3W98C

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98C00
1ID3B 1P3PD 3B6FA 1R4VA 1S32B 4R8PB 4KHAB 3AZGA 1KX4B 3KUYD 1KX5B 3WTPB 4E44A 3KWQC 4J8UB 5KDMB 3AZND 4YS3A 2IO5C 4ZBJC 5B33C 3TU4D 5AVCA 5B31B 5B0ZA 5BNXB 2F8NK 3AZMB 1F66A 5CPJB 2IO5B 3UTBD 5F99B 3WTPD 4JJNA 3MVDB 5B2JD 2BYMB 3LZ0C 1P34D 3R45A 1HQ3C 3C1BC 3AZEB 1U35B 3AFAC 3A6NB 5JRGD 1S32D 3TU4C 2PYOB 1P3FD 3VH5A 3VH6T 1P3MB 4QLCA 4UUZB 3AZIC 1EQZA 3LJAA 5BS7C 4H9OB 3UTAD 5B32C 5AV5A 1P3PA 3W96D 5AVBD 3WAAD 2YFVB 5CP6D 4H9RA 1P3GB 4XUJC 3C1BA 1M18B 5DNMC 3UTAB 4WU8B 3WKJB 3UT9A 4G91C 3A6ND 1M19A 3MNND 5AV8D 1F66D 1U35C 4KGCC 3MGPB 5GXQC 1AOIC 3AN2A 4G91B 1KX3D 2NQBC 2F8NA 5B2IC 4Z66A 5B31G 5GT0B 5B0YD 4AWLC 4X23D 4KGCB 3AZHD 3AZFA 2YFWA 4EO5C 3REKC 4X23C 1P3AC 5DNNC 3LJAC 3RELD 2CV5B 5GSUC 4XUJA 3LJAD 3AFAD 5C3IC 1KX3A 1P3FC 1KX3C 4H9QA 1P3OB 1TZYD 5B31A 1P3LC 3AZKA 5CPJA 1KX4D 3V9RA 5B2JC 4J8XB 3REJD 4WZSB 5G49B 5GT3C 5CP6B 4H9NA 3MGSC 3AFAA 5B33D 5B1MD 3NQUB 3AZHB 2NZDC 5GT3B 5CP6C 3AZMD 4KUDB 3AZGD 4QLCB 4YS3C 5E5AC 1P3IB 5BO0B 4YS3D 3AZNA 3AN2D 2FJ7A 1AOIB 5B32D 4Z66D 3W96C 4KGCD 4LD9D 5GT0C 3AZKC 5FUGA 1P3MD 4WNNA 5CPKD 1KX5C 4KHAA 3AZGB 3W99B 1S32C 4ZBJB 5DNMD 5AV9A 4AWLB 3X1VA 3W97C 3W98C 1H3OB 5AV9C 4J8UC 5B31C 4WU8A 3WKJA 5AVBB 3MNNA 3REHB 1Q9CA 1ID3C 3UTAC 3AZIA 4KUDD 1ULYA 3X1SA 1P3BC 3MGQC 3O62C 2JSSA 3C1CD 1HQ3A 4NFTA 3AV2A 2FJ7C 4XZQD 3KXBD 3REKA 1P3AA 3W96A 3AZHC 1P3KB 1KX5A 3AZNC 3AZJD 4H9SC 5DNMB 3AZLD 4YS3B 5AY8C 3AYWB 4WU9A 5BT1C 3AV2D 5BNVB 5B32B 4XZQA 3KXBA 5GXQD 3LELA 3MGRC 5C3IB 1B6WA 4DRBA 5AV8A 5CPIC 3WA9A 5B24C 3MGRA 5CPJD 5AV6B 2AROA 3REJA 3AZJB 3X1TC 5F99D 3KWQB 3LELD 1ZLAB 5AV5D 3AZED 1JFIA 3AZGC 5DNNB 3NQUA 3AZHA 3WAAA 3B0BA 5BNXA 2PYOD 1BH8A 3VH6W 2NQBB 4Z66C 5E5AD 3LZ0B 5B2IB 4H9OA 1TAFB 5GXQB 3B6GB 5F99C 5B33B 3AZEA 3MGQB 1S32A 3B6FB 3X1UC 2AROC 5B24A 5B1MC 4WU9C 3KUYB 4UUZA 1EQZB 3MGPC 5E5AB 5AVCD 3VH5W 3MGQD 5AVBA 3MNNB 1P3IC 4LD9C 1F66B 3UTBA 5B40D 1P3MC 3RELA 5G49A 5CP6A 4XUJD 2FJ7D 4J8VA 5B2JB 2F8NH 3REKD 5CPIB 1P3AD 1ZLAD 2HIOB 4CAYA 4Z2MG 5AVCB 5DNND 3REIA 1M19B 3B6FD 5JRGB 2PYOA 5BS7A 5B40A 1EQZD 5GSUA 3LZ1B 2CV5D 1KU5A 3NQJB 4ZUXA 3MGSB 4YM6D 5B1LB 1P3BB 2HIOD 1BFMA 1U35A 3AV1D 5B24D 3X1UB 3WA9C 4J8XD 3REJB 3AZLB 3WTPA 2CV5A 3MVDD 4HGAC 1P34B 4CSRA 3X1TA 4Z5TB 3AZJC 2CV5C 1H3OA 4YM6A 1M18A 2NZDA 5BT1D 4LD9A 3WAAB 5CPKA 3AZKB 1TZYC 3B0DB 4JJNB 4J8VD 3R45B 2F8ND 3KWQD 2BYMA 1M18D 5B33A 5B0YA 4WU8D 3WKJD 1BH9A 4WV4B 5GT3A 4R8PA 2BYKB 5JRGC 2AROD 3C1CA 3MGPD 4J8UD 2CWEA 1P3KC 2F8NB 1M1AB 1P3PB 1U35D 1ID3A 3AZFB 5CPKC 2F8NG 3AZKD 1KX5D 3V9RB 2AROB 4G92C 1A7WA 3AYWC 5JA4B 2RVQC 3AN2C 4X23A 5B1MB 4R8PC 4NE5A 1P3FB 3O62B 3X1SD 4NE3A 1P3ID 4JJND 5F99A 3WTPE 3LJAB 2FJ7B 3B6GC 3AN2B 5AY8A 3AV2B 3W97B 4Z66B 3W98B 1TZYB 3A6NA 3MGQA 1M19D 5CPJC 3WTPC 5GT3D 5FUGB 1M19C 3REHC 1KX4A 3AV1A 5AV6D 3LZ1D 5CPID 3AZJA 1M18C 4J8UA 1P3LA 4J8WB 3AZLA 4M6BA 3LZ1C 1P3GA 4QLCC 3UTAA 3AZLC 3TU4A 4G92B 5DNNA 3UTBC 4LD9B 3AZFD 2YFVA 3X1SB 3AZIB 3AZFC 5CPKB 4J8VC 3RELB 1HQ3D 4J8WD 5KDMA 1P3GD 3LZ0D 5AV6C 3AFAB 3B6GA 3X1VB 5CPIA 5GT0A 3UT9D 2YFWB 5B0ZB 3LELC 4H9PB 1BH8B 3KSYA 3MGPA 5DNMA 5AV9D 1KX3B 3MGSA 5GXQA 5GT0D 3VH5T 5AVBC 3WA9B 3UT9C 2HUEC 3B0CT 3W99A 4HGAB 3AYWD 2LY8A 5BNVA 5B32A 3KWQA 4Z5TA 3UT9B 5AV5B 3REIC 5JRGA 4Z5TC 1P3FA 3C1CC 5B40C 4QLCD 3MGRB 4KUDC 4J8XA 3W99D 3MVDA 2NQBD 4XZQC 3KXBC 4ZUXB 5B0YC 1AOID 3X1VD 5AY8B 3W97A 1B67A 5B32G 3X1VC 3AV1C 3W98A 5B0ZD 3REHD 3RELC 3WA9D 3A6NC 5B0ZC 1N1JA 1P3AB 1F66C 5GSUD 5AV8C 1HTAA 2NQBA 4ZUXD 1P3OC 1AOIA 4JJNC 4YM6C 1TAFA 3LELB 2NZDB 5B1LA 1P3OA 2HIOC 3KUYC 4WNNB 1P3PC 3UTBB 3MVDC 3B6FC 1WWIA 4J8XC 4J8WC 3C1BB 3X1TD 3AZEC 5CHLB 3AZMC 5JA4A 4ZUXC 2HUEB 1P3OD 2NZDD 4H9QB 5AV5C 3REIB 3AZMA 3AZID 4KUDA 3MGRD 4H9PA 1P3KD 1WWSA 3C1CB 5GSUB 3LZ1A 1HQ3B 1P3LD 4WU9B 4H9NB 3REJC 4DRAA 1KX4C 4XZQB 3KXBB 3C1BD 3MGSD 1P34C 2HIOA 4CAYB 1P3BA 3B0CW 1P3GC 1M1AD 1TZYA 4KGCA 1F1EA 3W99C 3W96B 1P3MA 2BYKA 4WU8C 3WKJC 3KUYA 5B24B 3X1UD 3REKB 5AV9B 1P3IA 4XUJB 1ZLAC 5E5AA 4J8WA 4WU9D 3AYWA 3NQJA 4CSRB 3X1TB 5B1LC 1ZLAA 4Z5TD 5B1LD 4YM6B 1P3BD 5B1MA 1M1AA 3REID 4Z2MH 3VH6A 4NE6A 5AVCC 1ID3D 2L5AA 5AV8B 3O62D 1M1AC 5AV6A 3X1UA 4H9RB 5B2ID 5B2JA 4J8VB 1P34A 4H9SA 1JFIB 3W97D 3W98D 3MNNC 1BH9B 5B0YB 4X23B 5B31D 3REHA 4R8PD 3O62A 2RVQD 3AV1B 4E45A 1P3KA 3X1SC 1N1JB 5B40B 1P3LB 3WAAC 5BO0A 3AZNB 5B2IA 3AV2C 1EQZC 3LZ0A 5AY8D 3B6GD 3B0DC 3TU4B 2PYOC 4EO5B
