5CPKC

Nucleosome containing methylated sat2l dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkC00
3KSYA 5F99A 1P3ID 5JRGD 3X1UB 3AZKC 3VH6W 4XZQD 3MGQB 1KX3B 3W97A 4Z66C 1AOIA 1F1EA 4CAYA 5AV5D 2NZDB 4JJNB 3AZFB 3X1VC 2NQBD 5KDMB 4KHAB 1B67A 4Z5TC 4H9NB 5GT0A 3V9RB 2CV5A 4CSRA 5CPID 5B1LC 3WTPA 5B0ZB 5B31B 3B6FA 1M18B 1HQ3C 5GXQA 2YFVA 1ULYA 1B6WA 3AZJC 3REKB 3AZKD 1P3BB 5B33A 1H3OA 3AV1D 3A6NB 2BYKA 4HGAB 3W99D 1F66B 1M1AD 3W97B 1M19D 3AFAD 3MVDD 4NE5A 5B2JC 3MGSC 1P34C 5B1MA 3KWQD 3B6GC 3AZGA 1P3OC 3C1BD 1HQ3D 3AV2C 5GT0B 3UTBD 5B2ID 2HIOC 3WKJD 1KX5B 3W96B 4CSRB 3MGPD 5GSUA 4R8PD 3WTPB 4H9SC 5CP6B 5DNMD 4XUJC 1P3AC 1TZYA 4WU8D 3B6FB 5E5AB 2PYOD 4J8VD 3LZ1A 1P3FC 3KXBA 3LELD 4ZUXD 1P3LB 3AN2C 5AV6C 2BYKB 3UTAD 3MGRC 4LD9C 5CPJD 5B24A 2FJ7B 1P3OD 1KX4C 1P3PD 3REJA 1BH9A 4QLCA 4J8UB 4J8WA 3WA9C 1P3KC 4J8XD 5B32G 1S32D 3AZMA 5B1MB 5GT3B 1KU5A 3AZGB 5DNND 4WU9A 3LZ0C 5AVBD 3C1CD 1ZLAD 3B6GA 4KUDD 3B0DB 1EQZA 1WWIA 3NQUB 3KUYA 3AN2D 4YS3D 1U35D 1P3GA 5B40B 1TZYB 3VH5T 5AV9B 3WAAA 4KGCA 3MNNB 2NZDC 3AYWD 4H9OA 3AZIA 3AZFC 3LZ1B 1P3MB 3UT9C 2AROA 5AV8D 1ID3D 3LJAC 5B32A 4H9QA 3AZEA 3WA9D 4ZBJB 1BH8B 2JSSA 5B0YB 3X1SC 5BS7A 3AZLA 5CPKC 3REJB 5AVBB 1M18C 2HUEB 3REHA 3WTPE 3X1UD 5JRGC 3REKC 3MGQD 1KX3D 2F8NG 4XZQC 1U35B 5AY8B 5AV5C 5AVCD 3A6NC 4G91B 4JJND 3AZFD 1EQZB 3KUYB 1F66C 2NQBC 3WAAB 4KGCB 3TU4B 3B0CW 5CPIC 3AZIB 5JA4A 2AROB 5B0ZD 4X23A 2YFWA 5B31D 1HTAA 2F8NK 2F8NA 4H9QB 3AZEB 3AZHA 3REKD 2IO5C 1P3BD 1KX5C 3O62A 3AV1C 3A6ND 3AZLB 5AVCB 3X1SA 1JFIB 3REHB 4EO5B 5CPKA 4YM6A 1F66D 3W99C 3B0BA 1M1AC 3X1TB 3REIA 3W97D 1P3IA 5JRGA 3AZNB 4XZQA 1M19C 3VH6A 3AFAC 3MVDC 4Z2MH 3NQJA 3KWQC 3RELA 3C1BC 3W98A 5GT0D 4G92C 3UTBC 5B2IC 1KX5D 3WKJC 3W96D 3MGPC 4R8PC 3WTPD 5JA4B 5GT3C 5CP6D 2YFWB 5DNMC 4WU8C 3B6FD 4DRBA 5E5AD 2PYOC 5F99B 4J8VC 3AZHB 3LELC 1P3LD 4ZUXC 5B33D 3O62B 4AWLC 2LY8A 1AOIB 3AZKA 4CAYB 3UTAC 4Z66A 3AV1A 5CPJC 4YM6B 2FJ7D 1TAFA 3X1VA 1P3PC 3W99A 4J8UD 2CV5B 4ZBJC 4J8XC 4Z5TA 3R45A 1S32C 5BO0A 3NQJB 5B1MD 5GT3D 3RELB 3AZGD 5B1LA 5BNVA 5DNNC 5AVBC 3C1CC 1ZLAC 3W98B 4KUDC 5GXQB 2YFVB 1HQ3A 5B33B 1H3OB 4YS3C 3AZJA 1U35C 5B40D 5AV9D 1TZYD 4R8PA 3MNND 5BT1D 5G49A 3AYWC 5DNMA 1P3MD 3LZ1D 2PYOA 5AV8C 1ID3C 2F8NH 3VH6T 4Z66B 3TU4C 5B0YD 3UTAA 5B2JA 3MGSA 3REJD 3X1VB 1P34A 1P3OA 4J8WD 3R45B 5GSUB 3X1UC 3AV2A 5BO0B 3MGQC 1KX3C 2HIOA 5B1LB 1BFMA 4H9SA 5AY8D 5AVCC 4XUJA 1P3AA 4JJNC 1EQZD 3KXBB 3KUYD 3C1CA 1P3FA 3AZJB 3X1TC 4NFTA 1P3GD 3WAAD 4KGCD 4NE6A 3AN2A 4YS3A 3TU4D 5AV6A 1R4VA 3AZID 5B24B 2AROD 3MGRA 5CHLB 5B0ZC 4LD9A 1BH9B 5B31C 4QLCB 5FUGA 1KX4A 4J8WB 3AZED 4WNNA 1P3BC 3AZMB 3WA9A 4WV4B 1P3KA 2BYMA 4WU9B 5B2JB 3MGSB 3AZLD 1P34B 3B6GB 3LZ0A 3REHD 2L5AA 4HGAC 3AV2B 3X1TD 2HIOB 4M6BA 5B31G 3W97C 1P3GB 3AZND 3MGQA 1KX3A 1P3AB 4H9OB 2NZDA 3AZFA 3UT9A 1P3FB 5B32B 5GT0C 4KHAA 3LJAA 3W96C 4H9NA 3WTPC 3MGRB 3V9RA 5CP6C 4LD9B 3B6FC 1KX4B 5E5AC 5F99D 3AZHD 1M18A 1P3LC 3O62D 5B33C 1AOID 2BYMB 3REKA 4H9PA 3LZ0B 5AV5A 3A6NA 4YM6D 5C3IB 2FJ7C 3REID 1F66A 4J8UC 2NQBA 5BNXA 2CV5D 4X23B 5B1MC 3RELD 3AZGC 5CPIA 3UT9B 2F8NB 3W98D 3B0DC 5GXQD 3LJAB 5GSUC 2RVQD 4H9RA 3W96A 3VH5W 1KX5A 3X1SB 5B40C 1TZYC 5AV9C 3MNNC 5BT1C 5CP6A 5CPKB 1P3MC 3LZ1C 3KXBC 5E5AA 3REIB 1P3IB 5JRGB 1P3LA 1M1AA 4H9PB 4XZQB 4Z66D 5AV5B 3VH5A 5B0YC 1M19A 3AFAA 5B24C 3MVDA 3X1VD 3REJC 3KWQA 4QLCC 2FJ7A 2NQBB 2HUEC 4J8WC 3C1BA 4DRAA 5BNXB 4Z5TD 5GSUD 4J8UA 3AZMC 3UTBA 5B2IA 3WKJA 4E44A 3MGPA 5B1LD 4WU9C 5CPIB 5AY8C 3B0CT 5GT3A 4G91C 4WU8A 3KXBD 1EQZC 3KUYC 4J8VA 3AZJD 3LELA 2IO5B 4H9RB 4ZUXA 3NQUA 3AZKB 1P3GC 3WAAC 4KGCC 1N1JA 3AV1B 5B40A 5AV9A 5B24D 3AZIC 4Z2MG 3MNNA 2AROC 1P3MA 5CPJA 1TAFB 4QLCD 3W99B 4E45A 5B32C 1M1AB 1P3PA 3AZEC 4Z5TB 3AZMD 1M19B 3AFAB 3MVDB 4J8XA 1BH8A 4WU9D 1S32A 5BNVB 5BS7C 5B2JD 5B0YA 3MGSD 3AZLC 1P34D 3KWQB 3B6GD 5DNNA 3REHC 3C1BB 4EO5C 1HQ3B 5AVBA 1ZLAA 3AV2D 4KUDA 4UUZA 4G92B 2HIOD 5B2IB 1Q9CA 2CWEA 3UTBB 3WKJB 3MGPB 4R8PB 3AZNC 1U35A 5G49B 4XUJD 1P3AD 5DNMB 4WU8B 5AY8A 3AYWA 2PYOB 5C3IC 4J8VB 1P3FD 3LELB 5B32D 4ZUXB 4AWLB 5AV8A 1ID3A 1N1JB 1WWSA 5AV6D 3UTAB 3MGRD 3TU4A 4X23C 4LD9D 5CPJB 1KX4D 1P3OB 5F99C 1P3PB 3AZHC 4WZSB 1P3KD 3O62C 4J8XB 3X1UA 1AOIC 1S32B 1A7WA 4XUJB 5DNNB 3LZ0D 5AVCA 4YM6C 3C1CB 1JFIA 1ZLAB 4JJNA 4KUDB 4UUZB 3REIC 1P3IC 5KDMA 3AN2B 3X1TA 4YS3B 5AV6B 2CV5C 3AZNA 2NZDD 4X23D 3AYWB 3RELC 4NE3A 3UT9D 5B0ZA 5FUGB 2F8ND 3W98C 4WNNB 5AV8B 5GXQC 5B31A 3LJAD 1ID3B 3WA9B 2RVQC 1P3KB 1P3BA 3X1SD 5CPKD 1M18D
