 4KGCB 3AN2A 1KX4C 5JRGD 2Y2QA 1P34B 1P3LB 1Q9CA 5E5AA 3AFAD 3KWQD 3W98B 3WTPA 3C1BD 4DRAA 3MGRC 2CV5A 1TZYD 5B1LA 3UTAA 2NZDB 5CP6A 3MGQA 3AYWB 1P3AA 4NE5A 3C1CA 5AV5B 3AZMC 3AZNB 1P3IA 4YM6B 1P3MB 1M19A 4KGCD 1P34D 1N1JB 3NQUA 4WZSB 3MVDA 2IO5C 1S32C 5AV8B 4XZQA 3AZGC 1A7WA 4J8VC 3W98D 3B0CT 5BT1D 5B32D 3AZJD 1KX3B 5B2IA 3V9RA 2NZDD 5B33A 4LD9A 3AYWD 3KUYA 3AZND 1P3MD 2HIOB 2BYKA 4YM6D 3AZLB 1P3GB 3X1VA 4WU8C 4KUDA 2Y2NA 3REKA 5AV8D 1F66A 3REHC 3REID 1KX3D 3W99B 4J8UA 4Z5TA 5CPJA 5E5AD 4J8UC 4H9QB 3NQJB 1ZLAA 5CHLB 5F99B 5B31A 2HIOD 3AZLD 1P3GD 5B1LD 5GT3B 4UUZA 4XUJD 3UT9D 3X1UC 5AY8B 3KXBB 3H0MC 4J8XA 3MNNA 2PYOC 3LZ0B 4QLCC 1EQZB 3EG5B 4Z66C 2Y2KA 3B6FB 4AWLB 1PZRA 5JA4A 5B40B 2YFWA 3AZFC 5F99D 1ID3D 2XD1A 4H9SA 4WNNB 5GXQC 5GT3D 5DNNB 2L5AA 1U35C 3VH5W 5AY8D 4ZBJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V D;  5B2J B;  3AV2 A;  1EQZ D;  5AV6 A;  4NE3 A;  3REJ C;  5CPI A;  4J8W C;  5AVB A;  3AZI C;  3B6F D;  3W97 C;  2NQB C;  1H3O A;  1B67 A;  5CPI C;  4WV4 B;  3A6N C;  3MGP C;  4JJN C;  4WU9 A;  5CPK A;  4E45 A;  5JRG A;  3WAA B;  5BNV A;  5B1M B;  5B2J D;  5AV9 B;  1F1E A;  4G92 C;  1M18 D;  1AOI B;  4H9N A;  5AVC B;  3AFA A;  3KWQ A;  1BH8 B;  3X1T B;  3C1B A;  1M1A B;  3WKJ D;  3X1S D;  1TZY A;  1P3F B;  3WA9 B;  3B6G C;  3UTB B;  1KX5 B;  2LY8 A;  4KGC A;  3WAA D;  1P34 A;  5B1M D;  5GT0 C;  4YS3 C;  3LZ1 B;  3AZE C;  5AV9 D;  1AOI D;  4G91 B;  5AVC D;  4X23 C;  3W98 A;  3X1T D;  1P3O C;  3AZJ A;  5B32 A;  1M1A D;  1P3F D;  5BT1 C;  2ARO D;  5B32 C;  3AZJ C;  3WA9 D;  2NZD A;  5AVB D;  3AYW A;  3UTB D;  1KX5 D;  3AZN A;  1P3M A;  4YM6 A;  4ZUX B;  1N1J A;  3LZ1 D;  4JJN B;  5AV8 A;  5B31 G;  1P3K B;  5B24 C;  3REI A;  1HQ3 B;  3MGS B;  3AZH C;  1KX3 A;  3AN2 C;  3REI C;  5B0Y B;  5E5A C;  2HIO A;  3AZL A;  1P3G A;  5B0Z B;  3AZK B;  3WTP C;  4ZUX D;  2CV5 C;  1P3B D;  4XUJ A;  3UT9 A;  5B1L C;  3UTA C;  3O62 B;  5CP6 C;  3MGQ C;  1P3K D;  2FJ7 B;  4XUJ C;  1P3A C;  1HQ3 D;  3MGS D;  3C1C C;  4EO5 C;  1P3I C;  1P3L D;  1M19 C;  4H9O A;  1P3P B;  3MVD C;  4H9Q A;  3NQJ A;  5GSU B;  5F99 A;  1ID3 A;  4XZQ C;  5BNX B;  3AZK D;  4R8P B;  3AV1 B;  5GT3 A;  3REL B;  1ID3 C;  5B2I C;  3W96 B;  5DNM B;  5AY8 A;  3O62 D;  5FUG B;  5AV5 D;  3KXB A;  5B33 C;  3LEL B;  4LD9 C;  3LZ0 A;  3LJA B;  3KUY C;  2FJ7 D;  1EQZ A;  3B6F A;  3X1V C;  3TU4 B;  1P3P D;  4KUD C;  3VH6 A;  5B40 A;  5GSU D;  3REK C;  1KX4 B;  1F66 C;  4WNN A;  3AV1 D;  4R8P D;  1ULY A;  3W96 D;  5DNM D;  4Z5T C;  5CPJ C;  3MGR B;  3LEL D;  3R45 A;  3LJA D;  1ZLA C;  5B2J A;  2YFV B;  5B31 C;  1M18 A;  3AZM B;  1M18 C;  2HUE C;  1KX4 D;  3WKJ A;  3X1S A;  3W99 D;  4J8X C;  