chains in the Genus database with same CATH superfamily
1ID3B 1P3PD 3B6FA 1R4VA 1S32B 4R8PB 4KHAB 3AZGA 1KX4B 3KUYD 1KX5B 2J8PA 3WTPB 4E44A 2Y2OA 3KWQC 4J8UB 5KDMB 3AZND 4YS3A 2IO5C 4ZBJC 5B33C 3TU4D 5AVCA 5B31B 5B0ZA 5BNXB 2F8NK 3AZMB 1F66A 5CPJB 2IO5B 3UTBD 2ZY5A 5F99B 3WTPD 4JJNA 2Y2JA 3MVDB 5B2JD 2BYMB 3LZ0C 1P34D 3R45A 1HQ3C 3EG5B 3EPKA 3C1BC 3AZEB 1U35B 3AFAC 3A6NB 5JRGD 1S32D 3TU4C 2PYOB 1P3FD 3VH5A 3VH6T 1P3MB 4QLCA 4UUZB 3AZIC 1EQZA 3LJAA 5BS7C 4H9OB 3UTAD 5B32C 5AV5A 1P3PA 3W96D 5AVBD 3FDDA 3WAAD 2YFVB 2G5IC 5CP6D 4H9RA 1P3GB 4XUJC 3C1BA 1M18B 5DNMC 3UTAB 4WU8B 3WKJB 3UT9A 4G91C 3A6ND 1M19A 3MNND 2VQRA 5AV8D 1F66D 1U35C 4KGCC 3MGPB 5GXQC 1AOIC 3AN2A 4G91B 1KX3D 2NQBC 2F8NA 5B2IC 2W8SA 4Z66A 5B31G 5GT0B 5B0YD 4AWLC 4X23D 4KGCB 3AZHD 3AZFA 2YFWA 4EO5C 3REKC 4X23C 1P3AC 5DNNC 3LJAC 3RELD 2CV5B 4DQYB 5GSUC 4XUJA 3LJAD 3AFAD 5C3IC 1KX3A 1P3FC 1KX3C 4H9QA 1P3OB 1TZYD 5B31A 1P3LC 3AZKA 5CPJA 1KX4D 3V9RA 5B2JC 4J8XB 3REJD 4WZSB 5G49B 5GT3C 5CP6B 4H9NA 3MGSC 3AFAA 5B33D 5B1MD 3NQUB 3AZHB 2NZDC 5GT3B 5CP6C 3AZMD 4KUDB 3AZGD 4QLCB 4YS3C 5E5AC 1P3IB 2Y2IA 5BO0B 4YS3D 3AZNA 3AN2D 2FJ7A 2Y2PA 1AOIB 3KFUG 5B32D 4Z66D 3W96C 2Y2LA 4KGCD 4LD9D 5GT0C 3AZKC 5FUGA 1P3MD 4WNNA 5CPKD 1KX5C 4KHAA 3AZGB 4UPKA 3W99B 1S32C 4ZBJB 5DNMD 5AV9A 4AWLB 3X1VA 3W97C 3W98C 1H3OB 5AV9C 4J8UC 5B31C 4WU8A 3WKJA 5AVBB 3MNNA 3REHB 1Q9CA 2FFFB 1ID3C 3UTAC 3AZIA 4KUDD 1ULYA 3X1SA 1P3BC 3MGQC 3O62C 2JSSA 3C1CD 1HQ3A 4NFTA 3AV2A 2FJ7C 4XZQD 3KXBD 3REKA 1P3AA 2RIQA 3W96A 2Y2KA 3AZHC 1P3KB 1KX5A 3AZNC 3AZJD 4H9SC 5DNMB 3AZLD 4YS3B 5AY8C 3AYWB 4WU9A 5BT1C 3AV2D 5BNVB 5B32B 4XZQA 3KXBA 5GXQD 3LELA 3MGRC 5C3IB 1B6WA 3H0LC 4DRBA 5CPIC 5AV8A 3WA9A 3F6TA 5B24C 5CPJD 5AV6B 3MGRA 2AROA 3REJA 3AZJB 3X1TC 5F99D 3KWQB 3LELD 1ZLAB 5AV5D 3AZED 1JFIA 2DQNC 3AZGC 5DNNB 3NQUA 3AZHA 3WAAA 3B0BA 5BNXA 2PYOD 1BH8A 2ZY3A 3VH6W 2NQBB 4Z66C 5E5AD 3LZ0B 5B2IB 4H9OA 1TAFB 5GXQB 3B6GB 5F99C 5B33B 3AZEA 3MGQB 1S32A 3B6FB 3X1UC 2AROC 5B24A 5B1MC 4WU9C 3KUYB 4UUZA 1EQZB 3MGPC 5E5AB 2G5HC 2Y2MA 5AVCD 3VH5W 3MGQD 5AVBA 3MNNB 1P3IC 4LD9C 1F66B 3UTBA 5B40D 1P3MC 3RELA 5G49A 5CP6A 4XUJD 2FJ7D 4J8VA 5B2JB 2F8NH 3REKD 5CPIB 1P3AD 1ZLAD 2HIOB 4CAYA 4Z2MG 5AVCB 5DNND 3REIA 1M19B 3B6FD 5JRGB 2PYOA 5BS7A 5B40A 1EQZD 4WJ3C 5GSUA 3LZ1B 2CV5D 1KU5A 3NQJB 4ZUXA 3MGSB 3EPLA 4YM6D 5B1LB 3P5JB 2HIOD 1P3BB 1BFMA 1U35A 3AV1D 5B24D 3X1UB 3WA9C 4J8XD 3REJB 3AZLB 3WTPA 2CV5A 3MVDD 2ZY2A 4HGAC 1P34B 4CSRA 3X1TA 4Z5TB 3AZJC 2CV5C 1H3OA 4YM6A 1M18A 2NZDA 5BT1D 4LD9A 3WAAB 5CPKA 3AZKB 1TZYC 3B0DB 1T3UA 2F2AC 2BG1A 4JJNB 4J8VD 3R45B 2F8ND 3KWQD 2BYMA 1M18D 5B33A 5B0YA 4WU8D 3WKJD 1BH9A 4WV4B 5GT3A 4R8PA 2BYKB 5JRGC 2AROD 3C1CA 3MGPD 4J8UD 2CWEA 1P3KC 2Y2NA 2F8NB 1M1AB 1P3PB 1U35D 1ID3A 3AZFB 5CPKC 2F8NG 3AZKD 2ZY4A 1KX5D 3V9RB 2AROB 4G92C 1A7WA 3AYWC 5JA4B 2RVQC 3AN2C 4X23A 5B1MB 4R8PC 4NE5A 1P3FB 3O62B 3X1SD 4NE3A 1P3ID 4JJND 5F99A 3WTPE 3LJAB 2FJ7B 3B6GC 3AN2B 5AY8A 3AV2B 3W97B 4Z66B 2UWXA 3W98B 1TZYB 3A6NA 3MGQA 1M19D 5CPJC 3WTPC 5GT3D 5FUGB 1M19C 3REHC 1KX4A 3AV1A 5AV6D 3LZ1D 5CPID 3AZJA 1M18C 4J8UA 2ZM5A 4J8WB 3AZLA 1P3LA 4M6BA 3LZ1C 1P3GA 4QLCC 3UTAA 3AZLC 3TU4A 4G92B 5DNNA 2DF4C 3UTBC 2Y2GA 4LD9B 3AZFD 2YFVA 1Z2CB 3X1SB 3AZIB 3AZFC 5CPKB 4J8VC 3RELB 1HQ3D 4J8WD 5KDMA 1P3GD 3LZ0D 5AV6C 3AFAB 3B6GA 3X1VB 5CPIA 3EPJA 5GT0A 3AL0C 3UT9D 2YFWB 5B0ZB 3LELC 4H9PB 1BH8B 3KSYA 3MGPA 5DNMA 5AV9D 1KX3B 3MGSA 5GXQA 5GT0D 3VH5T 5AVBC 3WA9B 3UT9C 3A1KA 2HUEC 3B0CT 3W99A 4HGAB 3AYWD 2LY8A 5BNVA 5B32A 3KWQA 2Y2QA 4Z5TA 3UT9B 5AV5B 3REIC 5JRGA 4Z5TC 1P3FA 3C1CC 5B40C 4QLCD 3MGRB 4KUDC 4J8XA 3W99D 3MVDA 2NQBD 4XZQC 3KXBC 4ZUXB 5B0YC 1AOID 3X1VD 5AY8B 3W97A 1B67A 5B32G 3X1VC 3AV1C 3W98A 5B0ZD 3REHD 3RELC 3WA9D 3A6NC 5B0ZC 1N1JA 1W2EA 1P3AB 1F66C 5GSUD 5AV8C 1HTAA 2NQBA 4ZUXD 1P3OC 1AOIA 4JJNC 4YM6C 1TAFA 3LELB 2NZDB 5B1LA 1P3OA 2HIOC 1PZRA 3KUYC 4WNNB 3IP4C 1P3PC 3UTBB 3MVDC 3B6FC 1WWIA 4J8XC 4J8WC 3C1BB 3X1TD 3AZEC 5CHLB 3AZMC 2JCHA 5JA4A 4ZUXC 2HUEB 1P3OD 2NZDD 4H9QB 5AV5C 3REIB 3AZMA 2XD5A 3AZID 4KUDA 3MGRD 4H9PA 1P3KD 1WWSA 3C1CB 5GSUB 3LZ1A 1HQ3B 1P3LD 4WU9B 4H9NB 3REJC 4DRAA 1KX4C 4XZQB 3KXBB 3C1BD 3MGSD 3H0MC 1P34C 2HIOA 4CAYB 1P3BA 3B0CW 1P3GC 1M1AD 1TZYA 4KGCA 1F1EA 3W99C 3W96B 1P3MA 2BYKA 4WU8C 3WKJC 3KUYA 5B24B 3X1UD 3REKB 5AV9B 1P3IA 4XUJB 3A1IA 5E5AA 4J8WA 1ZLAC 4WU9D 3AYWA 3NQJA 4CSRB 3X1TB 5B1LC 1ZLAA 4Z5TD 5B1LD 4YM6B 1P3BD 5B1MA 1M1AA 3H0RC 4Z2MH 3VH6A 4NE6A 5AVCC 3REID 1ID3D 2L5AA 5AV8B 3O62D 1M1AC 5AV6A 2JE5A 3EPHA 3X1UA 4H9RB 2XD1A 5B2ID 5B2JA 4J8VB 1P34A 4H9SA 1JFIB 3W97D 3W98D 3MNNC 1BH9B 5B0YB 4X23B 5B31D 3REHA 4R8PD 3O62A 2RVQD 3AV1B 4E45A 1P3KA 3X1SC 1N1JB 5B40B 1P3LB 3WAAC 5BO0A 3AZNB 5B2IA 3AV2C 1EQZC 3LZ0A 5AY8D 3B6GD 3B0DC 3TU4B 2PYOC 2Y2HA 4EO5B