chains in the Genus database with same CATH superfamily
3KSYA 5F99A 2J8PA 1P3ID 5JRGD 3X1UB 3AZKC 3VH6W 4XZQD 3MGQB 1KX3B 3W97A 4Z66C 1AOIA 1F1EA 4CAYA 5AV5D 2NZDB 4JJNB 3AZFB 3X1VC 2NQBD 5KDMB 4KHAB 1B67A 2W8SA 4Z5TC 4H9NB 5GT0A 3V9RB 2CV5A 4CSRA 5CPID 5B1LC 3WTPA 5B0ZB 2Y2JA 5B31B 3B6FA 1M18B 1HQ3C 5GXQA 1ULYA 2YFVA 1B6WA 3AZJC 3REKB 2Y2KA 3AZKD 1P3BB 5B33A 1H3OA 3AV1D 3A6NB 2BYKA 4HGAB 3W99D 1F66B 1M1AD 2XD5A 3W97B 1M19D 3AFAD 3MVDD 4NE5A 5B2JC 3MGSC 2Y2IA 1P34C 5B1MA 3KWQD 3B6GC 3AZGA 2Y2GA 1P3OC 3C1BD 1HQ3D 3AV2C 5GT0B 3UTBD 5B2ID 2HIOC 3WKJD 1KX5B 3H0RC 3W96B 4CSRB 3MGPD 5GSUA 4R8PD 3WTPB 4WJ3C 4H9SC 5CP6B 5DNMD 4XUJC 1P3AC 1TZYA 4WU8D 3B6FB 5E5AB 2PYOD 4J8VD 3LZ1A 1P3FC 3KXBA 3LELD 4ZUXD 1P3LB 2ZM5A 2Y2LA 3AN2C 5AV6C 2BYKB 3UTAD 3MGRC 4LD9C 5CPJD 5B24A 2FJ7B 1P3OD 1KX4C 1P3PD 3REJA 1BH9A 4QLCA 4J8UB 4J8WA 3WA9C 1P3KC 4J8XD 5B32G 1S32D 3AZMA 5B1MB 5GT3B 1KU5A 3AZGB 5DNND 4WU9A 3LZ0C 5AVBD 3C1CD 1ZLAD 3B6GA 4KUDD 3B0DB 1EQZA 1WWIA 3NQUB 3KUYA 3AN2D 4YS3D 1U35D 1P3GA 5B40B 1TZYB 3VH5T 5AV9B 3WAAA 4KGCA 2BG1A 3MNNB 2NZDC 3AYWD 4H9OA 3AZIA 3AZFC 3LZ1B 1P3MB 3UT9C 2AROA 5AV8D 1ID3D 3LJAC 5B32A 4H9QA 3AZEA 3WA9D 4ZBJB 1BH8B 2JSSA 5B0YB 3X1SC 5BS7A 3EPKA 3F6TA 3AZLA 3REJB 5CPKC 5AVBB 1M18C 2HUEB 3REHA 3WTPE 3X1UD 5JRGC 3REKC 3MGQD 1KX3D 2F8NG 4XZQC 1U35B 2Y2MA 1PZRA 5AY8B 5AV5C 5AVCD 3A6NC 4G91B 4JJND 3AZFD 1EQZB 3KUYB 1F66C 2Y2QA 2NQBC 3WAAB 4KGCB 3TU4B 3B0CW 1T3UA 5CPIC 3AZIB 5JA4A 2AROB 5B0ZD 4X23A 2YFWA 5B31D 1HTAA 2F8NK 2F8NA 4H9QB 3AZEB 3AZHA 3REKD 2IO5C 1P3BD 1KX5C 3O62A 3AL0C 3AV1C 3A6ND 3AZLB 5AVCB 3X1SA 1JFIB 3REHB 4EO5B 5CPKA 4YM6A 1F66D 3W99C 3B0BA 1M1AC 3X1TB 3REIA 3W97D 1P3IA 2JE5A 5JRGA 3AZNB 4XZQA 1M19C 3VH6A 3AFAC 3MVDC 3A1IA 4Z2MH 3NQJA 3KWQC 3RELA 3C1BC 3W98A 5GT0D 4G92C 3UTBC 5B2IC 1KX5D 3WKJC 3W96D 3MGPC 4R8PC 3WTPD 4DQYB 5JA4B 5GT3C 5CP6D 2YFWB 5DNMC 4WU8C 3B6FD 4DRBA 5E5AD 2PYOC 5F99B 4J8VC 3AZHB 3LELC 1P3LD 4ZUXC 5B33D 3O62B 4AWLC 2LY8A 1AOIB 3AZKA 4CAYB 3UTAC 4Z66A 3AV1A 5CPJC 4YM6B 2FJ7D 1TAFA 3X1VA 1P3PC 3W99A 4J8UD 3FDDA 2CV5B 4ZBJC 4J8XC 4Z5TA 3R45A 1S32C 5BO0A 3NQJB 5B1MD 5GT3D 3RELB 3AZGD 5B1LA 5BNVA 5DNNC 5AVBC 3C1CC 1ZLAC 3W98B 4KUDC 5GXQB 2YFVB 1HQ3A 5B33B 1H3OB 4YS3C 3AZJA 1U35C 5B40D 1TZYD 5AV9D 4R8PA 3MNND 5BT1D 5G49A 3AYWC 5DNMA 1P3MD 3LZ1D 2PYOA 5AV8C 1ID3C 2F8NH 3VH6T 4Z66B 3TU4C 5B0YD 2G5HC 3UTAA 3P5JB 5B2JA 3MGSA 3REJD 3X1VB 1P34A 2RIQA 1P3OA 3H0LC 4J8WD 3R45B 5GSUB 3X1UC 3AV2A 5BO0B 3MGQC 1KX3C 2HIOA 5B1LB 1BFMA 4H9SA 5AY8D 5AVCC 4XUJA 1P3AA 4JJNC 1EQZD 3KXBB 3KUYD 3C1CA 1P3FA 3AZJB 3X1TC 4NFTA 1P3GD 2DF4C 3WAAD 4KGCD 4NE6A 3AN2A 4YS3A 3TU4D 5AV6A 1R4VA 3AZID 5B24B 2AROD 3MGRA 5CHLB 5B0ZC 4LD9A 1BH9B 5B31C 4QLCB 5FUGA 1KX4A 4J8WB 3AZED 4WNNA 1P3BC 3AZMB 3WA9A 4WV4B 1P3KA 2BYMA 4WU9B 1Z2CB 3H0MC 5B2JB 3MGSB 3AZLD 1P34B 3B6GB 3LZ0A 3REHD 2L5AA 4HGAC 3AV2B 3X1TD 2HIOB 4M6BA 5B31G 3W97C 1P3GB 3AZND 3MGQA 1KX3A 1P3AB 4H9OB 2NZDA 2VQRA 3AZFA 3UT9A 1P3FB 5B32B 2ZY2A 5GT0C 4KHAA 3LJAA 2FFFB 3W96C 4H9NA 3WTPC 3MGRB 3A1KA 3V9RA 5CP6C 4LD9B 3B6FC 1KX4B 5E5AC 2Y2HA 5F99D 3AZHD 1M18A 1P3LC 3O62D 5B33C 1AOID 2BYMB 3REKA 4H9PA 2JCHA 3LZ0B 5AV5A 3A6NA 4YM6D 5C3IB 2FJ7C 3REID 1F66A 4J8UC 2NQBA 5BNXA 2CV5D 4X23B 5B1MC 3RELD 3AZGC 5CPIA 3UT9B 2F8NB 3W98D 3B0DC 5GXQD 3LJAB 5GSUC 2RVQD 4H9RA 3W96A 3VH5W 1KX5A 3X1SB 5B40C 1TZYC 5AV9C 2DQNC 3MNNC 5BT1C 5CP6A 5CPKB 1P3MC 3LZ1C 3KXBC 5E5AA 2XD1A 2Y2NA 1W2EA 3REIB 1P3IB 5JRGB 1P3LA 1M1AA 4H9PB 4XZQB 4Z66D 5AV5B 3VH5A 5B0YC 1M19A 3AFAA 5B24C 3MVDA 3X1VD 3REJC 3KWQA 4QLCC 2FJ7A 2NQBB 2Y2OA 2HUEC 4J8WC 3C1BA 4DRAA 5BNXB 4Z5TD 5GSUD 4J8UA 3AZMC 2ZY5A 3UTBA 5B2IA 3WKJA 4E44A 3MGPA 5B1LD 4WU9C 5CPIB 3IP4C 5AY8C 3B0CT 5GT3A 4G91C 2F2AC 4WU8A 3KXBD 1EQZC 3KUYC 4J8VA 3AZJD 3LELA 2IO5B 4H9RB 4ZUXA 3NQUA 3AZKB 1P3GC 3WAAC 4KGCC 1N1JA 3EG5B 3AV1B 5B40A 5AV9A 5B24D 3AZIC 4Z2MG 3MNNA 2AROC 1P3MA 5CPJA 1TAFB 4QLCD 3W99B 4E45A 5B32C 1M1AB 1P3PA 3AZEC 4Z5TB 3AZMD 1M19B 3AFAB 3MVDB 4J8XA 1BH8A 4WU9D 1S32A 5BNVB 5BS7C 5B2JD 5B0YA 3MGSD 3AZLC 1P34D 3KWQB 3B6GD 2G5IC 5DNNA 3REHC 3C1BB 4EO5C 2ZY3A 1HQ3B 5AVBA 1ZLAA 3EPJA 3AV2D 4KUDA 4UUZA 4G92B 2HIOD 5B2IB 1Q9CA 2CWEA 3UTBB 3WKJB 3MGPB 4R8PB 3AZNC 1U35A 5G49B 4XUJD 1P3AD 5DNMB 4WU8B 5AY8A 3AYWA 2PYOB 5C3IC 4J8VB 1P3FD 3LELB 5B32D 4ZUXB 4AWLB 5AV8A 1ID3A 1N1JB 1WWSA 5AV6D 4UPKA 3UTAB 3MGRD 3TU4A 4X23C 4LD9D 5CPJB 3KFUG 1KX4D 1P3OB 5F99C 1P3PB 3AZHC 4WZSB 2ZY4A 2UWXA 1P3KD 3O62C 4J8XB 3X1UA 1AOIC 1S32B 1A7WA 4XUJB 5DNNB 2Y2PA 3LZ0D 5AVCA 4YM6C 3C1CB 1JFIA 1ZLAB 4JJNA 4KUDB 4UUZB 3REIC 1P3IC 5KDMA 3AN2B 3EPHA 3X1TA 4YS3B 5AV6B 3EPLA 2CV5C 3AZNA 2NZDD 4X23D 3AYWB 3RELC 4NE3A 3UT9D 5B0ZA 5FUGB 2F8ND 3W98C 4WNNB 5AV8B 5GXQC 5B31A 3LJAD 1ID3B 3WA9B 2RVQC 1P3KB 1P3BA 3X1SD 5CPKD 1M18D