3MNN C;  2IO5 B;  1S32 B;  1JFI B;  3WKJ C;  3AZG B;  3X1S C;  5B32 G;  4J8V B;  3WAA A;  3MGR D;  5B1M A;  5AV9 A;  3B0D C;  1AOI A;  4H9S C;  5AVC A;  5KDM B;  3KXB D;  1BH8 A;  3X1T A;  3AZM D;  3LZ0 D;  4CSR B;  1M1A A;  2RVQ C;  1P3F A;  1WWS A;  4WU8 B;  1S32 D;  2ARO A;  4H9P B;  3WA9 A;  3UTB A;  3AV2 C;  3AZG D;  1KX5 A;  5AV6 C;  4HGA C;  5B40 D;  3REH B;  5AVB C;  4J8V D;  3LZ1 A;  3WTP E;  5DNN D;  2F8N B;  4J8U B;  4WU9 C;  5G49 B;  5CPK C;  5JRG C;  4WU8 D;  3X1U B;  2PYO B;  4H9R B;  3AFA C;  3KWQ C;  3REH D;  4QLC B;  3C1B C;  4ZUX A;  4J8X B;  2BYM B;  4Z66 B;  5C3I C;  1P3B A;  1TZY C;  2F8N D;  3AZF B;  1P3K A;  1P3B C;  5BS7 A;  1HQ3 A;  3MGS A;  1P3L A;  5JA4 B;  5GXQ B;  4KGC C;  5B0Y A;  1P34 C;  1P3L C;  1U35 B;  3KSY A;  3X1U D;  2PYO D;  5B0Z A;  3AZK A;  3W98 C;  3VH5 T;  3REJ B;  4Z66 D;  4J8W B;  3AZI B;  2NQB B;  3W97 B;  3O62 A;  5AV5 A;  2NZD C;  3AZF D;  5CPI B;  3AYW C;  2FJ7 A;  3A6N B;  3MGP B;  3AZN C;  1P3M C;  5AV5 C;  4YM6 C;  5GXQ D;  1TAF B;  1P3P A;  1U35 D;  3B0C W;  5GSU A;  5AV8 C;  5BNX A;  3AV1 A;  4R8P A;  3REL A;  4G92 B;  1KX3 C;  5BNV B;  3W96 A;  5DNM A;  4J8W D;  3AZI D;  2NQB D;  4CAY B;  3W97 D;  5FUG A;  3LEL A;  3LJA A;  3A6N D;  2HIO C;  4KHA B;  3AZL C;  1P3G C;  3B6G B;  4JJN D;  1BH9 B;  3TU4 A;  3UT9 C;  1KX4 A;  1WWI A;  3W99 A;  5GT0 B;  4YS3 B;  5BO0 B;  5B0Y D;  3AZE B;  3W99 C;  4X23 B;  1P3O B;  3MGR A;  5B0Z D;  5F99 C;  2YFV A;  3AZJ B;  5B32 B;  3B6G D;  5GT3 C;  3AZM A;  5AY8 C;  3KXB C;  4YS3 D;  5GT0 D;  3LZ0 C;  1S32 A;  1JFI A;  3AZE D;  1EQZ C;  3AZG A;  4X23 D;  5B24 B;  3B6F C;  4J8V A;  1P3O D;  4AWL C;  3AZH B;  3AN2 B;  5B40 C;  3REI B;  3REL D;  5DNN A;  5KDM A;  5E5A B;  5DNN C;  4CSR A;  3WTP B;  4WU8 A;  1BFM A;  4H9P A;  2CV5 B;  4ZBJ C;  5B2J C;  3TU4 D;  5B1L B;  3UTA B;  5CP6 B;  3MGQ B;  3REH A;  5B24 D;  4XUJ B;  3UT9 B;  3VH6 W;  1P3A B;  3C1C B;  1P3I B;  3AZH D;  4EO5 B;  1M19 B;  3AN2 D;  3NQU B;  2F8N A;  3MVD B;  4XZQ B;  3B0B A;  4H9O B;  5G49 A;  1ID3 B;  3WTP D;  3WAA C;  5B2I B;  5B1M C;  3V9R B;  2CV5 D;  3UTA D;  4NFT A;  3X1U A;  5AV9 C;  1AOI C;  5CP6 D;  2JSS A;  3VH5 A;  5B33 B;  5AVC C;  4H9R A;  3MGQ D;  3KUY B;  2PYO A;  4LD9 B;  4QLC A;  1B6W A;  3X1T C;  1P3A D;  3C1C D;  1P3I D;  1M19 D;  2BYK B;  1M1A C;  2BYM A;  4Z66 A;  4E44 A;  3X1V B;  1P3F C;  4KUD B;  3MVD D;  2ARO C;  3WA9 C;  2F8N K;  3AZF A;  3REK B;  3UTB C;  1KX5 C;  4XZQ D;  1F66 B;  5GXQ A;  5B2I D;  1U35 A;  4Z5T B;  3LZ1 C;  1R4V A;  5CPJ B;  4G91 C;  5B33 D;  4LD9 D;  3KUY D;  1ZLA B;  4DRB A;  5B31 B;  3R45 B;  3REJ A;  4J8W A;  3AZI A;  2NQB A;  3W97 A;  4KUD D;  