chains in the Genus database with same CATH topology
1ID3B 1P3PD 3B6FA 1R4VA 1S32B 4R8PB 4KHAB 3AZGA 1KX4B 3KUYD 1KX5B 2J8PA 3WTPB 4E44A 2Y2OA 3KWQC 4J8UB 5KDMB 3AZND 4YS3A 2IO5C 4ZBJC 5B33C 3TU4D 5AVCA 5B31B 5B0ZA 5BNXB 2F8NK 3AZMB 1F66A 5CPJB 2IO5B 3UTBD 2ZY5A 5F99B 3WTPD 4JJNA 2Y2JA 3MVDB 5B2JD 2BYMB 3LZ0C 1P34D 3R45A 1HQ3C 3EG5B 3EPKA 3C1BC 3AZEB 1U35B 3AFAC 3A6NB 5JRGD 1S32D 3TU4C 2PYOB 1P3FD 3VH5A 3VH6T 1P3MB 4QLCA 4UUZB 3AZIC 1EQZA 3LJAA 5BS7C 4H9OB 3UTAD 5B32C 5AV5A 1P3PA 3W96D 5AVBD 3FDDA 3WAAD 2YFVB 2G5IC 5CP6D 4H9RA 1P3GB 4XUJC 3C1BA 1M18B 5DNMC 3UTAB 4WU8B 3WKJB 3UT9A 4G91C 3A6ND 1M19A 3MNND 2VQRA 5AV8D 1F66D 1U35C 4KGCC 3MGPB 5GXQC 1AOIC 3AN2A 4G91B 1KX3D 2NQBC 2F8NA 5B2IC 2W8SA 4Z66A 5B31G 5GT0B 5B0YD 4AWLC 4X23D 4KGCB 3AZHD 3AZFA 2YFWA 4EO5C 3REKC 4X23C 1P3AC 5DNNC 3LJAC 3RELD 2CV5B 4DQYB 5GSUC 4XUJA 3LJAD 3AFAD 5C3IC 1KX3A 1P3FC 1KX3C 4H9QA 1P3OB 1TZYD 5B31A 1P3LC 3AZKA 5CPJA 1KX4D 3V9RA 5B2JC 4J8XB 3REJD 4WZSB 5G49B 5GT3C 5CP6B 4H9NA 3MGSC 3AFAA 5B33D 5B1MD 3NQUB 3AZHB 2NZDC 5GT3B 5CP6C 3AZMD 4KUDB 3AZGD 4QLCB 4YS3C 5E5AC 1P3IB 2Y2IA 5BO0B 4YS3D 3AZNA 3AN2D 2FJ7A 2Y2PA 1AOIB 3KFUG 5B32D 4Z66D 3W96C 2Y2LA 4KGCD 4LD9D 5GT0C 3AZKC 5FUGA 1P3MD 4WNNA 5CPKD 1KX5C 4KHAA 3AZGB 4UPKA 3W99B 1S32C 4ZBJB 5DNMD 5AV9A 4AWLB 3X1VA 3W97C 3W98C 1H3OB 5AV9C 4J8UC 5B31C 4WU8A 3WKJA 5AVBB 3MNNA 3REHB 1Q9CA 2FFFB 1ID3C 3UTAC 3AZIA 4KUDD 1ULYA 3X1SA 1P3BC 3MGQC 3O62C 2JSSA 3C1CD 1HQ3A 4NFTA 3AV2A 2FJ7C 4XZQD 3KXBD 3REKA 1P3AA 2RIQA 3W96A 2Y2KA 3AZHC 1P3KB 1KX5A 3AZNC 3AZJD 4H9SC 5DNMB 3AZLD 4YS3B 5AY8C 3AYWB 4WU9A 5BT1C 3AV2D 5BNVB 5B32B 4XZQA 3KXBA 5GXQD 3LELA 3MGRC 5C3IB 1B6WA 3H0LC 4DRBA 5CPIC 5AV8A 3WA9A 3F6TA 5B24C 5CPJD 5AV6B 3MGRA 2AROA 3REJA 3AZJB 3X1TC 5F99D 3KWQB 3LELD 1ZLAB 5AV5D 3AZED 1JFIA 2DQNC 3AZGC 5DNNB 3NQUA 3AZHA 3WAAA 3B0BA 5BNXA 2PYOD 1BH8A 2ZY3A 3VH6W 2NQBB 4Z66C 5E5AD 3LZ0B 5B2IB 4H9OA 1TAFB 5GXQB 3B6GB 5F99C 5B33B 3AZEA 3MGQB 1S32A 3B6FB 3X1UC 2AROC 5B24A 5B1MC 4WU9C 3KUYB 4UUZA 1EQZB 3MGPC 5E5AB 2G5HC 2Y2MA 5AVCD 3VH5W 3MGQD 5AVBA 3MNNB 1P3IC 4LD9C 1F66B 3UTBA 5B40D 1P3MC 3RELA 5G49A 5CP6A 4XUJD 2FJ7D 4J8VA 5B2JB 2F8NH 3REKD 5CPIB 1P3AD 1ZLAD 2HIOB 4CAYA 4Z2MG 5AVCB 5DNND 3REIA 1M19B 3B6FD 5JRGB 2PYOA 5BS7A 5B40A 1EQZD 4WJ3C 5GSUA 3LZ1B 2CV5D 1KU5A 3NQJB 4ZUXA 3MGSB 3EPLA 4YM6D 5B1LB 3P5JB 2HIOD 1P3BB 1BFMA 1U35A 3AV1D 5B24D 3X1UB 3WA9C 4J8XD 3REJB 3AZLB 3WTPA 2CV5A 3MVDD 2ZY2A 4HGAC 1P34B 4CSRA 3X1TA 4Z5TB 3AZJC 2CV5C 1H3OA 4YM6A 1M18A 2NZDA 5BT1D 4LD9A 3WAAB 5CPKA 3AZKB 1TZYC 3B0DB 1T3UA 2F2AC 2BG1A 4JJNB 4J8VD 3R45B 2F8ND 3KWQD 2BYMA 1M18D 5B33A 5B0YA 4WU8D 3WKJD 1BH9A 4WV4B 5GT3A 4R8PA 2BYKB 5JRGC 2AROD 3C1CA 3MGPD 4J8UD 2CWEA 1P3KC 2Y2NA 2F8NB 1M1AB 1P3PB 1U35D 1ID3A 3AZFB 5CPKC 2F8NG 3AZKD 2ZY4A 1KX5D 3V9RB 2AROB 4G92C 1A7WA 3AYWC 5JA4B 2RVQC 3AN2C 4X23A 5B1MB 4R8PC 4NE5A 1P3FB 3O62B 3X1SD 4NE3A 1P3ID 4JJND 5F99A 3WTPE 3LJAB 2FJ7B 3B6GC 3AN2B 5AY8A 3AV2B 3W97B 4Z66B 2UWXA 3W98B 1TZYB 3A6NA 3MGQA 1M19D 5CPJC 3WTPC 5GT3D 5FUGB 1M19C 3REHC 1KX4A 3AV1A 5AV6D 3LZ1D 5CPID 3AZJA 1M18C 4J8UA 2ZM5A 4J8WB 3AZLA 1P3LA 4M6BA 3LZ1C 1P3GA 4QLCC 3UTAA 3AZLC 3TU4A 4G92B 5DNNA 2DF4C 3UTBC 2Y2GA 4LD9B 3AZFD 2YFVA 1Z2CB 3X1SB 3AZIB 3AZFC 5CPKB 4J8VC 3RELB 1HQ3D 4J8WD 5KDMA 1P3GD 3LZ0D 5AV6C 3AFAB 3B6GA 3X1VB 5CPIA 3EPJA 5GT0A 3AL0C 3UT9D 2YFWB 5B0ZB 3LELC 4H9PB 1BH8B 3KSYA 3MGPA 5DNMA 5AV9D 1KX3B 3MGSA 5GXQA 5GT0D 3VH5T 5AVBC 3WA9B 3UT9C 3A1KA 2HUEC 3B0CT 3W99A 4HGAB 3AYWD 2LY8A 5BNVA 5B32A 3KWQA 2Y2QA 4Z5TA 3UT9B 5AV5B 3REIC 5JRGA 4Z5TC 1P3FA 3C1CC 5B40C 4QLCD 3MGRB 4KUDC 4J8XA 3W99D 3MVDA 2NQBD 4XZQC 3KXBC 4ZUXB 5B0YC 1AOID 3X1VD 5AY8B 3W97A 1B67A 5B32G 3X1VC 3AV1C 3W98A 5B0ZD 3REHD 3RELC 3WA9D 3A6NC 5B0ZC 1N1JA 1W2EA 1P3AB 1F66C 5GSUD 5AV8C 1HTAA 2NQBA 4ZUXD 1P3OC 1AOIA 4JJNC 4YM6C 1TAFA 3LELB 2NZDB 5B1LA 1P3OA 2HIOC 1PZRA 