3W98C

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98C00
4H9NB 4Z2MH 4YS3A 3X1UC 4Z66A 1EQZB 4KGCD 4WU8A 4H9SC 3MGQD 1B67A 5AVCC 3UTBA 1P3KB 1KX4C 1P3FD 5GSUB 1P3LD 3LELC 3MGSD 3MGRA 3AZEC 1HQ3A 3W97C 4J8VB 1P34B 1P3MD 5B0ZD 4X23A 3TU4A 1U35B 1M1AA 1KX3A 3WA9B 1P3PB 1BH8A 4J8UA 5B24B 1ULYA 4YS3D 5DNMA 4G91C 3LJAA 3MVDA 3B6GC 4YM6D 3UTBD 3KXBB 4J8XB 5BS7C 5B2JB 1ZLAC 3WTPE 5GT3C 3MNND 2LY8A 3MGRD 3AZFB 4H9PB 5CPKC 4E45A 2PYOD 3B0BA 5B40B 1HQ3D 4ZUXC 1TZYB 5B32D 3WAAB 1S32B 5AV9B 3AZKB 3TU4D 3X1SB 3LZ1B 3AZIC 3LZ0B 4XUJC 1EQZA 1M1AD 1KX3D 1KU5A 4KUDC 2BYKA 1F66C 3WTPB 3AFAD 1P3KA 1H3OB 2FJ7D 5DNMD 5GSUA 4LD9B 5JA4B 3UT9B 3V9RB 3MVDD 5C3IC 2F8NB 4J8VA 1P34A 3AZMA 1Q9CA 3KUYC 3REIC 3AV2D 5JRGC 3O62B 4NE5A 1U35A 3AZJB 1P3BC 5AY8C 1KX5C 4XZQC 5B24A 2NQBC 3R45B 1EQZD 3REJA 1JFIA 4EO5B 5GT0C 3AV1B 5B2JA 4Z66B 3MGQC 2HIOB 3AYWC 1P3KD 5B1MB 5GSUD 4WU8B 1P3FC 1P3LC 5CP6B 3X1TA 5AV6B 5B40A 4J8VD 3W99A 1P34D 1TZYA 3WAAA 1S32A 5AV9A 3AZKA 5CPIC 4J8WB 3X1SA 5B0ZC 3LZ1A 3WKJB 3LZ0A 1U35D 3NQJB 4Z5TC 5DNNC 1WWIA 4X23B 5B2IB 3B6FB 3RELB 5B24D 3WTPA 3MGPC 1P3GB 3VH6A 3X1VB 3C1CB 1BH8B 4J8UB 4HGAB 3V9RA 2F8NA 3KXBD 4J8XD 5B2JD 3LJAB 4YM6C 3UTBC 2BYMB 1P3AA 2IO5C 3VH5T 5BO0B 3AZFD 5B33B 3MNNC 1P3IA 5B40D 3AZJA 3AZLB 2PYOC 4G92C 3REHB 1TZYD 5B1LB 3WAAD 1S32D 3W98B 5AV9D 2AROB 4WU9A 3AZKD 5B32C 3X1SD 3LZ1D 2RVQD 5B31G 3LZ0D 4ZBJB 3AV1A 3B0CT 3WTPD 2HIOA 5AVCB 5B1MA 4LD9D 3AFAC 2FJ7C 3UT9D 1AOIA 2BYKB 5CP6A 5AV6A 2F8ND 3AZEB 1WWSA 2YFWB 2NZDB 3REKA 3O62D 4J8WA 3KWQC 3AZHC 3AN2C 3AV2C 3VH5W 3WKJA 5G49B 3AZMB 5GXQA 3NQJA 3AZJD 5B2IA 4NE6A 3B0DC 4UUZB 4R8PC 3RELA 3B6FA 5E5AA 4JJNC 1P3GA 4QLCA 3C1BC 3X1VA 3A6NA 3C1CA 5AV8B 4G91B 4Z2MG 3AV1D 5F99B 5BT1C 4Z66D 3B6GB 2HIOD 5B0YC 5B1MD 3REJB 3UTAC 1JFIB 3B0CW 4WU8D 2BYMA 1ZLAB 5BO0A 5B33A 5CP6D 5BNVA 5AV6D 4WNNB 3AZLA 3REHA 5B1LA 4ZUXB 3W98A 2AROA 3X1TB 4J8WD 2CV5C 3AZGC 3W99B 3WKJD 5AVBC 5B31C 3X1UA 4X23D 4XUJB 5B2ID 3B6FD 3RELD 3WA9C 4H9SA 1P3PC 5AVCA 1P3GD 3X1VD 1F66B 2YFVB 3C1CD 1KX4A 4J8UD 1P3OC 3AZEA 3LJAD 2YFWA 2NZDA 3KXBC 4J8XC 5B2JC 5B33D 5CPJC 1M19C 5JRGB 5G49A 3AZFC 3AZLD 1P3AB 3W96B 4NE3A 3REHD 5B1LD 3W98D 4UUZA 2AROD 5AY8B 1B6WA 1P3IB 1KX5B 4XZQB 3AZNB 2RVQC 5AV8A 5AV5C 3X1UD 5B32G 4WU9B 2NQBB 5F99A 2HUEC 3B6GA 5GT0B 5AVCD 5BS7A 1ZLAA 4WZSB 3AYWB 4KGCC 4LD9C 3UT9C 5CPKA 3AZED 4WNNA 2NZDD 1AOIB 4ZUXA 3MGSC 5CPIB 1N1JB 3O62C 3AZMD 3REKB 3AZIA 4XUJA 4Z5TB 1P3MC 3AZJC 5DNNB 5GXQB 1F66A 3MGPB 2YFVA 5AV8D 5E5AB 4QLCB 5F99D 3B6GD 3A6NB 3REJD 1ID3B 4YS3C 1ZLAD 1R4VA 4Z66C 4WU8C 2IO5B 3KUYA 3REIA 5JRGA 5BNXB 3W96A 4ZUXD 1M18B 1P3BA 5AY8A 5BNVB 3X1TD 4G92B 3MGRC 1KX5A 4XZQA 3W99D 4DRBA 3AZNA 1HQ3C 4CSRB 2NQBA 4XUJD 2L5AA 4X23C 3TU4C 5GT0A 3B6FC 3X1UB 3AYWA 3MGQA 1F66D 1P3GC 1M1AC 1KX3C 1HTAA 4E44A 3C1CC 1P3FA 1P3LA 4J8UC 1KX4B 5DNMC 3LELB 3LJAC 5KDMB 5JRGD 1TAFB 3MVDC 1N1JA 5CPIA 3KWQB 3AZHB 5FUGA 3AN2B 3W97B 2F8NH 1P3AD 4AWLC 3W96D 4Z5TA 5DNNA 5AY8D 4R8PB 1P3ID 1KX5D 4XZQD 4JJNB 4H9RB 3MGPA 4NFTA 3AZND 2NQBD 4WU9D 3C1BB 4ZBJC 5GT0D 1ID3A 3AYWD 5B0YB 3NQUB 4YM6A 3UTAB 1EQZC 4H9OB 5BNXA 3MNNA 1P3KC 5GT3B 1AOID 5GSUC 2PYOA 1M18A 2NZDC 5CPKB 2F8NG 5CPID 5B32A 3REKD 2CV5B 3AZGB 2CWEA 4CSRA 4J8VC 1P34C 5B31B 4Z5TD 5AVBB 3AZMC 5DNND 5GXQD 3AZIB 3MGPD 1U35C 5E5AD 3AFAA 2FJ7A 4KUDB 5AV8C 4QLCD 1P3OB 5B24C 3A6ND 4KHAB 1ID3D 5F99C 1BFMA 3VH6T 3LELA 3REJC 5KDMA 1TAFA 3VH5A 5C3IB 3KWQA 3AZHA 5CPJB 3AN2A 1M19B 3W97A 3AV2A 4CAYB 3KUYB 3REIB 1M18D 4R8PA 3X1TC 4JJNA 4H9RA 1BH9B 5B40C 3W99C 3C1BA 1P3BB 4DRAA 4H9NA 1TZYC 5AV5B 3WAAC 1S32C 5AV9C 3AZKC 3LZ1C 3X1SC 1A7WA 2HUEB 4WV4B 3LZ0C 5B0YA 3NQUA 3UTAA 4KGCB 4H9OA 3MGQB 3WTPC 5GT3A 1KX4D 3LELD 3VH6W 1P3FB 1P3LB 3MGSB 3KWQD 3AZHD 2F8NK 3AN2D 2CV5A 3AZGA 3W97D 5B31A 5AVBA 1P3AC 3W96C 5CHLB 4M6BA 1P3MB 5B0ZB 5FUGB 4R8PD 3WA9A 4JJND 1P3PA 1P3IC 3C1BD 4H9QB 3AZNC 4KUDA 1P3OA 4WU9C 4KHAA 5BT1D 5B0YD 3UTAD 4YS3B 3KXBA 4J8XA 4EO5C 5CPJA 3AV1C 1M19A 2HIOC 4YM6B 4CAYA 5B1MC 5GT3D 4H9PA 3UTBB 3AZFA 3KSYA 5CPKD 1AOIC 3MNNB 5CP6C 5AV6C 3MGRB 2CV5D 3AZGD 1BH9A 2PYOB 5B31D 5AVBD 3REKC 1HQ3B 5AV5A 5B32B 4J8WC 3AZID 3WA9D 3TU4B 3WKJC 1P3PD 5GXQC 5B2IC 1M1AB 1H3OA 1KX3B 4KUDD 4KGCA 4LD9A 3RELC 5JA4A 1P3OD 5E5AC 3UT9A 4QLCC 3X1VC 2JSSA 3A6NC 3AFAB 2FJ7B 1ID3C 5DNMB 3MGSA 4HGAC 5CPJD 1M19D 3MVDB 3O62A 1F1EA 3KUYD 4AWLB 3REID 1P3MA 5B33C 5B0ZA 3AV2B 1M18C 3AZLC 1P3BD 3REHC 4H9QA 5B1LC 5AV5D 3B0DB 3W98C 2AROC 3R45A
