3W98C

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98C00
3AN2A 5B1LB 3A6NC 5JRGC 5B0ZC 1U35D 1M18B 3W97A 3MGSA 4KGCB 1H3OB 5B40C 5AY8B 4XUJC 3NQUA 3RELC 3AZIC 1P3AC 4Z2MH 5DNND 3AZJD 3C1CB 4J8WC 4H9SA 3AFAD 4XZQD 4WU8C 4JJNB 3MGQB 3A6ND 5JRGD 4R8PB 5B0ZD 1A7WA 5KDMB 4EO5B 5B40D 4LD9C 4XUJD 2CWEA 4X23D 4G91B 2LY8A 3KUYB 3AZID 3RELD 1P3AD 3WTPB 5B2JB 1P34C 4ZBJB 3X1TD 3X1SB 4J8WD 4WU8D 3B0CW 5BO0B 5GSUB 3MGPC 4H9QB 3VH6T 4LD9D 3AZNA 5AV8D 3AV2C 3LZ1C 2HIOB 1KX5A 3AZMA 3REJC 1P34D 3NQJB 3LJAA 3UTAB 3REHC 1P3LC 4YM6B 4NFTA 3KXBD 5C3IB 5G49A 4H9OB 5GXQC 5B32C 3B6GD 1KX3C 5DNMB 1R4VA 3UT9C 3KSYA 2CV5C 1S32D 3AV2D 3LZ1D 2F8NH 3REJD 5CPID 3C1BA 1KX4C 3V9RB 3KWQC 1P3GC 1P3LD 3AZLB 2NZDB 3WA9C 3AN2B 5B32D 3W97B 3UT9D 3MGSB 5B1LC 3AZHA 5AV5A 3MGRA 1M18C 2AROA 4J8VC 3AV1A 3NQUB 1P3GD 2FJ7B 5AV9A 3AZKA 3WA9D 3AZFC 3C1CC 3REIC 3MGQC 4R8PC 1EQZC 3UTBA 4NE3A 5E5AA 1M18D 3W96A 2F8ND 4J8VD 1JFIA 1AOID 4CAYA 4WZSB 3X1UC 4G91C 4WU9C 3AZFD 3REID 1EQZD 1ZLAA 3AZNB 5CPJD 1KX5B 3X1UD 3AZMB 3B0CT 3LJAB 4WU9D 5G49B 3REKD 4YM6C 3WAAA 4YS3D 4DRBA 5C3IC 4E45A 5BNVA 5BS7A 3B0BA 3C1BB 1P3KC 5AV6A 5F99A 1P3FC 3W99A 5AVBB 3AN2C 3AZHB 5AV5B 3MGRB 3W97C 2AROB 4J8XC 5B24A 3AV1B 1P3BA 1Q9CA 1P3PA 3LELA 2HUEB 1P3KD 5JA4A 3O62A 5AV9B 3AZKB 1P3OA 1P3IC 3AZEA 1P3FD 2FJ7C 3AYWD 2PYOA 1TZYD 3AN2D 3UTBB 5E5AB 3W96B 4J8XD 1JFIB 1M19A 4CAYB 4QLCD 1B6WA 1P3ID 2FJ7D 4J8UA 1M1AC 2IO5B 3TU4A 3X1VC 3B0DB 3AZJC 1ZLAB 1BH8A 5B31A 5AVCC 4KUDD 3MVDC 3AZMC 3WKJA 4E44A 1M1AD 3WAAB 3X1VD 4UUZA 3W98A 1ID3A 5BNVB 1KU5A 4Z66A 5B1MC 5AVCD 3MVDD 5GT0A 5AV6B 2F8NK 5B2IA 5CPKA 3C1BC 5F99B 1F66A 1P3MA 3W99B 4Z5TA 4ZUXA 5AVBC 5B24B 1WWIA 5AV5C 5B1MD 3MGRC 1P3BB 1P3PB 3LELB 5JA4B 3O62B 1U35A 1P3OB 2HUEC 5B0YC 3AZEB 5AV9C 3MGPD 2PYOB 4G92B 1TAFA 5AVBD 3AZJA 3MGRD 3AFAA 4XZQA 1M19B 5E5AC 3W96C 3A6NA 3AZGC 5B0ZA 3REHD 5B0YD 5B40A 2RVQC 3MNNC 4XUJA 5AV9D 4J8UB 4X23A 5CHLB 2NQBC 3TU4B 5GXQD 3AZIA 1P3AA 1KX3D 2CV5D 3X1TA 4J8WA 4WU8A 1BH8B 4KHAA 5B31B 3AZGD 4KGCC 5AY8C 1KX4D 3KWQD 3WKJB 2RVQD 3MNND 4LD9A 5AV8A 3LZ0A 2NQBD 3W98B 4UUZB 1ID3B 4JJNC 1P34A 5B1LD 4Z66B 2L5AA 4KGCD 3KXBA 4EO5C 5AY8D 5BS7C 5GT0B 3B6GA 5B2IB 5CPKB 3KUYC 1F66B 1S32A 5B2JC 3WTPC 4NE6A 4ZBJC 3LZ1A 3C1CD 3AV2A 3X1SC 1P3MB 5F99C 4JJND 3MGQD 3REJA 5CPIA 4R8PD 4Z5TB 3W99C 5GSUC 1P3LA 4ZUXB 5B32A 5B24C 1U35B 2HIOC 3KUYD 3UT9A 5B2JD 3WTPD 1P3OC 3X1SD 3UTAC 3W99D 5GSUD 3VH5A 5GT3A 1P3GA 1TAFB 2PYOC 3AZJB 4WNNA 4XZQB 5DNMC 3WTPE 3AFAB 4AWLB 3A6NB 5B24D 5B0ZB 1M19C 2HIOD 5B40B 4XUJB 1P3OD 2YFWA 4X23B 2BYKA 3UTAD 4J8VA 4YM6D 3AZLC 2F8NA 2NZDC 1AOIA 3AZIB 1P3AB 2PYOD 3X1TB 4J8WB 4WU8B 5DNMD 3MGSC 4KHAB 3AZFA 1M19D 3REIA 1EQZA 4LD9B 3R45A 4HGAB 3WKJC 5AV8B 3LZ0B 3AZLD 2NZDD 5CPJA 4H9SC 3X1UA 1P34B 3W98C 1ID3C 4WU9A 3W97D 3MGSD 3KXBB 5B31G 4Z66C 3REKA 4YS3A 3B6GB 1HQ3A 1S32B 3AV2B 3LZ1B 5B2IC 3REJB 5CPIB 1P3MC 3W98D 1P3LB 4Z5TC 4Z66D 3AZNC 5BNXA 5B32B 3UT9B 1KX5C 5B2ID 3LJAC 4DRAA 1P3KA 1BH9A 5GT3B 1P3GB 4WNNB 3AZND 1P3FA 3AYWA 3B6FA 1TZYA 4AWLC 1KX5D 3AZMD 5CP6A 5B33A 3LJAD 2YFWB 4J8XA 2BYKB 2F8NB 4J8VB 3VH5W 1AOIB 5BT1C 4X23C 4QLCA 1P3IA 4H9RA 3AZHC 2FJ7A 3AZFB 3X1TC 3REIB 2AROC 4H9NA 3AV1C 1EQZB 3R45B 3C1BD 2BYMA 3AZKC 5CPJB 5BT1D 4HGAC 3X1UB 2YFVA 5AV8C 3LZ0C 4KUDA 4WU9B 5DNNA 3AZHD 5AV5D 3UTBC 5FUGA 1M1AA 3REKB 2AROD 5JRGA 1BFMA 3X1VA 3KXBC 3AV1D 4YS3B 4WV4B 1HQ3B 2JSSA 3AZKD 3B6GC 1S32C 3LZ0D 5AVCA 3RELA 3MVDA 4Z2MG 2IO5C 3VH6A 5CPIC 3UTBD 3B0DC 5E5AD 3W96D 1ZLAC 5BNXB 4CSRA 5B1MA 1P3KB 1BH9B 1HTAA 3WAAC 5GT3C 1ZLAD 1P3FB 3AYWB 3MGPA 3B6FB 1TZYB 5B32G 5CP6B 5B33B 4H9PA 4J8XB 1F1EA 5AVBA 5AV6C 4QLCB 3WAAD 1AOIC 3REHA 1P3IB 5B0YA 5GT3D 4H9RB 4H9NB 5GXQA 1KX3A 1P3BC 1P3PC 2CV5A 2BYMB 3VH5T 4NE5A 3LELC 5AV6D 3O62C 2F8NG 5F99D 3AZGA 2YFVB 3AZEC 1KX4A 5CPJC 1N1JA 3KWQA 4KUDB 5DNNB 3MNNA 1M1AB 5FUGB 3WA9A 4G92C 2NQBA 5JRGB 3X1VB 1P3BD 1P3PD 3LELD 5B1LA 3REKC 4YS3C 3O62D 1M18A 1HQ3C 4KGCA 1H3OA 3AZED 5AVCB 5AY8A 4J8UC 3RELB 3MVDB 3TU4C 3C1CA 4JJNA 3MGQA 4CSRB 5B31C 4R8PA 5KDMA 1HQ3D 5B1MB 4J8UD 3VH6W 1WWSA 3TU4D 3KUYA 5B2JA 3WTPA 3X1SA 3MGPB 5BO0A 5B31D 3AYWC 4H9PB 5GSUA 1TZYC 3B6FC 4H9QA 3WKJD 5GT0C 5CP6C 5B33C 5CPKC 1ULYA 1F66C 2HIOA 3REHB 1ID3D 5B0YB 3NQJA 4QLCC 3UTAA 4ZUXC 4YM6A 5GXQB 1KX3B 1B67A 2CV5B 3B6FD 4H9OA 5GT0D 5CP6D 4M6BA 5B33D 5DNMA 5CPKD 1U35C 3AZGB 1F66D 1P3MD 1KX4B 1N1JB 3KWQB 3MNNB 4Z5TD 3V9RA 3WA9B 4KUDC 4ZUXD 3AZLA 2NZDA 2NQBB 5DNNC 3AFAC 4XZQC