chains in the Genus database with same CATH topology
3KSYA 5F99A 2J8PA 1P3ID 5JRGD 3X1UB 3AZKC 3VH6W 4XZQD 3MGQB 1KX3B 3W97A 4Z66C 1AOIA 1F1EA 4CAYA 5AV5D 2NZDB 4JJNB 3AZFB 3X1VC 2NQBD 5KDMB 4KHAB 1B67A 2W8SA 4Z5TC 4H9NB 5GT0A 3V9RB 2CV5A 4CSRA 5CPID 5B1LC 3WTPA 5B0ZB 2Y2JA 5B31B 3B6FA 1M18B 1HQ3C 5GXQA 1ULYA 2YFVA 1B6WA 3AZJC 3REKB 2Y2KA 3AZKD 1P3BB 5B33A 1H3OA 3AV1D 3A6NB 2BYKA 4HGAB 3W99D 1F66B 1M1AD 2XD5A 3W97B 1M19D 3AFAD 3MVDD 4NE5A 5B2JC 3MGSC 2Y2IA 1P34C 5B1MA 3KWQD 3B6GC 3AZGA 2Y2GA 1P3OC 3C1BD 1HQ3D 3AV2C 5GT0B 3UTBD 5B2ID 2HIOC 3WKJD 1KX5B 3H0RC 3W96B 4CSRB 3MGPD 5GSUA 4R8PD 3WTPB 4WJ3C 4H9SC 5CP6B 5DNMD 4XUJC 1P3AC 1TZYA 4WU8D 3B6FB 5E5AB 2PYOD 4J8VD 3LZ1A 1P3FC 3KXBA 3LELD 4ZUXD 1P3LB 2ZM5A 2Y2LA 3AN2C 5AV6C 2BYKB 3UTAD 3MGRC 4LD9C 5CPJD 5B24A 2FJ7B 1P3OD 1KX4C 1P3PD 3REJA 1BH9A 4QLCA 4J8UB 4J8WA 3WA9C 1P3KC 4J8XD 5B32G 1S32D 3AZMA 5B1MB 5GT3B 1KU5A 3AZGB 5DNND 4WU9A 3LZ0C 5AVBD 3C1CD 1ZLAD 3B6GA 4KUDD 3B0DB 1EQZA 1WWIA 3NQUB 3KUYA 3AN2D 4YS3D 1U35D 1P3GA 5B40B 1TZYB 3VH5T 5AV9B 3WAAA 4KGCA 2BG1A 3MNNB 2NZDC 3AYWD 4H9OA 3AZIA 3AZFC 3LZ1B 1P3MB 3UT9C 2AROA 5AV8D 1ID3D 3LJAC 5B32A 4H9QA 3AZEA 3WA9D 4ZBJB 1BH8B 2JSSA 5B0YB 3X1SC 5BS7A 3EPKA 3F6TA 3AZLA 3REJB 5CPKC 5AVBB 1M18C 2HUEB 3REHA 3WTPE 3X1UD 5JRGC 3REKC 3MGQD 1KX3D 2F8NG 4XZQC 1U35B 2Y2MA 1PZRA 5AY8B 5AV5C 5AVCD 3A6NC 4G91B 4JJND 3AZFD 1EQZB 3KUYB 1F66C 2Y2QA 2NQBC 3WAAB 4KGCB 3TU4B 3B0CW 1T3UA 5CPIC 3AZIB 5JA4A 2AROB 5B0ZD 4X23A 2YFWA 5B31D 1HTAA 2F8NK 2F8NA 4H9QB 3AZEB 3AZHA 3REKD 2IO5C 1P3BD 1KX5C 3O62A 3AL0C 3AV1C 3A6ND 3AZLB 5AVCB 3X1SA 1JFIB 3REHB 4EO5B 5CPKA 4YM6A 1F66D 3W99C 3B0BA 1M1AC 3X1TB 3REIA 3W97D 1P3IA 2JE5A 5JRGA 3AZNB 4XZQA 1M19C 3VH6A 3AFAC 3MVDC 3A1IA 4Z2MH 3NQJA 3KWQC 3RELA 3C1BC 3W98A 5GT0D 4G92C 3UTBC 5B2IC 1KX5D 3WKJC 3W96D 3MGPC 4R8PC 3WTPD 4DQYB 5JA4B 5GT3C 5CP6D 2YFWB 5DNMC 4WU8C 3B6FD 4DRBA 5E5AD 2PYOC 5F99B 4J8VC 3AZHB 3LELC 1P3LD 4ZUXC 5B33D 3O62B 4AWLC 2LY8A 1AOIB 3AZKA 4CAYB 3UTAC 4Z66A 3AV1A 5CPJC 4YM6B 2FJ7D 1TAFA 3X1VA 1P3PC 3W99A 4J8UD 3FDDA 2CV5B 4ZBJC 4J8XC 4Z5TA 3R45A 1S32C 5BO0A 3NQJB 5B1MD 5GT3D 3RELB 3AZGD 5B1LA 5BNVA 5DNNC 5AVBC 3C1CC 1ZLAC 3W98B 4KUDC 5GXQB 2YFVB 1HQ3A 5B33B 1H3OB 4YS3C 3AZJA 1U35C 5B40D 1TZYD 5AV9D 4R8PA 3MNND 5BT1D 5G49A 3AYWC 5DNMA 1P3MD 3LZ1D 2PYOA 5AV8C 1ID3C 2F8NH 3VH6T 4Z66B 3TU4C 5B0YD 2G5HC 3UTAA 3P5JB 5B2JA 3MGSA 3REJD 3X1VB 1P34A 2RIQA 1P3OA 3H0LC 4J8WD 3R45B 5GSUB 3X1UC 3AV2A 5BO0B 3MGQC 1KX3C 2HIOA 5B1LB 1BFMA 4H9SA 5AY8D 5AVCC 4XUJA 1P3AA 4JJNC 1EQZD 3KXBB 3KUYD 3C1CA 1P3FA 3AZJB 3X1TC 4NFTA 1P3GD 2DF4C 3WAAD 4KGCD 4NE6A 3AN2A 4YS3A 3TU4D 5AV6A 1R4VA 3AZID 5B24B 2AROD 3MGRA 5CHLB 5B0ZC 4LD9A 1BH9B 5B31C 4QLCB 5FUGA 1KX4A 4J8WB 3AZED 4WNNA 1P3BC 3AZMB 3WA9A 4WV4B 1P3KA 2BYMA 4WU9B 1Z2CB 3H0MC 5B2JB 3MGSB 3AZLD 1P34B 3B6GB 3LZ0A 3REHD 2L5AA 4HGAC 3AV2B 3X1TD 2HIOB 4M6BA 5B31G 3W97C 1P3GB 3AZND 3MGQA 1KX3A 1P3AB 4H9OB 2NZDA 2VQRA 3AZFA 3UT9A 1P3FB 5B32B 2ZY2A 5GT0C 4KHAA 3LJAA 2FFFB 3W96C 4H9NA 3WTPC 3MGRB 3A1KA 3V9RA 5CP6C 4LD9B 3B6FC 1KX4B 5E5AC 2Y2HA 5F99D 3AZHD 1M18A 1P3LC 3O62D 5B33C 1AOID 2BYMB 3REKA 4H9PA 2JCHA 3LZ0B 5AV5A 3A6NA 4YM6D 5C3IB 2FJ7C 3REID 1F66A 4J8UC 2NQBA 5BNXA 2CV5D 4X23B 5B1MC 3RELD 3AZGC 5CPIA 3UT9B 2F8NB 3W98D 3B0DC 5GXQD 3LJAB 5GSUC 2RVQD 4H9RA 3W96A 3VH5W 1KX5A 3X1SB 5B40C 1TZYC 5AV9C 2DQNC 3MNNC 5BT1C 5CP6A 5CPKB 1P3MC 3LZ1C 3KXBC 5E5AA 2XD1A 2Y2NA 1W2EA 3REIB 1P3IB 5JRGB 1P3LA 1M1AA 4H9PB 4XZQB 4Z66D 5AV5B 3VH5A 5B0YC 1M19A 3AFAA 5B24C 3MVDA 3X1VD 3REJC 3KWQA 4QLCC 2FJ7A 2NQBB 2Y2OA 2HUEC 4J8WC 3C1BA 4DRAA 5BNXB 4Z5TD 5GSUD 4J8UA 3AZMC 2ZY5A 3UTBA 5B2IA 3WKJA 4E44A 3MGPA 5B1LD 4WU9C 5CPIB 3IP4C 5AY8C 3B0CT 5GT3A 4G91C 2F2AC 4WU8A 3KXBD 1EQZC 3KUYC 4J8VA 3AZJD 3LELA 2IO5B 4H9RB 4ZUXA 3NQUA 3AZKB 1P3GC 3WAAC 4KGCC 1N1JA 3EG5B 3AV1B 5B40A 