5CPKC

Nucleosome containing methylated sat2l dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkC00
1U35D 2AROD 3A6NC 5B32C 5CPJC 1M18B 4H9OA 5B1MD 3LELB 3UT9C 2PYOC 1TAFB 5AV6A 4WU8D 3KUYA 1P3LD 4J8WB 1P3OC 3RELD 4KHAA 1ZLAC 4YS3D 4Z66A 3AZJA 3B6FD 1P3MD 2F8NB 3AZED 4KUDA 5JRGC 1A7WA 3B0CT 4J8XC 1EQZC 1AOIC 3B0BA 1U35C 3AV1D 3AZKA 5GT3B 5G49B 5GXQB 3LZ1D 5B24B 5E5AD 5B1MC 1ID3A 3C1BB 5AVCD 3MGRA 1ULYA 2JSSA 3AV2D 4WU8C 5CPKD 3V9RB 3RELC 3B6FC 3MGQB 4YS3C 1P3MC 3W96B 3AZEC 3MGPB 3VH5W 3MGSB 3W97B 3A6NA 3W99B 4H9SC 1P3FD 5B0ZB 1M18C 2BYMA 5AY8A 3LZ1C 2PYOA 4WNNB 5DNND 3AZMA 2IO5B 3AN2A 3C1CD 5AVCC 1M19B 1P34A 2YFVA 4CAYB 3W96D 5BNVB 3MGSD 3UTBA 4AWLB 1AOIA 1EQZA 1M1AB 3WAAA 5CPIA 1P3IA 5FUGA 1TZYB 1P3FC 3REHA 1P3AB 4H9NB 5B24C 5JA4A 5AV8D 3C1BC 4WU8A 1P3KB 3MNNA 1KX3A 3C1CC 3REID 5B1LB 2NZDD 3LZ0B 3W96C 5BNXA 3MGSC 3X1TD 4H9RB 5CP6B 3AZFD 1M18A 3LELA 5DNMB 1TAFA 5AV8C 3LJAD 2IO5C 4J8WA 2NQBB 3VH5T 1B67A 2F8NA 3REIC 2CV5D 4Z5TB 5B31B 3AZIB 4AWLC 5B40B 4XZQD 2FJ7D 3NQJB 5GT3A 1S32B 5GXQA 5DNMD 5KDMA 5B24A 4YM6B 4X23D 3C1BA 3UTAB 4LD9B 2L5AA 3LJAC 3V9RA 1F1EA 4R8PA 3MGQA 5B40D 3MGPA 2CV5C 3W97A 1JFIB 3W99A 2BYKB 5B0ZA 3MVDD 5AV5B 5AV9B 1F66D 5DNMC 4WU9B 1M19A 2NQBC 1B6WA 3UT9B 4XUJB 2F8NK 4CAYA 3X1VD 1P3OB 5B2IB 1M1AA 5B40C 1TZYA 4J8XB 5AV9D 3AYWA 1P3AA 4H9NA 1U35B 2AROB 4WU9D 1R4VA 1P3KA 1F66C 3UTAC 1KX5D 4LD9C 3AZLD 3O62D 5B1LA 1KU5A 2RVQC 3LZ0A 5B32G 3KXBA 3X1VC 5B2ID 1P3LB 3X1SD 3RELB 5CP6A 1P3MB 3AZEB 4M6BA 5AV5C 5AV9C 4WU9C 5CHLB 3AV1B 2NQBA 3LZ1B 5F99D 4XUJC 5E5AB 3O62C 3AZLC 3AZGD 4Z5TA 5B31A 5AVCB 5B2IC 3AZIA 3AV2B 5CPKB 3X1SC 3NQJA 1S32A 3B0DC 4YM6A 4JJNB 2AROC 1P3FB 3UTAA 4LD9A 1P3PB 2YFWB 3W98B 5DNNB 1P3LC 5GT0A 3C1CB 1JFIA 2BYKA 2HIOA 5BO0B 3AZNB 1P3GD 5AV5A 4JJND 3AFAD 5B32A 5AV9A 2CWEA 5CPJA 1KX4D 3B6GB 1P3PD 3AV1C 2F8NG 3UT9A 4XUJA 3W98D 5E5AC 5AV8B 1P3OA 1N1JB 1ZLAA 3AV2C 5CPKC 4NE5A 3REIB 3AZND 3WTPB 5JRGA 2NZDB 5B0YD 4J8XA 4J8UD 1U35A 2AROA 3B6GD 4JJNC 4ZBJC 3X1TB 4H9QB 2F8NH 3AZFB 1P3PC 5B1MA 3W98C 5DNNC 1WWIA 4ZUXB 1P3LA 3LJAB 3RELA 3B6FA 3WTPD 3REKD 2LY8A 4YS3A 1HQ3D 1P3MA 4E45A 4KGCD 5BS7C 3AZEA 3AZNC 2CV5B 3TU4B 5B0YC 4H9SA 3B6GC 4XZQB 3AV1A 2FJ7B 4QLCD 3LZ1A 5E5AA 4ZUXD 4X23B 5AVCA 3AV2A 5AVBB 5CPKA 3R45B 3WTPC 3REKC 3TU4D 2NZDC 1BFMA 1HQ3C 4KGCC 3WKJD 3KWQD 4JJNA 5B2JD 3X1UB 2HUEC 3X1TC 1P3FA 4J8VD 5G49A 3AZFC 5B33D 2YFWA 3MVDB 4WZSB 5DNNA 1F66B 5AVBD 4ZUXC 3WTPE 4E44A 3C1CA 1P3BB 3X1VB 5BO0A 3AZNA 3W96A 3TU4C 3MGSA 3X1UD 3KWQC 4XZQC 2FJ7C 5B31G 3WA9B 5B33C 4WNNA 5AV8A 4KUDB 4X23C 1KX5B 1N1JA 1P3BD 5AVBC 3AZLB 3O62B 3REIA 3WTPA 2NZDA 5BNVA 1Q9CA 3X1SB 5AV6D 3X1TA 3X1UC 3AZFA 3B0DB 3REJB 3WA9D 3AZJD 4Z66D 3MVDC 4KUDD 3LJAA 5F99B 1P3BC 3AZHB 3AZKD 4CSRB 3AZGB 2CV5A 4G92B 5AY8B 4H9RA 1ID3D 3MGRD 3REJD 4XZQA 3AN2B 2FJ7A 4J8XD 3WA9C 5DNMA 2YFVB 3AZJC 1BH9B 4KUDC 4X23A 3A6ND 1KX5C 3AZHD 3WAAB 5CPIB 3R45A 3AZKC 3REHB 5AY8D 5B40A 3AZMD 3AN2D 3MGRC 1P34D 3REJC 1P3GB 3MVDA 4ZBJB 3AFAB 1KX4B 1F66A 3UTBD 1EQZD 1AOID 5BNXB 3WAAD 1P3BA 5CPID 1P3ID 5F99C 3AZHC 3X1VA 3REHD 3AZGC 4G92C 