1M18 B;  2HUE B;  4NE6 A;  4UUZ B;  3REK D;  1F66 D;  3A6N A;  3MGP A;  3MNN B;  4JJN A;  3WKJ B;  3X1S B;  1TAF A;  4ZUX C;  4J8U D;  3VH6 T;  4Z5T D;  5CPJ D;  1KU5 A;  2YFW B;  1P3K C;  1ZLA D;  5BS7 C;  5B31 D;  3B0D B;  1HQ3 C;  3MGS C;  4CAY A;  5B0Y C;  4QLC D;  4J8X D;  3MNN D;  4Z2M H;  4KHA A;  3B6G A;  4Z2M G;  5B0Z C;  3AZK C;  3AV2 B;  1BH9 A;  5AV6 B;  4HGA B;  2ARO B;  5AVB B;  3O62 C;  1H3O B;  5GT0 A;  4YS3 A;  2FJ7 C;  5BO0 A;  3AZE A;  4X23 A;  4WU9 B;  1P3O A;  1P3P C;  2CWE A;  5CPK B;  2RVQ D;  5GSU C;  5JRG B;  1HTA A;  3REJ D;  3AV1 C;  4R8P C;  3AV2 D;  3REL C;  5AV6 D;  4H9N B;  5CPI D;  3W96 C;  5DNM C;  3AFA B;  3KWQ B;  3MGP D;  3C1B B;  2F8N H;  3LEL C;  3LJA C;  2F8N G;  5C3I B;  1TZY B;  4M6B A;  5B24 A;  1P3B B;  3TU4 C;  4WU9 D;  3AZH A;  5CPK D;  4KGC B;  3AN2 A;  1KX4 C;  5JRG D;  1P34 B;  1P3L B;  1Q9C A;  5E5A A;  3AFA D;  3KWQ D;  3W98 B;  3WTP A;  3C1B D;  4DRA A;  3MGR C;  2CV5 A;  1TZY D;  5B1L A;  3UTA A;  2NZD B;  5CP6 A;  3MGQ A;  3AYW B;  1P3A A;  4NE5 A;  3C1C A;  5AV5 B;  3AZM C;  3AZN B;  1P3I A;  4YM6 B;  1P3M B;  1M19 A;  4KGC D;  1P34 D;  1N1J B;  3NQU A;  4WZS B;  3MVD A;  2IO5 C;  1S32 C;  5AV8 B;  4XZQ A;  3AZG C;  1A7W A;  4J8V C;  3W98 D;  3B0C T;  5BT1 D;  5B32 D;  3AZJ D;  1KX3 B;  5B2I A;  3V9R A;  2NZD D;  5B33 A;  4LD9 A;  3AYW D;  3KUY A;  3AZN D;  1P3M D;  2HIO B;  2BYK A;  4YM6 D;  3AZL B;  1P3G B;  3X1V A;  4WU8 C;  4KUD A;  3REK A;  5AV8 D;  1F66 A;  3REH C;  3REI D;  1KX3 D;  3W99 B;  4J8U A;  4Z5T A;  5CPJ A;  5E5A D;  4J8U C;  4H9Q B;  3NQJ B;  1ZLA A;  5CHL B;  5F99 B;  5B31 A;  2HIO D;  3AZL D;  1P3G D;  5B1L D;  5GT3 B;  4UUZ A;  4XUJ D;  3UT9 D;  3X1U C;  5AY8 B;  3KXB B;  4J8X A;  3MNN A;  2PYO C;  3LZ0 B;  4QLC C;  1EQZ B;  4Z66 C;  3B6F B;  4AWL B;  5JA4 A;  5B40 B;  2YFW A;  3AZF C;  5F99 D;  1ID3 D;  4WNN B;  4H9S A;  5GXQ C;  5GT3 D;  5DNN B;  2L5A A;  1U35 C;  3VH5 W;  5AY8 D;  4ZBJ B; 
#chains in the Genus database with same CATH topology
 3X1V D;  5B2J B;  3AV2 A;  1EQZ D;  5AV6 A;  4NE3 A;  3REJ C;  5CPI A;  4J8W C;  5AVB A;  3AZI C;  3B6F D;  3W97 C;  1T3U A;  2NQB C;  1H3O A;  1B67 A;  5CPI C;  2RIQ A;  4WV4 B;  3A6N C;  3MGP C;  4JJN C;  4WU9 A;  5CPK A;  3EPH A;  4E45 A;  5JRG A;  3WAA B;  2DQN C;  5BNV A;  5B1M B;  5B2J D;  5AV9 B;  1F1E A;  4G92 C;  1M18 D;  1AOI B;  4H9N A;  5AVC B;  3AFA A;  3KWQ A;  1BH8 B;  3X1T B;  3AL0 C;  3C1B A;  1M1A B;  3WKJ D;  3X1S D;  1TZY A;  1P3F B;  3A1K A;  3WA9 B;  3B6G C;  3UTB B;  1KX5 B;  2LY8 A;  4KGC A;  2W8S A;  3WAA D;  1P34 A;  5B1M D;  5GT0 C;  4YS3 C;  3LZ1 B;  3AZE C;  5AV9 D;  1AOI D;  4G91 B;  5AVC D;  4X23 C;  