3W98C

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98C00
4KHAA 4CSRA 5CP6A 3REKD 1H3OA 4EO5B 4WU9B 5B2IB 3LZ1B 3X1UC 4G91C 1TZYB 4R8PB 1P3FC 1P3OB 5AY8B 3LJAA 3A6ND 3AZIB 2AROB 5BS7A 3AYWC 5JRGA 2F8NK 5B33B 1ID3A 4H9NB 4QLCC 4YM6A 3X1VA 5GT3A 3LZ1A 1KX5D 3B6FA 4AWLB 3WAAC 3X1SB 1ZLAA 5B31C 5CPIB 4H9SC 2YFVB 3AV1C 3X1TC 3AZKB 4NE5A 4WU9A 5AV9A 5B2IA 5GSUB 4R8PA 3LELB 4X23C 5B24C 1P3OA 5AY8A 3AZED 3AN2D 3AZIA 2AROA 3AZMB 5CPKC 1EQZD 3C1BD 5B33A 3AZNC 5GXQC 4H9NA 3AZLC 3V9RB 3X1SA 1HTAA 5CP6C 5CPIA 4ZUXD 2YFVA 3B6GC 4YS3D 1WWSA 3AZKA 5B2JD 2PYOD 1P3LD 5GSUA 1M18D 1P3PB 3VH6T 3LELA 4Z5TC 4WNNB 3LJAC 5CPJC 4J8UD 1P3GA 3W99B 3UTBB 1P3AB 5CHLB 3AZMA 5BT1D 1ID3C 1HQ3D 3AV2B 3V9RA 5DNNC 3LZ1C 3KWQC 4KUDC 5AV5D 3NQJB 2NQBB 3AFAC 5B0YA 4WU9C 3X1UB 5AV9C 5GT0D 3LZ0C 1P3FB 1KX4C 4ZBJB 1P3PA 1F66D 3AYWB 3WTPD 4WNNA 3AZIC 2AROC 3W99A 3W98D 1BFMA 1P3AA 5B33C 4QLCB 4Z2MH 3MGRB 3UTBD 2CV5D 4JJNC 1P3KB 3O62B 3AV2A 1P34C 3WA9A 1P3MC 5B31B 1P3BC 3AV1B 3KUYD 3NQJA 1KX3C 2NQBA 3RELC 3REHC 1TZYD 4J8VC 3W97D 3X1UA 5AV8C 5GSUC 4X23B 3MVDD 4XZQD 2NZDD 1P3GC 3AYWA 3VH6A 4Z66B 1U35B 3TU4B 5CPKB 1M1AC 4WU8B 3MGRA 3AZLB 1P3KA 5F99C 5B40D 3O62A 3UT9D 3AZJC 2L5AA 4H9SA 2IO5B 3AV1A 3B6GB 5B0YC 5B0ZD 2HIOD 3AZHB 1P3ID 5B32D 5B1MD 4XUJD 4Z5TB 4X23A 5CPJB 3MGQD 3MNNC 2YFWA 4Z66A 1U35A 2RVQC 3TU4A 1ID3B 1M19B 3VH5T 4WU8A 4KGCD 4H9OA 5DNNB 3KXBB 3KWQB 3WA9C 4KUDB 4DRBA 3W96B 3AZGD 5AVBC 3AFAB 2NQBC 3B6GA 5BO0A 5AV9B 3REKC 3REID 3LZ0B 3B0CW 3AZHA 1KX4B 1JFIB 1TAFA 4J8XD 4Z5TA 5CPJA 4ZBJC 5JA4B 4J8WA 2PYOA 5E5AD 4CAYB 5DNMD 3A6NC 1S32D 3MGPD 1M19A 4JJNB 3MGRC 4LD9B 1P34B 1P3KC 1P3MB 3O62C 5DNNA 3KXBA 3KWQA 1P3BB 4KUDA 3W96A 1KX3B 3RELB 1KX5C 3AFAA 3REHB 1P3FD 4J8VB 1KU5A 5AV8B 3LZ0A 3MGSD 1AOID 1KX4A 1P3GB 1JFIA 4UUZB 5JA4A 2BYKB 5AV6D 4CAYA 4QLCD 4Z66C 1U35C 1M1AB 3TU4C 1F66A 3AZEC 3AN2C 1Q9CA 4WU8C 4JJNA 3WAAD 5AVCB 3VH5A 5F99B 4LD9A 1EQZC 3AZJB 1P34A 3X1TD 1P3MA 1P3BA 3WKJB 1KX3A 2IO5C 5B0YB 3RELA 3REHA 4DRAA 4J8VA 5B24D 4ZUXC 3AZHC 4YS3C 5AV8A 3UTAD 5B2JC 3REJD 2F8NB 2PYOC 3AZFB 4UUZA 3MNNB 4J8WC 1P3LC 3AZND 2BYKA 5GXQD 3C1CD 4J8UC 1M1AA 3AZLD 1M19C 5G49B 4M6BA 1F1EA 2F8NH 5AVCA 5CP6D 5F99A 5BT1C 4G92C 3AZJA 3WA9B 5B1LB 3KSYA 3KXBC 3W96C 3WKJA 5AVBB 2FJ7A 4E45A 1B6WA 3REKB 3LJAD 5JRGD 4H9QA 2F8NA 5GT0C 2HUEC 3AZFA 3MNNA 1WWIA 3A6NB 1F66C 4YM6D 3X1VD 5GT3D 4H9PB 3LZ1D 3B6FD 5G49A 1ZLAD 3W98C 4LD9C 4KGCA 5B1LA 3VH6W 4NFTA 4WU9D 4WZSB 5AV9D 5AVBA 5B2ID 1KX5B 4R8PD 4H9RB 3REKA 1P3OD 5AY8D 3AZID 2AROD 3REIA 3WTPE 2YFWB 4HGAB 5B33D 4XZQC 3A6NA 3AZEB 3AN2B 5BNVB 4H9PA 1EQZB 4H9OB 3X1SD 5AVCC 5CPID 3AZKD 4NE6A 3WKJC 5B40C 3UT9C 5BO0B 2FJ7C 1KX5A 5GSUD 4ZUXB 3LELD 4YS3B 4H9RA 3NQUB 5B2JB 1R4VA 1TAFB 2PYOB 1P3IC 2HIOC 4J8WB 1P3LB 3AZMD 1M18B 3AZFC 5B1MC 5B32G 4J8UB 3AZEA 3AN2A 5BNVA 4G92B 1EQZA 3C1BA 4KGCC 5B1LC 5B0YD 1A7WA 5AV5B 3AZGC 1P3PD 4ZUXA 4YS3A 3NQUA 5B2JA 3W99D 5GT0B 3REIC 1P3AD 2HUEB 1P3LA 1M18A 1F66B 4J8XC 3WTPB 4J8UA 3AV2D 3W98B 3B0DC 4WV4B 5DNMC 1S32C 2CV5B 2NQBD 1HQ3A 3R45B 3X1UD 5AV5A 5KDMB 3KUYB 3VH5W 3AYWD 5FUGB 4Z2MG 3W97B 1N1JB 5GT0A 3MVDB 3MGSC 4XZQB 2NZDB 4HGAC 1AOIC 3MGRD 3WTPA 1P3KD 3O62D 5AV6C 3W98A 5B31D 3C1BC 3AV1D 2CV5A 3UTBA 5B40B 3UT9B 3R45A 5B31G 2FJ7B 4X23D 5KDMA 3KUYA 4H9QB 1TZYA 5FUGA 5B0ZB 2HIOB 4Z66D 1U35D 1P3IB 3W97A 1N1JA 3TU4D 5CPKD 2CWEA 5B32B 5B1MB 4XUJB 3MVDA 3UTAC 1M18C 4WU8D 4XZQA 3MGQB 3REJC 2NZDA 3C1CC 4KGCB 3B6GD 1HQ3C 3X1VB 5B40A 3UT9A 3AZHD 1BH8B 3AZGB 5AV5C 4Z5TD 5CPJD 4J8WD 1ULYA 5C3IC 3REIB 5B0ZA 2HIOA 1P3IA 5BS7C 1ID3D 5B32A 5B1MA 5JRGC 4XUJA 4J8XB 1M19D 3MGQA 5E5AB 3WTPC 3B0DB 5DNND 5DNMB 3KXBD 3KWQD 1S32B 4KUDD 3W96D 3MGPB 2JSSA 4YM6C 3X1VC 5GT3C 3AFAD 3UTBC 2CV5C 1ZLAC 3B6FC 3LZ0D 4EO5C 1BH8A 3AZGA 1KX4D 3KUYC 4G91B 4E44A 5B2IC 1TZYC 4R8PC 1BH9B 3W97C 1P3OC 5AY8C 3MGSB 1AOIB 3MVDC 4J8XA 2NZDC 4JJND 4LD9D 5E5AA 5AV6B 1P34D 1P3MD 5DNMA 3C1BB 1S32A 1P3BD 3MGPA 1KX3D 3RELD 3WAAB 3REHD 4AWLC 3X1SC 3X1TB 5CPIC 4J8VD 5AV8D 3AZKC 5BNXB 1P3GD 1P3FA 5B24B 3B6FB 5B0ZC 3LELC 1BH9A 1M1AD 3UTAB 3MGSA 5B32C 3REJB 1AOIA 4XUJC 3MGQC 3AZMC 5AVCD 3AZNB 5F99D 3B0CT 5GXQB 4QLCA 2BYMB 5AV6A 3AZJD 3B0BA 3C1CB 3WKJD 2FJ7D 1HQ3B 4KHAB 3WAAA 4CSRB 5CP6B 5B31A 1H3OB 3X1TA 2F8ND 5BNXA 3AZFD 3MNND 5C3IB 3LJAB 1B67A 2LY8A 2RVQD 5B24A 1P3PC 2F8NG 5JRGB 3UTAA 4NE3A 3W99C 3REJA 5CPKA 1P3AC 5E5AC 3AZNA 3WA9D 5GXQA 5B1LD 2BYMA 3C1CA 3AZLA 3AV2C 4YM6B 3MGPC 5GT3B 5AVBD 1ZLAB