chains in the Genus database with same CATH superfamily
3AN2A 5B1LB 3A6NC 5JRGC 5B0ZC 1U35D 1M18B 3W97A 3MGSA 4KGCB 1H3OB 5B40C 4WJ3C 5AY8B 4XUJC 3NQUA 3RELC 3AZIC 1P3AC 4Z2MH 5DNND 3AZJD 3C1CB 4J8WC 4H9SA 3AFAD 4XZQD 4WU8C 4JJNB 3MGQB 3A6ND 5JRGD 4R8PB 5B0ZD 1A7WA 2ZY3A 5KDMB 2ZY5A 4EO5B 5B40D 4LD9C 4XUJD 2CWEA 4X23D 2Y2NA 2LY8A 4G91B 3KUYB 3AZID 3RELD 1P3AD 3WTPB 5B2JB 1P34C 4ZBJB 3X1TD 3X1SB 4J8WD 4WU8D 3B0CW 5BO0B 3EPLA 5GSUB 2ZY4A 3MGPC 4H9QB 3VH6T 4LD9D 3AZNA 5AV8D 3AV2C 3LZ1C 2HIOB 1KX5A 3AZMA 3REJC 1P34D 3NQJB 3LJAA 3UTAB 3REHC 1P3LC 4YM6B 4NFTA 3KXBD 5C3IB 5G49A 4H9OB 5GXQC 5B32C 3B6GD 1KX3C 5DNMB 1R4VA 3UT9C 3KSYA 2CV5C 1S32D 3AV2D 3LZ1D 2F8NH 3REJD 5CPID 3C1BA 1KX4C 3V9RB 3KWQC 1P3GC 1P3LD 3AZLB 2NZDB 3WA9C 2DF4C 3AN2B 5B32D 3W97B 3UT9D 3MGSB 5B1LC 3AZHA 5AV5A 3MGRA 1M18C 2AROA 4J8VC 3AV1A 2ZY2A 3NQUB 1P3GD 2FJ7B 5AV9A 3AZKA 2Y2HA 3WA9D 3AZFC 3C1CC 3REIC 3MGQC 4R8PC 1EQZC 3UTBA 4NE3A 5E5AA 1M18D 3W96A 2F8ND 4J8VD 1JFIA 1AOID 4CAYA 4WZSB 3X1UC 2Y2GA 4G91C 4WU9C 3H0LC 3AZFD 3REID 1EQZD 1ZLAA 3AZNB 5CPJD 1KX5B 3X1UD 3AZMB 3B0CT 2Y2QA 3LJAB 4WU9D 5G49B 3REKD 4YM6C 3WAAA 4YS3D 4DRBA 5C3IC 4E45A 5BNVA 3FDDA 5BS7A 3B0BA 3C1BB 1P3KC 5AV6A 5F99A 3EPKA 1P3FC 3W99A 3A1IA 5AVBB 3AN2C 3AZHB 5AV5B 3MGRB 3W97C 2AROB 4J8XC 5B24A 3AV1B 1P3BA 1Q9CA 1P3PA 3LELA 2HUEB 2XD1A 1P3KD 5JA4A 3O62A 5AV9B 3AZKB 1P3OA 1P3IC 3AZEA 1P3FD 2FJ7C 3IP4C 3AYWD 2VQRA 2PYOA 1TZYD 3AN2D 3UTBB 5E5AB 3W96B 4J8XD 1JFIB 1M19A 4CAYB 2JE5A 4QLCD 1B6WA 1P3ID 2Y2OA 2FJ7D 4J8UA 2XD5A 1M1AC 2IO5B 3TU4A 3X1VC 3B0DB 3AZJC 1ZLAB 1BH8A 5B31A 5AVCC 4KUDD 3MVDC 3AZMC 3WKJA 4E44A 1M1AD 3WAAB 3X1VD 4UUZA 3W98A 1ID3A 5BNVB 1KU5A 4Z66A 2G5HC 5B1MC 5AVCD 3MVDD 5GT0A 5AV6B 2F8NK 5B2IA 5CPKA 3C1BC 5F99B 1F66A 1P3MA 3W99B 4Z5TA 4ZUXA 5AVBC 5B24B 1WWIA 5AV5C 5B1MD 3MGRC 1P3BB 1P3PB 3LELB 5JA4B 3O62B 1U35A 3F6TA 1P3OB 2HUEC 5B0YC 3AZEB 5AV9C 3MGPD 2PYOB 4G92B 1TAFA 3EPHA 5AVBD 3AZJA 3MGRD 3AFAA 4XZQA 1M19B 5E5AC 3W96C 3A6NA 3AZGC 5B0ZA 3REHD 1T3UA 5B0YD 5B40A 2RVQC 3MNNC 4XUJA 5AV9D 4J8UB 2Y2MA 4X23A 5CHLB 2NQBC 3TU4B 5GXQD 3AZIA 1P3AA 1KX3D 2CV5D 3X1TA 4J8WA 4WU8A 1BH8B 4KHAA 5B31B 3AZGD 4KGCC 5AY8C 1KX4D 3KWQD 3WKJB 2RVQD 3MNND 4LD9A 1PZRA 2FFFB 5AV8A 3LZ0A 2NQBD 3W98B 4UUZB 1ID3B 4JJNC 1P34A 5B1LD 4Z66B 2L5AA 4KGCD 3KXBA 4EO5C 5AY8D 5BS7C 5GT0B 3B6GA 5B2IB 5CPKB 3KUYC 1F66B 1S32A 5B2JC 3WTPC 4NE6A 4ZBJC 3LZ1A 3C1CD 3AV2A 3X1SC 1P3MB 5F99C 4JJND 3MGQD 3REJA 5CPIA 4R8PD 4Z5TB 3W99C 5GSUC 1P3LA 4ZUXB 5B32A 5B24C 1U35B 2HIOC 3KUYD 3UT9A 5B2JD 3WTPD 1P3OC 3X1SD 3AL0C 3UTAC 3W99D 5GSUD 3VH5A 5GT3A 1P3GA 1TAFB 2PYOC 3AZJB 4WNNA 4XZQB 5DNMC 3WTPE 3AFAB 4AWLB 3A6NB 5B24D 5B0ZB 1M19C 2HIOD 5B40B 4XUJB 1P3OD 2YFWA 4X23B 2BYKA 3UTAD 4J8VA 4YM6D 3AZLC 2F8NA 3P5JB 2NZDC 1AOIA 3AZIB 1P3AB 2Y2PA 2PYOD 3X1TB 4J8WB 2DQNC 4WU8B 5DNMD 2J8PA 3MGSC 4KHAB 3AZFA 1M19D 3REIA 1EQZA 4LD9B 3R45A 4HGAB 3WKJC 5AV8B 3LZ0B 3AZLD 2NZDD 5CPJA 4H9SC 3X1UA 1P34B 3W98C 1ID3C 4WU9A 3W97D 3A1KA 3H0RC 3MGSD 3KXBB 5B31G 4Z66C 3REKA 4YS3A 3B6GB 1HQ3A 1S32B 3AV2B 3LZ1B 5B2IC 3REJB 5CPIB 1P3MC 3W98D 2Y2IA 1P3LB 4Z5TC 4Z66D 3AZNC 5BNXA 5B32B 3UT9B 1KX5C 2UWXA 5B2ID 3LJAC 2F2AC 2BG1A 4DRAA 1P3KA 1BH9A 5GT3B 1P3GB 4WNNB 3AZND 1P3FA 3AYWA 3B6FA 1TZYA 4AWLC 1KX5D 2W8SA 3AZMD 5CP6A 5B33A 3LJAD 2YFWB 4J8XA 2BYKB 2F8NB 4J8VB 3VH5W 1AOIB 2G5IC 5BT1C 4X23C 4QLCA 1P3IA 4H9RA 3AZHC 2FJ7A 3AZFB 3X1TC 3REIB 2AROC 4H9NA 3AV1C 1EQZB 3R45B 3C1BD 2BYMA 3AZKC 5CPJB 5BT1D 4HGAC 3X1UB 2YFVA 5AV8C 3LZ0C 4KUDA 4WU9B 5DNNA 3AZHD 5AV5D 3UTBC 1W2EA 5FUGA 1M1AA 3REKB 2AROD 2Y2JA 5JRGA 3X1VA 3KXBC 3AV1D 4YS3B 1BFMA 4WV4B 1HQ3B 2JSSA 3AZKD 3B6GC 1S32C 3LZ0D 5AVCA 3RELA 3MVDA 4Z2MG 2IO5C 3VH6A 5CPIC 3UTBD 3B0DC 5E5AD 3W96D 1ZLAC 5BNXB 4CSRA 2Y2LA 5B1MA 2Y2KA 1P3KB 1BH9B 1HTAA 3WAAC 3H0MC 5GT3C 1ZLAD 1P3FB 3AYWB 3MGPA 3B6FB 1TZYB 5B32G 2ZM5A 5CP6B 5B33B 4H9PA 4J8XB 1F1EA 5AVBA 5AV6C 4QLCB 3WAAD 1AOIC 3REHA 1P3IB 5B0YA 5GT3D 4H9RB 4H9NB 5GXQA 1KX3A 1P3BC 1P3PC 2CV5A 2BYMB 3VH5T 4NE5A 3LELC 5AV6D 3O62C 2F8NG 5F99D 3AZGA 2YFVB 3AZEC 1KX4A 5CPJC 1N1JA 3KWQA 4KUDB 5DNNB 3MNNA 1M1AB 5FUGB 3WA9A 4G92C 2NQBA 5JRGB 3X1VB 4DQYB 1P3BD 1P3PD 3LELD 5B1LA 3REKC 4YS3C 3O62D 1M18A 4UPKA 1HQ3C 3EPJA 4KGCA 1H3OA 3AZED 5AVCB 5AY8A 4J8UC 3RELB 3MVDB 3TU4C 3C1CA 4JJNA 3MGQA 4CSRB 3EG5B 5B31C 4R8PA 5KDMA 1HQ3D 5B1MB 4J8UD 3VH6W 1WWSA 3TU4D 3KUYA 5B2JA 3WTPA 3X1SA 3MGPB 5BO0A 5B31D 1Z2CB 3AYWC 4H9PB 5GSUA 1TZYC 3B6FC 4H9QA 3WKJD 5GT0C 5CP6C 5B33C 5CPKC 1ULYA 1F66C 2HIOA 2RIQA 3REHB 1ID3D 5B0YB 3NQJA 4QLCC 2JCHA 3UTAA 4ZUXC 4YM6A 5GXQB 1KX3B 1B67A 2CV5B 3B6FD 4H9OA 5CP6D 4M6BA 5B33D 5GT0D 5DNMA 5CPKD 1U35C 3AZGB 1F66D 1P3MD 1KX4B 3KFUG 1N1JB 3KWQB 3MNNB 4Z5TD 3V9RA 3WA9B 4KUDC 4ZUXD 3AZLA 2NZDA 2NQBB 5DNNC 3AFAC 4XZQC