3W98 A;  3X1T D;  1P3O C;  3AZJ A;  5B32 A;  1M1A D;  1P3F D;  5BT1 C;  2ARO D;  5B32 C;  3AZJ C;  3WA9 D;  2NZD A;  5AVB D;  3AYW A;  3UTB D;  1KX5 D;  3AZN A;  1P3M A;  4YM6 A;  4ZUX B;  1N1J A;  3LZ1 D;  2ZM5 A;  4JJN B;  5AV8 A;  5B31 G;  1P3K B;  5B24 C;  3REI A;  1W2E A;  1HQ3 B;  3H0R C;  3MGS B;  3AZH C;  1KX3 A;  3AN2 C;  3EPJ A;  3REI C;  5B0Y B;  5E5A C;  2HIO A;  3AZL A;  1P3G A;  2G5I C;  5B0Z B;  3AZK B;  3WTP C;  4ZUX D;  2CV5 C;  1P3B D;  4XUJ A;  3UT9 A;  5B1L C;  3UTA C;  3O62 B;  5CP6 C;  3MGQ C;  1P3K D;  2FJ7 B;  4XUJ C;  1P3A C;  1HQ3 D;  3MGS D;  3C1C C;  4EO5 C;  1P3I C;  1P3L D;  1M19 C;  3KFU G;  4H9O A;  1P3P B;  3MVD C;  2G5H C;  4H9Q A;  3NQJ A;  5GSU B;  5F99 A;  1ID3 A;  4XZQ C;  5BNX B;  2DF4 C;  3AZK D;  4R8P B;  3AV1 B;  5GT3 A;  3REL B;  1ID3 C;  4UPK A;  5B2I C;  3W96 B;  5DNM B;  2VQR A;  5AY8 A;  3O62 D;  5FUG B;  5AV5 D;  3KXB A;  5B33 C;  3LEL B;  4LD9 C;  3LZ0 A;  3LJA B;  3KUY C;  2Y2G A;  2FJ7 D;  1EQZ A;  2JCH A;  2Y2J A;  3B6F A;  3X1V C;  2ZY4 A;  3TU4 B;  1P3P D;  4KUD C;  3VH6 A;  5B40 A;  5GSU D;  3REK C;  1KX4 B;  2Y2I A;  1F66 C;  4WNN A;  3AV1 D;  4R8P D;  1ULY A;  3W96 D;  5DNM D;  4Z5T C;  4WJ3 C;  5CPJ C;  3MGR B;  3LEL D;  3R45 A;  3LJA D;  1ZLA C;  5B2J A;  2YFV B;  5B31 C;  1M18 A;  3AZM B;  1M18 C;  2HUE C;  3EPL A;  3EPK A;  1KX4 D;  3WKJ A;  3X1S A;  3W99 D;  4J8X C;  3MNN C;  2IO5 B;  2J8P A;  1S32 B;  1JFI B;  3WKJ C;  3AZG B;  3X1S C;  5B32 G;  4J8V B;  3WAA A;  3MGR D;  2Y2L A;  5B1M A;  5AV9 A;  3B0D C;  1AOI A;  4H9S C;  5AVC A;  5KDM B;  3KXB D;  1BH8 A;  3X1T A;  3AZM D;  3LZ0 D;  4CSR B;  1M1A A;  2RVQ C;  1P3F A;  1WWS A;  4WU8 B;  1S32 D;  2ARO A;  4H9P B;  3WA9 A;  3UTB A;  3AV2 C;  3AZG D;  1KX5 A;  5AV6 C;  4HGA C;  5B40 D;  3REH B;  5AVB C;  4J8V D;  3LZ1 A;  3WTP E;  5DNN D;  2F8N B;  4J8U B;  4WU9 C;  5G49 B;  5CPK C;  2ZY5 A;  5JRG C;  4WU8 D;  3X1U B;  2PYO B;  4H9R B;  3AFA C;  3KWQ C;  3REH D;  4QLC B;  3C1B C;  4ZUX A;  4J8X B;  2BYM B;  4Z66 B;  5C3I C;  1P3B A;  1TZY C;  2F8N D;  3AZF B;  1P3K A;  1P3B C;  5BS7 A;  2ZY3 A;  1HQ3 A;  3MGS A;  1P3L A;  5JA4 B;  5GXQ B;  4KGC C;  5B0Y A;  1P34 C;  1P3L C;  1U35 B;  3KSY A;  2UWX A;  3X1U D;  2PYO D;  5B0Z A;  3AZK A;  3W98 C;  3VH5 T;  2ZY2 A;  3REJ B;  4Z66 D;  4J8W B;  3AZI B;  2NQB B;  3W97 B;  3O62 A;  5AV5 A;  2NZD C;  3AZF D;  5CPI B;  3AYW C;  2FJ7 A;  3A6N B;  3MGP B;  3AZN C;  1P3M C;  5AV5 C;  4YM6 C;  5GXQ D;  1TAF B;  1P3P A;  1U35 D;  3B0C W;  5GSU A;  5AV8 C;  3FDD A;  5BNX A;  3AV1 A;  4R8P A;  4DQY B;  4G92 B;  3REL A;  1KX3 C;  5BNV B;  3W96 A;  5DNM A;  4J8W D;  3AZI D;  2NQB D;  4CAY B;  3W97 D;  