chains in the Genus database with same CATH superfamily
4KHAA 4CSRA 5CP6A 3REKD 1H3OA 4EO5B 4WU9B 5B2IB 3LZ1B 3X1UC 4G91C 1TZYB 4R8PB 1P3FC 1P3OB 5AY8B 3LJAA 3A6ND 3AZIB 2AROB 5BS7A 3AYWC 5JRGA 2F8NK 5B33B 1ID3A 4H9NB 4QLCC 4YM6A 3X1VA 5GT3A 3LZ1A 1KX5D 3B6FA 4AWLB 3WAAC 3X1SB 1ZLAA 5B31C 5CPIB 4H9SC 2YFVB 3AV1C 3X1TC 3AZKB 4NE5A 4WU9A 5AV9A 5B2IA 5GSUB 4R8PA 3LELB 4X23C 5B24C 1P3OA 5AY8A 3AZED 3AN2D 3AZIA 3KFUG 2AROA 3F6TA 3AZMB 5CPKC 1EQZD 3C1BD 5B33A 2XD1A 3AZNC 5GXQC 4H9NA 3AZLC 3V9RB 3X1SA 1HTAA 5CP6C 5CPIA 4ZUXD 2XD5A 2YFVA 4YS3D 3B6GC 1WWSA 3AZKA 5B2JD 2PYOD 1P3LD 5GSUA 1M18D 1P3PB 3VH6T 3LELA 4Z5TC 4WNNB 3LJAC 5CPJC 4J8UD 1P3GA 3W99B 3UTBB 1P3AB 5CHLB 3AZMA 5BT1D 1ID3C 1HQ3D 3AV2B 3V9RA 5DNNC 3LZ1C 3KWQC 4KUDC 5AV5D 3NQJB 2NQBB 3AFAC 5B0YA 4WU9C 3IP4C 3X1UB 5AV9C 5GT0D 3LZ0C 1P3FB 1KX4C 4ZBJB 1P3PA 1F66D 3AYWB 3WTPD 4WNNA 3AZIC 2AROC 3W99A 3W98D 1BFMA 1P3AA 5B33C 4QLCB 4Z2MH 3MGRB 3UTBD 2CV5D 4JJNC 1P3KB 2Y2KA 3O62B 3AV2A 1P34C 3WA9A 1P3MC 5B31B 1P3BC 3AV1B 3KUYD 3NQJA 1KX3C 2NQBA 3RELC 3REHC 1TZYD 4J8VC 3W97D 3X1UA 5AV8C 5GSUC 4X23B 3MVDD 4XZQD 2NZDD 1P3GC 3AYWA 3VH6A 4Z66B 1U35B 3TU4B 5CPKB 1M1AC 4WU8B 3MGRA 3AZLB 1P3KA 5F99C 5B40D 3O62A 3UT9D 3AZJC 2L5AA 4H9SA 2IO5B 3AV1A 3B6GB 5B0YC 5B0ZD 2HIOD 3AZHB 1P3ID 5B32D 5B1MD 4XUJD 4Z5TB 4X23A 5CPJB 3MGQD 3MNNC 2YFWA 4Z66A 1U35A 2G5IC 2RVQC 3TU4A 1ID3B 1PZRA 1M19B 3VH5T 4WU8A 4KGCD 4H9OA 5DNNB 3KXBB 3KWQB 3WA9C 4KUDB 4DRBA 3W96B 2ZY5A 3AZGD 5AVBC 3AFAB 2NQBC 3B6GA 5BO0A 5AV9B 3REKC 3REID 3LZ0B 3B0CW 3AZHA 2ZM5A 1KX4B 1JFIB 1TAFA 2DF4C 4J8XD 4Z5TA 5CPJA 4ZBJC 5JA4B 4J8WA 2PYOA 5E5AD 4CAYB 2ZY4A 5DNMD 3A6NC 3EPJA 1S32D 3MGPD 1M19A 4UPKA 4JJNB 3MGRC 4LD9B 1P34B 1P3KC 1P3MB 3O62C 5DNNA 3KXBA 3KWQA 1P3BB 4KUDA 3W96A 1KX3B 3RELB 1KX5C 3AFAA 3REHB 1P3FD 4J8VB 1KU5A 2ZY2A 5AV8B 3LZ0A 3MGSD 1AOID 1KX4A 1P3GB 1JFIA 4UUZB 5JA4A 2BYKB 5AV6D 4CAYA 4QLCD 2Y2IA 4Z66C 1U35C 1M1AB 3TU4C 1F66A 3AZEC 3AN2C 1Q9CA 4WU8C 4JJNA 3WAAD 5AVCB 3VH5A 5F99B 4LD9A 1EQZC 3AZJB 1P34A 3X1TD 1P3MA 2W8SA 1P3BA 3WKJB 1KX3A 2IO5C 5B0YB 3RELA 3REHA 1T3UA 4DRAA 4J8VA 5B24D 4ZUXC 1W2EA 3AZHC 4YS3C 5AV8A 3UTAD 5B2JC 3REJD 2F8NB 2PYOC 3AZFB 4UUZA 3MNNB 4J8WC 1P3LC 3AZND 2BYKA 5GXQD 3C1CD 4J8UC 1M1AA 3AZLD 1M19C 5G49B 4M6BA 3A1IA 1F1EA 2F8NH 5AVCA 5CP6D 5F99A 5BT1C 4G92C 3AZJA 3WA9B 5B1LB 2UWXA 3KSYA 3KXBC 2G5HC 3W96C 3WKJA 5AVBB 2FJ7A 4E45A 1B6WA 3REKB 3LJAD 5JRGD 4H9QA 2F8NA 5GT0C 2HUEC 3AZFA 3MNNA 1WWIA 3A6NB 2FFFB 1F66C 4YM6D 3X1VD 5GT3D 4H9PB 3LZ1D 3B6FD 5G49A 1ZLAD 3W98C 4LD9C 4KGCA 5B1LA 3VH6W 4NFTA 4WU9D 4WZSB 5AV9D 5AVBA 5B2ID 1KX5B 4R8PD 2BG1A 4H9RB 3REKA 1P3OD 5AY8D 3AZID 2AROD 3REIA 3WTPE 2YFWB 4HGAB 5B33D 4XZQC 3A6NA 3AZEB 3AN2B 5BNVB 4H9PA 2Y2PA 4H9OB 1EQZB 3X1SD 5AVCC 5CPID 3AZKD 4WJ3C 4NE6A 3WKJC 5B40C 3UT9C 5BO0B 2FJ7C 1KX5A 5GSUD 2VQRA 4ZUXB 3LELD 4YS3B 4H9RA 3NQUB 5B2JB 1R4VA 1TAFB 2PYOB 1P3IC 2HIOC 4J8WB 1P3LB 3AZMD 1M18B 3AZFC 5B1MC 5B32G 4J8UB 3AZEA 3AN2A 5BNVA 4G92B 1EQZA 3C1BA 4KGCC 5B1LC 5B0YD 3H0LC 2DQNC 1A7WA 5AV5B 3AZGC 1P3PD 4ZUXA 4YS3A 3NQUA 5B2JA 3W99D 5GT0B 3REIC 1P3AD 2HUEB 1P3LA 1M18A 1F66B 4J8XC 3WTPB 4J8UA 2Y2JA 3AV2D 3W98B 3B0DC 4WV4B 5DNMC 1S32C 2CV5B 2NQBD 3EPLA 1HQ3A 2Y2QA 3R45B 3X1UD 5AV5A 5KDMB 3KUYB 3VH5W 3FDDA 3AYWD 5FUGB 2RIQA 4Z2MG 3W97B 1N1JB 5GT0A 3MVDB 3P5JB 3MGSC 4XZQB 2NZDB 4HGAC 1AOIC 3MGRD 3WTPA 3EPHA 1P3KD 3O62D 5AV6C 3W98A 5B31D 3C1BC 3AV1D 2CV5A 3UTBA 5B40B 3UT9B 3R45A 5B31G 2FJ7B 4X23D 5KDMA 3KUYA 4H9QB 1TZYA 5FUGA 5B0ZB 2HIOB 4Z66D 1U35D 1P3IB 2Y2GA 1N1JA 2Y2NA 3W97A 3TU4D 5CPKD 2CWEA 5B32B 5B1MB 3EG5B 2Y2OA 4XUJB 3MVDA 3UTAC 4XZQA 4WU8D 3MGQB 3REJC 1M18C 2NZDA 2Y2HA 3C1CC 4KGCB 3B6GD 1HQ3C 3X1VB 5B40A 3UT9A 3AZHD 1BH8B 3AZGB 5AV5C 4Z5TD 5CPJD 4J8WD 1ULYA 5C3IC 3REIB 5B0ZA 2HIOA 1P3IA 5BS7C 1ID3D 5B32A 5B1MA 5JRGC 4XUJA 4J8XB 1M19D 3MGQA 5E5AB 3WTPC 3B0DB 2ZY3A 5DNND 3KXBD 3KWQD 5DNMB 1S32B 4KUDD 3W96D 3MGPB 2JSSA 2JE5A 2Y2LA 4YM6C 5GT3C 3X1VC 3AFAD 3UTBC 2CV5C 1ZLAC 3B6FC 3LZ0D 4EO5C 3A1KA 1BH8A 3AZGA 1KX4D 3KUYC 1Z2CB 4G91B 4E44A 5B2IC 1TZYC 4R8PC 1BH9B 3W97C 1P3OC 5AY8C 3MGSB 1AOIB 3MVDC 4DQYB 4J8XA 2NZDC 4JJND 4LD9D 5E5AA 5AV6B 1P34D 1P3MD 5DNMA 3C1BB 1S32A 1P3BD 3MGPA 1KX3D 3RELD 3WAAB 3REHD 3AL0C 4AWLC 3X1SC 3X1TB 5CPIC 4J8VD 5AV8D 3AZKC 5BNXB 1P3GD 1P3FA 5B24B 3B6FB 5B0ZC 3LELC 1BH9A 1M1AD 3UTAB 3MGSA 5B32C 3REJB 1AOIA 4XUJC 3H0RC 3MGQC 1ZLAB 3AZMC 5AVCD 3AZNB 5F99D 3B0CT 5GXQB 4QLCA 2BYMB 5AV6A 3AZJD 3B0BA 3C1CB 3WKJD 2FJ7D 1HQ3B 4KHAB 3WAAA 4CSRB 5CP6B 5B31A 1H3OB 2J8PA 3X1TA 2F8ND 5BNXA 3AZFD 3MNND 5C3IB 3LJAB 1B67A 2LY8A 2F2AC 2RVQD 5B24A 1P3PC 2F8NG 5JRGB 2Y2MA 3UTAA 4NE3A 3W99C 3REJA 5CPKA 1P3AC 3H0MC 5E5AC 3AZNA 3WA9D 5GXQA 5B1LD 2BYMA 2JCHA 3C1CA 3AZLA 3AV2C 4YM6B 3MGPC 5GT3B 5AVBD 3EPKA