chains in the Genus database with same CATH superfamily
4H9NB 4Z2MH 4YS3A 3X1UC 4Z66A 1EQZB 4KGCD 4WU8A 2DF4C 4H9SC 3MGQD 1B67A 5AVCC 3UTBA 2Y2LA 1P3KB 1KX4C 1P3FD 5GSUB 1P3LD 2ZY4A 3LELC 3MGSD 3MGRA 3AZEC 1HQ3A 3W97C 4J8VB 1P34B 1P3MD 5B0ZD 4X23A 3TU4A 1U35B 1M1AA 1KX3A 3WA9B 1P3PB 1BH8A 4J8UA 5B24B 1ULYA 4YS3D 5DNMA 4G91C 3LJAA 3MVDA 3B6GC 4YM6D 3UTBD 3KXBB 4J8XB 5BS7C 5B2JB 1ZLAC 3WTPE 5GT3C 3MNND 2LY8A 3MGRD 3AZFB 4H9PB 5CPKC 4E45A 2PYOD 3B0BA 5B40B 1HQ3D 4ZUXC 1TZYB 5B32D 3WAAB 1S32B 5AV9B 2UWXA 3EPKA 3AZKB 3TU4D 3X1SB 3LZ1B 3AZIC 3LZ0B 4XUJC 1EQZA 1M1AD 1KX3D 1KU5A 4KUDC 2BYKA 1F66C 3WTPB 3AFAD 1P3KA 1H3OB 2FJ7D 5DNMD 5GSUA 4LD9B 5JA4B 2Y2HA 3UT9B 3V9RB 3MVDD 5C3IC 2F8NB 4WJ3C 4J8VA 2Y2PA 1P34A 3AZMA 1Q9CA 3KUYC 3REIC 3AV2D 5JRGC 3O62B 2Y2KA 4NE5A 1U35A 3AZJB 1P3BC 5AY8C 1KX5C 4XZQC 5B24A 3AL0C 2NQBC 3R45B 1EQZD 3REJA 1JFIA 3IP4C 4EO5B 5GT0C 3AV1B 2ZM5A 5B2JA 4Z66B 3MGQC 2HIOB 3AYWC 1P3KD 5B1MB 5GSUD 4WU8B 2FFFB 1P3FC 1P3LC 3EPLA 5CP6B 3X1TA 5AV6B 5B40A 4J8VD 3W99A 1P34D 1TZYA 3WAAA 1S32A 5AV9A 3AZKA 5CPIC 4J8WB 3X1SA 5B0ZC 3LZ1A 3WKJB 3LZ0A 1U35D 3NQJB 4Z5TC 5DNNC 1WWIA 4X23B 5B2IB 2ZY3A 3B6FB 3RELB 5B24D 3WTPA 3MGPC 1P3GB 3VH6A 3X1VB 3C1CB 1BH8B 4J8UB 4HGAB 3V9RA 2F8NA 3KXBD 4J8XD 5B2JD 3LJAB 4YM6C 3UTBC 2BYMB 1P3AA 2IO5C 3VH5T 5BO0B 3AZFD 5B33B 3MNNC 1P3IA 5B40D 3AZJA 3AZLB 2PYOC 4G92C 3REHB 1TZYD 5B1LB 3WAAD 1S32D 3W98B 5AV9D 2AROB 4WU9A 3AZKD 2XD5A 4UPKA 5B32C 3X1SD 3LZ1D 2RVQD 5B31G 3LZ0D 4ZBJB 3P5JB 3AV1A 3B0CT 3WTPD 2HIOA 5AVCB 5B1MA 4LD9D 3AFAC 2FJ7C 3UT9D 1AOIA 2BYKB 5CP6A 5AV6A 2F8ND 3AZEB 1WWSA 2YFWB 2NZDB 3REKA 3O62D 4J8WA 3KWQC 3AZHC 3AN2C 3AV2C 3VH5W 2Y2JA 3WKJA 5G49B 3AZMB 5GXQA 3NQJA 3AZJD 5B2IA 4NE6A 3B0DC 4UUZB 4R8PC 3RELA 3B6FA 5E5AA 3A1IA 4JJNC 1P3GA 4QLCA 3C1BC 2G5IC 3A6NA 3X1VA 3C1CA 5AV8B 2Y2NA 4G91B 1T3UA 4Z2MG 3AV1D 5F99B 5BT1C 4Z66D 3B6GB 2HIOD 5B0YC 5B1MD 3REJB 3UTAC 1JFIB 3B0CW 4WU8D 2BYMA 1ZLAB 5BO0A 5B33A 5CP6D 5BNVA 5AV6D 4WNNB 3AZLA 3REHA 5B1LA 4ZUXB 3W98A 2AROA 3X1TB 4J8WD 2W8SA 2CV5C 3AZGC 3W99B 3WKJD 5AVBC 5B31C 3X1UA 4X23D 4XUJB 5B2ID 1Z2CB 2ZY5A 3RELD 3B6FD 3WA9C 4H9SA 1P3PC 5AVCA 1P3GD 3X1VD 1F66B 2YFVB 3C1CD 1KX4A 4J8UD 1P3OC 3AZEA 3H0MC 3LJAD 3EPJA 2YFWA 2NZDA 3EG5B 3KXBC 4J8XC 5B2JC 5B33D 5CPJC 1M19C 5JRGB 5G49A 3AZFC 3AZLD 1P3AB 3W96B 4NE3A 3REHD 5B1LD 3W98D 4UUZA 2AROD 5AY8B 1B6WA 1P3IB 1KX5B 4XZQB 3AZNB 2RVQC 5AV8A 5AV5C 3X1UD 5B32G 4WU9B 2NQBB 5F99A 2HUEC 3B6GA 5GT0B 5AVCD 2J8PA 5BS7A 1ZLAA 4WZSB 3AYWB 4KGCC 4LD9C 3UT9C 5CPKA 3AZED 4WNNA 2NZDD 1AOIB 4ZUXA 3MGSC 2Y2OA 2Y2IA 5CPIB 1N1JB 3O62C 3AZMD 3H0LC 3REKB 3AZIA 4XUJA 4Z5TB 1P3MC 3AZJC 5DNNB 5GXQB 1F66A 3MGPB 2YFVA 5AV8D 5E5AB 4DQYB 4QLCB 5F99D 3A1KA 3B6GD 3A6NB 2Y2MA 3REJD 1ID3B 4YS3C 1ZLAD 1R4VA 4Z66C 4WU8C 2IO5B 3KUYA 3REIA 5JRGA 5BNXB 2G5HC 3W96A 4ZUXD 1M18B 1P3BA 5AY8A 5BNVB 3X1TD 4G92B 3MGRC 1KX5A 4XZQA 3W99D 4DRBA 3AZNA 1HQ3C 4CSRB 2NQBA 4XUJD 2L5AA 4X23C 3TU4C 5GT0A 3B6FC 3X1UB 3AYWA 3MGQA 1F66D 1P3GC 1W2EA 1M1AC 1KX3C 1HTAA 4E44A 3C1CC 1P3FA 1P3LA 4J8UC 2Y2GA 1KX4B 5DNMC 3LELB 3LJAC 5KDMB 5JRGD 1TAFB 3MVDC 1N1JA 5CPIA 3KWQB 3AZHB 5FUGA 3AN2B 3W97B 2F8NH 3EPHA 1P3AD 4AWLC 3W96D 4Z5TA 5DNNA 5AY8D 4R8PB 1P3ID 1KX5D 4XZQD 4JJNB 4H9RB 3MGPA 4NFTA 3AZND 2NQBD 4WU9D 3C1BB 4ZBJC 5GT0D 1ID3A 2F2AC 3AYWD 5B0YB 3NQUB 4YM6A 3UTAB 1EQZC 2JE5A 4H9OB 5BNXA 3MNNA 1P3KC 5GT3B 1AOID 5GSUC 2PYOA 1M18A 2NZDC 5CPKB 3H0RC 2F8NG 5CPID 2DQNC 5B32A 3REKD 2CV5B 3AZGB 2CWEA 4CSRA 4J8VC 1P34C 5AVBB 4Z5TD 5B31B 3AZMC 3FDDA 5DNND 5GXQD 3AZIB 3MGPD 1U35C 5E5AD 3AFAA 2FJ7A 4KUDB 5AV8C 4QLCD 1P3OB 5B24C 3A6ND 4KHAB 1ID3D 5F99C 1BFMA 3VH6T 3LELA 3REJC 5KDMA 1TAFA 3VH5A 5C3IB 3KWQA 3AZHA 5CPJB 3AN2A 1M19B 3W97A 3AV2A 4CAYB 3KFUG 3KUYB 3REIB 1M18D 2Y2QA 4R8PA 3X1TC 4JJNA 4H9RA 1BH9B 5B40C 2ZY2A 3W99C 3C1BA 1P3BB 4DRAA 4H9NA 1TZYC 5AV5B 3WAAC 1S32C 5AV9C 3AZKC 3LZ1C 3X1SC 1A7WA 2HUEB 4WV4B 3LZ0C 5B0YA 3NQUA 3UTAA 2VQRA 4KGCB 4H9OA 3MGQB 3WTPC 5GT3A 1KX4D 3LELD 3VH6W 1P3FB 1P3LB 3MGSB 3KWQD 3AZHD 2F8NK 3AN2D 2CV5A 3AZGA 3W97D 1PZRA 5B31A 5AVBA 1P3AC 3W96C 5CHLB 4M6BA 1P3MB 5B0ZB 5FUGB 4R8PD 3WA9A 4JJND 1P3PA 1P3IC 3C1BD 4H9QB 3AZNC 4KUDA 1P3OA 4WU9C 4KHAA 5BT1D 5B0YD 3UTAD 4YS3B 3KXBA 4J8XA 4EO5C 5CPJA 3AV1C 1M19A 2HIOC 4CAYA 5GT3D 5B1MC 4YM6B 4H9PA 3UTBB 3AZFA 3KSYA 5CPKD 1AOIC 3MNNB 5CP6C 5AV6C 3MGRB 2CV5D 3AZGD 1BH9A 2PYOB 5B31D 5AVBD 3REKC 1HQ3B 5AV5A 3F6TA 5B32B 4J8WC 3AZID 3WA9D 3TU4B 3WKJC 1P3PD 2BG1A 5GXQC 2RIQA 5B2IC 1M1AB 1H3OA 1KX3B 4KUDD 4KGCA 4LD9A 3RELC 5JA4A 1P3OD 5E5AC 3UT9A 4QLCC 3X1VC 2JSSA 3A6NC 3AFAB 2FJ7B 1ID3C 5DNMB 3MGSA 4HGAC 5CPJD 1M19D 3MVDB 3O62A 1F1EA 3KUYD 4AWLB 3REID 2XD1A 1P3MA 5B33C 5B0ZA 3AV2B 1M18C 3AZLC 1P3BD 3REHC 4H9QA 5B1LC 5AV5D 3B0DB 3W98C 2AROC 3R45A 2JCHA