5AY8C 4G91B 3AZMC 3MNND 1KX3D 3AN2C 5B0YB 4J8UB 3WA9A 1P34C 3VH6A 1H3OB 4WU9A 4H9PB 1KX5A 3UTBC 3AZLA 3O62A 4UUZB 3WAAC 1M18D 5CPIC 1P3IC 5B2IA 3NQUB 3LELD 3REHC 5KDMB 3X1SA 4NE3A 3REKB 4J8WD 1HQ3B 3REJA 4KGCB 1P3GC 3MNNC 1KX3C 2F8ND 2HUEB 3AFAC 4R8PB 1KX4C 4QLCB 5F99A 3AZHA 4CSRA 5GT3D 5GXQD 3AZGA 5B24D 3LELC 3C1BD 4G91C 4J8WC 4J8UC 4R8PD 3MGQD 3WKJB 3KWQB 1BH9A 4EO5B 5B2JB 3MGPD 4J8VB 4HGAB 3W97D 3W99D 4Z2MG 5B33B 4DRAA 5B0ZD 5GT3C 5GXQC 3AYWB 1M19D 1P3GA 5GSUB 3AFAA 4R8PC 1BH8B 3KXBB 3MGQC 1KX4A 3KSYA 4Z2MH 1P3PA 1M1AD 3MGPC 4QLCC 3W97C 3W99C 3W98A 1TZYD 5B0ZC 3AYWD 1P3AD 3VH6W 1P3KD 5BS7A 5B0YA 4J8UA 4H9OB 5GSUD 4NFTA 1M19C 5B1LD 3LZ0D 3KXBD 3B6GA 1H3OA 5AV6B 3KUYB 4EO5C 5B2JC 4H9PA 3WKJC 4J8VC 4HGAC 4KHAB 3AZJB 4Z66B 5CP6D 1M1AC 4UUZA 5C3IB 1TZYC 3NQUA 3AYWC 1P3AC 3REKA 4NE6A 3AZKB 2NQBD 1HQ3A 1P3KC 4KGCA 3KUYD 4DRBA 5GSUC 1ID3B 4Z5TD 4H9QA 5B1LC 4WV4B 5B31D 3KXBC 3LZ0C 3MGRB 3AZID 5GT0B 4QLCA 5CP6C 2HIOB 1S32D 4ZUXA 4YM6D 3A6NB 5B32B 5CPJB 3UTAD 4LD9D 3TU4A 3VH5A 3B0CW 2BYMB 2RVQD 2PYOB 5BT1D 3WKJA 3KWQA 5B2JA 5AV6C 3AZMB 3KUYC 4Z5TC 5B31C 1HTAA 5GT0D 4J8VA 1ZLAB 1P34B 5B33A 3AZIC 4Z66C 2HIOD 3VH6T 5JRGB 5C3IC 5AV5D 3UTBB 1S32C 5B32D 5AVBA 1AOIB 1EQZB 5CPJD 4YM6C 1P3IB 5FUGB 3UT9D 4XUJD 2PYOD 5JA4B 5B1MB 5GSUA 3X1UA 1P3OD 1ID3C 1BH8A 5BT1C 1WWSA 4WU8B 1ZLAD 3MNNB 1KX3B 5GT0C 3B6FB 5JRGD 4YS3B 2HIOC
chains in the Genus database with same CATH superfamily
1U35D 2AROD 3A6NC 5B32C 5CPJC 1M18B 3A1IA 2Y2JA 4H9OA 5B1MD 3LELB 3UT9C 1Z2CB 2PYOC 1TAFB 5AV6A 4WU8D 3KUYA 1P3LD 4J8WB 1P3OC 3RELD 2XD1A 4KHAA 1ZLAC 4YS3D 4Z66A 3AZJA 3B6FD 1P3MD 2F8NB 3AZED 4KUDA 5JRGC 1A7WA 3B0CT 4J8XC 1EQZC 1AOIC 3B0BA 1U35C 3AV1D 3AZKA 5GT3B 5G49B 5GXQB 3LZ1D 5B24B 2Y2IA 5E5AD 5B1MC 1ID3A 3C1BB 5AVCD 3MGRA 1ULYA 2JSSA 3AV2D 4WU8C 5CPKD 3P5JB 3V9RB 3RELC 3B6FC 3MGQB 4YS3C 1P3MC 3W96B 3AZEC 3MGPB 3VH5W 3MGSB 3W97B 3A6NA 3W99B 4H9SC 1P3FD 5B0ZB 1M18C 2BYMA 5AY8A 3LZ1C 2PYOA 4WNNB 5DNND 3AZMA 2IO5B 3AN2A 3C1CD 5AVCC 1M19B 1P34A 2YFVA 4CAYB 3W96D 5BNVB 3MGSD 3UTBA 4AWLB 1AOIA 1EQZA 1M1AB 3WAAA 5CPIA 1P3IA 5FUGA 1TZYB 1P3FC 3REHA 1P3AB 4H9NB 5B24C 5JA4A 5AV8D 3C1BC 4WU8A 1P3KB 2FFFB 3MNNA 1KX3A 3EPLA 3C1CC 3REID 5B1LB 2NZDD 3LZ0B 3W96C 5BNXA 3MGSC 3X1TD 4H9RB 5CP6B 3KFUG 3AZFD 1M18A 2Y2PA 3LELA 5DNMB 1TAFA 3EPKA 5AV8C 3LJAD 2IO5C 4J8WA 2NQBB 3VH5T 1B67A 2F8NA 3REIC 2CV5D 4Z5TB 5B31B 2ZY3A 3AZIB 4AWLC 5B40B 4XZQD 2FJ7D 3NQJB 5GT3A 1S32B 5GXQA 5DNMD 5KDMA 5B24A 4YM6B 4X23D 3C1BA 3UTAB 2G5IC 4LD9B 2L5AA 3LJAC 3V9RA 1F1EA 3A1KA 4R8PA 3MGQA 5B40D 3MGPA 2CV5C 3W97A 1JFIB 3W99A 2BYKB 5B0ZA 3MVDD 5AV5B 5AV9B 1F66D 5DNMC 2ZY4A 4WU9B 1M19A 2NQBC 1B6WA 3UT9B 4XUJB 2F8NK 4CAYA 3X1VD 1P3OB 5B2IB 1M1AA 5B40C 1TZYA 4J8XB 4DQYB 5AV9D 3AYWA 1P3AA 4H9NA 1U35B 2AROB 4WU9D 1R4VA 1P3KA 1F66C 3UTAC 1KX5D 4LD9C 3AZLD 3O62D 5B1LA 1KU5A 2RVQC 3LZ0A 5B32G 3KXBA 3X1VC 5B2ID 1P3LB 3X1SD 3RELB 5CP6A 2VQRA 1P3MB 3AZEB 4M6BA 5AV5C 5AV9C 4WU9C 5CHLB 3AV1B 2NQBA 3LZ1B 5F99D 2W8SA 4XUJC 5E5AB 3O62C 3AZLC 3IP4C 3AZGD 4Z5TA 5B31A 5AVCB 5B2IC 3AZIA 3AV2B 5CPKB 2J8PA 