chains in the Genus database with same CATH topology
3AN2A 5B1LB 3A6NC 5JRGC 5B0ZC 1U35D 1M18B 3W97A 3MGSA 4KGCB 1H3OB 5B40C 4WJ3C 5AY8B 4XUJC 3NQUA 3RELC 3AZIC 1P3AC 4Z2MH 5DNND 3AZJD 3C1CB 4J8WC 4H9SA 3AFAD 4XZQD 4WU8C 4JJNB 3MGQB 3A6ND 5JRGD 4R8PB 5B0ZD 1A7WA 2ZY3A 5KDMB 2ZY5A 4EO5B 5B40D 4LD9C 4XUJD 2CWEA 4X23D 2Y2NA 2LY8A 4G91B 3KUYB 3AZID 3RELD 1P3AD 3WTPB 5B2JB 1P34C 4ZBJB 3X1TD 3X1SB 4J8WD 4WU8D 3B0CW 5BO0B 3EPLA 5GSUB 2ZY4A 3MGPC 4H9QB 3VH6T 4LD9D 3AZNA 5AV8D 3AV2C 3LZ1C 2HIOB 1KX5A 3AZMA 3REJC 1P34D 3NQJB 3LJAA 3UTAB 3REHC 1P3LC 4YM6B 4NFTA 3KXBD 5C3IB 5G49A 4H9OB 5GXQC 5B32C 3B6GD 1KX3C 5DNMB 1R4VA 3UT9C 3KSYA 2CV5C 1S32D 3AV2D 3LZ1D 2F8NH 3REJD 5CPID 3C1BA 1KX4C 3V9RB 3KWQC 1P3GC 1P3LD 3AZLB 2NZDB 3WA9C 2DF4C 3AN2B 5B32D 3W97B 3UT9D 3MGSB 5B1LC 3AZHA 5AV5A 3MGRA 1M18C 2AROA 4J8VC 3AV1A 2ZY2A 3NQUB 1P3GD 2FJ7B 5AV9A 3AZKA 2Y2HA 3WA9D 3AZFC 3C1CC 3REIC 3MGQC 4R8PC 1EQZC 3UTBA 4NE3A 5E5AA 1M18D 3W96A 2F8ND 4J8VD 1JFIA 1AOID 4CAYA 4WZSB 3X1UC 2Y2GA 4G91C 4WU9C 3H0LC 3AZFD 3REID 1EQZD 1ZLAA 3AZNB 5CPJD 1KX5B 3X1UD 3AZMB 3B0CT 2Y2QA 3LJAB 4WU9D 5G49B 3REKD 4YM6C 3WAAA 4YS3D 4DRBA 5C3IC 4E45A 5BNVA 3FDDA 5BS7A 3B0BA 3C1BB 1P3KC 5AV6A 5F99A 3EPKA 1P3FC 3W99A 3A1IA 5AVBB 3AN2C 3AZHB 5AV5B 3MGRB 3W97C 2AROB 4J8XC 5B24A 3AV1B 1P3BA 1Q9CA 1P3PA 3LELA 2HUEB 2XD1A 1P3KD 5JA4A 3O62A 5AV9B 3AZKB 1P3OA 1P3IC 3AZEA 1P3FD 2FJ7C 3IP4C 3AYWD 2VQRA 2PYOA 1TZYD 3AN2D 3UTBB 5E5AB 3W96B 4J8XD 1JFIB 1M19A 4CAYB 2JE5A 4QLCD 1B6WA 1P3ID 2Y2OA 2FJ7D 4J8UA 2XD5A 1M1AC 2IO5B 3TU4A 3X1VC 3B0DB 3AZJC 1ZLAB 1BH8A 5B31A 5AVCC 4KUDD 3MVDC 3AZMC 3WKJA 4E44A 1M1AD 3WAAB 3X1VD 4UUZA 3W98A 1ID3A 5BNVB 1KU5A 4Z66A 2G5HC 5B1MC 5AVCD 3MVDD 5GT0A 5AV6B 2F8NK 5B2IA 5CPKA 3C1BC 5F99B 1F66A 1P3MA 3W99B 4Z5TA 4ZUXA 5AVBC 5B24B 1WWIA 5AV5C 5B1MD 3MGRC 1P3BB 1P3PB 3LELB 5JA4B 3O62B 1U35A 3F6TA 1P3OB 2HUEC 5B0YC 3AZEB 5AV9C 3MGPD 2PYOB 4G92B 1TAFA 3EPHA 5AVBD 3AZJA 3MGRD 3AFAA 4XZQA 1M19B 5E5AC 3W96C 3A6NA 3AZGC 5B0ZA 3REHD 1T3UA 5B0YD 5B40A 2RVQC 3MNNC 4XUJA 5AV9D 4J8UB 2Y2MA 4X23A 5CHLB 2NQBC 3TU4B 5GXQD 3AZIA 1P3AA 1KX3D 2CV5D 3X1TA 4J8WA 4WU8A 1BH8B 4KHAA 5B31B 3AZGD 4KGCC 5AY8C 1KX4D 3KWQD 3WKJB 2RVQD 3MNND 4LD9A 1PZRA 2FFFB 5AV8A 3LZ0A 2NQBD 3W98B 4UUZB 1ID3B 4JJNC 1P34A 5B1LD 4Z66B 2L5AA 4KGCD 3KXBA 4EO5C 5AY8D 5BS7C 5GT0B 3B6GA 5B2IB 5CPKB 3KUYC 1F66B 1S32A 5B2JC 3WTPC 4NE6A 4ZBJC 3LZ1A 3C1CD 3AV2A 3X1SC 1P3MB 5F99C 4JJND 3MGQD 3REJA 5CPIA 4R8PD 4Z5TB 3W99C 5GSUC 1P3LA 4ZUXB 5B32A 5B24C 1U35B 2HIOC 3KUYD 3UT9A 5B2JD 3WTPD 1P3OC 3X1SD 3AL0C 3UTAC 3W99D 5GSUD 3VH5A 5GT3A 1P3GA 1TAFB 2PYOC 3AZJB 4WNNA 4XZQB 5DNMC 3WTPE 3AFAB 4AWLB 3A6NB 5B24D 5B0ZB 1M19C 2HIOD 5B40B 4XUJB 1P3OD 2YFWA 4X23B 2BYKA 3UTAD 4J8VA 4YM6D 3AZLC 2F8NA 3P5JB 2NZDC 1AOIA 3AZIB 1P3AB 2Y2PA 2PYOD 3X1TB 4J8WB 2DQNC 4WU8B 5DNMD 2J8PA 3MGSC 4KHAB 3AZFA 1M19D 3REIA 1EQZA 4LD9B 3R45A 4HGAB 3WKJC 5AV8B 3LZ0B 3AZLD 2NZDD 5CPJA 4H9SC 3X1UA 1P34B 3W98C 1ID3C 4WU9A 3W97D 3A1KA 3H0RC 3MGSD 3KXBB 5B31G 4Z66C 3REKA 4YS3A 3B6GB 1HQ3A 1S32B 3AV2B 3LZ1B 5B2IC 3REJB 5CPIB 1P3MC 3W98D 2Y2IA 1P3LB 4Z5TC 4Z66D 3AZNC 5BNXA 5B32B 3UT9B 1KX5C 2UWXA 5B2ID 3LJAC 2F2AC 2BG1A 4DRAA 1P3KA 1BH9A 5GT3B 1P3GB 4WNNB 3AZND 1P3FA 3AYWA 3B6FA 1TZYA 4AWLC 1KX5D 2W8SA 3AZMD 5CP6A 5B33A 3LJAD 2YFWB 4J8XA 2BYKB 2F8NB 4J8VB 3VH5W 1AOIB 2G5IC 5BT1C 4X23C 4QLCA 1P3IA 4H9RA 3AZHC 2FJ7A 3AZFB 3X1TC 3REIB 2AROC 4H9NA 3AV1C 1EQZB 3R45B 3C1BD 2BYMA 3AZKC 5CPJB 5BT1D 4HGAC 3X1UB 2YFVA 5AV8C 3LZ0C 4KUDA 4WU9B 5DNNA 3AZHD 5AV5D 3UTBC 1W2EA 5FUGA 1M1AA 3REKB 2AROD 2Y2JA 5JRGA 3X1VA 3KXBC 3AV1D 4YS3B 1BFMA 4WV4B 1HQ3B 2JSSA 3AZKD 3B6GC 1S32C 3LZ0D 5AVCA 3RELA 3MVDA 4Z2MG 2IO5C 3VH6A 5CPIC 3UTBD 3B0DC 5E5AD 3W96D 1ZLAC 5BNXB 4CSRA 2Y2LA 5B1MA 2Y2KA 1P3KB 1BH9B 1HTAA 3WAAC 3H0MC 5GT3C 1ZLAD 1P3FB 3AYWB 3MGPA 3B6FB 1TZYB 5B32G 2ZM5A 5CP6B 5B33B 4H9PA 