5AV9A 5B24D 3AZIC 4Z2MG 3MNNA 2AROC 1P3MA 5CPJA 1TAFB 4QLCD 3W99B 4E45A 5B32C 1M1AB 1P3PA 3AZEC 4Z5TB 3AZMD 1M19B 3AFAB 3MVDB 4J8XA 1BH8A 4WU9D 1S32A 5BNVB 5BS7C 5B2JD 5B0YA 3MGSD 3AZLC 1P34D 3KWQB 3B6GD 2G5IC 5DNNA 3REHC 3C1BB 4EO5C 2ZY3A 1HQ3B 5AVBA 1ZLAA 3EPJA 3AV2D 4KUDA 4UUZA 4G92B 2HIOD 5B2IB 1Q9CA 2CWEA 3UTBB 3WKJB 3MGPB 4R8PB 3AZNC 1U35A 5G49B 4XUJD 1P3AD 5DNMB 4WU8B 5AY8A 3AYWA 2PYOB 5C3IC 4J8VB 1P3FD 3LELB 5B32D 4ZUXB 4AWLB 5AV8A 1ID3A 1N1JB 1WWSA 5AV6D 4UPKA 3UTAB 3MGRD 3TU4A 4X23C 4LD9D 5CPJB 3KFUG 1KX4D 1P3OB 5F99C 1P3PB 3AZHC 4WZSB 2ZY4A 2UWXA 1P3KD 3O62C 4J8XB 3X1UA 1AOIC 1S32B 1A7WA 4XUJB 5DNNB 2Y2PA 3LZ0D 5AVCA 4YM6C 3C1CB 1JFIA 1ZLAB 4JJNA 4KUDB 4UUZB 3REIC 1P3IC 5KDMA 3AN2B 3EPHA 3X1TA 4YS3B 5AV6B 3EPLA 2CV5C 3AZNA 2NZDD 4X23D 3AYWB 3RELC 4NE3A 3UT9D 5B0ZA 5FUGB 2F8ND 3W98C 4WNNB 5AV8B 5GXQC 5B31A 3LJAD 1ID3B 3WA9B 2RVQC 1P3KB 1P3BA 3X1SD 5CPKD 1M18D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  5F99 A;  1P3I D;  5JRG D;  3X1U B;  3AZK C;  3VH6 W;  4XZQ D;  3MGQ B;  1KX3 B;  3W97 A;  4Z66 C;  1AOI A;  1F1E A;  4CAY A;  5AV5 D;  2NZD B;  4JJN B;  3AZF B;  3X1V C;  2NQB D;  5KDM B;  4KHA B;  1B67 A;  4Z5T C;  4H9N B;  5GT0 A;  3V9R B;  2CV5 A;  4CSR A;  5CPI D;  5B1L C;  3WTP A;  5B0Z B;  5B31 B;  3B6F A;  1M18 B;  1HQ3 C;  5GXQ A;  2YFV A;  1ULY A;  1B6W A;  3AZJ C;  3REK B;  3AZK D;  1P3B B;  5B33 A;  1H3O A;  3AV1 D;  3A6N B;  2BYK A;  4HGA B;  3W99 D;  1F66 B;  1M1A D;  3W97 B;  1M19 D;  3AFA D;  3MVD D;  4NE5 A;  5B2J C;  3MGS C;  1P34 C;  5B1M A;  3KWQ D;  3B6G C;  3AZG A;  1P3O C;  3C1B D;  1HQ3 D;  3AV2 C;  5GT0 B;  3UTB D;  5B2I D;  2HIO C;  3WKJ D;  1KX5 B;  3W96 B;  4CSR B;  3MGP D;  5GSU A;  4R8P D;  3WTP B;  4H9S C;  5CP6 B;  5DNM D;  4XUJ C;  1P3A C;  1TZY A;  4WU8 D;  3B6F B;  5E5A B;  2PYO D;  4J8V D;  3LZ1 A;  1P3F C;  3KXB A;  3LEL D;  4ZUX D;  1P3L B;  3AN2 C;  5AV6 C;  2BYK B;  3UTA D;  3MGR C;  4LD9 C;  5CPJ D;  5B24 A;  2FJ7 B;  1P3O D;  1KX4 C;  1P3P D;  3REJ A;  1BH9 A;  4QLC A;  4J8U B;  4J8W A;  3WA9 C;  1P3K C;  4J8X D;  5B32 G;  1S32 D;  3AZM A;  5B1M B;  5GT3 B;  1KU5 A;  3AZG B;  5DNN D;  4WU9 A;  3LZ0 C;  5AVB D;  3C1C D;  1ZLA D;  3B6G A;  4KUD D;  3B0D B;  1EQZ A;  1WWI A;  3NQU B;  3KUY A;  3AN2 D;  4YS3 D;  1U35 D;  1P3G A;  5B40 B;  1TZY B;  3VH5 T;  5AV9 B;  3WAA A;  4KGC A;  3MNN B;  2NZD C;  3AYW D;  4H9O A;  3AZI A;  3AZF C;  3LZ1 B;  1P3M B;  3UT9 C;  2ARO A;  5AV8 D;  1ID3 D;  3LJA C;  5B32 A;  4H9Q A;  3AZE A;  3WA9 D;  4ZBJ B;  1BH8 B;  2JSS A;  5B0Y B;  3X1S C;  5BS7 A;  3AZL A;  5CPK C;  3REJ B;  5AVB B;  1M18 C;  2HUE B;  3REH A;  3WTP E;  3X1U D;  5JRG C;  3REK C;  3MGQ D;  1KX3 D;  2F8N G;  4XZQ C;  1U35 B;  5AY8 B;  5AV5 C;  5AVC D;  3A6N C;  4G91 B;  4JJN D;  3AZF D;  1EQZ B;  3KUY B;  1F66 C;  2NQB C;  3WAA B;  4KGC B;  3TU4 B;  3B0C W;  5CPI C;  3AZI B;  5JA4 A;  2ARO B;  5B0Z D;  4X23 A;  2YFW A;  5B31 D;  1HTA A;  2F8N K;  2F8N A;  4H9Q B;  3AZE B;  3AZH A;  3REK D;  2IO5 C;  1P3B D;  1KX5 C;  3O62 A;  3AV1 C;  3A6N D;  3AZL B;  5AVC B;  3X1S A;  1JFI B;  3REH B;  4EO5 B;  5CPK A;  4YM6 A;  1F66 D;  3W99 C;  3B0B A;  1M1A C;  3X1T B;  3REI A;  3W97 D;  1P3I A;  5JRG A;  3AZN B;  4XZQ A;  1M19 C;  3VH6 A;  3AFA C;  3MVD C;  4Z2M H;  3NQJ A;  3KWQ C;  3REL A;  3C1B C;  3W98 A;  5GT0 D;  4G92 C;  3UTB C;  5B2I C;  1KX5 D;  3WKJ C;  3W96 D;  3MGP C;  4R8P C;  3WTP D;  5JA4 B;  5GT3 C;  5CP6 D;  2YFW B;  5DNM C;  4WU8 C;  3B6F D;  4DRB A;  5E5A D;  2PYO C;  5F99 B;  4J8V C;  3AZH B;  3LEL C;  1P3L D;  4ZUX C;  5B33 D;  3O62 B;  4AWL C;  2LY8 A;  1AOI B;  3AZK A;  4CAY B;  3UTA C;  4Z66 A;  3AV1 A;  5CPJ C;  4YM6 B;  2FJ7 D;  1TAF A;  3X1V A;  1P3P C;  3W99 A;  4J8U D;  2CV5 B;  4ZBJ C;  4J8X C;  4Z5T A;  3R45 A;  1S32 C;  5BO0 A;  3NQJ B;  5B1M D;  5GT3 D;  3REL B;  3AZG D;  5B1L A;  5BNV A;  5DNN C;  5AVB C;  3C1C C;  1ZLA C;  3W98 B;  4KUD C;  5GXQ B;  2YFV B;  1HQ3 A;  5B33 B;  1H3O B;  4YS3 C;  3AZJ A;  1U35 C;  5B40 D;  5AV9 D;  1TZY D;  4R8P A;  3MNN D;  5BT1 D;  5G49 A;  3AYW C;  5DNM A;  1P3M D;  3LZ1 D;  2PYO A;  5AV8 C;  1ID3 C;  2F8N H;  3VH6 T;  4Z66 B;  3TU4 C;  5B0Y D;  3UTA A;  5B2J A;  3MGS A;  3REJ D;  3X1V B;  1P34 A;  1P3O A;  4J8W D;  3R45 B;  5GSU B;  3X1U C;  3AV2 A;  5BO0 B;  3MGQ C;  1KX3 C;  2HIO