chains in the Genus database with same CATH topology
4KHAA 4CSRA 5CP6A 3REKD 1H3OA 4EO5B 4WU9B 5B2IB 3LZ1B 3X1UC 4G91C 1TZYB 4R8PB 1P3FC 1P3OB 5AY8B 3LJAA 3A6ND 3AZIB 2AROB 5BS7A 3AYWC 5JRGA 2F8NK 5B33B 1ID3A 4H9NB 4QLCC 4YM6A 3X1VA 5GT3A 3LZ1A 1KX5D 3B6FA 4AWLB 3WAAC 3X1SB 1ZLAA 5B31C 5CPIB 4H9SC 2YFVB 3AV1C 3X1TC 3AZKB 4NE5A 4WU9A 5AV9A 5B2IA 5GSUB 4R8PA 3LELB 4X23C 5B24C 1P3OA 5AY8A 3AZED 3AN2D 3AZIA 3KFUG 2AROA 3F6TA 3AZMB 5CPKC 1EQZD 3C1BD 5B33A 2XD1A 3AZNC 5GXQC 4H9NA 3AZLC 3V9RB 3X1SA 1HTAA 5CP6C 5CPIA 4ZUXD 2XD5A 2YFVA 4YS3D 3B6GC 1WWSA 3AZKA 5B2JD 2PYOD 1P3LD 5GSUA 1M18D 1P3PB 3VH6T 3LELA 4Z5TC 4WNNB 3LJAC 5CPJC 4J8UD 1P3GA 3W99B 3UTBB 1P3AB 5CHLB 3AZMA 5BT1D 1ID3C 1HQ3D 3AV2B 3V9RA 5DNNC 3LZ1C 3KWQC 4KUDC 5AV5D 3NQJB 2NQBB 3AFAC 5B0YA 4WU9C 3IP4C 3X1UB 5AV9C 5GT0D 3LZ0C 1P3FB 1KX4C 4ZBJB 1P3PA 1F66D 3AYWB 3WTPD 4WNNA 3AZIC 2AROC 3W99A 3W98D 1BFMA 1P3AA 5B33C 4QLCB 4Z2MH 3MGRB 3UTBD 2CV5D 4JJNC 1P3KB 2Y2KA 3O62B 3AV2A 1P34C 3WA9A 1P3MC 5B31B 1P3BC 3AV1B 3KUYD 3NQJA 1KX3C 2NQBA 3RELC 3REHC 1TZYD 4J8VC 3W97D 3X1UA 5AV8C 5GSUC 4X23B 3MVDD 4XZQD 2NZDD 1P3GC 3AYWA 3VH6A 4Z66B 1U35B 3TU4B 5CPKB 1M1AC 4WU8B 3MGRA 3AZLB 1P3KA 5F99C 5B40D 3O62A 3UT9D 3AZJC 2L5AA 4H9SA 2IO5B 3AV1A 3B6GB 5B0YC 5B0ZD 2HIOD 3AZHB 1P3ID 5B32D 5B1MD 4XUJD 4Z5TB 4X23A 5CPJB 3MGQD 3MNNC 2YFWA 4Z66A 1U35A 2G5IC 2RVQC 3TU4A 1ID3B 1PZRA 1M19B 3VH5T 4WU8A 4KGCD 4H9OA 5DNNB 3KXBB 3KWQB 3WA9C 4KUDB 4DRBA 3W96B 2ZY5A 3AZGD 5AVBC 3AFAB 2NQBC 3B6GA 5BO0A 5AV9B 3REKC 3REID 3LZ0B 3B0CW 3AZHA 2ZM5A 1KX4B 1JFIB 1TAFA 2DF4C 4J8XD 4Z5TA 5CPJA 4ZBJC 5JA4B 4J8WA 2PYOA 5E5AD 4CAYB 2ZY4A 5DNMD 3A6NC 3EPJA 1S32D 3MGPD 1M19A 4UPKA 4JJNB 3MGRC 4LD9B 1P34B 1P3KC 1P3MB 3O62C 5DNNA 3KXBA 3KWQA 1P3BB 4KUDA 3W96A 1KX3B 3RELB 1KX5C 3AFAA 3REHB 1P3FD 4J8VB 1KU5A 2ZY2A 5AV8B 3LZ0A 3MGSD 1AOID 1KX4A 1P3GB 1JFIA 4UUZB 5JA4A 2BYKB 5AV6D 4CAYA 4QLCD 2Y2IA 4Z66C 1U35C 1M1AB 3TU4C 1F66A 3AZEC 3AN2C 1Q9CA 4WU8C 4JJNA 3WAAD 5AVCB 3VH5A 5F99B 4LD9A 1EQZC 3AZJB 1P34A 3X1TD 1P3MA 2W8SA 1P3BA 3WKJB 1KX3A 2IO5C 5B0YB 3RELA 3REHA 1T3UA 4DRAA 4J8VA 5B24D 4ZUXC 1W2EA 3AZHC 4YS3C 5AV8A 3UTAD 5B2JC 3REJD 2F8NB 2PYOC 3AZFB 4UUZA 3MNNB 4J8WC 1P3LC 3AZND 2BYKA 5GXQD 3C1CD 4J8UC 1M1AA 3AZLD 1M19C 5G49B 4M6BA 3A1IA 1F1EA 2F8NH 5AVCA 5CP6D 5F99A 5BT1C 4G92C 3AZJA 3WA9B 5B1LB 2UWXA 3KSYA 3KXBC 2G5HC 3W96C 3WKJA 5AVBB 2FJ7A 4E45A 1B6WA 3REKB 3LJAD 5JRGD 4H9QA 2F8NA 5GT0C 2HUEC 3AZFA 3MNNA 1WWIA 3A6NB 2FFFB 1F66C 4YM6D 3X1VD 5GT3D 4H9PB 3LZ1D 3B6FD 5G49A 1ZLAD 3W98C 4LD9C 4KGCA 5B1LA 3VH6W 4NFTA 4WU9D 4WZSB 5AV9D 5AVBA 5B2ID 1KX5B 4R8PD 2BG1A 4H9RB 3REKA 1P3OD 5AY8D 3AZID 2AROD 3REIA 3WTPE 2YFWB 4HGAB 5B33D 4XZQC 3A6NA 3AZEB 3AN2B 5BNVB 4H9PA 2Y2PA 4H9OB 1EQZB 3X1SD 5AVCC 5CPID 3AZKD 4WJ3C 4NE6A 3WKJC 5B40C 3UT9C 5BO0B 2FJ7C 1KX5A 5GSUD 2VQRA 4ZUXB 3LELD 4YS3B 4H9RA 3NQUB 5B2JB 1R4VA 1TAFB 2PYOB 1P3IC 2HIOC 4J8WB 1P3LB 3AZMD 1M18B 3AZFC 5B1MC 5B32G 4J8UB 3AZEA 3AN2A 5BNVA 4G92B 1EQZA 3C1BA 4KGCC 5B1LC 5B0YD 3H0LC 2DQNC 1A7WA 5AV5B 3AZGC 1P3PD 4ZUXA 4YS3A 3NQUA 5B2JA 3W99D 5GT0B 3REIC 1P3AD 2HUEB 1P3LA 1M18A 1F66B 4J8XC 3WTPB 4J8UA 2Y2JA 3AV2D 3W98B 3B0DC 4WV4B 5DNMC 1S32C 2CV5B 2NQBD 3EPLA 1HQ3A 2Y2QA 3R45B 3X1UD 5AV5A 5KDMB 3KUYB 3VH5W 3FDDA 3AYWD 5FUGB 2RIQA 4Z2MG 3W97B 1N1JB 5GT0A 3MVDB 3P5JB 3MGSC 4XZQB 2NZDB 4HGAC 1AOIC 3MGRD 3WTPA 3EPHA 1P3KD 3O62D 5AV6C 3W98A 5B31D 3C1BC 3AV1D 2CV5A 3UTBA 5B40B 3UT9B 3R45A 5B31G 2FJ7B 4X23D 5KDMA 3KUYA 4H9QB 1TZYA 5FUGA 5B0ZB 2HIOB 4Z66D 1U35D 1P3IB 2Y2GA 1N1JA 2Y2NA 3W97A 3TU4D 5CPKD 2CWEA 5B32B 5B1MB 3EG5B 2Y2OA 4XUJB 3MVDA 3UTAC 4XZQA 4WU8D 3MGQB 3REJC 1M18C 2NZDA 2Y2HA 3C1CC 4KGCB 3B6GD 1HQ3C 3X1VB 5B40A 3UT9A 3AZHD 1BH8B 3AZGB 5AV5C 4Z5TD 5CPJD 4J8WD 1ULYA 5C3IC 3REIB 5B0ZA 2HIOA 1P3IA 5BS7C 1ID3D 5B32A 5B1MA 5JRGC 4XUJA 4J8XB 1M19D 3MGQA 5E5AB 3WTPC 3B0DB 2ZY3A 