4J8XB 1F1EA 5AVBA 5AV6C 4QLCB 3WAAD 1AOIC 3REHA 1P3IB 5B0YA 5GT3D 4H9RB 4H9NB 5GXQA 1KX3A 1P3BC 1P3PC 2CV5A 2BYMB 3VH5T 4NE5A 3LELC 5AV6D 3O62C 2F8NG 5F99D 3AZGA 2YFVB 3AZEC 1KX4A 5CPJC 1N1JA 3KWQA 4KUDB 5DNNB 3MNNA 1M1AB 5FUGB 3WA9A 4G92C 2NQBA 5JRGB 3X1VB 4DQYB 1P3BD 1P3PD 3LELD 5B1LA 3REKC 4YS3C 3O62D 1M18A 4UPKA 1HQ3C 3EPJA 4KGCA 1H3OA 3AZED 5AVCB 5AY8A 4J8UC 3RELB 3MVDB 3TU4C 3C1CA 4JJNA 3MGQA 4CSRB 3EG5B 5B31C 4R8PA 5KDMA 1HQ3D 5B1MB 4J8UD 3VH6W 1WWSA 3TU4D 3KUYA 5B2JA 3WTPA 3X1SA 3MGPB 5BO0A 5B31D 1Z2CB 3AYWC 4H9PB 5GSUA 1TZYC 3B6FC 4H9QA 3WKJD 5GT0C 5CP6C 5B33C 5CPKC 1ULYA 1F66C 2HIOA 2RIQA 3REHB 1ID3D 5B0YB 3NQJA 4QLCC 2JCHA 3UTAA 4ZUXC 4YM6A 5GXQB 1KX3B 1B67A 2CV5B 3B6FD 4H9OA 5CP6D 4M6BA 5B33D 5GT0D 5DNMA 5CPKD 1U35C 3AZGB 1F66D 1P3MD 1KX4B 3KFUG 1N1JB 3KWQB 3MNNB 4Z5TD 3V9RA 3WA9B 4KUDC 4ZUXD 3AZLA 2NZDA 2NQBB 5DNNC 3AFAC 4XZQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 A;  5B1L B;  3A6N C;  5JRG C;  5B0Z C;  1U35 D;  1M18 B;  3W97 A;  3MGS A;  4KGC B;  1H3O B;  5B40 C;  5AY8 B;  4XUJ C;  3NQU A;  3REL C;  3AZI C;  1P3A C;  4Z2M H;  5DNN D;  3AZJ D;  3C1C B;  4J8W C;  4H9S A;  3AFA D;  4XZQ D;  4WU8 C;  4JJN B;  3MGQ B;  3A6N D;  5JRG D;  4R8P B;  5B0Z D;  1A7W A;  5KDM B;  4EO5 B;  5B40 D;  4LD9 C;  4XUJ D;  2CWE A;  4X23 D;  4G91 B;  2LY8 A;  3KUY B;  3AZI D;  3REL D;  1P3A D;  3WTP B;  5B2J B;  1P34 C;  4ZBJ B;  3X1T D;  3X1S B;  4J8W D;  4WU8 D;  3B0C W;  5BO0 B;  5GSU B;  3MGP C;  4H9Q B;  3VH6 T;  4LD9 D;  3AZN A;  5AV8 D;  3AV2 C;  3LZ1 C;  2HIO B;  1KX5 A;  3AZM A;  3REJ C;  1P34 D;  3NQJ B;  3LJA A;  3UTA B;  3REH C;  1P3L C;  4YM6 B;  4NFT A;  3KXB D;  5C3I B;  5G49 A;  4H9O B;  5GXQ C;  5B32 C;  3B6G D;  1KX3 C;  5DNM B;  1R4V A;  3UT9 C;  3KSY A;  2CV5 C;  1S32 D;  3AV2 D;  3LZ1 D;  2F8N H;  3REJ D;  5CPI D;  3C1B A;  1KX4 C;  3V9R B;  3KWQ C;  1P3G C;  1P3L D;  3AZL B;  2NZD B;  3WA9 C;  3AN2 B;  5B32 D;  3W97 B;  3UT9 D;  3MGS B;  5B1L C;  3AZH A;  5AV5 A;  3MGR A;  1M18 C;  2ARO A;  4J8V C;  3AV1 A;  3NQU B;  1P3G D;  2FJ7 B;  5AV9 A;  3AZK A;  3WA9 D;  3AZF C;  3C1C C;  3REI C;  3MGQ C;  4R8P C;  1EQZ C;  3UTB A;  4NE3 A;  5E5A A;  1M18 D;  3W96 A;  2F8N D;  4J8V D;  1JFI A;  1AOI D;  4CAY A;  4WZS B;  3X1U C;  4G91 C;  4WU9 C;  3AZF D;  3REI D;  1EQZ D;  1ZLA A;  3AZN B;  5CPJ D;  1KX5 B;  3X1U D;  3AZM B;  3B0C T;  3LJA B;  4WU9 D;  5G49 B;  3REK D;  4YM6 C;  3WAA A;  4YS3 D;  4DRB A;  5C3I C;  4E45 A;  5BNV A;  5BS7 A;  3B0B A;  3C1B B;  1P3K C;  5AV6 A;  5F99 A;  1P3F C;  3W99 A;  5AVB B;  3AN2 C;  3AZH B;  5AV5 B;  3MGR B;  3W97 C;  2ARO B;  4J8X C;  5B24 A;  3AV1 B;  1P3B A;  1Q9C A;  1P3P A;  3LEL A;  2HUE B;  1P3K D;  5JA4 A;  3O62 A;  5AV9 B;  3AZK B;  1P3O A;  1P3I C;  3AZE A;  1P3F D;  2FJ7 C;  3AYW D;  2PYO A;  1TZY D;  3AN2 D;  3UTB B;  5E5A B;  3W96 B;  4J8X D;  1JFI B;  1M19 A;  4CAY B;  4QLC D;  1B6W A;  1P3I D;  2FJ7 D;  4J8U A;  1M1A C;  2IO5 B;  3TU4 A;  3X1V C;  3B0D B;  3AZJ C;  1ZLA B;  1BH8 A;  5B31 A;  5AVC C;  4KUD D;  3MVD C;  3AZM C;  3WKJ A;  4E44 A;  1M1A D;  3WAA B;  3X1V D;  4UUZ A;  3W98 A;  1ID3 A;  5BNV B;  1KU5 A;  4Z66 A;  5B1M C;  5AVC D;  3MVD D;  5GT0 A;  5AV6 B;  2F8N K;  5B2I A;  5CPK A;  3C1B C;  5F99 B;  1F66 A;  1P3M A;  3W99 B;  4Z5T A;  4ZUX A;  5AVB C;  5B24 B;  1WWI A;  5AV5 C;  5B1M D;  3MGR C;  1P3B B;  1P3P B;  3LEL B;  5JA4 B;  3O62 B;  1U35 A;  1P3O B;  2HUE C;  5B0Y C;  3AZE B;  5AV9 C;  3MGP D;  2PYO B;  4G92 B;  1TAF A;  5AVB D;  3AZJ A;  3MGR D;  3AFA A;  4XZQ A;  1M19 B;  5E5A C;  3W96 C;  3A6N A;  3AZG C;  5B0Z A;  3REH D;  5B0Y D;  5B40 A;  2RVQ C;  3MNN C;  4XUJ A;  5AV9 D;  4J8U B;  4X23 A;  5CHL B;  2NQB C;  3TU4 B;  5GXQ D;  3AZI A;  1P3A A;  1KX3 D;  2CV5 D;  3X1T A;  4J8W A;  4WU8 A;  1BH8 B;  4KHA A;  5B31 B;  3AZG D;  4KGC C;  5AY8 C;  1KX4 D;  3KWQ D;  3WKJ B;  2RVQ D;  3MNN D;  4LD9 A;  5AV8 A;  3LZ0 A;  2NQB D;  3W98 B;  4UUZ B;  1ID3 B;  4JJN C;  1P34 A;  5B1L D;  4Z66 B;  2L5A A;  4KGC D;  3KXB A;  4EO5 C;  5AY8 D;  5BS7 C;  5GT0 B;  3B6G A;  5B2I B;  5CPK B;  3KUY C;  1F66 B;  1S32 A;  5B2J C;  3WTP C;  4NE6 A;  4ZBJ C;  3LZ1 A;  3C1C D;  3AV2 A;  3X1S C;  1P3M B;  5F99 C;  4JJN D;  3MGQ D;  3REJ A;  5CPI A;  4R8P D;  4Z5T B;  3W99 C;  5GSU C;  1P3L A;  4ZUX B;  5B32 A;  5B24 