chains in the Genus database with same CATH topology
4H9NB 4Z2MH 4YS3A 3X1UC 4Z66A 1EQZB 4KGCD 4WU8A 2DF4C 4H9SC 3MGQD 1B67A 5AVCC 3UTBA 2Y2LA 1P3KB 1KX4C 1P3FD 5GSUB 1P3LD 2ZY4A 3LELC 3MGSD 3MGRA 3AZEC 1HQ3A 3W97C 4J8VB 1P34B 1P3MD 5B0ZD 4X23A 3TU4A 1U35B 1M1AA 1KX3A 3WA9B 1P3PB 1BH8A 4J8UA 5B24B 1ULYA 4YS3D 5DNMA 4G91C 3LJAA 3MVDA 3B6GC 4YM6D 3UTBD 3KXBB 4J8XB 5BS7C 5B2JB 1ZLAC 3WTPE 5GT3C 3MNND 2LY8A 3MGRD 3AZFB 4H9PB 5CPKC 4E45A 2PYOD 3B0BA 5B40B 1HQ3D 4ZUXC 1TZYB 5B32D 3WAAB 1S32B 5AV9B 2UWXA 3EPKA 3AZKB 3TU4D 3X1SB 3LZ1B 3AZIC 3LZ0B 4XUJC 1EQZA 1M1AD 1KX3D 1KU5A 4KUDC 2BYKA 1F66C 3WTPB 3AFAD 1P3KA 1H3OB 2FJ7D 5DNMD 5GSUA 4LD9B 5JA4B 2Y2HA 3UT9B 3V9RB 3MVDD 5C3IC 2F8NB 4WJ3C 4J8VA 2Y2PA 1P34A 3AZMA 1Q9CA 3KUYC 3REIC 3AV2D 5JRGC 3O62B 2Y2KA 4NE5A 1U35A 3AZJB 1P3BC 5AY8C 1KX5C 4XZQC 5B24A 3AL0C 2NQBC 3R45B 1EQZD 3REJA 1JFIA 3IP4C 4EO5B 5GT0C 3AV1B 2ZM5A 5B2JA 4Z66B 3MGQC 2HIOB 3AYWC 1P3KD 5B1MB 5GSUD 4WU8B 2FFFB 1P3FC 1P3LC 3EPLA 5CP6B 3X1TA 5AV6B 5B40A 4J8VD 3W99A 1P34D 1TZYA 3WAAA 1S32A 5AV9A 3AZKA 5CPIC 4J8WB 3X1SA 5B0ZC 3LZ1A 3WKJB 3LZ0A 1U35D 3NQJB 4Z5TC 5DNNC 1WWIA 4X23B 5B2IB 2ZY3A 3B6FB 3RELB 5B24D 3WTPA 3MGPC 1P3GB 3VH6A 3X1VB 3C1CB 1BH8B 4J8UB 4HGAB 3V9RA 2F8NA 3KXBD 4J8XD 5B2JD 3LJAB 4YM6C 3UTBC 2BYMB 1P3AA 2IO5C 3VH5T 5BO0B 3AZFD 5B33B 3MNNC 1P3IA 5B40D 3AZJA 3AZLB 2PYOC 4G92C 3REHB 1TZYD 5B1LB 3WAAD 1S32D 3W98B 5AV9D 2AROB 4WU9A 3AZKD 2XD5A 4UPKA 5B32C 3X1SD 3LZ1D 2RVQD 5B31G 3LZ0D 4ZBJB 3P5JB 3AV1A 3B0CT 3WTPD 2HIOA 5AVCB 5B1MA 4LD9D 3AFAC 2FJ7C 3UT9D 1AOIA 2BYKB 5CP6A 5AV6A 2F8ND 3AZEB 1WWSA 2YFWB 2NZDB 3REKA 3O62D 4J8WA 3KWQC 3AZHC 3AN2C 3AV2C 3VH5W 2Y2JA 3WKJA 5G49B 3AZMB 5GXQA 3NQJA 3AZJD 5B2IA 4NE6A 3B0DC 4UUZB 4R8PC 3RELA 3B6FA 5E5AA 3A1IA 4JJNC 1P3GA 4QLCA 3C1BC 2G5IC 3A6NA 3X1VA 3C1CA 5AV8B 2Y2NA 4G91B 1T3UA 4Z2MG 3AV1D 5F99B 5BT1C 4Z66D 3B6GB 2HIOD 5B0YC 5B1MD 3REJB 3UTAC 1JFIB 3B0CW 4WU8D 2BYMA 1ZLAB 5BO0A 5B33A 5CP6D 5BNVA 5AV6D 4WNNB 3AZLA 3REHA 5B1LA 4ZUXB 3W98A 2AROA 3X1TB 4J8WD 2W8SA 2CV5C 3AZGC 3W99B 3WKJD 5AVBC 5B31C 3X1UA 4X23D 4XUJB 5B2ID 1Z2CB 2ZY5A 3RELD 3B6FD 3WA9C 4H9SA 1P3PC 5AVCA 1P3GD 3X1VD 1F66B 2YFVB 3C1CD 1KX4A 4J8UD 1P3OC 3AZEA 3H0MC 3LJAD 3EPJA 2YFWA 2NZDA 3EG5B 3KXBC 4J8XC 5B2JC 5B33D 5CPJC 1M19C 5JRGB 5G49A 3AZFC 3AZLD 1P3AB 3W96B 4NE3A 3REHD 5B1LD 3W98D 4UUZA 2AROD 5AY8B 1B6WA 1P3IB 1KX5B 4XZQB 3AZNB 2RVQC 5AV8A 5AV5C 3X1UD 5B32G 4WU9B 2NQBB 5F99A 2HUEC 3B6GA 5GT0B 5AVCD 2J8PA 5BS7A 1ZLAA 4WZSB 3AYWB 4KGCC 4LD9C 3UT9C 5CPKA 3AZED 4WNNA 2NZDD 1AOIB 4ZUXA 3MGSC 2Y2OA 2Y2IA 5CPIB 1N1JB 3O62C 3AZMD 3H0LC 3REKB 3AZIA 4XUJA 4Z5TB 1P3MC 3AZJC 5DNNB 5GXQB 1F66A 3MGPB 2YFVA 5AV8D 5E5AB 4DQYB 4QLCB 5F99D 3A1KA 3B6GD 3A6NB 2Y2MA 3REJD 1ID3B 4YS3C 1ZLAD 1R4VA 4Z66C 4WU8C 2IO5B 3KUYA 3REIA 5JRGA 5BNXB 2G5HC 3W96A 4ZUXD 1M18B 1P3BA 5AY8A 5BNVB 3X1TD 4G92B 3MGRC 1KX5A 4XZQA 3W99D 4DRBA 3AZNA 1HQ3C 4CSRB 2NQBA 4XUJD 2L5AA 4X23C 3TU4C 5GT0A 3B6FC 3X1UB 3AYWA 3MGQA 1F66D 1P3GC 1W2EA 1M1AC 1KX3C 1HTAA 4E44A 3C1CC 1P3FA 1P3LA 4J8UC 2Y2GA 1KX4B 5DNMC 3LELB 3LJAC 5KDMB 5JRGD 1TAFB 3MVDC 1N1JA 5CPIA 3KWQB 3AZHB 5FUGA 3AN2B 3W97B 2F8NH 3EPHA 1P3AD 4AWLC 3W96D 4Z5TA 5DNNA 5AY8D 4R8PB 1P3ID 1KX5D 4XZQD 4JJNB 4H9RB 3MGPA 4NFTA 3AZND 2NQBD 4WU9D 3C1BB 4ZBJC 5GT0D 1ID3A 2F2AC 3AYWD 5B0YB 3NQUB 4YM6A 3UTAB 1EQZC 2JE5A 4H9OB 5BNXA 3MNNA 1P3KC 5GT3B 1AOID 5GSUC 2PYOA 1M18A 2NZDC 5CPKB 3H0RC 2F8NG 5CPID 2DQNC 5B32A 3REKD 2CV5B 3AZGB 2CWEA 4CSRA 4J8VC 1P34C 5AVBB 4Z5TD 5B31B 3AZMC 3FDDA 5DNND 5GXQD 3AZIB 3MGPD 1U35C 5E5AD 3AFAA 2FJ7A 4KUDB 5AV8C 4QLCD 1P3OB 5B24C 3A6ND 4KHAB 1ID3D 5F99C 1BFMA 3VH6T 3LELA 3REJC 5KDMA 1TAFA 3VH5A 5C3IB 3KWQA 3AZHA 5CPJB 3AN2A 1M19B 3W97A 3AV2A 4CAYB 3KFUG 3KUYB 3REIB 1M18D 2Y2QA 4R8PA 3X1TC 4JJNA 4H9RA 1BH9B 5B40C 2ZY2A 3W99C 3C1BA 1P3BB 4DRAA 4H9NA 1TZYC 5AV5B 3WAAC 1S32C 5AV9C 