A;  5B1L B;  1BFM A;  4H9S A;  5AY8 D;  5AVC C;  4XUJ A;  1P3A A;  4JJN C;  1EQZ D;  3KXB B;  3KUY D;  3C1C A;  1P3F A;  3AZJ B;  3X1T C;  4NFT A;  1P3G D;  3WAA D;  4KGC D;  4NE6 A;  3AN2 A;  4YS3 A;  3TU4 D;  5AV6 A;  1R4V A;  3AZI D;  5B24 B;  2ARO D;  3MGR A;  5CHL B;  5B0Z C;  4LD9 A;  1BH9 B;  5B31 C;  4QLC B;  5FUG A;  1KX4 A;  4J8W B;  3AZE D;  4WNN A;  1P3B C;  3AZM B;  3WA9 A;  4WV4 B;  1P3K A;  2BYM A;  4WU9 B;  5B2J B;  3MGS B;  3AZL D;  1P34 B;  3B6G B;  3LZ0 A;  3REH D;  2L5A A;  4HGA C;  3AV2 B;  3X1T D;  2HIO B;  4M6B A;  5B31 G;  3W97 C;  1P3G B;  3AZN D;  3MGQ A;  1KX3 A;  1P3A B;  4H9O B;  2NZD A;  3AZF A;  3UT9 A;  1P3F B;  5B32 B;  5GT0 C;  4KHA A;  3LJA A;  3W96 C;  4H9N A;  3WTP C;  3MGR B;  3V9R A;  5CP6 C;  4LD9 B;  3B6F C;  1KX4 B;  5E5A C;  5F99 D;  3AZH D;  1M18 A;  1P3L C;  3O62 D;  5B33 C;  1AOI D;  2BYM B;  3REK A;  4H9P A;  3LZ0 B;  5AV5 A;  3A6N A;  4YM6 D;  5C3I B;  2FJ7 C;  3REI D;  1F66 A;  4J8U C;  2NQB A;  5BNX A;  2CV5 D;  4X23 B;  5B1M C;  3REL D;  3AZG C;  5CPI A;  3UT9 B;  2F8N B;  3W98 D;  3B0D C;  5GXQ D;  3LJA B;  5GSU C;  2RVQ D;  4H9R A;  3W96 A;  3VH5 W;  1KX5 A;  3X1S B;  5B40 C;  1TZY C;  5AV9 C;  3MNN C;  5BT1 C;  5CP6 A;  5CPK B;  1P3M C;  3LZ1 C;  3KXB C;  5E5A A;  3REI B;  1P3I B;  5JRG B;  1P3L A;  1M1A A;  4H9P B;  4XZQ B;  4Z66 D;  5AV5 B;  3VH5 A;  5B0Y C;  1M19 A;  3AFA A;  5B24 C;  3MVD A;  3X1V D;  3REJ C;  3KWQ A;  4QLC C;  2FJ7 A;  2NQB B;  2HUE C;  4J8W C;  3C1B A;  4DRA A;  5BNX B;  4Z5T D;  5GSU D;  4J8U A;  3AZM C;  3UTB A;  5B2I A;  3WKJ A;  4E44 A;  3MGP A;  5B1L D;  4WU9 C;  5CPI B;  5AY8 C;  3B0C T;  5GT3 A;  4G91 C;  4WU8 A;  3KXB D;  1EQZ C;  3KUY C;  4J8V A;  3AZJ D;  3LEL A;  2IO5 B;  4H9R B;  4ZUX A;  3NQU A;  3AZK B;  1P3G C;  3WAA C;  4KGC C;  1N1J A;  3AV1 B;  5B40 A;  5AV9 A;  5B24 D;  3AZI C;  4Z2M G;  3MNN A;  2ARO C;  1P3M A;  5CPJ A;  1TAF B;  4QLC D;  3W99 B;  4E45 A;  5B32 C;  1M1A B;  1P3P A;  3AZE C;  4Z5T B;  3AZM D;  1M19 B;  3AFA B;  3MVD B;  4J8X A;  1BH8 A;  4WU9 D;  1S32 A;  5BNV B;  5BS7 C;  5B2J D;  5B0Y A;  3MGS D;  3AZL C;  1P34 D;  3KWQ B;  3B6G D;  5DNN A;  3REH C;  3C1B B;  4EO5 C;  1HQ3 B;  5AVB A;  1ZLA A;  3AV2 D;  4KUD A;  4UUZ A;  4G92 B;  2HIO D;  5B2I B;  1Q9C A;  2CWE A;  3UTB B;  3WKJ B;  3MGP B;  4R8P B;  3AZN C;  1U35 A;  5G49 B;  4XUJ D;  1P3A D;  5DNM B;  4WU8 B;  5AY8 A;  3AYW A;  2PYO B;  5C3I C;  4J8V B;  1P3F D;  3LEL B;  5B32 D;  4ZUX B;  4AWL B;  5AV8 A;  1ID3 A;  1N1J B;  1WWS A;  5AV6 D;  3UTA B;  3MGR D;  3TU4 A;  4X23 C;  4LD9 D;  5CPJ B;  1KX4 D;  1P3O B;  5F99 C;  1P3P B;  3AZH C;  4WZS B;  1P3K D;  3O62 C;  4J8X B;  3X1U A;  1AOI C;  1S32 B;  1A7W A;  4XUJ B;  5DNN B;  3LZ0 D;  5AVC A;  4YM6 C;  3C1C B;  1JFI A;  1ZLA B;  4JJN A;  4KUD B;  4UUZ B;  3REI C;  1P3I C;  5KDM A;  3AN2 B;  3X1T A;  4YS3 B;  5AV6 B;  2CV5 C;  3AZN A;  2NZD D;  4X23 D;  3AYW B;  3REL C;  4NE3 A;  3UT9 D;  5B0Z A;  5FUG B;  2F8N D;  3W98 C;  4WNN B;  5AV8 B;  5GXQ C;  5B31 A;  3LJA D;  1ID3 B;  3WA9 B;  2RVQ C;  1P3K B;  1P3B A;  3X1S D;  5CPK D;  1M18 D; 
#chains in the Genus database with same CATH topology
 3KSY A;  5F99 A;  2J8P A;  1P3I D;  5JRG D;  3X1U B;  3AZK C;  3VH6 W;  4XZQ D;  3MGQ B;  1KX3 B;  3W97 A;  4Z66 C;  1AOI A;  1F1E A;  4CAY A;  5AV5 D;  2NZD B;  4JJN B;  3AZF B;  3X1V C;  2NQB D;  5KDM B;  4KHA B;  1B67 A;  2W8S A;  4Z5T C;  4H9N B;  5GT0 A;  3V9R B;  2CV5 A;  4CSR A;  5CPI D;  5B1L C;  3WTP A;  5B0Z B;  2Y2J A;  5B31 B;  3B6F A;  1M18 B;  1HQ3 C;  5GXQ A;  1ULY A;  2YFV A;  1B6W A;  3AZJ C;  3REK B;  2Y2K A;  3AZK D;  1P3B B;  5B33 A;  1H3O A;  3AV1 D;  3A6N B;  2BYK A;  4HGA B;  3W99 D;  1F66 B;  1M1A D;  2XD5 A;  3W97 B;  1M19 D;  3AFA D;  3MVD D;  4NE5 A;  5B2J C;  3MGS C;  2Y2I A;  1P34 C;  5B1M A;  3KWQ D;  3B6G C;  3AZG A;  2Y2G A;  1P3O C;  3C1B D;  1HQ3 D;  3AV2 C;  5GT0 B;  3UTB D;  5B2I D;  2HIO C;  3WKJ D;  1KX5 B;  3H0R C;  3W96 B;  4CSR B;  3MGP D;  5GSU A;  4R8P D;  3WTP B;  4WJ3 C;  4H9S C;  5CP6 B;  5DNM D;  4XUJ C;  1P3A C;  1TZY A;  4WU8 D;  3B6F B;  5E5A B;  2PYO D;  4J8V D;  3LZ1 A;  1P3F C;  3KXB A;  3LEL D;  4ZUX D;  1P3L B;  2ZM5 A;  2Y2L A;  3AN2 C;  5AV6 C;  2BYK B;  3UTA D;  3MGR C;  4LD9 C;  5CPJ D;  5B24 A;  2FJ7 B;  1P3O D;  1KX4 C;  1P3P