3X1SC 3NQJA 1S32A 3B0DC 4YM6A 4JJNB 2AROC 1P3FB 3UTAA 3EG5B 4LD9A 1P3PB 2YFWB 2G5HC 3W98B 5DNNB 1W2EA 1P3LC 5GT0A 3C1CB 1JFIA 2Y2OA 2BYKA 2HIOA 5BO0B 3AZNB 1P3GD 5AV5A 4JJND 3AFAD 5B32A 5AV9A 2CWEA 5CPJA 1KX4D 3B6GB 1P3PD 3AV1C 2F8NG 3UT9A 4XUJA 2Y2QA 3W98D 5E5AC 5AV8B 1P3OA 1N1JB 1ZLAA 3AV2C 5CPKC 4NE5A 3REIB 3AZND 3WTPB 5JRGA 2NZDB 5B0YD 4J8XA 4J8UD 1U35A 2AROA 3B6GD 4JJNC 4ZBJC 3X1TB 4H9QB 2F8NH 3AZFB 4UPKA 1P3PC 5B1MA 3W98C 5DNNC 1WWIA 4ZUXB 1P3LA 3LJAB 3RELA 3B6FA 3WTPD 3REKD 2LY8A 4YS3A 1HQ3D 1P3MA 4E45A 4KGCD 5BS7C 3AZEA 3AZNC 2CV5B 3TU4B 5B0YC 4H9SA 2ZY2A 3B6GC 4XZQB 3AV1A 2FJ7B 4QLCD 3LZ1A 5E5AA 4ZUXD 4X23B 5AVCA 3AV2A 5AVBB 5CPKA 3R45B 3WTPC 3REKC 3TU4D 2NZDC 1BFMA 1HQ3C 2DF4C 4KGCC 3WKJD 3KWQD 4JJNA 5B2JD 3X1UB 2HUEC 3X1TC 1P3FA 4J8VD 5G49A 3AZFC 4WJ3C 5B33D 2YFWA 3MVDB 4WZSB 5DNNA 1F66B 5AVBD 4ZUXC 3WTPE 4E44A 3C1CA 1P3BB 3X1VB 5BO0A 3AZNA 3W96A 3TU4C 3MGSA 3X1UD 2XD5A 3KWQC 4XZQC 2FJ7C 2JE5A 5B31G 3WA9B 5B33C 4WNNA 5AV8A 4KUDB 4X23C 1KX5B 1N1JA 1P3BD 5AVBC 3AZLB 3O62B 3REIA 1PZRA 3WTPA 2NZDA 5BNVA 1Q9CA 3H0MC 3X1SB 5AV6D 3X1TA 3X1UC 3AZFA 3B0DB 2Y2KA 3REJB 3WA9D 2Y2LA 3AZJD 4Z66D 3MVDC 4KUDD 3LJAA 5F99B 1P3BC 3AZHB 3AZKD 4CSRB 3AZGB 2CV5A 4G92B 5AY8B 4H9RA 1ID3D 3EPHA 3MGRD 3REJD 4XZQA 3AN2B 2FJ7A 4J8XD 3WA9C 5DNMA 2YFVB 3AZJC 1BH9B 4KUDC 4X23A 3A6ND 1KX5C 3AZHD 3WAAB 5CPIB 3R45A 2Y2MA 3AZKC 2Y2GA 3REHB 5AY8D 5B40A 2Y2HA 3AZMD 3AN2D 3MGRC 1T3UA 1P34D 3REJC 1P3GB 3MVDA 4ZBJB 3AFAB 1KX4B 1F66A 3UTBD 2Y2NA 1AOID 1EQZD 2RIQA 5BNXB 3WAAD 1P3BA 5CPID 1P3ID 5F99C 3AZHC 2ZY5A 3X1VA 3REHD 3AZGC 4G92C 5AY8C 4G91B 3AZMC 3MNND 1KX3D 3AN2C 5B0YB 2F2AC 4J8UB 3WA9A 1P34C 3VH6A 1H3OB 4WU9A 4H9PB 1KX5A 3UTBC 3AZLA 3O62A 4UUZB 3WAAC 1M18D 5CPIC 1P3IC 5B2IA 3NQUB 3LELD 3REHC 5KDMB 3X1SA 4NE3A 3REKB 4J8WD 1HQ3B 3REJA 4KGCB 1P3GC 3MNNC 1KX3C 2F8ND 2HUEB 3AFAC 4R8PB 1KX4C 2BG1A 4QLCB 5F99A 3AZHA 4CSRA 5GT3D 5GXQD 3AZGA 5B24D 3LELC 3C1BD 4G91C 4J8WC 4J8UC 4R8PD 3MGQD 2UWXA 3WKJB 3KWQB 1BH9A 4EO5B 5B2JB 3MGPD 4J8VB 4HGAB 3W97D 3H0RC 3W99D 4Z2MG 5B33B 4DRAA 5B0ZD 5GT3C 5GXQC 3AYWB 1M19D 1P3GA 5GSUB 3AFAA 4R8PC 1BH8B 3KXBB 3MGQC 1KX4A 3KSYA 4Z2MH 1P3PA 1M1AD 3MGPC 4QLCC 3W97C 3W99C 3W98A 1TZYD 5B0ZC 3AYWD 1P3AD 3VH6W 1P3KD 5BS7A 5B0YA 4J8UA 4H9OB 5GSUD 4NFTA 1M19C 5B1LD 3LZ0D 3KXBD 3B6GA 1H3OA 5AV6B 3KUYB 4EO5C 5B2JC 4H9PA 3WKJC 4J8VC 4HGAC 4KHAB 3AZJB 4Z66B 5CP6D 1M1AC 3F6TA 4UUZA 5C3IB 1TZYC 3AL0C 3NQUA 2ZM5A 3AYWC 1P3AC 2JCHA 3REKA 4NE6A 3AZKB 2NQBD 1HQ3A 1P3KC 4KGCA 2DQNC 3KUYD 4DRBA 5GSUC 1ID3B 4Z5TD 4H9QA 5B1LC 4WV4B 5B31D 3KXBC 3LZ0C 3MGRB 3AZID 5GT0B 4QLCA 5CP6C 2HIOB 1S32D 4ZUXA 4YM6D 3A6NB 5B32B 5CPJB 3UTAD 4LD9D 3TU4A 3VH5A 3B0CW 3H0LC 2BYMB 2RVQD 2PYOB 5BT1D 3WKJA 3KWQA 5B2JA 5AV6C 3AZMB 3KUYC 4Z5TC 5B31C 1HTAA 5GT0D 4J8VA 1ZLAB 1P34B 5B33A 3AZIC 4Z66C 2HIOD 3VH6T 5JRGB 5C3IC 5AV5D 3FDDA 3UTBB 5B32D 5AVBA 1S32C 1AOIB 1EQZB 5CPJD 3EPJA 4YM6C 1P3IB 5FUGB 3UT9D 4XUJD 2PYOD 5JA4B 5B1MB 5GSUA 3X1UA 1P3OD 1ID3C 1BH8A 5BT1C 1WWSA 4WU8B 1ZLAD 3MNNB 1KX3B 5GT0C 3B6FB 5JRGD 4YS3B 2HIOC