5FUG A;  3LEL A;  3LJA A;  3A6N D;  2HIO C;  4KHA B;  3AZL C;  1P3G C;  3B6G B;  4JJN D;  1BH9 B;  3TU4 A;  3UT9 C;  1KX4 A;  1WWI A;  3W99 A;  5GT0 B;  4YS3 B;  5BO0 B;  5B0Y D;  3AZE B;  3W99 C;  4X23 B;  1P3O B;  2JE5 A;  3MGR A;  5B0Z D;  5F99 C;  2YFV A;  3AZJ B;  5B32 B;  2FFF B;  3B6G D;  5GT3 C;  3AZM A;  5AY8 C;  3KXB C;  4YS3 D;  5GT0 D;  3LZ0 C;  1S32 A;  1JFI A;  3AZE D;  1EQZ C;  3AZG A;  4X23 D;  5B24 B;  3B6F C;  4J8V A;  1P3O D;  4AWL C;  3AZH B;  3AN2 B;  5B40 C;  3REI B;  3REL D;  5DNN A;  5KDM A;  5E5A B;  5DNN C;  4CSR A;  3WTP B;  4WU8 A;  1BFM A;  4H9P A;  2CV5 B;  4ZBJ C;  5B2J C;  3TU4 D;  5B1L B;  3UTA B;  5CP6 B;  3MGQ B;  3REH A;  5B24 D;  4XUJ B;  3UT9 B;  3F6T A;  3VH6 W;  1P3A B;  3C1C B;  1P3I B;  3AZH D;  4EO5 B;  1M19 B;  3AN2 D;  3NQU B;  2F8N A;  3MVD B;  4XZQ B;  3B0B A;  4H9O B;  5G49 A;  1ID3 B;  3WTP D;  3WAA C;  5B2I B;  5B1M C;  3V9R B;  2CV5 D;  3UTA D;  4NFT A;  3X1U A;  5AV9 C;  1AOI C;  5CP6 D;  2JSS A;  3VH5 A;  5B33 B;  4H9R A;  5AVC C;  3MGQ D;  3KUY B;  2PYO A;  4LD9 B;  4QLC A;  1B6W A;  3X1T C;  1P3A D;  3C1C D;  1P3I D;  1M19 D;  2BYK B;  1M1A C;  2BYM A;  3IP4 C;  4E44 A;  4Z66 A;  3X1V B;  1P3F C;  4KUD B;  3MVD D;  2ARO C;  3WA9 C;  2F8N K;  3AZF A;  3REK B;  3UTB C;  1KX5 C;  4XZQ D;  1F66 B;  1Z2C B;  5GXQ A;  5B2I D;  1U35 A;  4Z5T B;  3LZ1 C;  1R4V A;  5CPJ B;  4G91 C;  5B33 D;  4LD9 D;  3KUY D;  1ZLA B;  4DRB A;  5B31 B;  2Y2M A;  3P5J B;  3R45 B;  3REJ A;  4J8W A;  3AZI A;  2NQB A;  3W97 A;  4KUD D;  1M18 B;  2HUE B;  4NE6 A;  4UUZ B;  2BG1 A;  3REK D;  1F66 D;  3A6N A;  3MGP A;  3MNN B;  4JJN A;  3WKJ B;  3A1I A;  3X1S B;  1TAF A;  4ZUX C;  4J8U D;  3VH6 T;  4Z5T D;  5CPJ D;  1KU5 A;  2Y2O A;  2YFW B;  1P3K C;  1ZLA D;  5BS7 C;  5B31 D;  3B0D B;  1HQ3 C;  3MGS C;  4CAY A;  5B0Y C;  4QLC D;  4J8X D;  3MNN D;  4Z2M H;  4KHA A;  3B6G A;  4Z2M G;  5B0Z C;  3AZK C;  3AV2 B;  1BH9 A;  5AV6 B;  4HGA B;  2ARO B;  5AVB B;  3O62 C;  1H3O B;  5GT0 A;  4YS3 A;  3H0L C;  2FJ7 C;  5BO0 A;  3AZE A;  2XD5 A;  4X23 A;  4WU9 B;  1P3O A;  2Y2H A;  1P3P C;  2CWE A;  5CPK B;  2RVQ D;  5GSU C;  5JRG B;  1HTA A;  2F2A C;  3REJ D;  3AV1 C;  4R8P C;  3AV2 D;  3REL C;  5AV6 D;  4H9N B;  5CPI D;  3W96 C;  5DNM C;  3AFA B;  3KWQ B;  3MGP D;  3C1B B;  2F8N H;  3LEL C;  2Y2P A;  3LJA C;  2F8N G;  5C3I B;  1TZY B;  4M6B A;  5B24 A;  1P3B B;  3TU4 C;  4WU9 D;  3AZH A;  5CPK D;  4KGC B;  3AN2 A;  1KX4 C;  5JRG D;  2Y2Q A;  1P34 B;  1P3L B;  1Q9C A;  5E5A A;  3AFA D;  3KWQ D;  3W98 B;  3WTP A;  3C1B D;  4DRA A;  3MGR C;  2CV5 A;  1TZY D;  5B1L A;  3UTA A;  2NZD B;  5CP6 A;  3MGQ A;  3AYW B;  1P3A A;  4NE5 A;  3C1C A;  5AV5 