5DNND 3KXBD 3KWQD 5DNMB 1S32B 4KUDD 3W96D 3MGPB 2JSSA 2JE5A 2Y2LA 4YM6C 5GT3C 3X1VC 3AFAD 3UTBC 2CV5C 1ZLAC 3B6FC 3LZ0D 4EO5C 3A1KA 1BH8A 3AZGA 1KX4D 3KUYC 1Z2CB 4G91B 4E44A 5B2IC 1TZYC 4R8PC 1BH9B 3W97C 1P3OC 5AY8C 3MGSB 1AOIB 3MVDC 4DQYB 4J8XA 2NZDC 4JJND 4LD9D 5E5AA 5AV6B 1P34D 1P3MD 5DNMA 3C1BB 1S32A 1P3BD 3MGPA 1KX3D 3RELD 3WAAB 3REHD 3AL0C 4AWLC 3X1SC 3X1TB 5CPIC 4J8VD 5AV8D 3AZKC 5BNXB 1P3GD 1P3FA 5B24B 3B6FB 5B0ZC 3LELC 1BH9A 1M1AD 3UTAB 3MGSA 5B32C 3REJB 1AOIA 4XUJC 3H0RC 3MGQC 1ZLAB 3AZMC 5AVCD 3AZNB 5F99D 3B0CT 5GXQB 4QLCA 2BYMB 5AV6A 3AZJD 3B0BA 3C1CB 3WKJD 2FJ7D 1HQ3B 4KHAB 3WAAA 4CSRB 5CP6B 5B31A 1H3OB 2J8PA 3X1TA 2F8ND 5BNXA 3AZFD 3MNND 5C3IB 3LJAB 1B67A 2LY8A 2F2AC 2RVQD 5B24A 1P3PC 2F8NG 5JRGB 2Y2MA 3UTAA 4NE3A 3W99C 3REJA 5CPKA 1P3AC 3H0MC 5E5AC 3AZNA 3WA9D 5GXQA 5B1LD 2BYMA 2JCHA 3C1CA 3AZLA 3AV2C 4YM6B 3MGPC 5GT3B 5AVBD 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA A;  4CSR A;  5CP6 A;  3REK D;  1H3O A;  4EO5 B;  4WU9 B;  5B2I B;  3LZ1 B;  3X1U C;  4G91 C;  1TZY B;  4R8P B;  1P3F C;  1P3O B;  5AY8 B;  3LJA A;  3A6N D;  3AZI B;  2ARO B;  5BS7 A;  3AYW C;  5JRG A;  2F8N K;  5B33 B;  1ID3 A;  4H9N B;  4QLC C;  4YM6 A;  3X1V A;  5GT3 A;  3LZ1 A;  1KX5 D;  3B6F A;  4AWL B;  3WAA C;  3X1S B;  1ZLA A;  5B31 C;  5CPI B;  4H9S C;  2YFV B;  3AV1 C;  3X1T C;  3AZK B;  4NE5 A;  4WU9 A;  5AV9 A;  5B2I A;  5GSU B;  4R8P A;  3LEL B;  4X23 C;  5B24 C;  1P3O A;  5AY8 A;  3AZE D;  3AN2 D;  3AZI A;  2ARO A;  3AZM B;  5CPK C;  1EQZ D;  3C1B D;  5B33 A;  3AZN C;  5GXQ C;  4H9N A;  3AZL C;  3V9R B;  3X1S A;  1HTA A;  5CP6 C;  5CPI A;  4ZUX D;  2YFV A;  3B6G C;  4YS3 D;  1WWS A;  3AZK A;  5B2J D;  2PYO D;  1P3L D;  5GSU A;  1M18 D;  1P3P B;  3VH6 T;  3LEL A;  4Z5T C;  4WNN B;  3LJA C;  5CPJ C;  4J8U D;  1P3G A;  3W99 B;  3UTB B;  1P3A B;  5CHL B;  3AZM A;  5BT1 D;  1ID3 C;  1HQ3 D;  3AV2 B;  3V9R A;  5DNN C;  3LZ1 C;  3KWQ C;  4KUD C;  5AV5 D;  3NQJ B;  2NQB B;  3AFA C;  5B0Y A;  4WU9 C;  3X1U B;  5AV9 C;  5GT0 D;  3LZ0 C;  1P3F B;  1KX4 C;  4ZBJ B;  1P3P A;  1F66 D;  3AYW B;  3WTP D;  4WNN A;  3AZI C;  2ARO C;  3W99 A;  3W98 D;  1BFM A;  1P3A A;  5B33 C;  4QLC B;  4Z2M H;  3MGR B;  3UTB D;  2CV5 D;  4JJN C;  1P3K B;  3O62 B;  3AV2 A;  1P34 C;  3WA9 A;  1P3M C;  5B31 B;  1P3B C;  3AV1 B;  3KUY D;  3NQJ A;  1KX3 C;  2NQB A;  3REL C;  3REH C;  1TZY D;  4J8V C;  3W97 D;  3X1U A;  5AV8 C;  5GSU C;  4X23 B;  3MVD D;  4XZQ D;  2NZD D;  1P3G C;  3AYW A;  3VH6 A;  4Z66 B;  1U35 B;  3TU4 B;  5CPK B;  1M1A C;  4WU8 B;  3MGR A;  3AZL B;  1P3K A;  5F99 C;  5B40 D;  3O62 A;  3UT9 D;  3AZJ C;  2L5A A;  4H9S A;  2IO5 B;  3AV1 A;  3B6G B;  5B0Y C;  5B0Z D;  2HIO D;  3AZH B;  1P3I D;  5B32 D;  5B1M D;  4XUJ D;  4Z5T B;  4X23 A;  5CPJ B;  3MGQ D;  3MNN C;  2YFW A;  4Z66 A;  1U35 A;  2RVQ C;  3TU4 A;  1ID3 B;  1M19 B;  3VH5 T;  4WU8 A;  4KGC D;  4H9O A;  5DNN B;  3KXB B;  3KWQ B;  3WA9 C;  4KUD B;  4DRB A;  3W96 B;  3AZG D;  5AVB C;  3AFA B;  2NQB C;  3B6G A;  5BO0 A;  5AV9 B;  3REK C;  3REI D;  3LZ0 B;  3B0C W;  3AZH A;  1KX4 B;  1JFI B;  1TAF A;  4J8X D;  4Z5T A;  5CPJ A;  4ZBJ C;  5JA4 B;  4J8W A;  2PYO A;  5E5A D;  4CAY B;  5DNM D;  3A6N C;  1S32 D;  3MGP D;  1M19 A;  4JJN B;  3MGR C;  4LD9 B;  1P34 B;  1P3K C;  1P3M B;  3O62 C;  5DNN A;  3KXB A;  3KWQ A;  1P3B B;  4KUD A;  3W96 A;  1KX3 B;  3REL B;  1KX5 C;  3AFA A;  3REH B;  1P3F D;  4J8V B;  1KU5 A;  5AV8 B;  3LZ0 A;  3MGS D;  1AOI D;  1KX4 A;  1P3G B;  1JFI A;  4UUZ B;  5JA4 A;  2BYK B;  5AV6 D;  4CAY A;  4QLC D;  4Z66 C;  1U35 C;  1M1A B;  3TU4 C;  1F66 A;  3AZE C;  3AN2 C;  1Q9C A;  4WU8 C;  4JJN A;  3WAA D;  5AVC B;  3VH5 A;  5F99 B;  4LD9 A;  1EQZ C;  3AZJ B;  1P34 A;  3X1T D;  1P3M A;  1P3B A;  3WKJ B;  1KX3 A;  2IO5 C;  5B0Y B;  3REL A;  3REH A;  4DRA A;  4J8V A;  5B24 D;  4ZUX C;  3AZH C;  4YS3 C;  5AV8 A;  3UTA D;  5B2J C;  3REJ D;  2F8N B;  2PYO C;  3AZF B;  4UUZ A;  3MNN B;  4J8W C;  1P3L C;  3AZN D;  2BYK A;  5GXQ D;  3C1C D;  4J8U C;  1M1A A;  3AZL D;  1M19 C;  5G49 B;  4M6B A;  1F1E A;  2F8N H;  5AVC A;  5CP6 D;  5F99 A;  5BT1 C;  4G92 C;  3AZJ A;  3WA9 B;  5B1L B;  3KSY A;  3KXB C;  3W96 C;  3WKJ A;  5AVB B;  2FJ7 A;  4E45 A;  1B6W A;  3REK B;  3LJA D;  5JRG D;  4H9Q A;  2F8N A;  5GT0 C;  2HUE C;  3AZF A;  3MNN A;  1WWI A;  