C;  1U35 B;  2HIO C;  3KUY D;  3UT9 A;  5B2J D;  3WTP D;  1P3O C;  3X1S D;  3UTA C;  3W99 D;  5GSU D;  3VH5 A;  5GT3 A;  1P3G A;  1TAF B;  2PYO C;  3AZJ B;  4WNN A;  4XZQ B;  5DNM C;  3WTP E;  3AFA B;  4AWL B;  3A6N B;  5B24 D;  5B0Z B;  1M19 C;  2HIO D;  5B40 B;  4XUJ B;  1P3O D;  2YFW A;  4X23 B;  2BYK A;  3UTA D;  4J8V A;  4YM6 D;  3AZL C;  2F8N A;  2NZD C;  1AOI A;  3AZI B;  1P3A B;  2PYO D;  3X1T B;  4J8W B;  4WU8 B;  5DNM D;  3MGS C;  4KHA B;  3AZF A;  1M19 D;  3REI A;  1EQZ A;  4LD9 B;  3R45 A;  4HGA B;  3WKJ C;  5AV8 B;  3LZ0 B;  3AZL D;  2NZD D;  5CPJ A;  4H9S C;  3X1U A;  1P34 B;  3W98 C;  1ID3 C;  4WU9 A;  3W97 D;  3MGS D;  3KXB B;  5B31 G;  4Z66 C;  3REK A;  4YS3 A;  3B6G B;  1HQ3 A;  1S32 B;  3AV2 B;  3LZ1 B;  5B2I C;  3REJ B;  5CPI B;  1P3M C;  3W98 D;  1P3L B;  4Z5T C;  4Z66 D;  3AZN C;  5BNX A;  5B32 B;  3UT9 B;  1KX5 C;  5B2I D;  3LJA C;  4DRA A;  1P3K A;  1BH9 A;  5GT3 B;  1P3G B;  4WNN B;  3AZN D;  1P3F A;  3AYW A;  3B6F A;  1TZY A;  4AWL C;  1KX5 D;  3AZM D;  5CP6 A;  5B33 A;  3LJA D;  2YFW B;  4J8X A;  2BYK B;  2F8N B;  4J8V B;  3VH5 W;  1AOI B;  5BT1 C;  4X23 C;  4QLC A;  1P3I A;  4H9R A;  3AZH C;  2FJ7 A;  3AZF B;  3X1T C;  3REI B;  2ARO C;  4H9N A;  3AV1 C;  1EQZ B;  3R45 B;  3C1B D;  2BYM A;  3AZK C;  5CPJ B;  5BT1 D;  4HGA C;  3X1U B;  2YFV A;  5AV8 C;  3LZ0 C;  4KUD A;  4WU9 B;  5DNN A;  3AZH D;  5AV5 D;  3UTB C;  5FUG A;  1M1A A;  3REK B;  2ARO D;  5JRG A;  1BFM A;  3X1V A;  3KXB C;  3AV1 D;  4YS3 B;  4WV4 B;  1HQ3 B;  2JSS A;  3AZK D;  3B6G C;  1S32 C;  3LZ0 D;  5AVC A;  3REL A;  3MVD A;  4Z2M G;  2IO5 C;  3VH6 A;  5CPI C;  3UTB D;  3B0D C;  5E5A D;  3W96 D;  1ZLA C;  5BNX B;  4CSR A;  5B1M A;  1P3K B;  1BH9 B;  1HTA A;  3WAA C;  5GT3 C;  1ZLA D;  1P3F B;  3AYW B;  3MGP A;  3B6F B;  1TZY B;  5B32 G;  5CP6 B;  5B33 B;  4H9P A;  4J8X B;  1F1E A;  5AVB A;  5AV6 C;  4QLC B;  3WAA D;  1AOI C;  3REH A;  1P3I B;  5B0Y A;  5GT3 D;  4H9R B;  4H9N B;  5GXQ A;  1KX3 A;  1P3B C;  1P3P C;  2CV5 A;  2BYM B;  3VH5 T;  4NE5 A;  3LEL C;  5AV6 D;  3O62 C;  2F8N G;  5F99 D;  3AZG A;  2YFV B;  3AZE C;  1KX4 A;  5CPJ C;  1N1J A;  3KWQ A;  4KUD B;  5DNN B;  3MNN A;  1M1A B;  5FUG B;  3WA9 A;  4G92 C;  2NQB A;  5JRG B;  3X1V B;  1P3B D;  1P3P D;  3LEL D;  5B1L A;  3REK C;  4YS3 C;  3O62 D;  1M18 A;  1HQ3 C;  4KGC A;  1H3O A;  3AZE D;  5AVC B;  5AY8 A;  4J8U C;  3REL B;  3MVD B;  3TU4 C;  3C1C A;  4JJN A;  3MGQ A;  4CSR B;  5B31 C;  4R8P A;  5KDM A;  1HQ3 D;  5B1M B;  4J8U D;  3VH6 W;  1WWS A;  3TU4 D;  3KUY A;  5B2J A;  3WTP A;  3X1S A;  3MGP B;  5BO0 A;  5B31 D;  3AYW C;  4H9P B;  5GSU A;  1TZY C;  3B6F C;  4H9Q A;  3WKJ D;  5GT0 C;  5CP6 C;  5B33 C;  5CPK C;  1ULY A;  1F66 C;  2HIO A;  3REH B;  1ID3 D;  5B0Y B;  3NQJ A;  4QLC C;  3UTA A;  4ZUX C;  4YM6 A;  5GXQ B;  1KX3 B;  1B67 A;  2CV5 B;  3B6F D;  4H9O A;  5GT0 D;  5CP6 D;  4M6B A;  5B33 D;  5DNM A;  5CPK D;  1U35 C;  3AZG B;  1F66 D;  1P3M D;  1KX4 B;  1N1J B;  3KWQ B;  3MNN B;  4Z5T D;  3V9R A;  3WA9 B;  4KUD C;  4ZUX D;  3AZL A;  2NZD A;  2NQB B;  5DNN C;  3AFA C;  4XZQ C; 
#chains in the Genus database with same CATH topology
 3AN2 A;  5B1L B;  3A6N C;  5JRG C;  5B0Z C;  1U35 D;  1M18 B;  3W97 A;  3MGS A;  4KGC B;  1H3O B;  5B40 C;  4WJ3 C;  5AY8 B;  4XUJ C;  3NQU A;  3REL C;  3AZI C;  1P3A C;  4Z2M H;  5DNN D;  3AZJ D;  3C1C B;  4J8W C;  4H9S A;  3AFA D;  4XZQ D;  4WU8 C;  4JJN B;  3MGQ B;  3A6N D;  5JRG D;  4R8P B;  5B0Z D;  1A7W A;  2ZY3 A;  5KDM B;  2ZY5 A;  4EO5 B;  5B40 D;  4LD9 C;  4XUJ D;  2CWE A;  4X23 D;  2Y2N A;  2LY8 A;  4G91 B;  3KUY B;  3AZI D;  3REL D;  1P3A D;  3WTP B;  5B2J B;  1P34 C;  4ZBJ B;  3X1T D;  3X1S B;  4J8W D;  4WU8 D;  3B0C W;  5BO0 B;  3EPL A;  5GSU B;  2ZY4 A;  3MGP C;  4H9Q B;  3VH6 T;  4LD9 D;  3AZN A;  5AV8 D;  3AV2 C;  3LZ1 C;  2HIO B;  1KX5 A;  3AZM A;  3REJ C;  1P34 D;  3NQJ B;  3LJA A;  3UTA B;  3REH C;  1P3L C;  4YM6 B;  4NFT A;  3KXB D;  5C3I B;  5G49 A;  4H9O B;  5GXQ C;  5B32 C;  3B6G D;  1KX3 C;  5DNM B;  1R4V A;  3UT9 C;  3KSY A;  2CV5 C;  1S32 D;  3AV2 D;  3LZ1 D;  2F8N H;  3REJ D;  5CPI D;  3C1B A;  1KX4 C;  3V9R B;  3KWQ C;  1P3G C;  1P3L D;  3AZL B;  2NZD B;  3WA9 C;  2DF4 C;  3AN2 B;  5B32 D;  3W97 B;  3UT9 D;  3MGS B;  5B1L C;  3AZH A;  5AV5 A;  3MGR A;  1M18 C;  2ARO A;  