D;  3REJ A;  1BH9 A;  4QLC A;  4J8U B;  4J8W A;  3WA9 C;  1P3K C;  4J8X D;  5B32 G;  1S32 D;  3AZM A;  5B1M B;  5GT3 B;  1KU5 A;  3AZG B;  5DNN D;  4WU9 A;  3LZ0 C;  5AVB D;  3C1C D;  1ZLA D;  3B6G A;  4KUD D;  3B0D B;  1EQZ A;  1WWI A;  3NQU B;  3KUY A;  3AN2 D;  4YS3 D;  1U35 D;  1P3G A;  5B40 B;  1TZY B;  3VH5 T;  5AV9 B;  3WAA A;  4KGC A;  2BG1 A;  3MNN B;  2NZD C;  3AYW D;  4H9O A;  3AZI A;  3AZF C;  3LZ1 B;  1P3M B;  3UT9 C;  2ARO A;  5AV8 D;  1ID3 D;  3LJA C;  5B32 A;  4H9Q A;  3AZE A;  3WA9 D;  4ZBJ B;  1BH8 B;  2JSS A;  5B0Y B;  3X1S C;  5BS7 A;  3EPK A;  3F6T A;  3AZL A;  3REJ B;  5CPK C;  5AVB B;  1M18 C;  2HUE B;  3REH A;  3WTP E;  3X1U D;  5JRG C;  3REK C;  3MGQ D;  1KX3 D;  2F8N G;  4XZQ C;  1U35 B;  2Y2M A;  1PZR A;  5AY8 B;  5AV5 C;  5AVC D;  3A6N C;  4G91 B;  4JJN D;  3AZF D;  1EQZ B;  3KUY B;  1F66 C;  2Y2Q A;  2NQB C;  3WAA B;  4KGC B;  3TU4 B;  3B0C W;  1T3U A;  5CPI C;  3AZI B;  5JA4 A;  2ARO B;  5B0Z D;  4X23 A;  2YFW A;  5B31 D;  1HTA A;  2F8N K;  2F8N A;  4H9Q B;  3AZE B;  3AZH A;  3REK D;  2IO5 C;  1P3B D;  1KX5 C;  3O62 A;  3AL0 C;  3AV1 C;  3A6N D;  3AZL B;  5AVC B;  3X1S A;  1JFI B;  3REH B;  4EO5 B;  5CPK A;  4YM6 A;  1F66 D;  3W99 C;  3B0B A;  1M1A C;  3X1T B;  3REI A;  3W97 D;  1P3I A;  2JE5 A;  5JRG A;  3AZN B;  4XZQ A;  1M19 C;  3VH6 A;  3AFA C;  3MVD C;  3A1I A;  4Z2M H;  3NQJ A;  3KWQ C;  3REL A;  3C1B C;  3W98 A;  5GT0 D;  4G92 C;  3UTB C;  5B2I C;  1KX5 D;  3WKJ C;  3W96 D;  3MGP C;  4R8P C;  3WTP D;  4DQY B;  5JA4 B;  5GT3 C;  5CP6 D;  2YFW B;  5DNM C;  4WU8 C;  3B6F D;  4DRB A;  5E5A D;  2PYO C;  5F99 B;  4J8V C;  3AZH B;  3LEL C;  1P3L D;  4ZUX C;  5B33 D;  3O62 B;  4AWL C;  2LY8 A;  1AOI B;  3AZK A;  4CAY B;  3UTA C;  4Z66 A;  3AV1 A;  5CPJ C;  4YM6 B;  2FJ7 D;  1TAF A;  3X1V A;  1P3P C;  3W99 A;  4J8U D;  3FDD A;  2CV5 B;  4ZBJ C;  4J8X C;  4Z5T A;  3R45 A;  1S32 C;  5BO0 A;  3NQJ B;  5B1M D;  5GT3 D;  3REL B;  3AZG D;  5B1L A;  5BNV A;  5DNN C;  5AVB C;  3C1C C;  1ZLA C;  3W98 B;  4KUD C;  5GXQ B;  2YFV B;  1HQ3 A;  5B33 B;  1H3O B;  4YS3 C;  3AZJ A;  1U35 C;  5B40 D;  1TZY D;  5AV9 D;  4R8P A;  3MNN D;  5BT1 D;  5G49 A;  3AYW C;  5DNM A;  1P3M D;  3LZ1 D;  2PYO A;  5AV8 C;  1ID3 C;  2F8N H;  3VH6 T;  4Z66 B;  3TU4 C;  5B0Y D;  2G5H C;  3UTA A;  3P5J B;  5B2J A;  3MGS A;  3REJ D;  3X1V B;  1P34 A;  2RIQ A;  1P3O A;  3H0L C;  4J8W D;  3R45 B;  5GSU B;  3X1U C;  3AV2 A;  5BO0 B;  3MGQ C;  1KX3 C;  2HIO A;  5B1L B;  1BFM A;  4H9S A;  5AY8 D;  5AVC C;  4XUJ A;  1P3A A;  4JJN C;  1EQZ D;  3KXB B;  3KUY D;  3C1C A;  1P3F A;  3AZJ B;  3X1T C;  4NFT A;  1P3G D;  2DF4 C;  3WAA D;  4KGC D;  4NE6 A;  3AN2 A;  4YS3 A;  3TU4 D;  5AV6 A;  1R4V A;  3AZI D;  5B24 B;  2ARO D;  3MGR A;  5CHL B;  5B0Z C;  4LD9 A;  1BH9 B;  5B31 C;  4QLC B;  5FUG A;  1KX4 A;  4J8W B;  3AZE D;  4WNN A;  1P3B C;  3AZM B;  3WA9 A;  4WV4 B;  1P3K A;  2BYM A;  4WU9 B;  1Z2C B;  3H0M C;  5B2J B;  3MGS B;  3AZL D;  1P34 B;  3B6G B;  3LZ0 A;  3REH D;  2L5A A;  4HGA C;  3AV2 B;  3X1T D;  2HIO B;  4M6B A;  5B31 G;  3W97 C;  1P3G B;  3AZN D;  3MGQ A;  1KX3 A;  1P3A B;  4H9O B;  2NZD A;  2VQR A;  3AZF A;  3UT9 A;  1P3F B;  5B32 B;  2ZY2 A;  5GT0 C;  4KHA A;  3LJA A;  2FFF B;  3W96 C;  4H9N A;  3WTP C;  3MGR B;  3A1K A;  3V9R A;  5CP6 C;  4LD9 B;  3B6F C;  1KX4 B;  5E5A C;  2Y2H A;  5F99 D;  3AZH D;  1M18 A;  1P3L C;  3O62 D;  5B33 C;  1AOI D;  2BYM B;  3REK A;  4H9P A;  2JCH A;  3LZ0 B;  5AV5 A;  3A6N A;  4YM6 D;  5C3I B;  2FJ7 C;  3REI D;  1F66 A;  4J8U C;  2NQB A;  5BNX A;  2CV5 D;  4X23 B;  5B1M C;  3REL D;  3AZG C;  5CPI A;  3UT9 B;  2F8N B;  3W98 D;  3B0D C;  5GXQ D;  3LJA B;  5GSU C;  2RVQ D;  4H9R A;  3W96 A;  3VH5 W;  1KX5 A;  3X1S B;  5B40 C;  1TZY C;  5AV9 C;  2DQN C;  3MNN C;  5BT1 C;  5CP6 A;  5CPK B;  1P3M C;  3LZ1 C;  3KXB C;  5E5A A;  2XD1 A;  2Y2N A;  1W2E A;  3REI B;  1P3I B;  5JRG B;  1P3L A;  1M1A A;  4H9P B;  4XZQ B;  4Z66 D;  5AV5 B;  3VH5 A;  5B0Y C;  1M19 A;  3AFA A;  5B24 C;  3MVD A;  3X1V D;  3REJ C;  3KWQ A;  4QLC C;  2FJ7 A;  2NQB B;  2Y2O A;  2HUE C;  4J8W C;  3C1B A;  4DRA A;  5BNX B;  4Z5T D;  5GSU D;  4J8U A;  3AZM C;  2ZY5 A;  3UTB A;  5B2I A;  3WKJ A;  4E44 A;  3MGP A;  5B1L D;  4WU9 C;  5CPI B;  3IP4 C;  5AY8 C;  3B0C T;  5GT3 A;  4G91 C;  2F2A C;  4WU8 A;  3KXB