chains in the Genus database with same CATH topology
1U35D 2AROD 3A6NC 5B32C 5CPJC 1M18B 3A1IA 2Y2JA 4H9OA 5B1MD 3LELB 3UT9C 1Z2CB 2PYOC 1TAFB 5AV6A 4WU8D 3KUYA 1P3LD 4J8WB 1P3OC 3RELD 2XD1A 4KHAA 1ZLAC 4YS3D 4Z66A 3AZJA 3B6FD 1P3MD 2F8NB 3AZED 4KUDA 5JRGC 1A7WA 3B0CT 4J8XC 1EQZC 1AOIC 3B0BA 1U35C 3AV1D 3AZKA 5GT3B 5G49B 5GXQB 3LZ1D 5B24B 2Y2IA 5E5AD 5B1MC 1ID3A 3C1BB 5AVCD 3MGRA 1ULYA 2JSSA 3AV2D 4WU8C 5CPKD 3P5JB 3V9RB 3RELC 3B6FC 3MGQB 4YS3C 1P3MC 3W96B 3AZEC 3MGPB 3VH5W 3MGSB 3W97B 3A6NA 3W99B 4H9SC 1P3FD 5B0ZB 1M18C 2BYMA 5AY8A 3LZ1C 2PYOA 4WNNB 5DNND 3AZMA 2IO5B 3AN2A 3C1CD 5AVCC 1M19B 1P34A 2YFVA 4CAYB 3W96D 5BNVB 3MGSD 3UTBA 4AWLB 1AOIA 1EQZA 1M1AB 3WAAA 5CPIA 1P3IA 5FUGA 1TZYB 1P3FC 3REHA 1P3AB 4H9NB 5B24C 5JA4A 5AV8D 3C1BC 4WU8A 1P3KB 2FFFB 3MNNA 1KX3A 3EPLA 3C1CC 3REID 5B1LB 2NZDD 3LZ0B 3W96C 5BNXA 3MGSC 3X1TD 4H9RB 5CP6B 3KFUG 3AZFD 1M18A 2Y2PA 3LELA 5DNMB 1TAFA 3EPKA 5AV8C 3LJAD 2IO5C 4J8WA 2NQBB 3VH5T 1B67A 2F8NA 3REIC 2CV5D 4Z5TB 5B31B 2ZY3A 3AZIB 4AWLC 5B40B 4XZQD 2FJ7D 3NQJB 5GT3A 1S32B 5GXQA 5DNMD 5KDMA 5B24A 4YM6B 4X23D 3C1BA 3UTAB 2G5IC 4LD9B 2L5AA 3LJAC 3V9RA 1F1EA 3A1KA 4R8PA 3MGQA 5B40D 3MGPA 2CV5C 3W97A 1JFIB 3W99A 2BYKB 5B0ZA 3MVDD 5AV5B 5AV9B 1F66D 5DNMC 2ZY4A 4WU9B 1M19A 2NQBC 1B6WA 3UT9B 4XUJB 2F8NK 4CAYA 3X1VD 1P3OB 5B2IB 1M1AA 5B40C 1TZYA 4J8XB 4DQYB 5AV9D 3AYWA 1P3AA 4H9NA 1U35B 2AROB 4WU9D 1R4VA 1P3KA 1F66C 3UTAC 1KX5D 4LD9C 3AZLD 3O62D 5B1LA 1KU5A 2RVQC 3LZ0A 5B32G 3KXBA 3X1VC 5B2ID 1P3LB 3X1SD 3RELB 5CP6A 2VQRA 1P3MB 3AZEB 4M6BA 5AV5C 5AV9C 4WU9C 5CHLB 3AV1B 2NQBA 3LZ1B 5F99D 2W8SA 4XUJC 5E5AB 3O62C 3AZLC 3IP4C 3AZGD 4Z5TA 5B31A 5AVCB 5B2IC 3AZIA 3AV2B 5CPKB 2J8PA 3X1SC 3NQJA 1S32A 3B0DC 4YM6A 4JJNB 2AROC 1P3FB 3UTAA 3EG5B 4LD9A 1P3PB 2YFWB 2G5HC 3W98B 5DNNB 1W2EA 1P3LC 5GT0A 3C1CB 1JFIA 2Y2OA 2BYKA 2HIOA 5BO0B 3AZNB 1P3GD 5AV5A 4JJND 3AFAD 5B32A 5AV9A 2CWEA 5CPJA 1KX4D 3B6GB 1P3PD 3AV1C 2F8NG 3UT9A 4XUJA 2Y2QA 3W98D 5E5AC 5AV8B 1P3OA 1N1JB 1ZLAA 3AV2C 5CPKC 4NE5A 3REIB 3AZND 3WTPB 5JRGA 2NZDB 5B0YD 4J8XA 4J8UD 1U35A 2AROA 3B6GD 4JJNC 4ZBJC 3X1TB 4H9QB 2F8NH 3AZFB 4UPKA 1P3PC 5B1MA 3W98C 5DNNC 1WWIA 4ZUXB 1P3LA 3LJAB 3RELA 3B6FA 3WTPD 3REKD 2LY8A 4YS3A 1HQ3D 1P3MA 4E45A 4KGCD 5BS7C 3AZEA 3AZNC 2CV5B 3TU4B 5B0YC 4H9SA 2ZY2A 3B6GC 4XZQB 3AV1A 2FJ7B 4QLCD 3LZ1A 5E5AA 4ZUXD 4X23B 5AVCA 3AV2A 5AVBB 5CPKA 3R45B 3WTPC 3REKC 3TU4D 2NZDC 1BFMA 1HQ3C 2DF4C 4KGCC 3WKJD 3KWQD 4JJNA 5B2JD 3X1UB 2HUEC 3X1TC 1P3FA 4J8VD 5G49A 3AZFC 4WJ3C 5B33D 2YFWA 3MVDB 4WZSB 5DNNA 1F66B 5AVBD 4ZUXC 3WTPE 4E44A 3C1CA 1P3BB 3X1VB 5BO0A 3AZNA 3W96A 3TU4C 3MGSA 3X1UD 2XD5A 3KWQC 4XZQC 2FJ7C 2JE5A 5B31G 3WA9B 5B33C 4WNNA 5AV8A 4KUDB 4X23C 1KX5B 1N1JA 1P3BD 5AVBC 3AZLB 3O62B 3REIA 1PZRA 3WTPA 2NZDA 5BNVA 1Q9CA 3H0MC 3X1SB 5AV6D 3X1TA 3X1UC 3AZFA 3B0DB 2Y2KA 3REJB 3WA9D 2Y2LA 3AZJD 4Z66D 3MVDC 4KUDD 3LJAA 5F99B 1P3BC 3AZHB 3AZKD 4CSRB 3AZGB 2CV5A 4G92B 5AY8B 4H9RA 1ID3D 3EPHA 3MGRD 3REJD 4XZQA 3AN2B 2FJ7A 4J8XD 3WA9C 5DNMA 2YFVB 3AZJC 1BH9B 4KUDC 4X23A 3A6ND 1KX5C 3AZHD 3WAAB 5CPIB 3R45A 2Y2MA 3AZKC 2Y2GA 3REHB 5AY8D 