3AZKC 3LZ1C 3X1SC 1A7WA 2HUEB 4WV4B 3LZ0C 5B0YA 3NQUA 3UTAA 2VQRA 4KGCB 4H9OA 3MGQB 3WTPC 5GT3A 1KX4D 3LELD 3VH6W 1P3FB 1P3LB 3MGSB 3KWQD 3AZHD 2F8NK 3AN2D 2CV5A 3AZGA 3W97D 1PZRA 5B31A 5AVBA 1P3AC 3W96C 5CHLB 4M6BA 1P3MB 5B0ZB 5FUGB 4R8PD 3WA9A 4JJND 1P3PA 1P3IC 3C1BD 4H9QB 3AZNC 4KUDA 1P3OA 4WU9C 4KHAA 5BT1D 5B0YD 3UTAD 4YS3B 3KXBA 4J8XA 4EO5C 5CPJA 3AV1C 1M19A 2HIOC 4CAYA 5GT3D 5B1MC 4YM6B 4H9PA 3UTBB 3AZFA 3KSYA 5CPKD 1AOIC 3MNNB 5CP6C 5AV6C 3MGRB 2CV5D 3AZGD 1BH9A 2PYOB 5B31D 5AVBD 3REKC 1HQ3B 5AV5A 3F6TA 5B32B 4J8WC 3AZID 3WA9D 3TU4B 3WKJC 1P3PD 2BG1A 5GXQC 2RIQA 5B2IC 1M1AB 1H3OA 1KX3B 4KUDD 4KGCA 4LD9A 3RELC 5JA4A 1P3OD 5E5AC 3UT9A 4QLCC 3X1VC 2JSSA 3A6NC 3AFAB 2FJ7B 1ID3C 5DNMB 3MGSA 4HGAC 5CPJD 1M19D 3MVDB 3O62A 1F1EA 3KUYD 4AWLB 3REID 2XD1A 1P3MA 5B33C 5B0ZA 3AV2B 1M18C 3AZLC 1P3BD 3REHC 4H9QA 5B1LC 5AV5D 3B0DB 3W98C 2AROC 3R45A 2JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N B;  4Z2M H;  4YS3 A;  3X1U C;  4Z66 A;  1EQZ B;  4KGC D;  4WU8 A;  4H9S C;  3MGQ D;  1B67 A;  5AVC C;  3UTB A;  1P3K B;  1KX4 C;  1P3F D;  5GSU B;  1P3L D;  3LEL C;  3MGS D;  3MGR A;  3AZE C;  1HQ3 A;  3W97 C;  4J8V B;  1P34 B;  1P3M D;  5B0Z D;  4X23 A;  3TU4 A;  1U35 B;  1M1A A;  1KX3 A;  3WA9 B;  1P3P B;  1BH8 A;  4J8U A;  5B24 B;  1ULY A;  4YS3 D;  5DNM A;  4G91 C;  3LJA A;  3MVD A;  3B6G C;  4YM6 D;  3UTB D;  3KXB B;  4J8X B;  5BS7 C;  5B2J B;  1ZLA C;  3WTP E;  5GT3 C;  3MNN D;  2LY8 A;  3MGR D;  3AZF B;  4H9P B;  5CPK C;  4E45 A;  2PYO D;  3B0B A;  5B40 B;  1HQ3 D;  4ZUX C;  1TZY B;  5B32 D;  3WAA B;  1S32 B;  5AV9 B;  3AZK B;  3TU4 D;  3X1S B;  3LZ1 B;  3AZI C;  3LZ0 B;  4XUJ C;  1EQZ A;  1M1A D;  1KX3 D;  1KU5 A;  4KUD C;  2BYK A;  1F66 C;  3WTP B;  3AFA D;  1P3K A;  1H3O B;  2FJ7 D;  5DNM D;  5GSU A;  4LD9 B;  5JA4 B;  3UT9 B;  3V9R B;  3MVD D;  5C3I C;  2F8N B;  4J8V A;  1P34 A;  3AZM A;  1Q9C A;  3KUY C;  3REI C;  3AV2 D;  5JRG C;  3O62 B;  4NE5 A;  1U35 A;  3AZJ B;  1P3B C;  5AY8 C;  1KX5 C;  4XZQ C;  5B24 A;  2NQB C;  3R45 B;  1EQZ D;  3REJ A;  1JFI A;  4EO5 B;  5GT0 C;  3AV1 B;  5B2J A;  4Z66 B;  3MGQ C;  2HIO B;  3AYW C;  1P3K D;  5B1M B;  5GSU D;  4WU8 B;  1P3F C;  1P3L C;  5CP6 B;  3X1T A;  5AV6 B;  5B40 A;  4J8V D;  3W99 A;  1P34 D;  1TZY A;  3WAA A;  1S32 A;  5AV9 A;  3AZK A;  5CPI C;  4J8W B;  3X1S A;  5B0Z C;  3LZ1 A;  3WKJ B;  3LZ0 A;  1U35 D;  3NQJ B;  4Z5T C;  5DNN C;  1WWI A;  4X23 B;  5B2I B;  3B6F B;  3REL B;  5B24 D;  3WTP A;  3MGP C;  1P3G B;  3VH6 A;  3X1V B;  3C1C B;  1BH8 B;  4J8U B;  4HGA B;  3V9R A;  2F8N A;  3KXB D;  4J8X D;  5B2J D;  3LJA B;  4YM6 C;  3UTB C;  2BYM B;  1P3A A;  2IO5 C;  3VH5 T;  5BO0 B;  3AZF D;  5B33 B;  3MNN C;  1P3I A;  5B40 D;  3AZJ A;  3AZL B;  2PYO C;  4G92 C;  3REH B;  1TZY D;  5B1L B;  3WAA D;  1S32 D;  3W98 B;  5AV9 D;  2ARO B;  4WU9 A;  3AZK D;  5B32 C;  3X1S D;  3LZ1 D;  2RVQ D;  5B31 G;  3LZ0 D;  4ZBJ B;  3AV1 A;  3B0C T;  3WTP D;  2HIO A;  5AVC B;  5B1M A;  4LD9 D;  3AFA C;  2FJ7 C;  3UT9 D;  1AOI A;  2BYK B;  5CP6 A;  5AV6 A;  2F8N D;  3AZE B;  1WWS A;  2YFW B;  2NZD B;  3REK A;  3O62 D;  4J8W A;  3KWQ C;  3AZH C;  3AN2 C;  3AV2 C;  3VH5 W;  3WKJ A;  5G49 B;  3AZM B;  5GXQ A;  3NQJ A;  3AZJ D;  5B2I A;  4NE6 A;  3B0D C;  4UUZ B;  4R8P C;  3REL A;  3B6F A;  5E5A A;  4JJN C;  1P3G A;  4QLC A;  3C1B C;  3X1V A;  3A6N A;  3C1C A;  5AV8 B;  4G91 B;  4Z2M G;  3AV1 D;  5F99 B;  5BT1 C;  4Z66 D;  3B6G B;  2HIO D;  5B0Y C;  5B1M D;  3REJ B;  3UTA C;  1JFI B;  3B0C W;  4WU8 D;  2BYM A;  1ZLA B;  5BO0 A;  5B33 A;  5CP6 D;  5BNV A;  5AV6 D;  4WNN B;  3AZL A;  3REH A;  5B1L A;  4ZUX B;  3W98 A;  2ARO A;  3X1T B;  4J8W D;  2CV5 C;  3AZG C;  3W99 B;  3WKJ D;  5AVB C;  5B31 C;  3X1U A;  4X23 D;  4XUJ B;  5B2I D;  3B6F D;  3REL D;  3WA9 C;  4H9S A;  1P3P C;  5AVC A;  1P3G D;  3X1V D;  1F66 B;  2YFV B;  3C1C D;  1KX4 A;  4J8U D;  1P3O C;  3AZE A;  3LJA D;  2YFW A;  2NZD A;  3KXB C;  4J8X C;  5B2J C;  5B33 D;  5CPJ C;  1M19 C;  5JRG B;  5G49 A;  3AZF C;  3AZL D;  1P3A B;  3W96 B;  4NE3 A;  3REH D;  5B1L D;  3W98 D;  4UUZ A;  2ARO D;  5AY8 B;  1B6W A;  1P3I B;  1KX5 B;  4XZQ B;  3AZN B;  2RVQ C;  5AV8 A;  5AV5 C;  3X1U D;  5B32 G;  4WU9 B;  2NQB B;  5F99 A;  2HUE C;  3B6G A;  5GT0 B;  5AVC D;  5BS7 A;  1ZLA A;  4WZS B;  3AYW B;  4KGC C;  4LD9 C;  3UT9 