D;  1EQZ C;  3KUY C;  4J8V A;  3AZJ D;  3LEL A;  2IO5 B;  4H9R B;  4ZUX A;  3NQU A;  3AZK B;  1P3G C;  3WAA C;  4KGC C;  1N1J A;  3EG5 B;  3AV1 B;  5B40 A;  5AV9 A;  5B24 D;  3AZI C;  4Z2M G;  3MNN A;  2ARO C;  1P3M A;  5CPJ A;  1TAF B;  4QLC D;  3W99 B;  4E45 A;  5B32 C;  1M1A B;  1P3P A;  3AZE C;  4Z5T B;  3AZM D;  1M19 B;  3AFA B;  3MVD B;  4J8X A;  1BH8 A;  4WU9 D;  1S32 A;  5BNV B;  5BS7 C;  5B2J D;  5B0Y A;  3MGS D;  3AZL C;  1P34 D;  3KWQ B;  3B6G D;  2G5I C;  5DNN A;  3REH C;  3C1B B;  4EO5 C;  2ZY3 A;  1HQ3 B;  5AVB A;  1ZLA A;  3EPJ A;  3AV2 D;  4KUD A;  4UUZ A;  4G92 B;  2HIO D;  5B2I B;  1Q9C A;  2CWE A;  3UTB B;  3WKJ B;  3MGP B;  4R8P B;  3AZN C;  1U35 A;  5G49 B;  4XUJ D;  1P3A D;  5DNM B;  4WU8 B;  5AY8 A;  3AYW A;  2PYO B;  5C3I C;  4J8V B;  1P3F D;  3LEL B;  5B32 D;  4ZUX B;  4AWL B;  5AV8 A;  1ID3 A;  1N1J B;  1WWS A;  5AV6 D;  4UPK A;  3UTA B;  3MGR D;  3TU4 A;  4X23 C;  4LD9 D;  5CPJ B;  3KFU G;  1KX4 D;  1P3O B;  5F99 C;  1P3P B;  3AZH C;  4WZS B;  2ZY4 A;  2UWX A;  1P3K D;  3O62 C;  4J8X B;  3X1U A;  1AOI C;  1S32 B;  1A7W A;  4XUJ B;  5DNN B;  2Y2P A;  3LZ0 D;  5AVC A;  4YM6 C;  3C1C B;  1JFI A;  1ZLA B;  4JJN A;  4KUD B;  4UUZ B;  3REI C;  1P3I C;  5KDM A;  3AN2 B;  3EPH A;  3X1T A;  4YS3 B;  5AV6 B;  3EPL A;  2CV5 C;  3AZN A;  2NZD D;  4X23 D;  3AYW B;  3REL C;  4NE3 A;  3UT9 D;  5B0Z A;  5FUG B;  2F8N D;  3W98 C;  4WNN B;  5AV8 B;  5GXQ C;  5B31 A;  3LJA D;  1ID3 B;  3WA9 B;  2RVQ C;  1P3K B;  1P3B A;  3X1S D;  5CPK D;  1M18 D; 
#chains in the Genus database with same CATH homology
 3KSY A;  5F99 A;  2J8P A;  1P3I D;  5JRG D;  3X1U B;  3AZK C;  3VH6 W;  4XZQ D;  3MGQ B;  1KX3 B;  3W97 A;  4Z66 C;  1AOI A;  1F1E A;  4CAY A;  5AV5 D;  2NZD B;  4JJN B;  3AZF B;  3X1V C;  2NQB D;  5KDM B;  4KHA B;  1B67 A;  2W8S A;  4Z5T C;  4H9N B;  5GT0 A;  3V9R B;  2CV5 A;  4CSR A;  5CPI D;  5B1L C;  3WTP A;  5B0Z B;  2Y2J A;  5B31 B;  3B6F A;  1M18 B;  1HQ3 C;  5GXQ A;  1ULY A;  2YFV A;  1B6W A;  3AZJ C;  3REK B;  2Y2K A;  3AZK D;  1P3B B;  5B33 A;  1H3O A;  3AV1 D;  3A6N B;  2BYK A;  4HGA B;  3W99 D;  1F66 B;  1M1A D;  2XD5 A;  3W97 B;  1M19 D;  3AFA D;  3MVD D;  4NE5 A;  5B2J C;  3MGS C;  2Y2I A;  1P34 C;  5B1M A;  3KWQ D;  3B6G C;  3AZG A;  2Y2G A;  1P3O C;  3C1B D;  1HQ3 D;  3AV2 C;  5GT0 B;  3UTB D;  5B2I D;  2HIO C;  3WKJ D;  1KX5 B;  3H0R C;  3W96 B;  4CSR B;  3MGP D;  5GSU A;  4R8P D;  3WTP B;  4WJ3 C;  4H9S C;  5CP6 B;  5DNM D;  4XUJ C;  1P3A C;  1TZY A;  4WU8 D;  3B6F B;  5E5A B;  2PYO D;  4J8V D;  3LZ1 A;  1P3F C;  3KXB A;  3LEL D;  4ZUX D;  1P3L B;  2ZM5 A;  2Y2L A;  3AN2 C;  5AV6 C;  2BYK B;  3UTA D;  3MGR C;  4LD9 C;  5CPJ D;  5B24 A;  2FJ7 B;  1P3O D;  1KX4 C;  1P3P D;  3REJ A;  1BH9 A;  4QLC A;  4J8U B;  4J8W A;  3WA9 C;  1P3K C;  4J8X D;  5B32 G;  1S32 D;  3AZM A;  5B1M B;  5GT3 B;  1KU5 A;  3AZG B;  5DNN D;  4WU9 A;  3LZ0 C;  5AVB D;  3C1C D;  1ZLA D;  3B6G A;  4KUD D;  3B0D B;  1EQZ A;  1WWI A;  3NQU B;  3KUY A;  3AN2 D;  4YS3 D;  1U35 D;  1P3G A;  5B40 B;  1TZY B;  3VH5 T;  5AV9 B;  3WAA A;  4KGC A;  2BG1 A;  3MNN B;  2NZD C;  3AYW D;  4H9O A;  3AZI A;  3AZF C;  3LZ1 B;  1P3M B;  3UT9 C;  2ARO A;  5AV8 D;  1ID3 D;  3LJA C;  5B32 A;  4H9Q A;  3AZE A;  3WA9 D;  4ZBJ B;  1BH8 B;  2JSS A;  5B0Y B;  3X1S C;  5BS7 A;  3EPK A;  3F6T A;  3AZL A;  3REJ B;  5CPK C;  5AVB B;  1M18 C;  2HUE B;  3REH A;  3WTP E;  3X1U D;  5JRG C;  3REK C;  3MGQ D;  1KX3 D;  2F8N G;  4XZQ C;  1U35 B;  2Y2M A;  1PZR A;  5AY8 B;  5AV5 C;  5AVC D;  3A6N C;  4G91 B;  4JJN D;  3AZF D;  1EQZ B;  3KUY B;  1F66 C;  2Y2Q A;  2NQB C;  3WAA B;  4KGC B;  3TU4 B;  3B0C W;  1T3U A;  5CPI C;  3AZI B;  5JA4 A;  2ARO B;  5B0Z D;  4X23 A;  2YFW A;  5B31 D;  1HTA A;  2F8N K;  2F8N A;  4H9Q B;  3AZE B;  3AZH A;  3REK D;  2IO5 C;  1P3B D;  1KX5 C;  3O62 A;  3AL0 C;  3AV1 C;  3A6N D;  3AZL B;  5AVC B;  3X1S A;  1JFI B;  3REH B;  4EO5 B;  5CPK A;  4YM6 A;  1F66 D;  3W99 C;  3B0B A;  1M1A C;  3X1T B;  3REI A;  3W97 D;  1P3I A;  2JE5 A;  5JRG A;  3AZN B;  4XZQ A;  1M19 C;  3VH6 A;  3AFA C;  3MVD C;  3A1I A;  4Z2M H;  3NQJ A;  3KWQ C;  3REL A;  3C1B C;  3W98 A;  5GT0 D;  4G92 C;  3UTB C;  5B2I C;  1KX5 D;  3WKJ C;  3W96 D;  3MGP C;  4R8P C;  3WTP D;  4DQY B;  5JA4 B;  5GT3 C;  5CP6 D;  2YFW B;  5DNM C;  4WU8 C;  3B6F