5B40A 2Y2HA 3AZMD 3AN2D 3MGRC 1T3UA 1P34D 3REJC 1P3GB 3MVDA 4ZBJB 3AFAB 1KX4B 1F66A 3UTBD 2Y2NA 1AOID 1EQZD 2RIQA 5BNXB 3WAAD 1P3BA 5CPID 1P3ID 5F99C 3AZHC 2ZY5A 3X1VA 3REHD 3AZGC 4G92C 5AY8C 4G91B 3AZMC 3MNND 1KX3D 3AN2C 5B0YB 2F2AC 4J8UB 3WA9A 1P34C 3VH6A 1H3OB 4WU9A 4H9PB 1KX5A 3UTBC 3AZLA 3O62A 4UUZB 3WAAC 1M18D 5CPIC 1P3IC 5B2IA 3NQUB 3LELD 3REHC 5KDMB 3X1SA 4NE3A 3REKB 4J8WD 1HQ3B 3REJA 4KGCB 1P3GC 3MNNC 1KX3C 2F8ND 2HUEB 3AFAC 4R8PB 1KX4C 2BG1A 4QLCB 5F99A 3AZHA 4CSRA 5GT3D 5GXQD 3AZGA 5B24D 3LELC 3C1BD 4G91C 4J8WC 4J8UC 4R8PD 3MGQD 2UWXA 3WKJB 3KWQB 1BH9A 4EO5B 5B2JB 3MGPD 4J8VB 4HGAB 3W97D 3H0RC 3W99D 4Z2MG 5B33B 4DRAA 5B0ZD 5GT3C 5GXQC 3AYWB 1M19D 1P3GA 5GSUB 3AFAA 4R8PC 1BH8B 3KXBB 3MGQC 1KX4A 3KSYA 4Z2MH 1P3PA 1M1AD 3MGPC 4QLCC 3W97C 3W99C 3W98A 1TZYD 5B0ZC 3AYWD 1P3AD 3VH6W 1P3KD 5BS7A 5B0YA 4J8UA 4H9OB 5GSUD 4NFTA 1M19C 5B1LD 3LZ0D 3KXBD 3B6GA 1H3OA 5AV6B 3KUYB 4EO5C 5B2JC 4H9PA 3WKJC 4J8VC 4HGAC 4KHAB 3AZJB 4Z66B 5CP6D 1M1AC 3F6TA 4UUZA 5C3IB 1TZYC 3AL0C 3NQUA 2ZM5A 3AYWC 1P3AC 2JCHA 3REKA 4NE6A 3AZKB 2NQBD 1HQ3A 1P3KC 4KGCA 2DQNC 3KUYD 4DRBA 5GSUC 1ID3B 4Z5TD 4H9QA 5B1LC 4WV4B 5B31D 3KXBC 3LZ0C 3MGRB 3AZID 5GT0B 4QLCA 5CP6C 2HIOB 1S32D 4ZUXA 4YM6D 3A6NB 5B32B 5CPJB 3UTAD 4LD9D 3TU4A 3VH5A 3B0CW 3H0LC 2BYMB 2RVQD 2PYOB 5BT1D 3WKJA 3KWQA 5B2JA 5AV6C 3AZMB 3KUYC 4Z5TC 5B31C 1HTAA 5GT0D 4J8VA 1ZLAB 1P34B 5B33A 3AZIC 4Z66C 2HIOD 3VH6T 5JRGB 5C3IC 5AV5D 3FDDA 3UTBB 5B32D 5AVBA 1S32C 1AOIB 1EQZB 5CPJD 3EPJA 4YM6C 1P3IB 5FUGB 3UT9D 4XUJD 2PYOD 5JA4B 5B1MB 5GSUA 3X1UA 1P3OD 1ID3C 1BH8A 5BT1C 1WWSA 4WU8B 1ZLAD 3MNNB 1KX3B 5GT0C 3B6FB 5JRGD 4YS3B 2HIOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 D;  2ARO D;  3A6N C;  5B32 C;  5CPJ C;  1M18 B;  4H9O A;  5B1M D;  3LEL B;  3UT9 C;  2PYO C;  1TAF B;  5AV6 A;  4WU8 D;  3KUY A;  1P3L D;  4J8W B;  1P3O C;  3REL D;  4KHA A;  1ZLA C;  4YS3 D;  4Z66 A;  3AZJ A;  3B6F D;  1P3M D;  2F8N B;  3AZE D;  4KUD A;  5JRG C;  1A7W A;  3B0C T;  4J8X C;  1EQZ C;  1AOI C;  3B0B A;  1U35 C;  3AV1 D;  3AZK A;  5GT3 B;  5G49 B;  5GXQ B;  3LZ1 D;  5B24 B;  5E5A D;  5B1M C;  1ID3 A;  3C1B B;  5AVC D;  3MGR A;  1ULY A;  2JSS A;  3AV2 D;  4WU8 C;  5CPK D;  3V9R B;  3REL C;  3B6F C;  3MGQ B;  4YS3 C;  1P3M C;  3W96 B;  3AZE C;  3MGP B;  3VH5 W;  3MGS B;  3W97 B;  3A6N A;  3W99 B;  4H9S C;  1P3F D;  5B0Z B;  1M18 C;  2BYM A;  5AY8 A;  3LZ1 C;  2PYO A;  4WNN B;  5DNN D;  3AZM A;  2IO5 B;  3AN2 A;  3C1C D;  5AVC C;  1M19 B;  1P34 A;  2YFV A;  4CAY B;  3W96 D;  5BNV B;  3MGS D;  3UTB A;  4AWL B;  1AOI A;  1EQZ A;  1M1A B;  3WAA A;  5CPI A;  1P3I A;  5FUG A;  1TZY B;  1P3F C;  3REH A;  1P3A B;  4H9N B;  5B24 C;  5JA4 A;  5AV8 D;  3C1B C;  4WU8 A;  1P3K B;  3MNN A;  1KX3 A;  3C1C C;  3REI D;  5B1L B;  2NZD D;  3LZ0 B;  3W96 C;  5BNX A;  3MGS C;  3X1T D;  4H9R B;  5CP6 B;  3AZF D;  1M18 A;  3LEL A;  5DNM B;  1TAF A;  5AV8 C;  3LJA D;  2IO5 C;  4J8W A;  2NQB B;  3VH5 T;  1B67 A;  2F8N A;  3REI C;  2CV5 D;  4Z5T B;  5B31 B;  3AZI B;  4AWL C;  5B40 B;  4XZQ D;  2FJ7 D;  3NQJ B;  