C;  5CPK A;  3AZE D;  4WNN A;  2NZD D;  1AOI B;  4ZUX A;  3MGS C;  5CPI B;  1N1J B;  3O62 C;  3AZM D;  3REK B;  3AZI A;  4XUJ A;  4Z5T B;  1P3M C;  3AZJ C;  5DNN B;  5GXQ B;  1F66 A;  3MGP B;  2YFV A;  5AV8 D;  5E5A B;  4QLC B;  5F99 D;  3B6G D;  3A6N B;  3REJ D;  1ID3 B;  4YS3 C;  1ZLA D;  1R4V A;  4Z66 C;  4WU8 C;  2IO5 B;  3KUY A;  3REI A;  5JRG A;  5BNX B;  3W96 A;  4ZUX D;  1M18 B;  1P3B A;  5AY8 A;  5BNV B;  3X1T D;  4G92 B;  3MGR C;  1KX5 A;  4XZQ A;  3W99 D;  4DRB A;  3AZN A;  1HQ3 C;  4CSR B;  2NQB A;  4XUJ D;  2L5A A;  4X23 C;  3TU4 C;  5GT0 A;  3B6F C;  3X1U B;  3AYW A;  3MGQ A;  1F66 D;  1P3G C;  1M1A C;  1KX3 C;  1HTA A;  4E44 A;  3C1C C;  1P3F A;  1P3L A;  4J8U C;  1KX4 B;  5DNM C;  3LEL B;  3LJA C;  5KDM B;  5JRG D;  1TAF B;  3MVD C;  1N1J A;  5CPI A;  3KWQ B;  3AZH B;  5FUG A;  3AN2 B;  3W97 B;  2F8N H;  1P3A D;  4AWL C;  3W96 D;  4Z5T A;  5DNN A;  5AY8 D;  4R8P B;  1P3I D;  1KX5 D;  4XZQ D;  4JJN B;  4H9R B;  3MGP A;  4NFT A;  3AZN D;  2NQB D;  4WU9 D;  3C1B B;  4ZBJ C;  5GT0 D;  1ID3 A;  3AYW D;  5B0Y B;  3NQU B;  4YM6 A;  3UTA B;  1EQZ C;  4H9O B;  5BNX A;  3MNN A;  1P3K C;  5GT3 B;  1AOI D;  5GSU C;  2PYO A;  1M18 A;  2NZD C;  5CPK B;  2F8N G;  5CPI D;  5B32 A;  3REK D;  2CV5 B;  3AZG B;  2CWE A;  4CSR A;  4J8V C;  1P34 C;  5B31 B;  4Z5T D;  5AVB B;  3AZM C;  5DNN D;  5GXQ D;  3AZI B;  3MGP D;  1U35 C;  5E5A D;  3AFA A;  2FJ7 A;  4KUD B;  5AV8 C;  4QLC D;  1P3O B;  5B24 C;  3A6N D;  4KHA B;  1ID3 D;  5F99 C;  1BFM A;  3VH6 T;  3LEL A;  3REJ C;  5KDM A;  1TAF A;  3VH5 A;  5C3I B;  3KWQ A;  3AZH A;  5CPJ B;  3AN2 A;  1M19 B;  3W97 A;  3AV2 A;  4CAY B;  3KUY B;  3REI B;  1M18 D;  4R8P A;  3X1T C;  4JJN A;  4H9R A;  1BH9 B;  5B40 C;  3W99 C;  3C1B A;  1P3B B;  4DRA A;  4H9N A;  1TZY C;  5AV5 B;  3WAA C;  1S32 C;  5AV9 C;  3AZK C;  3LZ1 C;  3X1S C;  1A7W A;  2HUE B;  4WV4 B;  3LZ0 C;  5B0Y A;  3NQU A;  3UTA A;  4KGC B;  4H9O A;  3MGQ B;  3WTP C;  5GT3 A;  1KX4 D;  3LEL D;  3VH6 W;  1P3F B;  1P3L B;  3MGS B;  3KWQ D;  3AZH D;  2F8N K;  3AN2 D;  2CV5 A;  3AZG A;  3W97 D;  5B31 A;  5AVB A;  1P3A C;  3W96 C;  5CHL B;  4M6B A;  1P3M B;  5B0Z B;  5FUG B;  4R8P D;  3WA9 A;  4JJN D;  1P3P A;  1P3I C;  3C1B D;  4H9Q B;  3AZN C;  4KUD A;  1P3O A;  4WU9 C;  4KHA A;  5BT1 D;  5B0Y D;  3UTA D;  4YS3 B;  3KXB A;  4J8X A;  4EO5 C;  5CPJ A;  3AV1 C;  1M19 A;  2HIO C;  4YM6 B;  4CAY A;  5B1M C;  5GT3 D;  4H9P A;  3UTB B;  3AZF A;  3KSY A;  5CPK D;  1AOI C;  3MNN B;  5CP6 C;  5AV6 C;  3MGR B;  2CV5 D;  3AZG D;  1BH9 A;  2PYO B;  5B31 D;  5AVB D;  3REK C;  1HQ3 B;  5AV5 A;  5B32 B;  4J8W C;  3AZI D;  3WA9 D;  3TU4 B;  3WKJ C;  1P3P D;  5GXQ C;  5B2I C;  1M1A B;  1H3O A;  1KX3 B;  4KUD D;  4KGC A;  4LD9 A;  3REL C;  5JA4 A;  1P3O D;  5E5A C;  3UT9 A;  4QLC C;  3X1V C;  2JSS A;  3A6N C;  3AFA B;  2FJ7 B;  1ID3 C;  5DNM B;  3MGS A;  4HGA C;  5CPJ D;  1M19 D;  3MVD B;  3O62 A;  1F1E A;  3KUY D;  4AWL B;  3REI D;  1P3M A;  5B33 C;  5B0Z A;  3AV2 B;  1M18 C;  3AZL C;  1P3B D;  3REH C;  4H9Q A;  5B1L C;  5AV5 D;  3B0D B;  3W98 C;  2ARO C;  3R45 A; 
#chains in the Genus database with same CATH topology
 4H9N B;  4Z2M H;  4YS3 A;  3X1U C;  4Z66 A;  1EQZ B;  4KGC D;  4WU8 A;  2DF4 C;  4H9S C;  3MGQ D;  1B67 A;  5AVC C;  3UTB A;  2Y2L A;  1P3K B;  1KX4 C;  1P3F D;  5GSU B;  1P3L D;  2ZY4 A;  3LEL C;  3MGS D;  3MGR A;  3AZE C;  1HQ3 A;  3W97 C;  4J8V B;  1P34 B;  1P3M D;  5B0Z D;  4X23 A;  3TU4 A;  1U35 B;  1M1A A;  1KX3 A;  3WA9 B;  1P3P B;  1BH8 A;  4J8U A;  5B24 B;  1ULY A;  4YS3 D;  5DNM A;  4G91 C;  3LJA A;  3MVD A;  3B6G C;  4YM6 D;  3UTB D;  3KXB B;  4J8X B;  5BS7 C;  5B2J B;  1ZLA C;  3WTP E;  5GT3 C;  3MNN D;  2LY8 A;  3MGR D;  3AZF B;  4H9P B;  5CPK C;  4E45 A;  2PYO D;  3B0B A;  5B40 B;  1HQ3 D;  4ZUX C;  1TZY B;  5B32 D;  3WAA B;  1S32 B;  5AV9 B;  2UWX A;  3EPK A;  3AZK B;  3TU4 D;  3X1S B;  3LZ1 B;  3AZI C;  3LZ0 B;  4XUJ C;  1EQZ A;  1M1A D;  1KX3 D;  1KU5 A;  4KUD C;  2BYK A;  1F66 C;  3WTP B;  3AFA D;  1P3K A;  1H3O B;  2FJ7 D;  5DNM D;  5GSU A;  4LD9 B;  5JA4 B;  2Y2H A;  3UT9 B;  3V9R B;  3MVD D;  5C3I C;  2F8N B;  4WJ3 C;  4J8V A;  2Y2P A;  1P34 A;  3AZM A;  1Q9C A;  3KUY C;  3REI C;  3AV2 D;  5JRG C;  3O62 B;  2Y2K A;  4NE5 A;  1U35 A;  3AZJ B;  1P3B C;  5AY8 C;  1KX5 C;  4XZQ C;  