3A6N B;  1F66 C;  4YM6 D;  3X1V D;  5GT3 D;  4H9P B;  3LZ1 D;  3B6F D;  5G49 A;  1ZLA D;  3W98 C;  4LD9 C;  4KGC A;  5B1L A;  3VH6 W;  4NFT A;  4WU9 D;  4WZS B;  5AV9 D;  5AVB A;  5B2I D;  1KX5 B;  4R8P D;  4H9R B;  3REK A;  1P3O D;  5AY8 D;  3AZI D;  2ARO D;  3REI A;  3WTP E;  2YFW B;  4HGA B;  5B33 D;  4XZQ C;  3A6N A;  3AZE B;  3AN2 B;  5BNV B;  4H9P A;  1EQZ B;  4H9O B;  3X1S D;  5AVC C;  5CPI D;  3AZK D;  4NE6 A;  3WKJ C;  5B40 C;  3UT9 C;  5BO0 B;  2FJ7 C;  1KX5 A;  5GSU D;  4ZUX B;  3LEL D;  4YS3 B;  4H9R A;  3NQU B;  5B2J B;  1R4V A;  1TAF B;  2PYO B;  1P3I C;  2HIO C;  4J8W B;  1P3L B;  3AZM D;  1M18 B;  3AZF C;  5B1M C;  5B32 G;  4J8U B;  3AZE A;  3AN2 A;  5BNV A;  4G92 B;  1EQZ A;  3C1B A;  4KGC C;  5B1L C;  5B0Y D;  1A7W A;  5AV5 B;  3AZG C;  1P3P D;  4ZUX A;  4YS3 A;  3NQU A;  5B2J A;  3W99 D;  5GT0 B;  3REI C;  1P3A D;  2HUE B;  1P3L A;  1M18 A;  1F66 B;  4J8X C;  3WTP B;  4J8U A;  3AV2 D;  3W98 B;  3B0D C;  4WV4 B;  5DNM C;  1S32 C;  2CV5 B;  2NQB D;  1HQ3 A;  3R45 B;  3X1U D;  5AV5 A;  5KDM B;  3KUY B;  3VH5 W;  3AYW D;  5FUG B;  4Z2M G;  3W97 B;  1N1J B;  5GT0 A;  3MVD B;  3MGS C;  4XZQ B;  2NZD B;  4HGA C;  1AOI C;  3MGR D;  3WTP A;  1P3K D;  3O62 D;  5AV6 C;  3W98 A;  5B31 D;  3C1B C;  3AV1 D;  2CV5 A;  3UTB A;  5B40 B;  3UT9 B;  3R45 A;  5B31 G;  2FJ7 B;  4X23 D;  5KDM A;  3KUY A;  4H9Q B;  1TZY A;  5FUG A;  5B0Z B;  2HIO B;  4Z66 D;  1U35 D;  1P3I B;  3W97 A;  1N1J A;  3TU4 D;  5CPK D;  2CWE A;  5B32 B;  5B1M B;  4XUJ B;  3MVD A;  3UTA C;  1M18 C;  4WU8 D;  4XZQ A;  3MGQ B;  3REJ C;  2NZD A;  3C1C C;  4KGC B;  3B6G D;  1HQ3 C;  3X1V B;  5B40 A;  3UT9 A;  3AZH D;  1BH8 B;  3AZG B;  5AV5 C;  4Z5T D;  5CPJ D;  4J8W D;  1ULY A;  5C3I C;  3REI B;  5B0Z A;  2HIO A;  1P3I A;  5BS7 C;  1ID3 D;  5B32 A;  5B1M A;  5JRG C;  4XUJ A;  4J8X B;  1M19 D;  3MGQ A;  5E5A B;  3WTP C;  3B0D B;  5DNN D;  5DNM B;  3KXB D;  3KWQ D;  1S32 B;  4KUD D;  3W96 D;  3MGP B;  2JSS A;  4YM6 C;  3X1V C;  5GT3 C;  3AFA D;  3UTB C;  2CV5 C;  1ZLA C;  3B6F C;  3LZ0 D;  4EO5 C;  1BH8 A;  3AZG A;  1KX4 D;  3KUY C;  4G91 B;  4E44 A;  5B2I C;  1TZY C;  4R8P C;  1BH9 B;  3W97 C;  1P3O C;  5AY8 C;  3MGS B;  1AOI B;  3MVD C;  4J8X A;  2NZD C;  4JJN D;  4LD9 D;  5E5A A;  5AV6 B;  1P34 D;  1P3M D;  5DNM A;  3C1B B;  1S32 A;  1P3B D;  3MGP A;  1KX3 D;  3REL D;  3WAA B;  3REH D;  4AWL C;  3X1S C;  3X1T B;  5CPI C;  4J8V D;  5AV8 D;  3AZK C;  5BNX B;  1P3G D;  1P3F A;  5B24 B;  3B6F B;  5B0Z C;  3LEL C;  1BH9 A;  1M1A D;  3UTA B;  3MGS A;  5B32 C;  3REJ B;  1AOI A;  4XUJ C;  3MGQ C;  3AZM C;  5AVC D;  3AZN B;  5F99 D;  3B0C T;  5GXQ B;  4QLC A;  2BYM B;  5AV6 A;  3AZJ D;  3B0B A;  3C1C B;  3WKJ D;  2FJ7 D;  1HQ3 B;  4KHA B;  3WAA A;  4CSR B;  5CP6 B;  5B31 A;  1H3O B;  3X1T A;  2F8N D;  5BNX A;  3AZF D;  3MNN D;  5C3I B;  3LJA B;  1B67 A;  2LY8 A;  2RVQ D;  5B24 A;  1P3P C;  2F8N G;  5JRG B;  3UTA A;  4NE3 A;  3W99 C;  3REJ A;  5CPK A;  1P3A C;  5E5A C;  3AZN A;  3WA9 D;  5GXQ A;  5B1L D;  2BYM A;  3C1C A;  3AZL A;  3AV2 C;  4YM6 B;  3MGP C;  5GT3 B;  5AVB D;  1ZLA B; 
#chains in the Genus database with same CATH topology
 4KHA A;  4CSR A;  5CP6 A;  3REK D;  1H3O A;  4EO5 B;  4WU9 B;  5B2I B;  3LZ1 B;  3X1U C;  4G91 C;  1TZY B;  4R8P B;  1P3F C;  1P3O B;  5AY8 B;  3LJA A;  3A6N D;  3AZI B;  2ARO B;  5BS7 A;  3AYW C;  5JRG A;  2F8N K;  5B33 B;  1ID3 A;  4H9N B;  4QLC C;  4YM6 A;  3X1V A;  5GT3 A;  3LZ1 A;  1KX5 D;  3B6F A;  4AWL B;  3WAA C;  3X1S B;  1ZLA A;  5B31 C;  5CPI B;  4H9S C;  2YFV B;  3AV1 C;  3X1T C;  3AZK B;  4NE5 A;  4WU9 A;  5AV9 A;  5B2I A;  5GSU B;  4R8P A;  3LEL B;  4X23 C;  5B24 C;  1P3O A;  5AY8 A;  3AZE D;  3AN2 D;  3AZI A;  3KFU G;  2ARO A;  3F6T A;  3AZM B;  5CPK C;  1EQZ D;  3C1B D;  5B33 A;  2XD1 A;  3AZN C;  5GXQ C;  4H9N A;  3AZL C;  3V9R B;  3X1S A;  1HTA A;  5CP6 C;  5CPI A;  4ZUX D;  2XD5 A;  2YFV A;  4YS3 D;  3B6G C;  1WWS A;  3AZK A;  5B2J D;  2PYO D;  1P3L D;  5GSU A;  1M18 D;  1P3P B;  3VH6 T;  3LEL A;  4Z5T C;  4WNN B;  3LJA C;  5CPJ C;  4J8U D;  1P3G A;  3W99 B;  3UTB B;  1P3A B;  5CHL B;  3AZM A;  5BT1 D;  1ID3 C;  1HQ3 D;  3AV2 B;  3V9R A;  5DNN C;  3LZ1 C;  3KWQ C;  4KUD C;  5AV5 D;  3NQJ B;  2NQB B;  3AFA C;  5B0Y A;  4WU9 C;  3IP4 C;  3X1U B;  5AV9 C;  5GT0 D;  3LZ0 C;  1P3F