5GT3 A;  1S32 B;  5GXQ A;  5DNM D;  5KDM A;  5B24 A;  4YM6 B;  4X23 D;  3C1B A;  3UTA B;  4LD9 B;  2L5A A;  3LJA C;  3V9R A;  1F1E A;  4R8P A;  3MGQ A;  5B40 D;  3MGP A;  2CV5 C;  3W97 A;  1JFI B;  3W99 A;  2BYK B;  5B0Z A;  3MVD D;  5AV5 B;  5AV9 B;  1F66 D;  5DNM C;  4WU9 B;  1M19 A;  2NQB C;  1B6W A;  3UT9 B;  4XUJ B;  2F8N K;  4CAY A;  3X1V D;  1P3O B;  5B2I B;  1M1A A;  5B40 C;  1TZY A;  4J8X B;  5AV9 D;  3AYW A;  1P3A A;  4H9N A;  1U35 B;  2ARO B;  4WU9 D;  1R4V A;  1P3K A;  1F66 C;  3UTA C;  1KX5 D;  4LD9 C;  3AZL D;  3O62 D;  5B1L A;  1KU5 A;  2RVQ C;  3LZ0 A;  5B32 G;  3KXB A;  3X1V C;  5B2I D;  1P3L B;  3X1S D;  3REL B;  5CP6 A;  1P3M B;  3AZE B;  4M6B A;  5AV5 C;  5AV9 C;  4WU9 C;  5CHL B;  3AV1 B;  2NQB A;  3LZ1 B;  5F99 D;  4XUJ C;  5E5A B;  3O62 C;  3AZL C;  3AZG D;  4Z5T A;  5B31 A;  5AVC B;  5B2I C;  3AZI A;  3AV2 B;  5CPK B;  3X1S C;  3NQJ A;  1S32 A;  3B0D C;  4YM6 A;  4JJN B;  2ARO C;  1P3F B;  3UTA A;  4LD9 A;  1P3P B;  2YFW B;  3W98 B;  5DNN B;  1P3L C;  5GT0 A;  3C1C B;  1JFI A;  2BYK A;  2HIO A;  5BO0 B;  3AZN B;  1P3G D;  5AV5 A;  4JJN D;  3AFA D;  5B32 A;  5AV9 A;  2CWE A;  5CPJ A;  1KX4 D;  3B6G B;  1P3P D;  3AV1 C;  2F8N G;  3UT9 A;  4XUJ A;  3W98 D;  5E5A C;  5AV8 B;  1P3O A;  1N1J B;  1ZLA A;  3AV2 C;  5CPK C;  4NE5 A;  3REI B;  3AZN D;  3WTP B;  5JRG A;  2NZD B;  5B0Y D;  4J8X A;  4J8U D;  1U35 A;  2ARO A;  3B6G D;  4JJN C;  4ZBJ C;  3X1T B;  4H9Q B;  2F8N H;  3AZF B;  1P3P C;  5B1M A;  3W98 C;  5DNN C;  1WWI A;  4ZUX B;  1P3L A;  3LJA B;  3REL A;  3B6F A;  3WTP D;  3REK D;  2LY8 A;  4YS3 A;  1HQ3 D;  1P3M A;  4E45 A;  4KGC D;  5BS7 C;  3AZE A;  3AZN C;  2CV5 B;  3TU4 B;  5B0Y C;  4H9S A;  3B6G C;  4XZQ B;  3AV1 A;  2FJ7 B;  4QLC D;  3LZ1 A;  5E5A A;  4ZUX D;  4X23 B;  5AVC A;  3AV2 A;  5AVB B;  5CPK A;  3R45 B;  3WTP C;  3REK C;  3TU4 D;  2NZD C;  1BFM A;  1HQ3 C;  4KGC C;  3WKJ D;  3KWQ D;  4JJN A;  5B2J D;  3X1U B;  2HUE C;  3X1T C;  1P3F A;  4J8V D;  5G49 A;  3AZF C;  5B33 D;  2YFW A;  3MVD B;  4WZS B;  5DNN A;  1F66 B;  5AVB D;  4ZUX C;  3WTP E;  4E44 A;  3C1C A;  1P3B B;  3X1V B;  5BO0 A;  3AZN A;  3W96 A;  3TU4 C;  3MGS A;  3X1U D;  3KWQ C;  4XZQ C;  2FJ7 C;  5B31 G;  3WA9 B;  5B33 C;  4WNN A;  5AV8 A;  4KUD B;  4X23 C;  1KX5 B;  1N1J A;  1P3B D;  5AVB C;  3AZL B;  3O62 B;  3REI A;  3WTP A;  2NZD A;  5BNV A;  1Q9C A;  3X1S B;  5AV6 D;  3X1T A;  3X1U C;  3AZF A;  3B0D B;  3REJ B;  3WA9 D;  3AZJ D;  4Z66 D;  3MVD C;  4KUD D;  3LJA A;  5F99 B;  1P3B C;  3AZH B;  3AZK D;  4CSR B;  3AZG B;  2CV5 A;  4G92 B;  5AY8 B;  4H9R A;  1ID3 D;  3MGR D;  3REJ D;  4XZQ A;  3AN2 B;  2FJ7 A;  4J8X D;  3WA9 C;  5DNM A;  2YFV B;  3AZJ C;  1BH9 B;  4KUD C;  4X23 A;  3A6N D;  1KX5 C;  3AZH D;  3WAA B;  5CPI B;  3R45 A;  3AZK C;  3REH B;  5AY8 D;  5B40 A;  3AZM D;  3AN2 D;  3MGR C;  1P34 D;  3REJ C;  1P3G B;  3MVD A;  4ZBJ B;  3AFA B;  1KX4 B;  1F66 A;  3UTB D;  1EQZ D;  1AOI D;  5BNX B;  3WAA D;  1P3B A;  5CPI D;  1P3I D;  5F99 C;  3AZH C;  3X1V A;  3REH D;  3AZG C;  4G92 C;  5AY8 C;  