5B24 A;  3AL0 C;  2NQB C;  3R45 B;  1EQZ D;  3REJ A;  1JFI A;  3IP4 C;  4EO5 B;  5GT0 C;  3AV1 B;  2ZM5 A;  5B2J A;  4Z66 B;  3MGQ C;  2HIO B;  3AYW C;  1P3K D;  5B1M B;  5GSU D;  4WU8 B;  2FFF B;  1P3F C;  1P3L C;  3EPL A;  5CP6 B;  3X1T A;  5AV6 B;  5B40 A;  4J8V D;  3W99 A;  1P34 D;  1TZY A;  3WAA A;  1S32 A;  5AV9 A;  3AZK A;  5CPI C;  4J8W B;  3X1S A;  5B0Z C;  3LZ1 A;  3WKJ B;  3LZ0 A;  1U35 D;  3NQJ B;  4Z5T C;  5DNN C;  1WWI A;  4X23 B;  5B2I B;  2ZY3 A;  3B6F B;  3REL B;  5B24 D;  3WTP A;  3MGP C;  1P3G B;  3VH6 A;  3X1V B;  3C1C B;  1BH8 B;  4J8U B;  4HGA B;  3V9R A;  2F8N A;  3KXB D;  4J8X D;  5B2J D;  3LJA B;  4YM6 C;  3UTB C;  2BYM B;  1P3A A;  2IO5 C;  3VH5 T;  5BO0 B;  3AZF D;  5B33 B;  3MNN C;  1P3I A;  5B40 D;  3AZJ A;  3AZL B;  2PYO C;  4G92 C;  3REH B;  1TZY D;  5B1L B;  3WAA D;  1S32 D;  3W98 B;  5AV9 D;  2ARO B;  4WU9 A;  3AZK D;  2XD5 A;  4UPK A;  5B32 C;  3X1S D;  3LZ1 D;  2RVQ D;  5B31 G;  3LZ0 D;  4ZBJ B;  3P5J B;  3AV1 A;  3B0C T;  3WTP D;  2HIO A;  5AVC B;  5B1M A;  4LD9 D;  3AFA C;  2FJ7 C;  3UT9 D;  1AOI A;  2BYK B;  5CP6 A;  5AV6 A;  2F8N D;  3AZE B;  1WWS A;  2YFW B;  2NZD B;  3REK A;  3O62 D;  4J8W A;  3KWQ C;  3AZH C;  3AN2 C;  3AV2 C;  3VH5 W;  2Y2J A;  3WKJ A;  5G49 B;  3AZM B;  5GXQ A;  3NQJ A;  3AZJ D;  5B2I A;  4NE6 A;  3B0D C;  4UUZ B;  4R8P C;  3REL A;  3B6F A;  5E5A A;  3A1I A;  4JJN C;  1P3G A;  4QLC A;  3C1B C;  2G5I C;  3A6N A;  3X1V A;  3C1C A;  5AV8 B;  2Y2N A;  4G91 B;  1T3U A;  4Z2M G;  3AV1 D;  5F99 B;  5BT1 C;  4Z66 D;  3B6G B;  2HIO D;  5B0Y C;  5B1M D;  3REJ B;  3UTA C;  1JFI B;  3B0C W;  4WU8 D;  2BYM A;  1ZLA B;  5BO0 A;  5B33 A;  5CP6 D;  5BNV A;  5AV6 D;  4WNN B;  3AZL A;  3REH A;  5B1L A;  4ZUX B;  3W98 A;  2ARO A;  3X1T B;  4J8W D;  2W8S A;  2CV5 C;  3AZG C;  3W99 B;  3WKJ D;  5AVB C;  5B31 C;  3X1U A;  4X23 D;  4XUJ B;  5B2I D;  1Z2C B;  2ZY5 A;  3REL D;  3B6F D;  3WA9 C;  4H9S A;  1P3P C;  5AVC A;  1P3G D;  3X1V D;  1F66 B;  2YFV B;  3C1C D;  1KX4 A;  4J8U D;  1P3O C;  3AZE A;  3H0M C;  3LJA D;  3EPJ A;  2YFW A;  2NZD A;  3EG5 B;  3KXB C;  4J8X C;  5B2J C;  5B33 D;  5CPJ C;  1M19 C;  5JRG B;  5G49 A;  3AZF C;  3AZL D;  1P3A B;  3W96 B;  4NE3 A;  3REH D;  5B1L D;  3W98 D;  4UUZ A;  2ARO D;  5AY8 B;  1B6W A;  1P3I B;  1KX5 B;  4XZQ B;  3AZN B;  2RVQ C;  5AV8 A;  5AV5 C;  3X1U D;  5B32 G;  4WU9 B;  2NQB B;  5F99 A;  2HUE C;  3B6G A;  5GT0 B;  5AVC D;  2J8P A;  5BS7 A;  1ZLA A;  4WZS B;  3AYW B;  4KGC C;  4LD9 C;  3UT9 C;  5CPK A;  3AZE D;  4WNN A;  2NZD D;  1AOI B;  4ZUX A;  3MGS C;  2Y2O A;  2Y2I A;  5CPI B;  1N1J B;  3O62 C;  3AZM D;  3H0L C;  3REK B;  3AZI A;  4XUJ A;  4Z5T B;  1P3M C;  3AZJ C;  5DNN B;  5GXQ B;  1F66 A;  3MGP B;  2YFV A;  5AV8 D;  5E5A B;  4DQY B;  4QLC B;  5F99 D;  3A1K A;  3B6G D;  3A6N B;  2Y2M A;  3REJ D;  1ID3 B;  4YS3 C;  1ZLA D;  1R4V A;  4Z66 C;  4WU8 C;  2IO5 B;  3KUY A;  3REI A;  5JRG A;  5BNX B;  2G5H C;  3W96 A;  4ZUX D;  1M18 B;  1P3B A;  5AY8 A;  5BNV B;  3X1T D;  4G92 B;  3MGR C;  1KX5 A;  4XZQ A;  3W99 D;  4DRB A;  3AZN A;  1HQ3 C;  4CSR B;  2NQB A;  4XUJ D;  2L5A A;  4X23 C;  3TU4 C;  5GT0 A;  3B6F C;  3X1U B;  3AYW A;  3MGQ A;  1F66 D;  1P3G C;  1W2E A;  1M1A C;  1KX3 C;  1HTA A;  4E44 A;  3C1C C;  1P3F A;  1P3L A;  4J8U C;  2Y2G A;  1KX4 B;  5DNM C;  3LEL B;  3LJA C;  5KDM B;  5JRG D;  1TAF B;  3MVD C;  1N1J A;  5CPI A;  3KWQ B;  3AZH B;  5FUG A;  3AN2 B;  3W97 B;  2F8N H;  3EPH A;  1P3A D;  4AWL C;  3W96 D;  4Z5T A;  5DNN A;  5AY8 D;  4R8P B;  1P3I D;  1KX5 D;  4XZQ D;  4JJN B;  4H9R B;  3MGP A;  4NFT A;  3AZN D;  2NQB D;  4WU9 D;  3C1B B;  4ZBJ C;  5GT0 D;  1ID3 A;  2F2A C;  3AYW D;  5B0Y B;  3NQU B;  4YM6 A;  3UTA B;  1EQZ C;  2JE5 A;  4H9O B;  5BNX A;  3MNN A;  1P3K C;  5GT3 B;  1AOI D;  5GSU C;  2PYO A;  1M18 A;  2NZD C;  5CPK B;  3H0R C;  2F8N G;  5CPI D;  2DQN C;  5B32 A;  3REK D;  2CV5 B;  3AZG B;  2CWE A;  4CSR A;  4J8V C;  1P34 C;  5AVB B;  4Z5T D;  5B31 B;  3AZM C;  3FDD A;  5DNN D;  5GXQ D;  3AZI B;  3MGP D;  1U35 C;  5E5A D;  3AFA A;  2FJ7 A;  4KUD B;  5AV8 C;  4QLC D;  1P3O B;  5B24 C;  3A6N D;  4KHA B;  1ID3 D;  5F99 C;  1BFM A;  3VH6 T;  3LEL A;  3REJ C;  5KDM A;  1TAF A;  3VH5 A;  5C3I B;  3KWQ A;  3AZH A;  5CPJ B;  3AN2 A;  1M19 B;  3W97 A;  3AV2 A;  4CAY B;  3KFU G;  3KUY