3KUYC 4WNNB 3IP4C 1P3PC 3UTBB 3MVDC 3B6FC 1WWIA 4J8XC 4J8WC 3C1BB 3X1TD 3AZEC 5CHLB 3AZMC 2JCHA 5JA4A 4ZUXC 2HUEB 1P3OD 2NZDD 4H9QB 5AV5C 3REIB 3AZMA 2XD5A 3AZID 4KUDA 3MGRD 4H9PA 1P3KD 1WWSA 3C1CB 5GSUB 3LZ1A 1HQ3B 1P3LD 4WU9B 4H9NB 3REJC 4DRAA 1KX4C 4XZQB 3KXBB 3C1BD 3MGSD 3H0MC 1P34C 2HIOA 4CAYB 1P3BA 3B0CW 1P3GC 1M1AD 1TZYA 4KGCA 1F1EA 3W99C 3W96B 1P3MA 2BYKA 4WU8C 3WKJC 3KUYA 5B24B 3X1UD 3REKB 5AV9B 1P3IA 4XUJB 3A1IA 5E5AA 4J8WA 1ZLAC 4WU9D 3AYWA 3NQJA 4CSRB 3X1TB 5B1LC 1ZLAA 4Z5TD 5B1LD 4YM6B 1P3BD 5B1MA 1M1AA 3H0RC 4Z2MH 3VH6A 4NE6A 5AVCC 3REID 1ID3D 2L5AA 5AV8B 3O62D 1M1AC 5AV6A 2JE5A 3EPHA 3X1UA 4H9RB 2XD1A 5B2ID 5B2JA 4J8VB 1P34A 4H9SA 1JFIB 3W97D 3W98D 3MNNC 1BH9B 5B0YB 4X23B 5B31D 3REHA 4R8PD 3O62A 2RVQD 3AV1B 4E45A 1P3KA 3X1SC 1N1JB 5B40B 1P3LB 3WAAC 5BO0A 3AZNB 5B2IA 3AV2C 1EQZC 3LZ0A 5AY8D 3B6GD 3B0DC 3TU4B 2PYOC 2Y2HA 4EO5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 B;  1P3P D;  3B6F A;  1R4V A;  1S32 B;  4R8P B;  4KHA B;  3AZG A;  1KX4 B;  3KUY D;  1KX5 B;  3WTP B;  4E44 A;  3KWQ C;  4J8U B;  5KDM B;  3AZN D;  4YS3 A;  2IO5 C;  4ZBJ C;  5B33 C;  3TU4 D;  5AVC A;  5B31 B;  5B0Z A;  5BNX B;  2F8N K;  3AZM B;  1F66 A;  5CPJ B;  2IO5 B;  3UTB D;  5F99 B;  3WTP D;  4JJN A;  3MVD B;  5B2J D;  2BYM B;  3LZ0 C;  1P34 D;  3R45 A;  1HQ3 C;  3C1B C;  3AZE B;  1U35 B;  3AFA C;  3A6N B;  5JRG D;  1S32 D;  3TU4 C;  2PYO B;  1P3F D;  3VH5 A;  3VH6 T;  1P3M B;  4QLC A;  4UUZ B;  3AZI C;  1EQZ A;  3LJA A;  5BS7 C;  4H9O B;  3UTA D;  5B32 C;  5AV5 A;  1P3P A;  3W96 D;  5AVB D;  3WAA D;  2YFV B;  5CP6 D;  4H9R A;  1P3G B;  4XUJ C;  3C1B A;  1M18 B;  5DNM C;  3UTA B;  4WU8 B;  3WKJ B;  3UT9 A;  4G91 C;  3A6N D;  1M19 A;  3MNN D;  5AV8 D;  1F66 D;  1U35 C;  4KGC C;  3MGP B;  5GXQ C;  1AOI C;  3AN2 A;  4G91 B;  1KX3 D;  2NQB C;  2F8N A;  5B2I C;  4Z66 A;  5B31 G;  5GT0 B;  5B0Y D;  4AWL C;  4X23 D;  4KGC B;  3AZH D;  3AZF A;  2YFW A;  4EO5 C;  3REK C;  4X23 C;  1P3A C;  5DNN C;  3LJA C;  3REL D;  2CV5 B;  5GSU C;  4XUJ A;  3LJA D;  3AFA D;  5C3I C;  1KX3 A;  1P3F C;  1KX3 C;  4H9Q A;  1P3O B;  1TZY D;  5B31 A;  1P3L C;  3AZK A;  5CPJ A;  1KX4 D;  3V9R A;  5B2J C;  4J8X B;  3REJ D;  4WZS B;  5G49 B;  5GT3 C;  5CP6 B;  4H9N A;  3MGS C;  3AFA A;  5B33 D;  5B1M D;  3NQU B;  3AZH B;  2NZD C;  5GT3 B;  5CP6 C;  3AZM D;  4KUD B;  3AZG D;  4QLC B;  4YS3 C;  5E5A C;  1P3I B;  5BO0 B;  4YS3 D;  3AZN A;  3AN2 D;  2FJ7 A;  1AOI B;  5B32 D;  4Z66 D;  3W96 C;  4KGC D;  4LD9 D;  5GT0 C;  3AZK C;  5FUG A;  1P3M D;  4WNN A;  5CPK D;  1KX5 C;  4KHA A;  3AZG B;  3W99 B;  1S32 C;  4ZBJ B;  5DNM D;  5AV9 A;  4AWL B;  3X1V A;  3W97 C;  3W98 C;  1H3O B;  5AV9 C;  4J8U C;  5B31 C;  4WU8 A;  3WKJ A;  5AVB B;  3MNN A;  3REH B;  1Q9C A;  1ID3 C;  3UTA C;  3AZI A;  4KUD D;  1ULY A;  3X1S A;  1P3B C;  3MGQ C;  3O62 C;  2JSS A;  3C1C D;  1HQ3 A;  4NFT A;  3AV2 A;  2FJ7 C;  4XZQ D;  3KXB D;  3REK A;  1P3A A;  3W96 A;  3AZH C;  1P3K B;  1KX5 A;  3AZN C;  3AZJ D;  4H9S C;  5DNM B;  3AZL D;  4YS3 B;  5AY8 C;  3AYW B;  4WU9 A;  5BT1 C;  3AV2 D;  5BNV B;  5B32 B;  4XZQ A;  3KXB A;  5GXQ D;  3LEL A;  3MGR C;  5C3I B;  1B6W A;  4DRB A;  5AV8 A;  5CPI C;  3WA9 A;  5B24 C;  3MGR A;  5CPJ D;  5AV6 B;  2ARO A;  3REJ A;  3AZJ B;  3X1T C;  5F99 D;  3KWQ B;  3LEL D;  1ZLA B;  5AV5 D;  3AZE D;  1JFI A;  3AZG C;  5DNN B;  3NQU A;  3AZH A;  3WAA A;  3B0B A;  5BNX A;  2PYO D;  1BH8 A;  3VH6 W;  2NQB B;  4Z66 C;  5E5A D;  3LZ0 B;  5B2I B;  4H9O A;  1TAF B;  5GXQ B;  3B6G B;  5F99 C;  5B33 B;  3AZE A;  3MGQ B;  1S32 A;  3B6F B;  3X1U C;  2ARO C;  5B24 A;  5B1M C;  4WU9 C;  3KUY B;  4UUZ A;  1EQZ B;  3MGP C;  5E5A B;  5AVC D;  3VH5 W;  3MGQ D;  5AVB A;  3MNN B;  1P3I C;  4LD9 C;  1F66 B;  3UTB A;  5B40 D;  1P3M C;  3REL A;  5G49 A;  5CP6 A;  4XUJ D;  2FJ7 D;  4J8V A;  5B2J B;  2F8N H;  3REK D;  5CPI B;  1P3A D;  1ZLA D;  2HIO B;  4CAY A;  4Z2M G;  5AVC B;  5DNN D;  3REI A;  1M19 B;  3B6F D;  5JRG B;  2PYO A;  5BS7 A;  5B40 A;  1EQZ D;  5GSU A;  3LZ1 B;  2CV5 D;  1KU5 A;  3NQJ B;  4ZUX A;  3MGS B;  4YM6 D;  5B1L B;  1P3B B;  2HIO D;  1BFM A;  1U35 A;  3AV1 D;  5B24 D;  3X1U B;  3WA9 C;  4J8X D;  3REJ B;  3AZL B;  3WTP A;  2CV5 A;  3MVD D;  4HGA C;  1P34 B;  4CSR A;  3X1T A;  4Z5T B;  3AZJ C;  2CV5 C;  1H3O A;  4YM6 A;  1M18 A;  2NZD