4G91 B;  3AZM C;  3MNN D;  1KX3 D;  3AN2 C;  5B0Y B;  4J8U B;  3WA9 A;  1P34 C;  3VH6 A;  1H3O B;  4WU9 A;  4H9P B;  1KX5 A;  3UTB C;  3AZL A;  3O62 A;  4UUZ B;  3WAA C;  1M18 D;  5CPI C;  1P3I C;  5B2I A;  3NQU B;  3LEL D;  3REH C;  5KDM B;  3X1S A;  4NE3 A;  3REK B;  4J8W D;  1HQ3 B;  3REJ A;  4KGC B;  1P3G C;  3MNN C;  1KX3 C;  2F8N D;  2HUE B;  3AFA C;  4R8P B;  1KX4 C;  4QLC B;  5F99 A;  3AZH A;  4CSR A;  5GT3 D;  5GXQ D;  3AZG A;  5B24 D;  3LEL C;  3C1B D;  4G91 C;  4J8W C;  4J8U C;  4R8P D;  3MGQ D;  3WKJ B;  3KWQ B;  1BH9 A;  4EO5 B;  5B2J B;  3MGP D;  4J8V B;  4HGA B;  3W97 D;  3W99 D;  4Z2M G;  5B33 B;  4DRA A;  5B0Z D;  5GT3 C;  5GXQ C;  3AYW B;  1M19 D;  1P3G A;  5GSU B;  3AFA A;  4R8P C;  1BH8 B;  3KXB B;  3MGQ C;  1KX4 A;  3KSY A;  4Z2M H;  1P3P A;  1M1A D;  3MGP C;  4QLC C;  3W97 C;  3W99 C;  3W98 A;  1TZY D;  5B0Z C;  3AYW D;  1P3A D;  3VH6 W;  1P3K D;  5BS7 A;  5B0Y A;  4J8U A;  4H9O B;  5GSU D;  4NFT A;  1M19 C;  5B1L D;  3LZ0 D;  3KXB D;  3B6G A;  1H3O A;  5AV6 B;  3KUY B;  4EO5 C;  5B2J C;  4H9P A;  3WKJ C;  4J8V C;  4HGA C;  4KHA B;  3AZJ B;  4Z66 B;  5CP6 D;  1M1A C;  4UUZ A;  5C3I B;  1TZY C;  3NQU A;  3AYW C;  1P3A C;  3REK A;  4NE6 A;  3AZK B;  2NQB D;  1HQ3 A;  1P3K C;  4KGC A;  3KUY D;  4DRB A;  5GSU C;  1ID3 B;  4Z5T D;  4H9Q A;  5B1L C;  4WV4 B;  5B31 D;  3KXB C;  3LZ0 C;  3MGR B;  3AZI D;  5GT0 B;  4QLC A;  5CP6 C;  2HIO B;  1S32 D;  4ZUX A;  4YM6 D;  3A6N B;  5B32 B;  5CPJ B;  3UTA D;  4LD9 D;  3TU4 A;  3VH5 A;  3B0C W;  2BYM B;  2RVQ D;  2PYO B;  5BT1 D;  3WKJ A;  3KWQ A;  5B2J A;  5AV6 C;  3AZM B;  3KUY C;  4Z5T C;  5B31 C;  1HTA A;  5GT0 D;  4J8V A;  1ZLA B;  1P34 B;  5B33 A;  3AZI C;  4Z66 C;  2HIO D;  3VH6 T;  5JRG B;  5C3I C;  5AV5 D;  3UTB B;  1S32 C;  5B32 D;  5AVB A;  1AOI B;  1EQZ B;  5CPJ D;  4YM6 C;  1P3I B;  5FUG B;  3UT9 D;  4XUJ D;  2PYO D;  5JA4 B;  5B1M B;  5GSU A;  3X1U A;  1P3O D;  1ID3 C;  1BH8 A;  5BT1 C;  1WWS A;  4WU8 B;  1ZLA D;  3MNN B;  1KX3 B;  5GT0 C;  3B6F B;  5JRG D;  4YS3 B;  2HIO C; 
#chains in the Genus database with same CATH topology
 1U35 D;  2ARO D;  3A6N C;  5B32 C;  5CPJ C;  1M18 B;  3A1I A;  2Y2J A;  4H9O A;  5B1M D;  3LEL B;  3UT9 C;  1Z2C B;  2PYO C;  1TAF B;  5AV6 A;  4WU8 D;  3KUY A;  1P3L D;  4J8W B;  1P3O C;  3REL D;  2XD1 A;  4KHA A;  1ZLA C;  4YS3 D;  4Z66 A;  3AZJ A;  3B6F D;  1P3M D;  2F8N B;  3AZE D;  4KUD A;  5JRG C;  1A7W A;  3B0C T;  4J8X C;  1EQZ C;  1AOI C;  3B0B A;  1U35 C;  3AV1 D;  3AZK A;  5GT3 B;  5G49 B;  5GXQ B;  3LZ1 D;  5B24 B;  2Y2I A;  5E5A D;  5B1M C;  1ID3 A;  3C1B B;  5AVC D;  3MGR A;  1ULY A;  2JSS A;  3AV2 D;  4WU8 C;  5CPK D;  3P5J B;  3V9R B;  3REL C;  3B6F C;  3MGQ B;  4YS3 C;  1P3M C;  3W96 B;  3AZE C;  3MGP B;  3VH5 W;  3MGS B;  3W97 B;  3A6N A;  3W99 B;  4H9S C;  1P3F D;  5B0Z B;  1M18 C;  2BYM A;  5AY8 A;  3LZ1 C;  2PYO A;  4WNN B;  5DNN D;  3AZM A;  2IO5 B;  3AN2 A;  3C1C D;  5AVC C;  1M19 B;  1P34 A;  2YFV A;  4CAY B;  3W96 D;  5BNV B;  3MGS D;  3UTB A;  4AWL B;  1AOI A;  1EQZ A;  1M1A