B;  1KX4 C;  4ZBJ B;  1P3P A;  1F66 D;  3AYW B;  3WTP D;  4WNN A;  3AZI C;  2ARO C;  3W99 A;  3W98 D;  1BFM A;  1P3A A;  5B33 C;  4QLC B;  4Z2M H;  3MGR B;  3UTB D;  2CV5 D;  4JJN C;  1P3K B;  2Y2K A;  3O62 B;  3AV2 A;  1P34 C;  3WA9 A;  1P3M C;  5B31 B;  1P3B C;  3AV1 B;  3KUY D;  3NQJ A;  1KX3 C;  2NQB A;  3REL C;  3REH C;  1TZY D;  4J8V C;  3W97 D;  3X1U A;  5AV8 C;  5GSU C;  4X23 B;  3MVD D;  4XZQ D;  2NZD D;  1P3G C;  3AYW A;  3VH6 A;  4Z66 B;  1U35 B;  3TU4 B;  5CPK B;  1M1A C;  4WU8 B;  3MGR A;  3AZL B;  1P3K A;  5F99 C;  5B40 D;  3O62 A;  3UT9 D;  3AZJ C;  2L5A A;  4H9S A;  2IO5 B;  3AV1 A;  3B6G B;  5B0Y C;  5B0Z D;  2HIO D;  3AZH B;  1P3I D;  5B32 D;  5B1M D;  4XUJ D;  4Z5T B;  4X23 A;  5CPJ B;  3MGQ D;  3MNN C;  2YFW A;  4Z66 A;  1U35 A;  2G5I C;  2RVQ C;  3TU4 A;  1ID3 B;  1PZR A;  1M19 B;  3VH5 T;  4WU8 A;  4KGC D;  4H9O A;  5DNN B;  3KXB B;  3KWQ B;  3WA9 C;  4KUD B;  4DRB A;  3W96 B;  2ZY5 A;  3AZG D;  5AVB C;  3AFA B;  2NQB C;  3B6G A;  5BO0 A;  5AV9 B;  3REK C;  3REI D;  3LZ0 B;  3B0C W;  3AZH A;  2ZM5 A;  1KX4 B;  1JFI B;  1TAF A;  2DF4 C;  4J8X D;  4Z5T A;  5CPJ A;  4ZBJ C;  5JA4 B;  4J8W A;  2PYO A;  5E5A D;  4CAY B;  2ZY4 A;  5DNM D;  3A6N C;  3EPJ A;  1S32 D;  3MGP D;  1M19 A;  4UPK A;  4JJN B;  3MGR C;  4LD9 B;  1P34 B;  1P3K C;  1P3M B;  3O62 C;  5DNN A;  3KXB A;  3KWQ A;  1P3B B;  4KUD A;  3W96 A;  1KX3 B;  3REL B;  1KX5 C;  3AFA A;  3REH B;  1P3F D;  4J8V B;  1KU5 A;  2ZY2 A;  5AV8 B;  3LZ0 A;  3MGS D;  1AOI D;  1KX4 A;  1P3G B;  1JFI A;  4UUZ B;  5JA4 A;  2BYK B;  5AV6 D;  4CAY A;  4QLC D;  2Y2I A;  4Z66 C;  1U35 C;  1M1A B;  3TU4 C;  1F66 A;  3AZE C;  3AN2 C;  1Q9C A;  4WU8 C;  4JJN A;  3WAA D;  5AVC B;  3VH5 A;  5F99 B;  4LD9 A;  1EQZ C;  3AZJ B;  1P34 A;  3X1T D;  1P3M A;  2W8S A;  1P3B A;  3WKJ B;  1KX3 A;  2IO5 C;  5B0Y B;  3REL A;  3REH A;  1T3U A;  4DRA A;  4J8V A;  5B24 D;  4ZUX C;  1W2E A;  3AZH C;  4YS3 C;  5AV8 A;  3UTA D;  5B2J C;  3REJ D;  2F8N B;  2PYO C;  3AZF B;  4UUZ A;  3MNN B;  4J8W C;  1P3L C;  3AZN D;  2BYK A;  5GXQ D;  3C1C D;  4J8U C;  1M1A A;  3AZL D;  1M19 C;  5G49 B;  4M6B A;  3A1I A;  1F1E A;  2F8N H;  5AVC A;  5CP6 D;  5F99 A;  5BT1 C;  4G92 C;  3AZJ A;  3WA9 B;  5B1L B;  2UWX A;  3KSY A;  3KXB C;  2G5H C;  3W96 C;  3WKJ A;  5AVB B;  2FJ7 A;  4E45 A;  1B6W A;  3REK B;  3LJA D;  5JRG D;  4H9Q A;  2F8N A;  5GT0 C;  2HUE C;  3AZF A;  3MNN A;  1WWI A;  3A6N B;  2FFF B;  1F66 C;  4YM6 D;  3X1V D;  5GT3 D;  4H9P B;  3LZ1 D;  3B6F D;  5G49 A;  1ZLA D;  3W98 C;  4LD9 C;  4KGC A;  5B1L A;  3VH6 W;  4NFT A;  4WU9 D;  4WZS B;  5AV9 D;  5AVB A;  5B2I D;  1KX5 B;  4R8P D;  2BG1 A;  4H9R B;  3REK A;  1P3O D;  5AY8 D;  3AZI D;  2ARO D;  3REI A;  3WTP E;  2YFW B;  4HGA B;  5B33 D;  4XZQ C;  3A6N A;  3AZE B;  3AN2 B;  5BNV B;  4H9P A;  2Y2P A;  4H9O B;  1EQZ B;  3X1S D;  5AVC C;  5CPI D;  3AZK D;  4WJ3 C;  4NE6 A;  3WKJ C;  5B40 C;  3UT9 C;  5BO0 B;  2FJ7 C;  1KX5 A;  5GSU D;  2VQR A;  4ZUX B;  3LEL D;  4YS3 B;  4H9R A;  3NQU B;  5B2J B;  1R4V A;  1TAF B;  2PYO B;  1P3I C;  2HIO C;  4J8W B;  1P3L B;  3AZM D;  1M18 B;  3AZF C;  5B1M C;  5B32 G;  4J8U B;  3AZE A;  3AN2 A;  5BNV A;  4G92 B;  1EQZ A;  3C1B A;  4KGC C;  5B1L C;  5B0Y D;  3H0L C;  2DQN C;  1A7W A;  5AV5 B;  3AZG C;  1P3P D;  4ZUX A;  4YS3 A;  3NQU A;  5B2J A;  3W99 D;  5GT0 B;  3REI C;  1P3A D;  2HUE B;  1P3L A;  1M18 A;  1F66 B;  4J8X C;  3WTP B;  4J8U A;  2Y2J A;  3AV2 D;  3W98 B;  3B0D C;  4WV4 B;  5DNM C;  1S32 C;  2CV5 B;  2NQB D;  3EPL A;  1HQ3 A;  2Y2Q A;  3R45 B;  3X1U D;  5AV5 A;  5KDM B;  3KUY B;  3VH5 W;  3FDD A;  3AYW D;  5FUG B;  2RIQ A;  4Z2M G;  3W97 B;  1N1J B;  5GT0 A;  3MVD B;  3P5J B;  3MGS C;  4XZQ B;  2NZD B;  4HGA C;  1AOI C;  3MGR D;  3WTP A;  3EPH A;  1P3K D;  3O62 D;  5AV6 C;  3W98 A;  5B31 D;  3C1B C;  3AV1 D;  2CV5 A;  3UTB A;  5B40 B;  3UT9 B;  3R45 A;  5B31 G;  2FJ7 B;  4X23 D;  5KDM A;  3KUY A;  4H9Q B;  1TZY A;  5FUG A;  5B0Z B;  2HIO B;  4Z66 D;  1U35 D;  1P3I B;  2Y2G A;  1N1J A;  2Y2N A;  3W97 A;  3TU4 D;  5CPK D;  2CWE A;  5B32 B;  5B1M B;  3EG5 B;  2Y2O A;  4XUJ B;  3MVD A;  3UTA C;  4XZQ A;  4WU8 D;  3MGQ B;  3REJ C;  1M18 C;  2NZD A;  2Y2H A;  3C1C C;  4KGC B;  3B6G D;  1HQ3 C;  3X1V B;  5B40 A;  3UT9 A;  3AZH D;  1BH8 B;  3AZG B;  5AV5 C;  4Z5T D;  