A;  5BT1 D;  4LD9 A;  3WAA B;  5CPK A;  3AZK B;  1TZY C;  3B0D B;  4JJN B;  4J8V D;  3R45 B;  2F8N D;  3KWQ D;  2BYM A;  1M18 D;  5B33 A;  5B0Y A;  4WU8 D;  3WKJ D;  1BH9 A;  4WV4 B;  5GT3 A;  4R8P A;  2BYK B;  5JRG C;  2ARO D;  3C1C A;  3MGP D;  4J8U D;  2CWE A;  1P3K C;  2F8N B;  1M1A B;  1P3P B;  1U35 D;  1ID3 A;  3AZF B;  5CPK C;  2F8N G;  3AZK D;  1KX5 D;  3V9R B;  2ARO B;  4G92 C;  1A7W A;  3AYW C;  5JA4 B;  2RVQ C;  3AN2 C;  4X23 A;  5B1M B;  4R8P C;  4NE5 A;  1P3F B;  3O62 B;  3X1S D;  4NE3 A;  1P3I D;  4JJN D;  5F99 A;  3WTP E;  3LJA B;  2FJ7 B;  3B6G C;  3AN2 B;  5AY8 A;  3AV2 B;  3W97 B;  4Z66 B;  3W98 B;  1TZY B;  3A6N A;  3MGQ A;  1M19 D;  5CPJ C;  3WTP C;  5GT3 D;  5FUG B;  1M19 C;  3REH C;  1KX4 A;  3AV1 A;  5AV6 D;  3LZ1 D;  5CPI D;  3AZJ A;  1M18 C;  4J8U A;  1P3L A;  4J8W B;  3AZL A;  4M6B A;  3LZ1 C;  1P3G A;  4QLC C;  3UTA A;  3AZL C;  3TU4 A;  4G92 B;  5DNN A;  3UTB C;  4LD9 B;  3AZF D;  2YFV A;  3X1S B;  3AZI B;  3AZF C;  5CPK B;  4J8V C;  3REL B;  1HQ3 D;  4J8W D;  5KDM A;  1P3G D;  3LZ0 D;  5AV6 C;  3AFA B;  3B6G A;  3X1V B;  5CPI A;  5GT0 A;  3UT9 D;  2YFW B;  5B0Z B;  3LEL C;  4H9P B;  1BH8 B;  3KSY A;  3MGP A;  5DNM A;  5AV9 D;  1KX3 B;  3MGS A;  5GXQ A;  5GT0 D;  3VH5 T;  5AVB C;  3WA9 B;  3UT9 C;  2HUE C;  3B0C T;  3W99 A;  4HGA B;  3AYW D;  2LY8 A;  5BNV A;  5B32 A;  3KWQ A;  4Z5T A;  3UT9 B;  5AV5 B;  3REI C;  5JRG A;  4Z5T C;  1P3F A;  3C1C C;  5B40 C;  4QLC D;  3MGR B;  4KUD C;  4J8X A;  3W99 D;  3MVD A;  2NQB D;  4XZQ C;  3KXB C;  4ZUX B;  5B0Y C;  1AOI D;  3X1V D;  5AY8 B;  3W97 A;  1B67 A;  5B32 G;  3X1V C;  3AV1 C;  3W98 A;  5B0Z D;  3REH D;  3REL C;  3WA9 D;  3A6N C;  5B0Z C;  1N1J A;  1P3A B;  1F66 C;  5GSU D;  5AV8 C;  1HTA A;  2NQB A;  4ZUX D;  1P3O C;  1AOI A;  4JJN C;  4YM6 C;  1TAF A;  3LEL B;  2NZD B;  5B1L A;  1P3O A;  2HIO C;  3KUY C;  4WNN B;  1P3P C;  3UTB B;  3MVD C;  3B6F C;  1WWI A;  4J8X C;  4J8W C;  3C1B B;  3X1T D;  3AZE C;  5CHL B;  3AZM C;  5JA4 A;  4ZUX C;  2HUE B;  1P3O D;  2NZD D;  4H9Q B;  5AV5 C;  3REI B;  3AZM A;  3AZI D;  4KUD A;  3MGR D;  4H9P A;  1P3K D;  1WWS A;  3C1C B;  5GSU B;  3LZ1 A;  1HQ3 B;  1P3L D;  4WU9 B;  4H9N B;  3REJ C;  4DRA A;  1KX4 C;  4XZQ B;  3KXB B;  3C1B D;  3MGS D;  1P34 C;  2HIO A;  4CAY B;  1P3B A;  3B0C W;  1P3G C;  1M1A D;  1TZY A;  4KGC A;  1F1E A;  3W99 C;  3W96 B;  1P3M A;  2BYK A;  4WU8 C;  3WKJ C;  3KUY A;  5B24 B;  3X1U D;  3REK B;  5AV9 B;  1P3I A;  4XUJ B;  1ZLA C;  5E5A A;  4J8W A;  4WU9 D;  3AYW A;  3NQJ A;  4CSR B;  3X1T B;  5B1L C;  1ZLA A;  4Z5T D;  5B1L D;  4YM6 B;  1P3B D;  5B1M A;  1M1A A;  3REI D;  4Z2M H;  3VH6 A;  4NE6 A;  5AVC C;  1ID3 D;  2L5A A;  5AV8 B;  3O62 D;  1M1A C;  5AV6 A;  3X1U A;  4H9R B;  5B2I D;  5B2J A;  4J8V B;  1P34 A;  4H9S A;  1JFI B;  3W97 D;  3W98 D;  3MNN C;  1BH9 B;  5B0Y B;  4X23 B;  5B31 D;  3REH A;  4R8P D;  3O62 A;  2RVQ D;  3AV1 B;  4E45 A;  1P3K A;  3X1S C;  1N1J B;  5B40 B;  1P3L B;  3WAA C;  5BO0 A;  3AZN B;  5B2I A;  3AV2 C;  1EQZ C;  3LZ0 A;  5AY8 D;  3B6G D;  3B0D C;  3TU4 B;  2PYO C;  4EO5 B; 
#chains in the Genus database with same CATH topology
 1ID3 B;  1P3P D;  3B6F A;  1R4V A;  1S32 B;  4R8P B;  4KHA B;  3AZG A;  1KX4 B;  3KUY D;  1KX5 B;  2J8P A;  3WTP B;  4E44 A;  2Y2O A;  3KWQ C;  4J8U B;  5KDM B;  3AZN D;  4YS3 A;  2IO5 C;  4ZBJ C;  5B33 C;  3TU4 D;  5AVC A;  5B31 B;  5B0Z A;  5BNX B;  2F8N K;  3AZM B;  1F66 A;  5CPJ B;  2IO5 B;  3UTB D;  2ZY5 A;  5F99 B;  3WTP D;  4JJN A;  2Y2J A;  3MVD B;  5B2J D;  2BYM B;  3LZ0 C;  1P34 D;  3R45 A;  1HQ3 C;  3EG5 B;  3EPK A;  3C1B C;  3AZE B;  1U35 B;  3AFA C;  3A6N B;  5JRG D;  1S32 D;  3TU4 C;  2PYO B;  1P3F D;  3VH5 A;  3VH6 T;  1P3M B;  4QLC A;  4UUZ B;  3AZI C;  1EQZ A;  3LJA A;  5BS7 C;  4H9O B;  3UTA D;  5B32 C;  5AV5 A;  1P3P A;  3W96 D;  5AVB D;  3FDD A;  3WAA D;  2YFV B;  2G5I C;  5CP6 D;  4H9R A;  1P3G B;  4XUJ C;  3C1B A;  1M18 B;  5DNM C;  3UTA B;  4WU8 B;  3WKJ B;  3UT9 A;  4G91 C;  3A6N D;  1M19 A;  3MNN D;  2VQR A;  5AV8 D;  1F66 D;  1U35 C;  4KGC C;  3MGP B;  5GXQ C;  1AOI C;  3AN2 A;  4G91 B;  1KX3 D;  2NQB C;  2F8N A;  5B2I C;  2W8S A;  4Z66 A;  5B31 G;  5GT0 B;  5B0Y D;  4AWL C;  4X23 D;  4KGC B;  3AZH D;  3AZF A;  2YFW A;  4EO5 C;  3REK C;  4X23 C;  1P3A C;  5DNN C;  3LJA C;  