B;  3AZM C;  3AZN B;  1P3I A;  4YM6 B;  1P3M B;  1M19 A;  4KGC D;  1P34 D;  1N1J B;  3NQU A;  4WZS B;  3MVD A;  2IO5 C;  1S32 C;  5AV8 B;  4XZQ A;  3AZG C;  1A7W A;  4J8V C;  3W98 D;  3B0C T;  5BT1 D;  5B32 D;  3AZJ D;  1KX3 B;  5B2I A;  3V9R A;  2NZD D;  5B33 A;  4LD9 A;  3AYW D;  3KUY A;  3AZN D;  1P3M D;  2HIO B;  2BYK A;  4YM6 D;  3AZL B;  1P3G B;  3X1V A;  4WU8 C;  4KUD A;  2Y2N A;  3REK A;  5AV8 D;  1F66 A;  3REH C;  3REI D;  1KX3 D;  3W99 B;  4J8U A;  4Z5T A;  5CPJ A;  5E5A D;  4J8U C;  4H9Q B;  3NQJ B;  1ZLA A;  5CHL B;  5F99 B;  5B31 A;  2HIO D;  3AZL D;  1P3G D;  5B1L D;  5GT3 B;  4UUZ A;  4XUJ D;  3UT9 D;  3X1U C;  5AY8 B;  3KXB B;  3H0M C;  4J8X A;  3MNN A;  2PYO C;  3LZ0 B;  4QLC C;  1EQZ B;  3EG5 B;  4Z66 C;  2Y2K A;  3B6F B;  4AWL B;  1PZR A;  5JA4 A;  5B40 B;  2YFW A;  3AZF C;  5F99 D;  1ID3 D;  2XD1 A;  4H9S A;  4WNN B;  5GXQ C;  5GT3 D;  5DNN B;  2L5A A;  1U35 C;  3VH5 W;  5AY8 D;  4ZBJ B; 
#chains in the Genus database with same CATH homology
 3X1V D;  5B2J B;  3AV2 A;  1EQZ D;  5AV6 A;  4NE3 A;  3REJ C;  5CPI A;  4J8W C;  5AVB A;  3AZI C;  3B6F D;  3W97 C;  1T3U A;  2NQB C;  1H3O A;  1B67 A;  5CPI C;  2RIQ A;  4WV4 B;  3A6N C;  3MGP C;  4JJN C;  4WU9 A;  5CPK A;  3EPH A;  4E45 A;  5JRG A;  3WAA B;  2DQN C;  5BNV A;  5B1M B;  5B2J D;  5AV9 B;  1F1E A;  4G92 C;  1M18 D;  1AOI B;  4H9N A;  5AVC B;  3AFA A;  3KWQ A;  1BH8 B;  3X1T B;  3AL0 C;  3C1B A;  1M1A B;  3WKJ D;  3X1S D;  1TZY A;  1P3F B;  3A1K A;  3WA9 B;  3B6G C;  3UTB B;  1KX5 B;  2LY8 A;  4KGC A;  2W8S A;  3WAA D;  1P34 A;  5B1M D;  5GT0 C;  4YS3 C;  3LZ1 B;  3AZE C;  5AV9 D;  1AOI D;  4G91 B;  5AVC D;  4X23 C;  3W98 A;  3X1T D;  1P3O C;  3AZJ A;  5B32 A;  1M1A D;  1P3F D;  5BT1 C;  2ARO D;  5B32 C;  3AZJ C;  3WA9 D;  2NZD A;  5AVB D;  3AYW A;  3UTB D;  1KX5 D;  3AZN A;  1P3M A;  4YM6 A;  4ZUX B;  1N1J A;  3LZ1 D;  2ZM5 A;  4JJN B;  5AV8 A;  5B31 G;  1P3K B;  5B24 C;  3REI A;  1W2E A;  1HQ3 B;  3H0R C;  3MGS B;  3AZH C;  1KX3 A;  3AN2 C;  3EPJ A;  3REI C;  5B0Y B;  5E5A C;  2HIO A;  3AZL A;  1P3G A;  2G5I C;  5B0Z B;  3AZK B;  3WTP C;  4ZUX D;  2CV5 C;  1P3B D;  4XUJ A;  3UT9 A;  5B1L C;  3UTA C;  3O62 B;  5CP6 C;  3MGQ C;  1P3K D;  2FJ7 B;  4XUJ C;  1P3A C;  1HQ3 D;  3MGS D;  3C1C C;  4EO5 C;  1P3I C;  1P3L D;  1M19 C;  3KFU G;  4H9O A;  1P3P B;  3MVD C;  2G5H C;  4H9Q A;  3NQJ A;  5GSU B;  5F99 A;  1ID3 A;  4XZQ C;  5BNX B;  2DF4 C;  3AZK D;  4R8P B;  3AV1 B;  5GT3 A;  3REL B;  1ID3 C;  4UPK A;  5B2I C;  3W96 B;  5DNM B;  2VQR A;  5AY8 A;  3O62 D;  5FUG B;  5AV5 D;  3KXB A;  5B33 C;  3LEL B;  4LD9 C;  3LZ0 A;  3LJA B;  3KUY C;  2Y2G A;  2FJ7 D;  1EQZ A;  2JCH A;  2Y2J