4J8V C;  3AV1 A;  2ZY2 A;  3NQU B;  1P3G D;  2FJ7 B;  5AV9 A;  3AZK A;  2Y2H A;  3WA9 D;  3AZF C;  3C1C C;  3REI C;  3MGQ C;  4R8P C;  1EQZ C;  3UTB A;  4NE3 A;  5E5A A;  1M18 D;  3W96 A;  2F8N D;  4J8V D;  1JFI A;  1AOI D;  4CAY A;  4WZS B;  3X1U C;  2Y2G A;  4G91 C;  4WU9 C;  3H0L C;  3AZF D;  3REI D;  1EQZ D;  1ZLA A;  3AZN B;  5CPJ D;  1KX5 B;  3X1U D;  3AZM B;  3B0C T;  2Y2Q A;  3LJA B;  4WU9 D;  5G49 B;  3REK D;  4YM6 C;  3WAA A;  4YS3 D;  4DRB A;  5C3I C;  4E45 A;  5BNV A;  3FDD A;  5BS7 A;  3B0B A;  3C1B B;  1P3K C;  5AV6 A;  5F99 A;  3EPK A;  1P3F C;  3W99 A;  3A1I A;  5AVB B;  3AN2 C;  3AZH B;  5AV5 B;  3MGR B;  3W97 C;  2ARO B;  4J8X C;  5B24 A;  3AV1 B;  1P3B A;  1Q9C A;  1P3P A;  3LEL A;  2HUE B;  2XD1 A;  1P3K D;  5JA4 A;  3O62 A;  5AV9 B;  3AZK B;  1P3O A;  1P3I C;  3AZE A;  1P3F D;  2FJ7 C;  3IP4 C;  3AYW D;  2VQR A;  2PYO A;  1TZY D;  3AN2 D;  3UTB B;  5E5A B;  3W96 B;  4J8X D;  1JFI B;  1M19 A;  4CAY B;  2JE5 A;  4QLC D;  1B6W A;  1P3I D;  2Y2O A;  2FJ7 D;  4J8U A;  2XD5 A;  1M1A C;  2IO5 B;  3TU4 A;  3X1V C;  3B0D B;  3AZJ C;  1ZLA B;  1BH8 A;  5B31 A;  5AVC C;  4KUD D;  3MVD C;  3AZM C;  3WKJ A;  4E44 A;  1M1A D;  3WAA B;  3X1V D;  4UUZ A;  3W98 A;  1ID3 A;  5BNV B;  1KU5 A;  4Z66 A;  2G5H C;  5B1M C;  5AVC D;  3MVD D;  5GT0 A;  5AV6 B;  2F8N K;  5B2I A;  5CPK A;  3C1B C;  5F99 B;  1F66 A;  1P3M A;  3W99 B;  4Z5T A;  4ZUX A;  5AVB C;  5B24 B;  1WWI A;  5AV5 C;  5B1M D;  3MGR C;  1P3B B;  1P3P B;  3LEL B;  5JA4 B;  3O62 B;  1U35 A;  3F6T A;  1P3O B;  2HUE C;  5B0Y C;  3AZE B;  5AV9 C;  3MGP D;  2PYO B;  4G92 B;  1TAF A;  3EPH A;  5AVB D;  3AZJ A;  3MGR D;  3AFA A;  4XZQ A;  1M19 B;  5E5A C;  3W96 C;  3A6N A;  3AZG C;  5B0Z A;  3REH D;  1T3U A;  5B0Y D;  5B40 A;  2RVQ C;  3MNN C;  4XUJ A;  5AV9 D;  4J8U B;  2Y2M A;  4X23 A;  5CHL B;  2NQB C;  3TU4 B;  5GXQ D;  3AZI A;  1P3A A;  1KX3 D;  2CV5 D;  3X1T A;  4J8W A;  4WU8 A;  1BH8 B;  4KHA A;  5B31 B;  3AZG D;  4KGC C;  5AY8 C;  1KX4 D;  3KWQ D;  3WKJ B;  2RVQ D;  3MNN D;  4LD9 A;  1PZR A;  2FFF B;  5AV8 A;  3LZ0 A;  2NQB D;  3W98 B;  4UUZ B;  1ID3 B;  4JJN C;  1P34 A;  5B1L D;  4Z66 B;  2L5A A;  4KGC D;  3KXB A;  4EO5 C;  5AY8 D;  5BS7 C;  5GT0 B;  3B6G A;  5B2I B;  5CPK B;  3KUY C;  1F66 B;  1S32 A;  5B2J C;  3WTP C;  4NE6 A;  4ZBJ C;  3LZ1 A;  3C1C D;  3AV2 A;  3X1S C;  1P3M B;  5F99 C;  4JJN D;  3MGQ D;  3REJ A;  5CPI A;  4R8P D;  4Z5T B;  3W99 C;  5GSU C;  1P3L A;  4ZUX B;  5B32 A;  5B24 C;  1U35 B;  2HIO C;  3KUY D;  3UT9 A;  5B2J D;  3WTP D;  1P3O C;  3X1S D;  3AL0 C;  3UTA C;  3W99 D;  5GSU D;  3VH5 A;  5GT3 A;  1P3G A;  1TAF B;  2PYO C;  3AZJ B;  4WNN A;  4XZQ B;  5DNM C;  3WTP E;  3AFA B;  4AWL B;  3A6N B;  5B24 D;  5B0Z B;  1M19 C;  2HIO D;  5B40 B;  4XUJ B;  1P3O D;  2YFW A;  4X23 B;  2BYK A;  3UTA D;  4J8V A;  4YM6 D;  3AZL C;  2F8N A;  3P5J B;  2NZD C;  1AOI A;  3AZI B;  1P3A B;  2Y2P A;  2PYO D;  3X1T B;  4J8W B;  2DQN C;  4WU8 B;  5DNM D;  2J8P A;  3MGS C;  4KHA B;  3AZF A;  1M19 D;  3REI A;  1EQZ A;  4LD9 B;  3R45 A;  4HGA B;  3WKJ C;  5AV8 B;  3LZ0 B;  3AZL D;  2NZD D;  5CPJ A;  4H9S C;  3X1U A;  1P34 B;  3W98 C;  1ID3 C;  4WU9 A;  3W97 D;  3A1K A;  3H0R C;  3MGS D;  3KXB B;  5B31 G;  4Z66 C;  3REK A;  4YS3 A;  3B6G B;  1HQ3 A;  1S32 B;  3AV2 B;  3LZ1 B;  5B2I C;  3REJ B;  5CPI B;  1P3M C;  3W98 D;  2Y2I A;  1P3L B;  4Z5T C;  4Z66 D;  3AZN C;  5BNX A;  5B32 B;  3UT9 B;  1KX5 C;  2UWX A;  5B2I D;  3LJA C;  2F2A C;  2BG1 A;  4DRA A;  1P3K A;  1BH9 A;  5GT3 B;  1P3G B;  4WNN B;  3AZN D;  1P3F A;  3AYW A;  3B6F A;  1TZY A;  4AWL C;  1KX5 D;  2W8S A;  3AZM D;  5CP6 A;  5B33 A;  3LJA D;  2YFW B;  4J8X A;  2BYK B;  2F8N B;  4J8V B;  3VH5 W;  1AOI B;  2G5I C;  5BT1 C;  4X23 C;  4QLC A;  1P3I A;  4H9R A;  3AZH C;  2FJ7 A;  3AZF B;  3X1T C;  3REI B;  2ARO C;  4H9N A;  3AV1 C;  1EQZ B;  3R45 B;  3C1B D;  2BYM A;  3AZK C;  5CPJ B;  5BT1 D;  4HGA C;  3X1U B;  2YFV A;  5AV8 C;  3LZ0 C;  4KUD A;  4WU9 B;  5DNN A;  3AZH D;  5AV5 D;  3UTB C;  1W2E A;  5FUG A;  1M1A A;  3REK B;  2ARO D;  2Y2J A;  5JRG A;  3X1V A;  3KXB C;  3AV1 D;  4YS3 B;  1BFM A;  4WV4 B;  1HQ3 B;  2JSS A;  3AZK D;  3B6G C;  1S32 C;  3LZ0 D;  5AVC A;  3REL A;  3MVD A;  4Z2M G;  2IO5 C;  3VH6 A;  5CPI C;  3UTB D;  3B0D C;  5E5A D;  3W96 D;  1ZLA C;  5BNX