3REL D;  2CV5 B;  4DQY B;  5GSU C;  4XUJ A;  3LJA D;  3AFA D;  5C3I C;  1KX3 A;  1P3F C;  1KX3 C;  4H9Q A;  1P3O B;  1TZY D;  5B31 A;  1P3L C;  3AZK A;  5CPJ A;  1KX4 D;  3V9R A;  5B2J C;  4J8X B;  3REJ D;  4WZS B;  5G49 B;  5GT3 C;  5CP6 B;  4H9N A;  3MGS C;  3AFA A;  5B33 D;  5B1M D;  3NQU B;  3AZH B;  2NZD C;  5GT3 B;  5CP6 C;  3AZM D;  4KUD B;  3AZG D;  4QLC B;  4YS3 C;  5E5A C;  1P3I B;  2Y2I A;  5BO0 B;  4YS3 D;  3AZN A;  3AN2 D;  2FJ7 A;  2Y2P A;  1AOI B;  3KFU G;  5B32 D;  4Z66 D;  3W96 C;  2Y2L A;  4KGC D;  4LD9 D;  5GT0 C;  3AZK C;  5FUG A;  1P3M D;  4WNN A;  5CPK D;  1KX5 C;  4KHA A;  3AZG B;  4UPK A;  3W99 B;  1S32 C;  4ZBJ B;  5DNM D;  5AV9 A;  4AWL B;  3X1V A;  3W97 C;  3W98 C;  1H3O B;  5AV9 C;  4J8U C;  5B31 C;  4WU8 A;  3WKJ A;  5AVB B;  3MNN A;  3REH B;  1Q9C A;  2FFF B;  1ID3 C;  3UTA C;  3AZI A;  4KUD D;  1ULY A;  3X1S A;  1P3B C;  3MGQ C;  3O62 C;  2JSS A;  3C1C D;  1HQ3 A;  4NFT A;  3AV2 A;  2FJ7 C;  4XZQ D;  3KXB D;  3REK A;  1P3A A;  2RIQ A;  3W96 A;  2Y2K A;  3AZH C;  1P3K B;  1KX5 A;  3AZN C;  3AZJ D;  4H9S C;  5DNM B;  3AZL D;  4YS3 B;  5AY8 C;  3AYW B;  4WU9 A;  5BT1 C;  3AV2 D;  5BNV B;  5B32 B;  4XZQ A;  3KXB A;  5GXQ D;  3LEL A;  3MGR C;  5C3I B;  1B6W A;  3H0L C;  4DRB A;  5CPI C;  5AV8 A;  3WA9 A;  3F6T A;  5B24 C;  5CPJ D;  5AV6 B;  3MGR A;  2ARO A;  3REJ A;  3AZJ B;  3X1T C;  5F99 D;  3KWQ B;  3LEL D;  1ZLA B;  5AV5 D;  3AZE D;  1JFI A;  2DQN C;  3AZG C;  5DNN B;  3NQU A;  3AZH A;  3WAA A;  3B0B A;  5BNX A;  2PYO D;  1BH8 A;  2ZY3 A;  3VH6 W;  2NQB B;  4Z66 C;  5E5A D;  3LZ0 B;  5B2I B;  4H9O A;  1TAF B;  5GXQ B;  3B6G B;  5F99 C;  5B33 B;  3AZE A;  3MGQ B;  1S32 A;  3B6F B;  3X1U C;  2ARO C;  5B24 A;  5B1M C;  4WU9 C;  3KUY B;  4UUZ A;  1EQZ B;  3MGP C;  5E5A B;  2G5H C;  2Y2M A;  5AVC D;  3VH5 W;  3MGQ D;  5AVB A;  3MNN B;  1P3I C;  4LD9 C;  1F66 B;  3UTB A;  5B40 D;  1P3M C;  3REL A;  5G49 A;  5CP6 A;  4XUJ D;  2FJ7 D;  4J8V A;  5B2J B;  2F8N H;  3REK D;  5CPI B;  1P3A D;  1ZLA D;  2HIO B;  4CAY A;  4Z2M G;  5AVC B;  5DNN D;  3REI A;  1M19 B;  3B6F D;  5JRG B;  2PYO A;  5BS7 A;  5B40 A;  1EQZ D;  4WJ3 C;  5GSU A;  3LZ1 B;  2CV5 D;  1KU5 A;  3NQJ B;  4ZUX A;  3MGS B;  3EPL A;  4YM6 D;  5B1L B;  3P5J B;  2HIO D;  1P3B B;  1BFM A;  1U35 A;  3AV1 D;  5B24 D;  3X1U B;  3WA9 C;  4J8X D;  3REJ B;  3AZL B;  3WTP A;  2CV5 A;  3MVD D;  2ZY2 A;  4HGA C;  1P34 B;  4CSR A;  3X1T A;  4Z5T B;  3AZJ C;  2CV5 C;  1H3O A;  4YM6 A;  1M18 A;  2NZD A;  5BT1 D;  4LD9 A;  3WAA B;  5CPK A;  3AZK B;  1TZY C;  3B0D B;  1T3U A;  2F2A C;  2BG1 A;  4JJN B;  4J8V D;  3R45 B;  2F8N D;  3KWQ D;  2BYM A;  1M18 D;  5B33 A;  5B0Y A;  4WU8 D;  3WKJ D;  1BH9 A;  4WV4 B;  5GT3 A;  4R8P A;  2BYK B;  5JRG C;  2ARO D;  3C1C A;  3MGP D;  4J8U D;  2CWE A;  1P3K C;  2Y2N A;  2F8N B;  1M1A B;  1P3P B;  1U35 D;  1ID3 A;  3AZF B;  5CPK C;  2F8N G;  3AZK D;  2ZY4 A;  1KX5 D;  3V9R B;  2ARO B;  4G92 C;  1A7W A;  3AYW C;  5JA4 B;  2RVQ C;  3AN2 C;  4X23 A;  5B1M B;  4R8P C;  4NE5 A;  1P3F B;  3O62 B;  3X1S D;  4NE3 A;  1P3I D;  4JJN D;  5F99 A;  3WTP E;  3LJA B;  2FJ7 B;  3B6G C;  3AN2 B;  5AY8 A;  3AV2 B;  3W97 B;  4Z66 B;  2UWX A;  3W98 B;  1TZY B;  3A6N A;  3MGQ A;  1M19 D;  5CPJ C;  3WTP C;  5GT3 D;  5FUG B;  1M19 C;  3REH C;  1KX4 A;  3AV1 A;  5AV6 D;  3LZ1 D;  5CPI D;  3AZJ A;  1M18 C;  4J8U A;  2ZM5 A;  4J8W B;  3AZL A;  1P3L A;  4M6B A;  3LZ1 C;  1P3G A;  4QLC C;  3UTA A;  3AZL C;  3TU4 A;  4G92 B;  5DNN A;  2DF4 C;  3UTB C;  2Y2G A;  4LD9 B;  3AZF D;  2YFV A;  1Z2C B;  3X1S B;  3AZI B;  3AZF C;  5CPK B;  4J8V C;  3REL B;  1HQ3 D;  4J8W D;  5KDM A;  1P3G D;  3LZ0 D;  5AV6 C;  3AFA B;  3B6G A;  3X1V B;  5CPI A;  3EPJ A;  5GT0 A;  3AL0 C;  3UT9 D;  2YFW B;  5B0Z B;  3LEL C;  4H9P B;  1BH8 B;  3KSY A;  3MGP A;  5DNM A;  5AV9 D;  1KX3 B;  3MGS A;  5GXQ A;  5GT0 D;  3VH5 T;  5AVB C;  3WA9 B;  3UT9 C;  3A1K A;  2HUE C;  3B0C T;  3W99 A;  4HGA B;  3AYW D;  2LY8 A;  5BNV A;  5B32 A;  3KWQ A;  2Y2Q A;  4Z5T A;  3UT9 B;  5AV5 B;  3REI C;  5JRG A;  4Z5T C;  1P3F A;  3C1C C;  5B40 C;  4QLC D;  3MGR B;  4KUD C;  4J8X A;  3W99 D;  3MVD A;  2NQB D;  4XZQ C;  3KXB C;  4ZUX B;  5B0Y C;  1AOI D;  3X1V D;  5AY8 B;  3W97 A;  1B67 A;  5B32 G;  3X1V C;  3AV1 C;  3W98 A;  5B0Z D;  3REH D;  3REL C;  3WA9 D;  3A6N