A;  3B6F A;  3X1V C;  2ZY4 A;  3TU4 B;  1P3P D;  4KUD C;  3VH6 A;  5B40 A;  5GSU D;  3REK C;  1KX4 B;  2Y2I A;  1F66 C;  4WNN A;  3AV1 D;  4R8P D;  1ULY A;  3W96 D;  5DNM D;  4Z5T C;  4WJ3 C;  5CPJ C;  3MGR B;  3LEL D;  3R45 A;  3LJA D;  1ZLA C;  5B2J A;  2YFV B;  5B31 C;  1M18 A;  3AZM B;  1M18 C;  2HUE C;  3EPL A;  3EPK A;  1KX4 D;  3WKJ A;  3X1S A;  3W99 D;  4J8X C;  3MNN C;  2IO5 B;  2J8P A;  1S32 B;  1JFI B;  3WKJ C;  3AZG B;  3X1S C;  5B32 G;  4J8V B;  3WAA A;  3MGR D;  2Y2L A;  5B1M A;  5AV9 A;  3B0D C;  1AOI A;  4H9S C;  5AVC A;  5KDM B;  3KXB D;  1BH8 A;  3X1T A;  3AZM D;  3LZ0 D;  4CSR B;  1M1A A;  2RVQ C;  1P3F A;  1WWS A;  4WU8 B;  1S32 D;  2ARO A;  4H9P B;  3WA9 A;  3UTB A;  3AV2 C;  3AZG D;  1KX5 A;  5AV6 C;  4HGA C;  5B40 D;  3REH B;  5AVB C;  4J8V D;  3LZ1 A;  3WTP E;  5DNN D;  2F8N B;  4J8U B;  4WU9 C;  5G49 B;  5CPK C;  2ZY5 A;  5JRG C;  4WU8 D;  3X1U B;  2PYO B;  4H9R B;  3AFA C;  3KWQ C;  3REH D;  4QLC B;  3C1B C;  4ZUX A;  4J8X B;  2BYM B;  4Z66 B;  5C3I C;  1P3B A;  1TZY C;  2F8N D;  3AZF B;  1P3K A;  1P3B C;  5BS7 A;  2ZY3 A;  1HQ3 A;  3MGS A;  1P3L A;  5JA4 B;  5GXQ B;  4KGC C;  5B0Y A;  1P34 C;  1P3L C;  1U35 B;  3KSY A;  2UWX A;  3X1U D;  2PYO D;  5B0Z A;  3AZK A;  3W98 C;  3VH5 T;  2ZY2 A;  3REJ B;  4Z66 D;  4J8W B;  3AZI B;  2NQB B;  3W97 B;  3O62 A;  5AV5 A;  2NZD C;  3AZF D;  5CPI B;  3AYW C;  2FJ7 A;  3A6N B;  3MGP B;  3AZN C;  1P3M C;  5AV5 C;  4YM6 C;  5GXQ D;  1TAF B;  1P3P A;  1U35 D;  3B0C W;  5GSU A;  5AV8 C;  3FDD A;  5BNX A;  3AV1 A;  4R8P A;  4DQY B;  4G92 B;  3REL A;  1KX3 C;  5BNV B;  3W96 A;  5DNM A;  4J8W D;  3AZI D;  2NQB D;  4CAY B;  3W97 D;  5FUG A;  3LEL A;  3LJA A;  3A6N D;  2HIO C;  4KHA B;  3AZL C;  1P3G C;  3B6G B;  4JJN D;  1BH9 B;  3TU4 A;  3UT9 C;  1KX4 A;  1WWI A;  3W99 A;  5GT0 B;  4YS3 B;  5BO0 B;  5B0Y D;  3AZE B;  3W99 C;  4X23 B;  1P3O B;  2JE5 A;  3MGR A;  5B0Z D;  5F99 C;  2YFV A;  3AZJ B;  5B32 B;  2FFF B;  3B6G D;  5GT3 C;  3AZM A;  5AY8 C;  3KXB C;  4YS3 D;  5GT0 D;  3LZ0 C;  1S32 A;  1JFI A;  3AZE D;  1EQZ C;  3AZG A;  4X23 D;  5B24 B;  3B6F C;  4J8V A;  1P3O D;  4AWL C;  3AZH B;  3AN2 B;  5B40 C;  3REI B;  3REL D;  5DNN A;  5KDM A;  5E5A B;  5DNN C;  4CSR A;  3WTP B;  4WU8 A;  1BFM A;  4H9P A;  2CV5 B;  4ZBJ C;  5B2J C;  3TU4 D;  5B1L B;  3UTA B;  5CP6 B;  3MGQ B;  3REH A;  5B24 D;  4XUJ B;  3UT9 B;  3F6T A;  3VH6 W;  1P3A B;  3C1C B;  1P3I B;  3AZH D;  4EO5 B;  1M19 B;  3AN2 D;  3NQU B;  2F8N A;  3MVD B;  4XZQ B;  3B0B A;  4H9O B;  5G49 A;  1ID3 B;  3WTP D;  3WAA C;  5B2I B;  5B1M C;  3V9R B;  2CV5 D;  3UTA D;  4NFT A;  3X1U A;  5AV9 C;  1AOI C;  5CP6 D;  2JSS A;  3VH5 A;  5B33 