D;  4DRB A;  5E5A D;  2PYO C;  5F99 B;  4J8V C;  3AZH B;  3LEL C;  1P3L D;  4ZUX C;  5B33 D;  3O62 B;  4AWL C;  2LY8 A;  1AOI B;  3AZK A;  4CAY B;  3UTA C;  4Z66 A;  3AV1 A;  5CPJ C;  4YM6 B;  2FJ7 D;  1TAF A;  3X1V A;  1P3P C;  3W99 A;  4J8U D;  3FDD A;  2CV5 B;  4ZBJ C;  4J8X C;  4Z5T A;  3R45 A;  1S32 C;  5BO0 A;  3NQJ B;  5B1M D;  5GT3 D;  3REL B;  3AZG D;  5B1L A;  5BNV A;  5DNN C;  5AVB C;  3C1C C;  1ZLA C;  3W98 B;  4KUD C;  5GXQ B;  2YFV B;  1HQ3 A;  5B33 B;  1H3O B;  4YS3 C;  3AZJ A;  1U35 C;  5B40 D;  1TZY D;  5AV9 D;  4R8P A;  3MNN D;  5BT1 D;  5G49 A;  3AYW C;  5DNM A;  1P3M D;  3LZ1 D;  2PYO A;  5AV8 C;  1ID3 C;  2F8N H;  3VH6 T;  4Z66 B;  3TU4 C;  5B0Y D;  2G5H C;  3UTA A;  3P5J B;  5B2J A;  3MGS A;  3REJ D;  3X1V B;  1P34 A;  2RIQ A;  1P3O A;  3H0L C;  4J8W D;  3R45 B;  5GSU B;  3X1U C;  3AV2 A;  5BO0 B;  3MGQ C;  1KX3 C;  2HIO A;  5B1L B;  1BFM A;  4H9S A;  5AY8 D;  5AVC C;  4XUJ A;  1P3A A;  4JJN C;  1EQZ D;  3KXB B;  3KUY D;  3C1C A;  1P3F A;  3AZJ B;  3X1T C;  4NFT A;  1P3G D;  2DF4 C;  3WAA D;  4KGC D;  4NE6 A;  3AN2 A;  4YS3 A;  3TU4 D;  5AV6 A;  1R4V A;  3AZI D;  5B24 B;  2ARO D;  3MGR A;  5CHL B;  5B0Z C;  4LD9 A;  1BH9 B;  5B31 C;  4QLC B;  5FUG A;  1KX4 A;  4J8W B;  3AZE D;  4WNN A;  1P3B C;  3AZM B;  3WA9 A;  4WV4 B;  1P3K A;  2BYM A;  4WU9 B;  1Z2C B;  3H0M C;  5B2J B;  3MGS B;  3AZL D;  1P34 B;  3B6G B;  3LZ0 A;  3REH D;  2L5A A;  4HGA C;  3AV2 B;  3X1T D;  2HIO B;  4M6B A;  5B31 G;  3W97 C;  1P3G B;  3AZN D;  3MGQ A;  1KX3 A;  1P3A B;  4H9O B;  2NZD A;  2VQR A;  3AZF A;  3UT9 A;  1P3F B;  5B32 B;  2ZY2 A;  5GT0 C;  4KHA A;  3LJA A;  2FFF B;  3W96 C;  4H9N A;  3WTP C;  3MGR B;  3A1K A;  3V9R A;  5CP6 C;  4LD9 B;  3B6F C;  1KX4 B;  5E5A C;  2Y2H A;  5F99 D;  3AZH D;  1M18 A;  1P3L C;  3O62 D;  5B33 C;  1AOI D;  2BYM B;  3REK A;  4H9P A;  2JCH A;  3LZ0 B;  5AV5 A;  3A6N A;  4YM6 D;  5C3I B;  2FJ7 C;  3REI D;  1F66 A;  4J8U C;  2NQB A;  5BNX A;  2CV5 D;  4X23 B;  5B1M C;  3REL D;  3AZG C;  5CPI A;  3UT9 B;  2F8N B;  3W98 D;  3B0D C;  5GXQ D;  3LJA B;  5GSU C;  2RVQ D;  4H9R A;  3W96 A;  3VH5 W;  1KX5 A;  3X1S B;  5B40 C;  1TZY C;  5AV9 C;  2DQN C;  3MNN C;  5BT1 C;  5CP6 A;  5CPK B;  1P3M C;  3LZ1 C;  3KXB C;  5E5A A;  2XD1 A;  2Y2N A;  1W2E A;  3REI B;  1P3I B;  5JRG B;  1P3L A;  1M1A A;  4H9P B;  4XZQ B;  4Z66 D;  5AV5 B;  3VH5 A;  5B0Y C;  1M19 A;  3AFA A;  5B24 C;  3MVD A;  3X1V D;  3REJ C;  3KWQ A;  4QLC C;  2FJ7 A;  2NQB B;  2Y2O A;  2HUE C;  4J8W C;  3C1B A;  4DRA A;  5BNX B;  4Z5T D;  5GSU D;  4J8U A;  3AZM C;  2ZY5 A;  3UTB A;  5B2I A;  3WKJ A;  4E44 A;  3MGP A;  5B1L D;  4WU9 C;  5CPI B;  3IP4 C;  5AY8 C;  3B0C T;  5GT3 A;  4G91 C;  2F2A C;  4WU8 A;  3KXB D;  1EQZ C;  3KUY C;  4J8V A;  3AZJ D;  3LEL A;  2IO5 B;  4H9R B;  4ZUX A;  3NQU A;  3AZK B;  1P3G C;  3WAA C;  4KGC C;  1N1J A;  3EG5 B;  3AV1 B;  5B40 A;  5AV9 A;  5B24 D;  3AZI C;  4Z2M G;  3MNN A;  2ARO C;  1P3M A;  5CPJ A;  1TAF B;  4QLC D;  3W99 B;  4E45 A;  5B32 C;  1M1A B;  1P3P A;  3AZE C;  4Z5T B;  3AZM D;  1M19 B;  3AFA B;  3MVD B;  4J8X A;  1BH8 A;  4WU9 D;  1S32 A;  5BNV B;  5BS7 C;  5B2J D;  5B0Y A;  3MGS D;  3AZL C;  1P34 D;  3KWQ B;  3B6G D;  2G5I C;  5DNN A;  3REH C;  3C1B B;  4EO5 C;  2ZY3 A;  1HQ3 B;  5AVB A;  1ZLA A;  3EPJ A;  3AV2 D;  4KUD A;  4UUZ A;  4G92 B;  2HIO D;  5B2I B;  1Q9C A;  2CWE A;  3UTB B;  3WKJ B;  3MGP B;  4R8P B;  3AZN C;  1U35 A;  5G49 B;  4XUJ D;  1P3A D;  5DNM B;  4WU8 B;  5AY8 A;  3AYW A;  2PYO B;  5C3I C;  4J8V B;  1P3F D;  3LEL B;  5B32 D;  4ZUX B;  4AWL B;  5AV8 A;  1ID3 A;  1N1J B;  1WWS A;  5AV6 D;  4UPK A;  3UTA B;  3MGR D;  3TU4 A;  4X23 C;  4LD9 D;  5CPJ B;  3KFU G;  1KX4 D;  1P3O B;  5F99 C;  1P3P B;  3AZH C;  4WZS B;  2ZY4 A;  2UWX A;  1P3K D;  3O62 C;  4J8X B;  3X1U A;  1AOI C;  1S32 B;  1A7W A;  4XUJ B;  5DNN B;  2Y2P A;  3LZ0 D;  5AVC A;  4YM6 C;  3C1C B;  1JFI A;  1ZLA B;  4JJN A;  4KUD B;  4UUZ B;  3REI C;  1P3I C;  5KDM A;  3AN2 B;  3EPH A;  3X1T A;  4YS3 B;  5AV6 B;  3EPL A;  2CV5 C;  3AZN A;  2NZD D;  4X23 D;  3AYW B;  3REL C;  4NE3 A;  3UT9 D;  5B0Z A;  5FUG B;  2F8N D;  3W98 C;  4WNN B;  5AV8 B;  5GXQ C;  5B31 A;  3LJA D;  1ID3 B;  3WA9 B;  2RVQ C;  1P3K B;  1P3B A;  3X1S D;  5CPK D;  1M18 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...