5CPJ D;  4J8W D;  1ULY A;  5C3I C;  3REI B;  5B0Z A;  2HIO A;  1P3I A;  5BS7 C;  1ID3 D;  5B32 A;  5B1M A;  5JRG C;  4XUJ A;  4J8X B;  1M19 D;  3MGQ A;  5E5A B;  3WTP C;  3B0D B;  2ZY3 A;  5DNN D;  3KXB D;  3KWQ D;  5DNM B;  1S32 B;  4KUD D;  3W96 D;  3MGP B;  2JSS A;  2JE5 A;  2Y2L A;  4YM6 C;  5GT3 C;  3X1V C;  3AFA D;  3UTB C;  2CV5 C;  1ZLA C;  3B6F C;  3LZ0 D;  4EO5 C;  3A1K A;  1BH8 A;  3AZG A;  1KX4 D;  3KUY C;  1Z2C B;  4G91 B;  4E44 A;  5B2I C;  1TZY C;  4R8P C;  1BH9 B;  3W97 C;  1P3O C;  5AY8 C;  3MGS B;  1AOI B;  3MVD C;  4DQY B;  4J8X A;  2NZD C;  4JJN D;  4LD9 D;  5E5A A;  5AV6 B;  1P34 D;  1P3M D;  5DNM A;  3C1B B;  1S32 A;  1P3B D;  3MGP A;  1KX3 D;  3REL D;  3WAA B;  3REH D;  3AL0 C;  4AWL C;  3X1S C;  3X1T B;  5CPI C;  4J8V D;  5AV8 D;  3AZK C;  5BNX B;  1P3G D;  1P3F A;  5B24 B;  3B6F B;  5B0Z C;  3LEL C;  1BH9 A;  1M1A D;  3UTA B;  3MGS A;  5B32 C;  3REJ B;  1AOI A;  4XUJ C;  3H0R C;  3MGQ C;  1ZLA B;  3AZM C;  5AVC D;  3AZN B;  5F99 D;  3B0C T;  5GXQ B;  4QLC A;  2BYM B;  5AV6 A;  3AZJ D;  3B0B A;  3C1C B;  3WKJ D;  2FJ7 D;  1HQ3 B;  4KHA B;  3WAA A;  4CSR B;  5CP6 B;  5B31 A;  1H3O B;  2J8P A;  3X1T A;  2F8N D;  5BNX A;  3AZF D;  3MNN D;  5C3I B;  3LJA B;  1B67 A;  2LY8 A;  2F2A C;  2RVQ D;  5B24 A;  1P3P C;  2F8N G;  5JRG B;  2Y2M A;  3UTA A;  4NE3 A;  3W99 C;  3REJ A;  5CPK A;  1P3A C;  3H0M C;  5E5A C;  3AZN A;  3WA9 D;  5GXQ A;  5B1L D;  2BYM A;  2JCH A;  3C1C A;  3AZL A;  3AV2 C;  4YM6 B;  3MGP C;  5GT3 B;  5AVB D;  3EPK A; 
#chains in the Genus database with same CATH homology
 4KHA A;  4CSR A;  5CP6 A;  3REK D;  1H3O A;  4EO5 B;  4WU9 B;  5B2I B;  3LZ1 B;  3X1U C;  4G91 C;  1TZY B;  4R8P B;  1P3F C;  1P3O B;  5AY8 B;  3LJA A;  3A6N D;  3AZI B;  2ARO B;  5BS7 A;  3AYW C;  5JRG A;  2F8N K;  5B33 B;  1ID3 A;  4H9N B;  4QLC C;  4YM6 A;  3X1V A;  5GT3 A;  3LZ1 A;  1KX5 D;  3B6F A;  4AWL B;  3WAA C;  3X1S B;  1ZLA A;  5B31 C;  5CPI B;  4H9S C;  2YFV B;  3AV1 C;  3X1T C;  3AZK B;  4NE5 A;  4WU9 A;  5AV9 A;  5B2I A;  5GSU B;  4R8P A;  3LEL B;  4X23 C;  5B24 C;  1P3O A;  5AY8 A;  3AZE D;  3AN2 D;  3AZI A;  3KFU G;  2ARO A;  3F6T A;  3AZM B;  5CPK C;  1EQZ D;  3C1B D;  5B33 A;  2XD1 A;  3AZN C;  5GXQ C;  4H9N A;  3AZL C;  3V9R B;  3X1S A;  1HTA A;  5CP6 C;  5CPI A;  4ZUX D;  2XD5 A;  2YFV A;  4YS3 D;  3B6G C;  1WWS A;  3AZK A;  5B2J D;  2PYO D;  1P3L D;  5GSU A;  1M18 D;  1P3P B;  3VH6 T;  3LEL A;  4Z5T C;  4WNN B;  3LJA C;  5CPJ C;  4J8U D;  1P3G A;  3W99 B;  3UTB B;  1P3A B;  5CHL B;  3AZM A;  5BT1 D;  1ID3 C;  1HQ3 D;  3AV2 B;  3V9R A;  5DNN C;  3LZ1 C;  3KWQ C;  4KUD C;  5AV5 D;  3NQJ B;  2NQB B;  3AFA C;  5B0Y A;  4WU9 C;  3IP4 C;  3X1U B;  5AV9 C;  5GT0 D;  3LZ0 C;  1P3F B;  1KX4 C;  4ZBJ B;  1P3P A;  1F66 D;  3AYW B;  3WTP D;  4WNN A;  3AZI C;  2ARO C;  3W99 A;  3W98 D;  1BFM A;  1P3A A;  5B33 C;  4QLC B;  4Z2M H;  3MGR B;  3UTB D;  2CV5 D;  4JJN C;  1P3K B;  2Y2K A;  3O62 B;  3AV2 A;  1P34 C;  3WA9 A;  1P3M C;  5B31 B;  1P3B C;  3AV1 B;  3KUY D;  3NQJ A;  1KX3 C;  2NQB A;  3REL C;  3REH C;  1TZY D;  4J8V C;  3W97 D;  3X1U A;  5AV8 C;  5GSU C;  4X23 B;  3MVD D;  4XZQ D;  2NZD D;  1P3G C;  3AYW A;  3VH6 A;  4Z66 B;  1U35 B;  3TU4 B;  5CPK B;  1M1A C;  4WU8 B;  3MGR A;  3AZL B;  1P3K A;  5F99 C;  5B40 D;  3O62 A;  3UT9 D;  3AZJ C;  2L5A A;  4H9S A;  2IO5 B;  3AV1 A;  3B6G B;  5B0Y C;  5B0Z D;  2HIO D;  3AZH B;  1P3I D;  5B32 D;  5B1M D;  4XUJ D;  4Z5T B;  4X23 A;  5CPJ B;  3MGQ D;  3MNN C;  2YFW A;  4Z66 A;  1U35 A;  2G5I C;  2RVQ C;  3TU4 A;  1ID3 B;  1PZR A;  1M19 B;  3VH5 T;  4WU8 A;  4KGC D;  4H9O A;  5DNN B;  3KXB B;  3KWQ B;  3WA9 C;  4KUD B;  4DRB A;  3W96 B;  2ZY5 A;  3AZG D;  5AVB C;  3AFA B;  2NQB C;  3B6G A;  5BO0 A;  5AV9 B;  3REK C;  3REI D;  3LZ0 B;  3B0C W;  3AZH A;  2ZM5 A;  1KX4 B;  1JFI B;  1TAF A;  2DF4 C;  4J8X D;  4Z5T A;  5CPJ A;  4ZBJ C;  5JA4 B;  4J8W A;  2PYO A;  5E5A D;  4CAY B;  2ZY4 A;  5DNM D;  3A6N C;  3EPJ A;  1S32 D;  3MGP D;  1M19 A;  4UPK A;  4JJN B;  3MGR C;  4LD9 B;  1P34 B;  1P3K C;  1P3M B;  3O62 C;  5DNN A;  3KXB A;  3KWQ A;  1P3B B;  4KUD A;  3W96 A;  1KX3 B;  3REL B;  1KX5 C;  3AFA A;  3REH B;  1P3F D;  4J8V B;  1KU5 A;  2ZY2 A;  5AV8 B;  3LZ0 A;  3MGS D;  1AOI D;  1KX4 A;  1P3G B;  1JFI A;  4UUZ B;  5JA4 A;  2BYK B;  5AV6 