B;  4H9R A;  5AVC C;  3MGQ D;  3KUY B;  2PYO A;  4LD9 B;  4QLC A;  1B6W A;  3X1T C;  1P3A D;  3C1C D;  1P3I D;  1M19 D;  2BYK B;  1M1A C;  2BYM A;  3IP4 C;  4E44 A;  4Z66 A;  3X1V B;  1P3F C;  4KUD B;  3MVD D;  2ARO C;  3WA9 C;  2F8N K;  3AZF A;  3REK B;  3UTB C;  1KX5 C;  4XZQ D;  1F66 B;  1Z2C B;  5GXQ A;  5B2I D;  1U35 A;  4Z5T B;  3LZ1 C;  1R4V A;  5CPJ B;  4G91 C;  5B33 D;  4LD9 D;  3KUY D;  1ZLA B;  4DRB A;  5B31 B;  2Y2M A;  3P5J B;  3R45 B;  3REJ A;  4J8W A;  3AZI A;  2NQB A;  3W97 A;  4KUD D;  1M18 B;  2HUE B;  4NE6 A;  4UUZ B;  2BG1 A;  3REK D;  1F66 D;  3A6N A;  3MGP A;  3MNN B;  4JJN A;  3WKJ B;  3A1I A;  3X1S B;  1TAF A;  4ZUX C;  4J8U D;  3VH6 T;  4Z5T D;  5CPJ D;  1KU5 A;  2Y2O A;  2YFW B;  1P3K C;  1ZLA D;  5BS7 C;  5B31 D;  3B0D B;  1HQ3 C;  3MGS C;  4CAY A;  5B0Y C;  4QLC D;  4J8X D;  3MNN D;  4Z2M H;  4KHA A;  3B6G A;  4Z2M G;  5B0Z C;  3AZK C;  3AV2 B;  1BH9 A;  5AV6 B;  4HGA B;  2ARO B;  5AVB B;  3O62 C;  1H3O B;  5GT0 A;  4YS3 A;  3H0L C;  2FJ7 C;  5BO0 A;  3AZE A;  2XD5 A;  4X23 A;  4WU9 B;  1P3O A;  2Y2H A;  1P3P C;  2CWE A;  5CPK B;  2RVQ D;  5GSU C;  5JRG B;  1HTA A;  2F2A C;  3REJ D;  3AV1 C;  4R8P C;  3AV2 D;  3REL C;  5AV6 D;  4H9N B;  5CPI D;  3W96 C;  5DNM C;  3AFA B;  3KWQ B;  3MGP D;  3C1B B;  2F8N H;  3LEL C;  2Y2P A;  3LJA C;  2F8N G;  5C3I B;  1TZY B;  4M6B A;  5B24 A;  1P3B B;  3TU4 C;  4WU9 D;  3AZH A;  5CPK D;  4KGC B;  3AN2 A;  1KX4 C;  5JRG D;  2Y2Q A;  1P34 B;  1P3L B;  1Q9C A;  5E5A A;  3AFA D;  3KWQ D;  3W98 B;  3WTP A;  3C1B D;  4DRA A;  3MGR C;  2CV5 A;  1TZY D;  5B1L A;  3UTA A;  2NZD B;  5CP6 A;  3MGQ A;  3AYW B;  1P3A A;  4NE5 A;  3C1C A;  5AV5 B;  3AZM C;  3AZN B;  1P3I A;  4YM6 B;  1P3M B;  1M19 A;  4KGC D;  1P34 D;  1N1J B;  3NQU A;  4WZS B;  3MVD A;  2IO5 C;  1S32 C;  5AV8 B;  4XZQ A;  3AZG C;  1A7W A;  4J8V C;  3W98 D;  3B0C T;  5BT1 D;  5B32 D;  3AZJ D;  1KX3 B;  5B2I A;  3V9R A;  2NZD D;  5B33 A;  4LD9 A;  3AYW D;  3KUY A;  3AZN D;  1P3M D;  2HIO B;  2BYK A;  4YM6 D;  3AZL B;  1P3G B;  3X1V A;  4WU8 C;  4KUD A;  2Y2N A;  3REK A;  5AV8 D;  1F66 A;  3REH C;  3REI D;  1KX3 D;  3W99 B;  4J8U A;  4Z5T A;  5CPJ A;  5E5A D;  4J8U C;  4H9Q B;  3NQJ B;  1ZLA A;  5CHL B;  5F99 B;  5B31 A;  2HIO D;  3AZL D;  1P3G D;  5B1L D;  5GT3 B;  4UUZ A;  4XUJ D;  3UT9 D;  3X1U C;  5AY8 B;  3KXB B;  3H0M C;  4J8X A;  3MNN A;  2PYO C;  3LZ0 B;  4QLC C;  1EQZ B;  3EG5 B;  4Z66 C;  2Y2K A;  3B6F B;  4AWL B;  1PZR A;  5JA4 A;  5B40 B;  2YFW A;  3AZF C;  5F99 D;  1ID3 D;  2XD1 A;  4H9S A;  4WNN B;  5GXQ C;  5GT3 D;  5DNN B;  2L5A A;  1U35 C;  3VH5 W;  5AY8 D;  4ZBJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...