B;  3REI B;  1M18 D;  2Y2Q A;  4R8P A;  3X1T C;  4JJN A;  4H9R A;  1BH9 B;  5B40 C;  2ZY2 A;  3W99 C;  3C1B A;  1P3B B;  4DRA A;  4H9N A;  1TZY C;  5AV5 B;  3WAA C;  1S32 C;  5AV9 C;  3AZK C;  3LZ1 C;  3X1S C;  1A7W A;  2HUE B;  4WV4 B;  3LZ0 C;  5B0Y A;  3NQU A;  3UTA A;  2VQR A;  4KGC B;  4H9O A;  3MGQ B;  3WTP C;  5GT3 A;  1KX4 D;  3LEL D;  3VH6 W;  1P3F B;  1P3L B;  3MGS B;  3KWQ D;  3AZH D;  2F8N K;  3AN2 D;  2CV5 A;  3AZG A;  3W97 D;  1PZR A;  5B31 A;  5AVB A;  1P3A C;  3W96 C;  5CHL B;  4M6B A;  1P3M B;  5B0Z B;  5FUG B;  4R8P D;  3WA9 A;  4JJN D;  1P3P A;  1P3I C;  3C1B D;  4H9Q B;  3AZN C;  4KUD A;  1P3O A;  4WU9 C;  4KHA A;  5BT1 D;  5B0Y D;  3UTA D;  4YS3 B;  3KXB A;  4J8X A;  4EO5 C;  5CPJ A;  3AV1 C;  1M19 A;  2HIO C;  4CAY A;  5GT3 D;  5B1M C;  4YM6 B;  4H9P A;  3UTB B;  3AZF A;  3KSY A;  5CPK D;  1AOI C;  3MNN B;  5CP6 C;  5AV6 C;  3MGR B;  2CV5 D;  3AZG D;  1BH9 A;  2PYO B;  5B31 D;  5AVB D;  3REK C;  1HQ3 B;  5AV5 A;  3F6T A;  5B32 B;  4J8W C;  3AZI D;  3WA9 D;  3TU4 B;  3WKJ C;  1P3P D;  2BG1 A;  5GXQ C;  2RIQ A;  5B2I C;  1M1A B;  1H3O A;  1KX3 B;  4KUD D;  4KGC A;  4LD9 A;  3REL C;  5JA4 A;  1P3O D;  5E5A C;  3UT9 A;  4QLC C;  3X1V C;  2JSS A;  3A6N C;  3AFA B;  2FJ7 B;  1ID3 C;  5DNM B;  3MGS A;  4HGA C;  5CPJ D;  1M19 D;  3MVD B;  3O62 A;  1F1E A;  3KUY D;  4AWL B;  3REI D;  2XD1 A;  1P3M A;  5B33 C;  5B0Z A;  3AV2 B;  1M18 C;  3AZL C;  1P3B D;  3REH C;  4H9Q A;  5B1L C;  5AV5 D;  3B0D B;  3W98 C;  2ARO C;  3R45 A;  2JCH A; 
#chains in the Genus database with same CATH homology
 4H9N B;  4Z2M H;  4YS3 A;  3X1U C;  4Z66 A;  1EQZ B;  4KGC D;  4WU8 A;  2DF4 C;  4H9S C;  3MGQ D;  1B67 A;  5AVC C;  3UTB A;  2Y2L A;  1P3K B;  1KX4 C;  1P3F D;  5GSU B;  1P3L D;  2ZY4 A;  3LEL C;  3MGS D;  3MGR A;  3AZE C;  1HQ3 A;  3W97 C;  4J8V B;  1P34 B;  1P3M D;  5B0Z D;  4X23 A;  3TU4 A;  1U35 B;  1M1A A;  1KX3 A;  3WA9 B;  1P3P B;  1BH8 A;  4J8U A;  5B24 B;  1ULY A;  4YS3 D;  5DNM A;  4G91 C;  3LJA A;  3MVD A;  3B6G C;  4YM6 D;  3UTB D;  3KXB B;  4J8X B;  5BS7 C;  5B2J B;  1ZLA C;  3WTP E;  5GT3 C;  3MNN D;  2LY8 A;  3MGR D;  3AZF B;  4H9P B;  5CPK C;  4E45 A;  2PYO D;  3B0B A;  5B40 B;  1HQ3 D;  4ZUX C;  1TZY B;  5B32 D;  3WAA B;  1S32 B;  5AV9 B;  2UWX A;  3EPK A;  3AZK B;  3TU4 D;  3X1S B;  3LZ1 B;  3AZI C;  3LZ0 B;  4XUJ C;  1EQZ A;  1M1A D;  1KX3 D;  1KU5 A;  4KUD C;  2BYK A;  1F66 C;  3WTP B;  3AFA D;  1P3K A;  1H3O B;  2FJ7 D;  5DNM D;  5GSU A;  4LD9 B;  5JA4 B;  2Y2H A;  3UT9 B;  3V9R B;  3MVD D;  5C3I C;  2F8N B;  4WJ3 C;  4J8V A;  2Y2P A;  1P34 A;  3AZM A;  1Q9C A;  3KUY C;  3REI C;  3AV2 D;  5JRG C;  3O62 B;  2Y2K A;  4NE5 A;  1U35 A;  3AZJ B;  1P3B C;  5AY8 C;  1KX5 C;  4XZQ C;  5B24 A;  3AL0 C;  2NQB C;  3R45 B;  1EQZ D;  3REJ A;  1JFI A;  3IP4 C;  4EO5 B;  5GT0 C;  3AV1 B;  2ZM5 A;  5B2J A;  4Z66 B;  3MGQ C;  2HIO B;  3AYW C;  1P3K D;  5B1M B;  5GSU D;  4WU8 B;  2FFF B;  1P3F C;  1P3L C;  3EPL A;  5CP6 B;  3X1T A;  5AV6 B;  5B40 A;  4J8V D;  3W99 A;  1P34 D;  1TZY A;  3WAA A;  1S32 A;  5AV9 A;  3AZK A;  5CPI C;  4J8W B;  3X1S A;  5B0Z C;  3LZ1 A;  3WKJ B;  3LZ0 A;  1U35 D;  3NQJ B;  4Z5T C;  5DNN C;  1WWI A;  4X23 B;  5B2I B;  2ZY3 A;  3B6F B;  3REL B;  5B24 D;  3WTP A;  3MGP C;  1P3G B;  3VH6 A;  3X1V B;  3C1C B;  1BH8 B;  4J8U B;  4HGA B;  3V9R A;  2F8N A;  3KXB D;  4J8X D;  5B2J D;  3LJA B;  4YM6 C;  3UTB C;  2BYM B;  1P3A A;  2IO5 C;  3VH5 T;  5BO0 B;  3AZF D;  5B33 B;  3MNN C;  1P3I A;  5B40 D;  3AZJ A;  3AZL B;  2PYO C;  4G92 C;  3REH B;  1TZY D;  5B1L B;  3WAA D;  1S32 D;  3W98 B;  5AV9 D;  2ARO B;  4WU9 A;  3AZK D;  2XD5 A;  4UPK A;  5B32 C;  3X1S D;  3LZ1 D;  2RVQ D;  5B31 G;  3LZ0 D;  4ZBJ B;  3P5J B;  3AV1 A;  3B0C T;  3WTP D;  2HIO A;  5AVC B;  5B1M A;  4LD9 D;  3AFA C;  2FJ7 C;  3UT9 D;  1AOI A;  2BYK B;  5CP6 A;  5AV6 A;  2F8N D;  3AZE B;  1WWS A;  2YFW B;  2NZD B;  3REK A;  3O62 D;  4J8W A;  3KWQ C;  3AZH C;  3AN2 C;  3AV2 C;  3VH5 W;  2Y2J A;  3WKJ A;  5G49 B;  3AZM B;  5GXQ A;  3NQJ A;  3AZJ D;  5B2I A;  4NE6 A;  3B0D C;  4UUZ B;  4R8P C;  3REL A;  3B6F A;  5E5A A;  3A1I A;  4JJN C;  1P3G A;  4QLC A;  3C1B C;  2G5I C;  3A6N A;  3X1V A;  3C1C A;  5AV8 B;  2Y2N A;  4G91 B;  1T3U A;  4Z2M G;  3AV1 D;  5F99 B;  5BT1 C;  4Z66 D;  3B6G B;  2HIO D;  5B0Y C;  