B;  4CSR A;  2Y2L A;  5B1M A;  2Y2K A;  1P3K B;  1BH9 B;  1HTA A;  3WAA C;  3H0M C;  5GT3 C;  1ZLA D;  1P3F B;  3AYW B;  3MGP A;  3B6F B;  1TZY B;  5B32 G;  2ZM5 A;  5CP6 B;  5B33 B;  4H9P A;  4J8X B;  1F1E A;  5AVB A;  5AV6 C;  4QLC B;  3WAA D;  1AOI C;  3REH A;  1P3I B;  5B0Y A;  5GT3 D;  4H9R B;  4H9N B;  5GXQ A;  1KX3 A;  1P3B C;  1P3P C;  2CV5 A;  2BYM B;  3VH5 T;  4NE5 A;  3LEL C;  5AV6 D;  3O62 C;  2F8N G;  5F99 D;  3AZG A;  2YFV B;  3AZE C;  1KX4 A;  5CPJ C;  1N1J A;  3KWQ A;  4KUD B;  5DNN B;  3MNN A;  1M1A B;  5FUG B;  3WA9 A;  4G92 C;  2NQB A;  5JRG B;  3X1V B;  4DQY B;  1P3B D;  1P3P D;  3LEL D;  5B1L A;  3REK C;  4YS3 C;  3O62 D;  1M18 A;  4UPK A;  1HQ3 C;  3EPJ A;  4KGC A;  1H3O A;  3AZE D;  5AVC B;  5AY8 A;  4J8U C;  3REL B;  3MVD B;  3TU4 C;  3C1C A;  4JJN A;  3MGQ A;  4CSR B;  3EG5 B;  5B31 C;  4R8P A;  5KDM A;  1HQ3 D;  5B1M B;  4J8U D;  3VH6 W;  1WWS A;  3TU4 D;  3KUY A;  5B2J A;  3WTP A;  3X1S A;  3MGP B;  5BO0 A;  5B31 D;  1Z2C B;  3AYW C;  4H9P B;  5GSU A;  1TZY C;  3B6F C;  4H9Q A;  3WKJ D;  5GT0 C;  5CP6 C;  5B33 C;  5CPK C;  1ULY A;  1F66 C;  2HIO A;  2RIQ A;  3REH B;  1ID3 D;  5B0Y B;  3NQJ A;  4QLC C;  2JCH A;  3UTA A;  4ZUX C;  4YM6 A;  5GXQ B;  1KX3 B;  1B67 A;  2CV5 B;  3B6F D;  4H9O A;  5CP6 D;  4M6B A;  5B33 D;  5GT0 D;  5DNM A;  5CPK D;  1U35 C;  3AZG B;  1F66 D;  1P3M D;  1KX4 B;  3KFU G;  1N1J B;  3KWQ B;  3MNN B;  4Z5T D;  3V9R A;  3WA9 B;  4KUD C;  4ZUX D;  3AZL A;  2NZD A;  2NQB B;  5DNN C;  3AFA C;  4XZQ C; 
#chains in the Genus database with same CATH homology
 3AN2 A;  5B1L B;  3A6N C;  5JRG C;  5B0Z C;  1U35 D;  1M18 B;  3W97 A;  3MGS A;  4KGC B;  1H3O B;  5B40 C;  4WJ3 C;  5AY8 B;  4XUJ C;  3NQU A;  3REL C;  3AZI C;  1P3A C;  4Z2M H;  5DNN D;  3AZJ D;  3C1C B;  4J8W C;  4H9S A;  3AFA D;  4XZQ D;  4WU8 C;  4JJN B;  3MGQ B;  3A6N D;  5JRG D;  4R8P B;  5B0Z D;  1A7W A;  2ZY3 A;  5KDM B;  2ZY5 A;  4EO5 B;  5B40 D;  4LD9 C;  4XUJ D;  2CWE A;  4X23 D;  2Y2N A;  2LY8 A;  4G91 B;  3KUY B;  3AZI D;  3REL D;  1P3A D;  3WTP B;  5B2J B;  1P34 C;  4ZBJ B;  3X1T D;  3X1S B;  4J8W D;  4WU8 D;  3B0C W;  5BO0 B;  3EPL A;  5GSU B;  2ZY4 A;  3MGP C;  4H9Q B;  3VH6 T;  4LD9 D;  3AZN A;  5AV8 D;  3AV2 C;  3LZ1 C;  2HIO B;  1KX5 A;  3AZM A;  3REJ C;  1P34 D;  3NQJ B;  3LJA A;  3UTA B;  3REH C;  1P3L C;  4YM6 B;  4NFT A;  3KXB D;  5C3I B;  5G49 A;  4H9O B;  5GXQ C;  5B32 C;  3B6G D;  1KX3 C;  5DNM B;  1R4V A;  3UT9 C;  3KSY A;  2CV5 C;  1S32 D;  3AV2 D;  3LZ1 D;  2F8N H;  3REJ D;  5CPI D;  3C1B A;  1KX4 C;  3V9R B;  3KWQ C;  1P3G C;  1P3L D;  3AZL B;  2NZD B;  3WA9 C;  2DF4 C;  3AN2 B;  5B32 D;  3W97 B;  3UT9 D;  3MGS B;  5B1L C;  3AZH A;  5AV5 A;  3MGR A;  1M18 C;  2ARO A;  4J8V C;  3AV1 A;  2ZY2 A;  3NQU B;  1P3G D;  2FJ7 B;  5AV9 A;  3AZK A;  2Y2H A;  3WA9 D;  3AZF C;  3C1C C;  3REI C;  3MGQ C;  4R8P C;  1EQZ C;  3UTB A;  4NE3 A;  5E5A A;  1M18 D;  3W96 A;  2F8N D;  4J8V D;  1JFI A;  1AOI D;  4CAY A;  4WZS B;  3X1U C;  2Y2G A;  4G91 C;  4WU9 C;  3H0L C;  3AZF D;  3REI D;  1EQZ D;  1ZLA A;  3AZN B;  5CPJ D;  1KX5 B;  3X1U D;  3AZM B;  3B0C T;  2Y2Q A;  3LJA B;  4WU9 D;  5G49 B;  3REK D;  4YM6 C;  3WAA A;  4YS3 D;  4DRB A;  5C3I C;  4E45 A;  5BNV A;  3FDD A;  5BS7 A;  3B0B A;  3C1B B;  1P3K C;  5AV6 A;  5F99 A;  3EPK A;  1P3F C;  3W99 A;  3A1I A;  5AVB B;  3AN2 C;  3AZH B;  5AV5 B;  3MGR B;  3W97 C;  2ARO B;  4J8X C;  5B24 A;  3AV1 B;  1P3B A;  1Q9C A;  1P3P A;  3LEL A;  2HUE B;  2XD1 A;  1P3K D;  5JA4 A;  3O62 A;  5AV9 B;  3AZK B;  1P3O A;  1P3I C;  3AZE A;  1P3F D;  2FJ7 C;  3IP4 C;  3AYW D;  2VQR A;  2PYO A;  1TZY D;  3AN2 D;  3UTB B;  5E5A B;  3W96 B;  4J8X D;  1JFI B;  1M19 A;  4CAY B;  2JE5 A;  4QLC D;  1B6W A;  1P3I D;  2Y2O A;  2FJ7 D;  4J8U A;  2XD5 A;  1M1A C;  2IO5 B;  3TU4 A;  3X1V C;  3B0D B;  3AZJ C;  1ZLA B;  1BH8 A;  5B31 A;  5AVC C;  4KUD D;  3MVD C;  3AZM C;  3WKJ A;  4E44 A;  1M1A D;  3WAA B;  3X1V D;  4UUZ A;  3W98 A;  1ID3 A;  5BNV B;  1KU5 A;  4Z66 A;  2G5H C;  5B1M C;  5AVC D;  3MVD D;  5GT0 A;  5AV6 B;  2F8N K;  5B2I A;  5CPK A;  3C1B C;  5F99 B;  1F66 A;  1P3M A;  3W99 B;  4Z5T A;  4ZUX A;  5AVB C;  5B24 B;  1WWI A;  5AV5 C;  5B1M D;  3MGR C;  1P3B B;  1P3P B;  3LEL B;  5JA4 B;  3O62 B;  1U35 A;  3F6T A;  1P3O B;  2HUE C;  5B0Y C;  3AZE B;  