D;  4CAY A;  4QLC D;  2Y2I A;  4Z66 C;  1U35 C;  1M1A B;  3TU4 C;  1F66 A;  3AZE C;  3AN2 C;  1Q9C A;  4WU8 C;  4JJN A;  3WAA D;  5AVC B;  3VH5 A;  5F99 B;  4LD9 A;  1EQZ C;  3AZJ B;  1P34 A;  3X1T D;  1P3M A;  2W8S A;  1P3B A;  3WKJ B;  1KX3 A;  2IO5 C;  5B0Y B;  3REL A;  3REH A;  1T3U A;  4DRA A;  4J8V A;  5B24 D;  4ZUX C;  1W2E A;  3AZH C;  4YS3 C;  5AV8 A;  3UTA D;  5B2J C;  3REJ D;  2F8N B;  2PYO C;  3AZF B;  4UUZ A;  3MNN B;  4J8W C;  1P3L C;  3AZN D;  2BYK A;  5GXQ D;  3C1C D;  4J8U C;  1M1A A;  3AZL D;  1M19 C;  5G49 B;  4M6B A;  3A1I A;  1F1E A;  2F8N H;  5AVC A;  5CP6 D;  5F99 A;  5BT1 C;  4G92 C;  3AZJ A;  3WA9 B;  5B1L B;  2UWX A;  3KSY A;  3KXB C;  2G5H C;  3W96 C;  3WKJ A;  5AVB B;  2FJ7 A;  4E45 A;  1B6W A;  3REK B;  3LJA D;  5JRG D;  4H9Q A;  2F8N A;  5GT0 C;  2HUE C;  3AZF A;  3MNN A;  1WWI A;  3A6N B;  2FFF B;  1F66 C;  4YM6 D;  3X1V D;  5GT3 D;  4H9P B;  3LZ1 D;  3B6F D;  5G49 A;  1ZLA D;  3W98 C;  4LD9 C;  4KGC A;  5B1L A;  3VH6 W;  4NFT A;  4WU9 D;  4WZS B;  5AV9 D;  5AVB A;  5B2I D;  1KX5 B;  4R8P D;  2BG1 A;  4H9R B;  3REK A;  1P3O D;  5AY8 D;  3AZI D;  2ARO D;  3REI A;  3WTP E;  2YFW B;  4HGA B;  5B33 D;  4XZQ C;  3A6N A;  3AZE B;  3AN2 B;  5BNV B;  4H9P A;  2Y2P A;  4H9O B;  1EQZ B;  3X1S D;  5AVC C;  5CPI D;  3AZK D;  4WJ3 C;  4NE6 A;  3WKJ C;  5B40 C;  3UT9 C;  5BO0 B;  2FJ7 C;  1KX5 A;  5GSU D;  2VQR A;  4ZUX B;  3LEL D;  4YS3 B;  4H9R A;  3NQU B;  5B2J B;  1R4V A;  1TAF B;  2PYO B;  1P3I C;  2HIO C;  4J8W B;  1P3L B;  3AZM D;  1M18 B;  3AZF C;  5B1M C;  5B32 G;  4J8U B;  3AZE A;  3AN2 A;  5BNV A;  4G92 B;  1EQZ A;  3C1B A;  4KGC C;  5B1L C;  5B0Y D;  3H0L C;  2DQN C;  1A7W A;  5AV5 B;  3AZG C;  1P3P D;  4ZUX A;  4YS3 A;  3NQU A;  5B2J A;  3W99 D;  5GT0 B;  3REI C;  1P3A D;  2HUE B;  1P3L A;  1M18 A;  1F66 B;  4J8X C;  3WTP B;  4J8U A;  2Y2J A;  3AV2 D;  3W98 B;  3B0D C;  4WV4 B;  5DNM C;  1S32 C;  2CV5 B;  2NQB D;  3EPL A;  1HQ3 A;  2Y2Q A;  3R45 B;  3X1U D;  5AV5 A;  5KDM B;  3KUY B;  3VH5 W;  3FDD A;  3AYW D;  5FUG B;  2RIQ A;  4Z2M G;  3W97 B;  1N1J B;  5GT0 A;  3MVD B;  3P5J B;  3MGS C;  4XZQ B;  2NZD B;  4HGA C;  1AOI C;  3MGR D;  3WTP A;  3EPH A;  1P3K D;  3O62 D;  5AV6 C;  3W98 A;  5B31 D;  3C1B C;  3AV1 D;  2CV5 A;  3UTB A;  5B40 B;  3UT9 B;  3R45 A;  5B31 G;  2FJ7 B;  4X23 D;  5KDM A;  3KUY A;  4H9Q B;  1TZY A;  5FUG A;  5B0Z B;  2HIO B;  4Z66 D;  1U35 D;  1P3I B;  2Y2G A;  1N1J A;  2Y2N A;  3W97 A;  3TU4 D;  5CPK D;  2CWE A;  5B32 B;  5B1M B;  3EG5 B;  2Y2O A;  4XUJ B;  3MVD A;  3UTA C;  4XZQ A;  4WU8 D;  3MGQ B;  3REJ C;  1M18 C;  2NZD A;  2Y2H A;  3C1C C;  4KGC B;  3B6G D;  1HQ3 C;  3X1V B;  5B40 A;  3UT9 A;  3AZH D;  1BH8 B;  3AZG B;  5AV5 C;  4Z5T D;  5CPJ D;  4J8W D;  1ULY A;  5C3I C;  3REI B;  5B0Z A;  2HIO A;  1P3I A;  5BS7 C;  1ID3 D;  5B32 A;  5B1M A;  5JRG C;  4XUJ A;  4J8X B;  1M19 D;  3MGQ A;  5E5A B;  3WTP C;  3B0D B;  2ZY3 A;  5DNN D;  3KXB D;  3KWQ D;  5DNM B;  1S32 B;  4KUD D;  3W96 D;  3MGP B;  2JSS A;  2JE5 A;  2Y2L A;  4YM6 C;  5GT3 C;  3X1V C;  3AFA D;  3UTB C;  2CV5 C;  1ZLA C;  3B6F C;  3LZ0 D;  4EO5 C;  3A1K A;  1BH8 A;  3AZG A;  1KX4 D;  3KUY C;  1Z2C B;  4G91 B;  4E44 A;  5B2I C;  1TZY C;  4R8P C;  1BH9 B;  3W97 C;  1P3O C;  5AY8 C;  3MGS B;  1AOI B;  3MVD C;  4DQY B;  4J8X A;  2NZD C;  4JJN D;  4LD9 D;  5E5A A;  5AV6 B;  1P34 D;  1P3M D;  5DNM A;  3C1B B;  1S32 A;  1P3B D;  3MGP A;  1KX3 D;  3REL D;  3WAA B;  3REH D;  3AL0 C;  4AWL C;  3X1S C;  3X1T B;  5CPI C;  4J8V D;  5AV8 D;  3AZK C;  5BNX B;  1P3G D;  1P3F A;  5B24 B;  3B6F B;  5B0Z C;  3LEL C;  1BH9 A;  1M1A D;  3UTA B;  3MGS A;  5B32 C;  3REJ B;  1AOI A;  4XUJ C;  3H0R C;  3MGQ C;  1ZLA B;  3AZM C;  5AVC D;  3AZN B;  5F99 D;  3B0C T;  5GXQ B;  4QLC A;  2BYM B;  5AV6 A;  3AZJ D;  3B0B A;  3C1C B;  3WKJ D;  2FJ7 D;  1HQ3 B;  4KHA B;  3WAA A;  4CSR B;  5CP6 B;  5B31 A;  1H3O B;  2J8P A;  3X1T A;  2F8N D;  5BNX A;  3AZF D;  3MNN D;  5C3I B;  3LJA B;  1B67 A;  2LY8 A;  2F2A C;  2RVQ D;  5B24 A;  1P3P C;  2F8N G;  5JRG B;  2Y2M A;  3UTA A;  4NE3 A;  3W99 C;  3REJ A;  5CPK A;  1P3A C;  3H0M C;  5E5A C;  3AZN A;  3WA9 D;  5GXQ A;  5B1L D;  2BYM A;  2JCH A;  3C1C A;  3AZL A;  3AV2 C;  4YM6 B;  3MGP C;  5GT3 B;  5AVB D;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...