5B1M D;  3REJ B;  3UTA C;  1JFI B;  3B0C W;  4WU8 D;  2BYM A;  1ZLA B;  5BO0 A;  5B33 A;  5CP6 D;  5BNV A;  5AV6 D;  4WNN B;  3AZL A;  3REH A;  5B1L A;  4ZUX B;  3W98 A;  2ARO A;  3X1T B;  4J8W D;  2W8S A;  2CV5 C;  3AZG C;  3W99 B;  3WKJ D;  5AVB C;  5B31 C;  3X1U A;  4X23 D;  4XUJ B;  5B2I D;  1Z2C B;  2ZY5 A;  3REL D;  3B6F D;  3WA9 C;  4H9S A;  1P3P C;  5AVC A;  1P3G D;  3X1V D;  1F66 B;  2YFV B;  3C1C D;  1KX4 A;  4J8U D;  1P3O C;  3AZE A;  3H0M C;  3LJA D;  3EPJ A;  2YFW A;  2NZD A;  3EG5 B;  3KXB C;  4J8X C;  5B2J C;  5B33 D;  5CPJ C;  1M19 C;  5JRG B;  5G49 A;  3AZF C;  3AZL D;  1P3A B;  3W96 B;  4NE3 A;  3REH D;  5B1L D;  3W98 D;  4UUZ A;  2ARO D;  5AY8 B;  1B6W A;  1P3I B;  1KX5 B;  4XZQ B;  3AZN B;  2RVQ C;  5AV8 A;  5AV5 C;  3X1U D;  5B32 G;  4WU9 B;  2NQB B;  5F99 A;  2HUE C;  3B6G A;  5GT0 B;  5AVC D;  2J8P A;  5BS7 A;  1ZLA A;  4WZS B;  3AYW B;  4KGC C;  4LD9 C;  3UT9 C;  5CPK A;  3AZE D;  4WNN A;  2NZD D;  1AOI B;  4ZUX A;  3MGS C;  2Y2O A;  2Y2I A;  5CPI B;  1N1J B;  3O62 C;  3AZM D;  3H0L C;  3REK B;  3AZI A;  4XUJ A;  4Z5T B;  1P3M C;  3AZJ C;  5DNN B;  5GXQ B;  1F66 A;  3MGP B;  2YFV A;  5AV8 D;  5E5A B;  4DQY B;  4QLC B;  5F99 D;  3A1K A;  3B6G D;  3A6N B;  2Y2M A;  3REJ D;  1ID3 B;  4YS3 C;  1ZLA D;  1R4V A;  4Z66 C;  4WU8 C;  2IO5 B;  3KUY A;  3REI A;  5JRG A;  5BNX B;  2G5H C;  3W96 A;  4ZUX D;  1M18 B;  1P3B A;  5AY8 A;  5BNV B;  3X1T D;  4G92 B;  3MGR C;  1KX5 A;  4XZQ A;  3W99 D;  4DRB A;  3AZN A;  1HQ3 C;  4CSR B;  2NQB A;  4XUJ D;  2L5A A;  4X23 C;  3TU4 C;  5GT0 A;  3B6F C;  3X1U B;  3AYW A;  3MGQ A;  1F66 D;  1P3G C;  1W2E A;  1M1A C;  1KX3 C;  1HTA A;  4E44 A;  3C1C C;  1P3F A;  1P3L A;  4J8U C;  2Y2G A;  1KX4 B;  5DNM C;  3LEL B;  3LJA C;  5KDM B;  5JRG D;  1TAF B;  3MVD C;  1N1J A;  5CPI A;  3KWQ B;  3AZH B;  5FUG A;  3AN2 B;  3W97 B;  2F8N H;  3EPH A;  1P3A D;  4AWL C;  3W96 D;  4Z5T A;  5DNN A;  5AY8 D;  4R8P B;  1P3I D;  1KX5 D;  4XZQ D;  4JJN B;  4H9R B;  3MGP A;  4NFT A;  3AZN D;  2NQB D;  4WU9 D;  3C1B B;  4ZBJ C;  5GT0 D;  1ID3 A;  2F2A C;  3AYW D;  5B0Y B;  3NQU B;  4YM6 A;  3UTA B;  1EQZ C;  2JE5 A;  4H9O B;  5BNX A;  3MNN A;  1P3K C;  5GT3 B;  1AOI D;  5GSU C;  2PYO A;  1M18 A;  2NZD C;  5CPK B;  3H0R C;  2F8N G;  5CPI D;  2DQN C;  5B32 A;  3REK D;  2CV5 B;  3AZG B;  2CWE A;  4CSR A;  4J8V C;  1P34 C;  5AVB B;  4Z5T D;  5B31 B;  3AZM C;  3FDD A;  5DNN D;  5GXQ D;  3AZI B;  3MGP D;  1U35 C;  5E5A D;  3AFA A;  2FJ7 A;  4KUD B;  5AV8 C;  4QLC D;  1P3O B;  5B24 C;  3A6N D;  4KHA B;  1ID3 D;  5F99 C;  1BFM A;  3VH6 T;  3LEL A;  3REJ C;  5KDM A;  1TAF A;  3VH5 A;  5C3I B;  3KWQ A;  3AZH A;  5CPJ B;  3AN2 A;  1M19 B;  3W97 A;  3AV2 A;  4CAY B;  3KFU G;  3KUY B;  3REI B;  1M18 D;  2Y2Q A;  4R8P A;  3X1T C;  4JJN A;  4H9R A;  1BH9 B;  5B40 C;  2ZY2 A;  3W99 C;  3C1B A;  1P3B B;  4DRA A;  4H9N A;  1TZY C;  5AV5 B;  3WAA C;  1S32 C;  5AV9 C;  3AZK C;  3LZ1 C;  3X1S C;  1A7W A;  2HUE B;  4WV4 B;  3LZ0 C;  5B0Y A;  3NQU A;  3UTA A;  2VQR A;  4KGC B;  4H9O A;  3MGQ B;  3WTP C;  5GT3 A;  1KX4 D;  3LEL D;  3VH6 W;  1P3F B;  1P3L B;  3MGS B;  3KWQ D;  3AZH D;  2F8N K;  3AN2 D;  2CV5 A;  3AZG A;  3W97 D;  1PZR A;  5B31 A;  5AVB A;  1P3A C;  3W96 C;  5CHL B;  4M6B A;  1P3M B;  5B0Z B;  5FUG B;  4R8P D;  3WA9 A;  4JJN D;  1P3P A;  1P3I C;  3C1B D;  4H9Q B;  3AZN C;  4KUD A;  1P3O A;  4WU9 C;  4KHA A;  5BT1 D;  5B0Y D;  3UTA D;  4YS3 B;  3KXB A;  4J8X A;  4EO5 C;  5CPJ A;  3AV1 C;  1M19 A;  2HIO C;  4CAY A;  5GT3 D;  5B1M C;  4YM6 B;  4H9P A;  3UTB B;  3AZF A;  3KSY A;  5CPK D;  1AOI C;  3MNN B;  5CP6 C;  5AV6 C;  3MGR B;  2CV5 D;  3AZG D;  1BH9 A;  2PYO B;  5B31 D;  5AVB D;  3REK C;  1HQ3 B;  5AV5 A;  3F6T A;  5B32 B;  4J8W C;  3AZI D;  3WA9 D;  3TU4 B;  3WKJ C;  1P3P D;  2BG1 A;  5GXQ C;  2RIQ A;  5B2I C;  1M1A B;  1H3O A;  1KX3 B;  4KUD D;  4KGC A;  4LD9 A;  3REL C;  5JA4 A;  1P3O D;  5E5A C;  3UT9 A;  4QLC C;  3X1V C;  2JSS A;  3A6N C;  3AFA B;  2FJ7 B;  1ID3 C;  5DNM B;  3MGS A;  4HGA C;  5CPJ D;  1M19 D;  3MVD B;  3O62 A;  1F1E A;  3KUY D;  4AWL B;  3REI D;  2XD1 A;  1P3M A;  5B33 C;  5B0Z A;  3AV2 B;  1M18 C;  3AZL C;  1P3B D;  3REH C;  4H9Q A;  5B1L C;  5AV5 D;  3B0D B;  3W98 C;  2ARO C;  3R45 A;  2JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...