5AV9 C;  3MGP D;  2PYO B;  4G92 B;  1TAF A;  3EPH A;  5AVB D;  3AZJ A;  3MGR D;  3AFA A;  4XZQ A;  1M19 B;  5E5A C;  3W96 C;  3A6N A;  3AZG C;  5B0Z A;  3REH D;  1T3U A;  5B0Y D;  5B40 A;  2RVQ C;  3MNN C;  4XUJ A;  5AV9 D;  4J8U B;  2Y2M A;  4X23 A;  5CHL B;  2NQB C;  3TU4 B;  5GXQ D;  3AZI A;  1P3A A;  1KX3 D;  2CV5 D;  3X1T A;  4J8W A;  4WU8 A;  1BH8 B;  4KHA A;  5B31 B;  3AZG D;  4KGC C;  5AY8 C;  1KX4 D;  3KWQ D;  3WKJ B;  2RVQ D;  3MNN D;  4LD9 A;  1PZR A;  2FFF B;  5AV8 A;  3LZ0 A;  2NQB D;  3W98 B;  4UUZ B;  1ID3 B;  4JJN C;  1P34 A;  5B1L D;  4Z66 B;  2L5A A;  4KGC D;  3KXB A;  4EO5 C;  5AY8 D;  5BS7 C;  5GT0 B;  3B6G A;  5B2I B;  5CPK B;  3KUY C;  1F66 B;  1S32 A;  5B2J C;  3WTP C;  4NE6 A;  4ZBJ C;  3LZ1 A;  3C1C D;  3AV2 A;  3X1S C;  1P3M B;  5F99 C;  4JJN D;  3MGQ D;  3REJ A;  5CPI A;  4R8P D;  4Z5T B;  3W99 C;  5GSU C;  1P3L A;  4ZUX B;  5B32 A;  5B24 C;  1U35 B;  2HIO C;  3KUY D;  3UT9 A;  5B2J D;  3WTP D;  1P3O C;  3X1S D;  3AL0 C;  3UTA C;  3W99 D;  5GSU D;  3VH5 A;  5GT3 A;  1P3G A;  1TAF B;  2PYO C;  3AZJ B;  4WNN A;  4XZQ B;  5DNM C;  3WTP E;  3AFA B;  4AWL B;  3A6N B;  5B24 D;  5B0Z B;  1M19 C;  2HIO D;  5B40 B;  4XUJ B;  1P3O D;  2YFW A;  4X23 B;  2BYK A;  3UTA D;  4J8V A;  4YM6 D;  3AZL C;  2F8N A;  3P5J B;  2NZD C;  1AOI A;  3AZI B;  1P3A B;  2Y2P A;  2PYO D;  3X1T B;  4J8W B;  2DQN C;  4WU8 B;  5DNM D;  2J8P A;  3MGS C;  4KHA B;  3AZF A;  1M19 D;  3REI A;  1EQZ A;  4LD9 B;  3R45 A;  4HGA B;  3WKJ C;  5AV8 B;  3LZ0 B;  3AZL D;  2NZD D;  5CPJ A;  4H9S C;  3X1U A;  1P34 B;  3W98 C;  1ID3 C;  4WU9 A;  3W97 D;  3A1K A;  3H0R C;  3MGS D;  3KXB B;  5B31 G;  4Z66 C;  3REK A;  4YS3 A;  3B6G B;  1HQ3 A;  1S32 B;  3AV2 B;  3LZ1 B;  5B2I C;  3REJ B;  5CPI B;  1P3M C;  3W98 D;  2Y2I A;  1P3L B;  4Z5T C;  4Z66 D;  3AZN C;  5BNX A;  5B32 B;  3UT9 B;  1KX5 C;  2UWX A;  5B2I D;  3LJA C;  2F2A C;  2BG1 A;  4DRA A;  1P3K A;  1BH9 A;  5GT3 B;  1P3G B;  4WNN B;  3AZN D;  1P3F A;  3AYW A;  3B6F A;  1TZY A;  4AWL C;  1KX5 D;  2W8S A;  3AZM D;  5CP6 A;  5B33 A;  3LJA D;  2YFW B;  4J8X A;  2BYK B;  2F8N B;  4J8V B;  3VH5 W;  1AOI B;  2G5I C;  5BT1 C;  4X23 C;  4QLC A;  1P3I A;  4H9R A;  3AZH C;  2FJ7 A;  3AZF B;  3X1T C;  3REI B;  2ARO C;  4H9N A;  3AV1 C;  1EQZ B;  3R45 B;  3C1B D;  2BYM A;  3AZK C;  5CPJ B;  5BT1 D;  4HGA C;  3X1U B;  2YFV A;  5AV8 C;  3LZ0 C;  4KUD A;  4WU9 B;  5DNN A;  3AZH D;  5AV5 D;  3UTB C;  1W2E A;  5FUG A;  1M1A A;  3REK B;  2ARO D;  2Y2J A;  5JRG A;  3X1V A;  3KXB C;  3AV1 D;  4YS3 B;  1BFM A;  4WV4 B;  1HQ3 B;  2JSS A;  3AZK D;  3B6G C;  1S32 C;  3LZ0 D;  5AVC A;  3REL A;  3MVD A;  4Z2M G;  2IO5 C;  3VH6 A;  5CPI C;  3UTB D;  3B0D C;  5E5A D;  3W96 D;  1ZLA C;  5BNX B;  4CSR A;  2Y2L A;  5B1M A;  2Y2K A;  1P3K B;  1BH9 B;  1HTA A;  3WAA C;  3H0M C;  5GT3 C;  1ZLA D;  1P3F B;  3AYW B;  3MGP A;  3B6F B;  1TZY B;  5B32 G;  2ZM5 A;  5CP6 B;  5B33 B;  4H9P A;  4J8X B;  1F1E A;  5AVB A;  5AV6 C;  4QLC B;  3WAA D;  1AOI C;  3REH A;  1P3I B;  5B0Y A;  5GT3 D;  4H9R B;  4H9N B;  5GXQ A;  1KX3 A;  1P3B C;  1P3P C;  2CV5 A;  2BYM B;  3VH5 T;  4NE5 A;  3LEL C;  5AV6 D;  3O62 C;  2F8N G;  5F99 D;  3AZG A;  2YFV B;  3AZE C;  1KX4 A;  5CPJ C;  1N1J A;  3KWQ A;  4KUD B;  5DNN B;  3MNN A;  1M1A B;  5FUG B;  3WA9 A;  4G92 C;  2NQB A;  5JRG B;  3X1V B;  4DQY B;  1P3B D;  1P3P D;  3LEL D;  5B1L A;  3REK C;  4YS3 C;  3O62 D;  1M18 A;  4UPK A;  1HQ3 C;  3EPJ A;  4KGC A;  1H3O A;  3AZE D;  5AVC B;  5AY8 A;  4J8U C;  3REL B;  3MVD B;  3TU4 C;  3C1C A;  4JJN A;  3MGQ A;  4CSR B;  3EG5 B;  5B31 C;  4R8P A;  5KDM A;  1HQ3 D;  5B1M B;  4J8U D;  3VH6 W;  1WWS A;  3TU4 D;  3KUY A;  5B2J A;  3WTP A;  3X1S A;  3MGP B;  5BO0 A;  5B31 D;  1Z2C B;  3AYW C;  4H9P B;  5GSU A;  1TZY C;  3B6F C;  4H9Q A;  3WKJ D;  5GT0 C;  5CP6 C;  5B33 C;  5CPK C;  1ULY A;  1F66 C;  2HIO A;  2RIQ A;  3REH B;  1ID3 D;  5B0Y B;  3NQJ A;  4QLC C;  2JCH A;  3UTA A;  4ZUX C;  4YM6 A;  5GXQ B;  1KX3 B;  1B67 A;  2CV5 B;  3B6F D;  4H9O A;  5CP6 D;  4M6B A;  5B33 D;  5GT0 D;  5DNM A;  5CPK D;  1U35 C;  3AZG B;  1F66 D;  1P3M D;  1KX4 B;  3KFU G;  1N1J B;  3KWQ B;  3MNN B;  4Z5T D;  3V9R A;  3WA9 B;  4KUD C;  4ZUX D;  3AZL A;  2NZD A;  2NQB B;  5DNN C;  3AFA C;  4XZQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...