C;  5B0Z C;  1N1J A;  1W2E A;  1P3A B;  1F66 C;  5GSU D;  5AV8 C;  1HTA A;  2NQB A;  4ZUX D;  1P3O C;  1AOI A;  4JJN C;  4YM6 C;  1TAF A;  3LEL B;  2NZD B;  5B1L A;  1P3O A;  2HIO C;  1PZR A;  3KUY C;  4WNN B;  3IP4 C;  1P3P C;  3UTB B;  3MVD C;  3B6F C;  1WWI A;  4J8X C;  4J8W C;  3C1B B;  3X1T D;  3AZE C;  5CHL B;  3AZM C;  2JCH A;  5JA4 A;  4ZUX C;  2HUE B;  1P3O D;  2NZD D;  4H9Q B;  5AV5 C;  3REI B;  3AZM A;  2XD5 A;  3AZI D;  4KUD A;  3MGR D;  4H9P A;  1P3K D;  1WWS A;  3C1C B;  5GSU B;  3LZ1 A;  1HQ3 B;  1P3L D;  4WU9 B;  4H9N B;  3REJ C;  4DRA A;  1KX4 C;  4XZQ B;  3KXB B;  3C1B D;  3MGS D;  3H0M C;  1P34 C;  2HIO A;  4CAY B;  1P3B A;  3B0C W;  1P3G C;  1M1A D;  1TZY A;  4KGC A;  1F1E A;  3W99 C;  3W96 B;  1P3M A;  2BYK A;  4WU8 C;  3WKJ C;  3KUY A;  5B24 B;  3X1U D;  3REK B;  5AV9 B;  1P3I A;  4XUJ B;  3A1I A;  5E5A A;  4J8W A;  1ZLA C;  4WU9 D;  3AYW A;  3NQJ A;  4CSR B;  3X1T B;  5B1L C;  1ZLA A;  4Z5T D;  5B1L D;  4YM6 B;  1P3B D;  5B1M A;  1M1A A;  3H0R C;  4Z2M H;  3VH6 A;  4NE6 A;  5AVC C;  3REI D;  1ID3 D;  2L5A A;  5AV8 B;  3O62 D;  1M1A C;  5AV6 A;  2JE5 A;  3EPH A;  3X1U A;  4H9R B;  2XD1 A;  5B2I D;  5B2J A;  4J8V B;  1P34 A;  4H9S A;  1JFI B;  3W97 D;  3W98 D;  3MNN C;  1BH9 B;  5B0Y B;  4X23 B;  5B31 D;  3REH A;  4R8P D;  3O62 A;  2RVQ D;  3AV1 B;  4E45 A;  1P3K A;  3X1S C;  1N1J B;  5B40 B;  1P3L B;  3WAA C;  5BO0 A;  3AZN B;  5B2I A;  3AV2 C;  1EQZ C;  3LZ0 A;  5AY8 D;  3B6G D;  3B0D C;  3TU4 B;  2PYO C;  2Y2H A;  4EO5 B; 
#chains in the Genus database with same CATH homology
 1ID3 B;  1P3P D;  3B6F A;  1R4V A;  1S32 B;  4R8P B;  4KHA B;  3AZG A;  1KX4 B;  3KUY D;  1KX5 B;  2J8P A;  3WTP B;  4E44 A;  2Y2O A;  3KWQ C;  4J8U B;  5KDM B;  3AZN D;  4YS3 A;  2IO5 C;  4ZBJ C;  5B33 C;  3TU4 D;  5AVC A;  5B31 B;  5B0Z A;  5BNX B;  2F8N K;  3AZM B;  1F66 A;  5CPJ B;  2IO5 B;  3UTB D;  2ZY5 A;  5F99 B;  3WTP D;  4JJN A;  2Y2J A;  3MVD B;  5B2J D;  2BYM B;  3LZ0 C;  1P34 D;  3R45 A;  1HQ3 C;  3EG5 B;  3EPK A;  3C1B C;  3AZE B;  1U35 B;  3AFA C;  3A6N B;  5JRG D;  1S32 D;  3TU4 C;  2PYO B;  1P3F D;  3VH5 A;  3VH6 T;  1P3M B;  4QLC A;  4UUZ B;  3AZI C;  1EQZ A;  3LJA A;  5BS7 C;  4H9O B;  3UTA D;  5B32 C;  5AV5 A;  1P3P A;  3W96 D;  5AVB D;  3FDD A;  3WAA D;  2YFV B;  2G5I C;  5CP6 D;  4H9R A;  1P3G B;  4XUJ C;  3C1B A;  1M18 B;  5DNM C;  3UTA B;  4WU8 B;  3WKJ B;  3UT9 A;  4G91 C;  3A6N D;  1M19 A;  3MNN D;  2VQR A;  5AV8 D;  1F66 D;  1U35 C;  4KGC C;  3MGP B;  5GXQ C;  1AOI C;  3AN2 A;  4G91 B;  1KX3 D;  2NQB C;  2F8N A;  5B2I C;  2W8S A;  4Z66 A;  5B31 G;  5GT0 B;  5B0Y D;  4AWL C;  4X23 D;  4KGC B;  3AZH D;  3AZF A;  2YFW A;  4EO5 C;  3REK C;  4X23 C;  1P3A C;  5DNN C;  3LJA C;  3REL D;  2CV5 B;  4DQY B;  5GSU C;  4XUJ A;  3LJA D;  3AFA D;  5C3I C;  1KX3 A;  1P3F C;  1KX3 C;  4H9Q A;  1P3O B;  1TZY D;  5B31 A;  1P3L C;  3AZK A;  5CPJ A;  1KX4 D;  3V9R A;  5B2J C;  4J8X B;  3REJ D;  4WZS B;  5G49 B;  5GT3 C;  5CP6 B;  4H9N A;  3MGS C;  3AFA A;  5B33 D;  5B1M D;  3NQU B;  3AZH B;  2NZD C;  5GT3 B;  5CP6 C;  3AZM D;  4KUD B;  3AZG D;  4QLC B;  4YS3 C;  5E5A C;  1P3I B;  2Y2I A;  5BO0 B;  4YS3 D;  3AZN A;  3AN2 D;  2FJ7 A;  2Y2P A;  1AOI B;  3KFU G;  5B32 D;  4Z66 D;  3W96 C;  2Y2L A;  4KGC D;  4LD9 D;  5GT0 C;  3AZK C;  5FUG A;  1P3M D;  4WNN A;  5CPK D;  1KX5 C;  4KHA A;  3AZG B;  4UPK A;  3W99 B;  1S32 C;  4ZBJ B;  5DNM D;  5AV9 A;  4AWL B;  3X1V A;  3W97 C;  3W98 C;  1H3O B;  5AV9 C;  4J8U C;  5B31 C;  4WU8 A;  3WKJ A;  5AVB B;  3MNN A;  3REH B;  1Q9C A;  2FFF B;  1ID3 C;  3UTA C;  3AZI A;  4KUD D;  1ULY A;  3X1S A;  1P3B C;  3MGQ C;  3O62 C;  2JSS A;  3C1C D;  1HQ3 A;  4NFT A;  3AV2 A;  2FJ7 C;  4XZQ D;  3KXB D;  3REK A;  1P3A A;  2RIQ A;  3W96 A;  2Y2K A;  3AZH C;  1P3K B;  1KX5 A;  3AZN C;  3AZJ D;  4H9S C;  5DNM B;  3AZL D;  4YS3 B;  5AY8 C;  3AYW B;  4WU9 A;  5BT1 C;  3AV2 D;  5BNV B;  5B32 B;  4XZQ A;  3KXB A;  5GXQ D;  3LEL A;  3MGR C;  5C3I B;  1B6W A;  3H0L C;  4DRB A;  5CPI C;  5AV8 A;  3WA9 A;  3F6T A;  5B24 C;  5CPJ D;  5AV6 B;  3MGR A;  2ARO A;  3REJ A;  3AZJ B;  3X1T C;  5F99 D;  3KWQ B;  3LEL D;  1ZLA B;  5AV5 D;  3AZE D;  1JFI A;  2DQN C;  3AZG C;  5DNN B;  3NQU A;  3AZH A;  3WAA A;  3B0B A;  5BNX A;  2PYO D;  1BH8 A;  2ZY3 A;  3VH6 W;  2NQB B;  4Z66 C;  5E5A D;  3LZ0 B;  5B2I B;  4H9O A;  1TAF B;  5GXQ B;  3B6G B;  5F99 C;  5B33 B;  3AZE A;  3MGQ B;  1S32 A;  3B6F B;  3X1U C;  2ARO C;  5B24 A;  5B1M C;  4WU9 C;  3KUY B;  4UUZ A;  1EQZ B;  3MGP C;  5E5A B;  2G5H C;  2Y2M A;  5AVC D;  3VH5 W;  3MGQ D;  5AVB A;  3MNN B;  1P3I C;  4LD9 C;  1F66 B;  3UTB A;  5B40 D;  1P3M C;  3REL A;  5G49 A;  5CP6 A;  4XUJ D;  2FJ7 D;  4J8V A;  5B2J B;  2F8N H;  3REK D;  5CPI B;  1P3A D;  1ZLA D;  2HIO B;  4CAY A;  4Z2M G;  5AVC B;  5DNN D;  3REI A;  1M19 B;  3B6F D;  5JRG B;  2PYO A;  5BS7 A;  5B40 A;  1EQZ D;  4WJ3 C;  5GSU A;  3LZ1 B;  2CV5 D;  1KU5 A;  3NQJ B;  4ZUX A;  3MGS B;  3EPL A;  4YM6 D;  5B1L B;  3P5J B;  2HIO D;  1P3B B;  1BFM A;  1U35 A;  3AV1 D;  5B24 D;  3X1U B;  3WA9 C;  4J8X D;  3REJ B;  3AZL B;  3WTP A;  2CV5 A;  3MVD D;  2ZY2 A;  4HGA C;  1P34 B;  4CSR A;  3X1T A;  4Z5T B;  3AZJ C;  2CV5 C;  1H3O A;  4YM6 A;  1M18 A;  2NZD A;  5BT1 D;  4LD9 A;  3WAA B;  5CPK A;  3AZK B;  1TZY C;  3B0D B;  1T3U A;  2F2A C;  2BG1 A;  4JJN B;  4J8V D;  3R45 B;  2F8N D;  3KWQ D;  2BYM A;  1M18 D;  5B33 A;  5B0Y A;  4WU8 D;  3WKJ D;  1BH9 A;  4WV4 B;  5GT3 A;  4R8P A;  2BYK B;  5JRG C;  2ARO D;  3C1C A;  3MGP D;  4J8U D;  2CWE A;  1P3K C;  2Y2N A;  2F8N B;  1M1A B;  1P3P B;  1U35 D;  1ID3 A;  3AZF B;  5CPK C;  2F8N G;  3AZK D;  2ZY4 A;  1KX5 D;  3V9R B;  2ARO B;  4G92 C;  1A7W A;  3AYW C;  5JA4 B;  2RVQ C;  3AN2 C;  4X23 A;  5B1M B;  4R8P C;  4NE5 A;  1P3F B;  3O62 B;  3X1S D;  4NE3 A;  1P3I D;  4JJN D;  5F99 A;  3WTP E;  3LJA B;  2FJ7 B;  3B6G C;  3AN2 B;  5AY8 A;  3AV2 B;  3W97 B;  4Z66 B;  2UWX A;  3W98 B;  1TZY B;  3A6N A;  3MGQ A;  1M19 D;  5CPJ C;  3WTP C;  5GT3 D;  5FUG B;  1M19 C;  3REH C;  1KX4 A;  3AV1 A;  5AV6 D;  3LZ1 D;  5CPI D;  3AZJ A;  1M18 C;  4J8U A;  2ZM5 A;  4J8W B;  3AZL A;  1P3L A;  4M6B A;  3LZ1 C;  1P3G A;  4QLC C;  3UTA A;  3AZL C;  3TU4 A;  4G92 B;  5DNN A;  2DF4 C;  3UTB C;  2Y2G A;  4LD9 B;  3AZF D;  2YFV A;  1Z2C B;  3X1S B;  3AZI B;  3AZF C;  5CPK B;  4J8V C;  3REL B;  1HQ3 D;  4J8W D;  5KDM A;  1P3G D;  3LZ0 D;  5AV6 C;  3AFA B;  3B6G A;  3X1V B;  5CPI A;  3EPJ A;  5GT0 A;  3AL0 C;  3UT9 D;  2YFW B;  5B0Z B;  3LEL C;  4H9P B;  1BH8 B;  3KSY A;  3MGP A;  5DNM A;  5AV9 D;  1KX3 B;  3MGS A;  5GXQ A;  5GT0 D;  3VH5 T;  5AVB C;  3WA9 B;  3UT9 C;  3A1K A;  2HUE C;  3B0C T;  3W99 A;  4HGA B;  3AYW D;  2LY8 A;  5BNV A;  5B32 A;  3KWQ A;  2Y2Q A;  4Z5T A;  3UT9 B;  5AV5 B;  3REI C;  5JRG A;  4Z5T C;  1P3F A;  3C1C C;  5B40 C;  4QLC D;  3MGR B;  4KUD C;  4J8X A;  3W99 D;  3MVD A;  2NQB D;  4XZQ C;  3KXB C;  4ZUX B;  5B0Y C;  1AOI D;  3X1V D;  5AY8 B;  3W97 A;  1B67 A;  5B32 G;  3X1V C;  3AV1 C;  3W98 A;  5B0Z D;  3REH D;  3REL C;  3WA9 D;  3A6N C;  5B0Z C;  1N1J A;  1W2E A;  1P3A B;  1F66 C;  5GSU D;  5AV8 C;  1HTA A;  2NQB A;  4ZUX D;  1P3O C;  1AOI A;  4JJN C;  4YM6 C;  1TAF A;  3LEL B;  2NZD B;  5B1L A;  1P3O A;  2HIO C;  1PZR A;  3KUY C;  4WNN B;  3IP4 C;  1P3P C;  3UTB B;  3MVD C;  3B6F C;  1WWI A;  4J8X C;  4J8W C;  3C1B B;  3X1T D;  3AZE C;  5CHL B;  3AZM C;  2JCH A;  5JA4 A;  4ZUX C;  2HUE B;  1P3O D;  2NZD D;  4H9Q B;  5AV5 C;  3REI B;  3AZM A;  2XD5 A;  3AZI D;  4KUD A;  3MGR D;  4H9P A;  1P3K D;  1WWS A;  3C1C B;  5GSU B;  3LZ1 A;  1HQ3 B;  1P3L D;  4WU9 B;  4H9N B;  3REJ C;  4DRA A;  1KX4 C;  4XZQ B;  3KXB B;  3C1B D;  3MGS D;  3H0M C;  1P34 C;  2HIO A;  4CAY B;  1P3B A;  3B0C W;  1P3G C;  1M1A D;  1TZY A;  4KGC A;  1F1E A;  3W99 C;  3W96 B;  1P3M A;  2BYK A;  4WU8 C;  3WKJ C;  3KUY A;  5B24 B;  3X1U D;  3REK B;  5AV9 B;  1P3I A;  4XUJ B;  3A1I A;  5E5A A;  4J8W A;  1ZLA C;  4WU9 D;  3AYW A;  3NQJ A;  4CSR B;  3X1T B;  5B1L C;  1ZLA A;  4Z5T D;  5B1L D;  4YM6 B;  1P3B D;  5B1M A;  1M1A A;  3H0R C;  4Z2M H;  3VH6 A;  4NE6 A;  5AVC C;  3REI D;  1ID3 D;  2L5A A;  5AV8 B;  3O62 D;  1M1A C;  5AV6 A;  2JE5 A;  3EPH A;  3X1U A;  4H9R B;  2XD1 A;  5B2I D;  5B2J A;  4J8V B;  1P34 A;  4H9S A;  1JFI B;  3W97 D;  3W98 D;  3MNN C;  1BH9 B;  5B0Y B;  4X23 B;  5B31 D;  3REH A;  4R8P D;  3O62 A;  2RVQ D;  3AV1 B;  4E45 A;  1P3K A;  3X1S C;  1N1J B;  5B40 B;  1P3L B;  3WAA C;  5BO0 A;  3AZN B;  5B2I A;  3AV2 C;  1EQZ C;  3LZ0 A;  5AY8 D;  3B6G D;  3B0D C;  3TU4 B;  2PYO C;  2Y2H A;  4EO5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...