B;  3WAA A;  5CPI A;  1P3I A;  5FUG A;  1TZY B;  1P3F C;  3REH A;  1P3A B;  4H9N B;  5B24 C;  5JA4 A;  5AV8 D;  3C1B C;  4WU8 A;  1P3K B;  2FFF B;  3MNN A;  1KX3 A;  3EPL A;  3C1C C;  3REI D;  5B1L B;  2NZD D;  3LZ0 B;  3W96 C;  5BNX A;  3MGS C;  3X1T D;  4H9R B;  5CP6 B;  3KFU G;  3AZF D;  1M18 A;  2Y2P A;  3LEL A;  5DNM B;  1TAF A;  3EPK A;  5AV8 C;  3LJA D;  2IO5 C;  4J8W A;  2NQB B;  3VH5 T;  1B67 A;  2F8N A;  3REI C;  2CV5 D;  4Z5T B;  5B31 B;  2ZY3 A;  3AZI B;  4AWL C;  5B40 B;  4XZQ D;  2FJ7 D;  3NQJ B;  5GT3 A;  1S32 B;  5GXQ A;  5DNM D;  5KDM A;  5B24 A;  4YM6 B;  4X23 D;  3C1B A;  3UTA B;  2G5I C;  4LD9 B;  2L5A A;  3LJA C;  3V9R A;  1F1E A;  3A1K A;  4R8P A;  3MGQ A;  5B40 D;  3MGP A;  2CV5 C;  3W97 A;  1JFI B;  3W99 A;  2BYK B;  5B0Z A;  3MVD D;  5AV5 B;  5AV9 B;  1F66 D;  5DNM C;  2ZY4 A;  4WU9 B;  1M19 A;  2NQB C;  1B6W A;  3UT9 B;  4XUJ B;  2F8N K;  4CAY A;  3X1V D;  1P3O B;  5B2I B;  1M1A A;  5B40 C;  1TZY A;  4J8X B;  4DQY B;  5AV9 D;  3AYW A;  1P3A A;  4H9N A;  1U35 B;  2ARO B;  4WU9 D;  1R4V A;  1P3K A;  1F66 C;  3UTA C;  1KX5 D;  4LD9 C;  3AZL D;  3O62 D;  5B1L A;  1KU5 A;  2RVQ C;  3LZ0 A;  5B32 G;  3KXB A;  3X1V C;  5B2I D;  1P3L B;  3X1S D;  3REL B;  5CP6 A;  2VQR A;  1P3M B;  3AZE B;  4M6B A;  5AV5 C;  5AV9 C;  4WU9 C;  5CHL B;  3AV1 B;  2NQB A;  3LZ1 B;  5F99 D;  2W8S A;  4XUJ C;  5E5A B;  3O62 C;  3AZL C;  3IP4 C;  3AZG D;  4Z5T A;  5B31 A;  5AVC B;  5B2I C;  3AZI A;  3AV2 B;  5CPK B;  2J8P A;  3X1S C;  3NQJ A;  1S32 A;  3B0D C;  4YM6 A;  4JJN B;  2ARO C;  1P3F B;  3UTA A;  3EG5 B;  4LD9 A;  1P3P B;  2YFW B;  2G5H C;  3W98 B;  5DNN B;  1W2E A;  1P3L C;  5GT0 A;  3C1C B;  1JFI A;  2Y2O A;  2BYK A;  2HIO A;  5BO0 B;  3AZN B;  1P3G D;  5AV5 A;  4JJN D;  3AFA D;  5B32 A;  5AV9 A;  2CWE A;  5CPJ A;  1KX4 D;  3B6G B;  1P3P D;  3AV1 C;  2F8N G;  3UT9 A;  4XUJ A;  2Y2Q A;  3W98 D;  5E5A C;  5AV8 B;  1P3O A;  1N1J B;  1ZLA A;  3AV2 C;  5CPK C;  4NE5 A;  3REI B;  3AZN D;  3WTP B;  5JRG A;  2NZD B;  5B0Y D;  4J8X A;  4J8U D;  1U35 A;  2ARO A;  3B6G D;  4JJN C;  4ZBJ C;  3X1T B;  4H9Q B;  2F8N H;  3AZF B;  4UPK A;  1P3P C;  5B1M A;  3W98 C;  5DNN C;  1WWI A;  4ZUX B;  1P3L A;  3LJA B;  3REL A;  3B6F A;  3WTP D;  3REK D;  2LY8 A;  4YS3 A;  1HQ3 D;  1P3M A;  4E45 A;  4KGC D;  5BS7 C;  3AZE A;  3AZN C;  2CV5 B;  3TU4 B;  5B0Y C;  4H9S A;  2ZY2 A;  3B6G C;  4XZQ B;  3AV1 A;  2FJ7 B;  4QLC D;  3LZ1 A;  5E5A A;  4ZUX D;  4X23 B;  5AVC A;  3AV2 A;  5AVB B;  5CPK A;  3R45 B;  3WTP C;  3REK C;  3TU4 D;  2NZD C;  1BFM A;  1HQ3 C;  2DF4 C;  4KGC C;  3WKJ D;  3KWQ D;  4JJN A;  5B2J D;  3X1U B;  2HUE C;  3X1T C;  1P3F A;  4J8V D;  5G49 A;  3AZF C;  4WJ3 C;  5B33 D;  2YFW A;  3MVD B;  4WZS B;  5DNN A;  1F66 B;  5AVB D;  4ZUX C;  3WTP E;  4E44 A;  3C1C A;  1P3B B;  3X1V B;  5BO0 A;  3AZN A;  3W96 A;  3TU4 C;  3MGS A;  3X1U D;  2XD5 A;  3KWQ C;  4XZQ C;  2FJ7 C;  2JE5 A;  5B31 G;  3WA9 B;  5B33 C;  4WNN A;  5AV8 A;  4KUD B;  4X23 C;  1KX5 B;  1N1J A;  1P3B D;  5AVB C;  3AZL B;  3O62 B;  3REI A;  1PZR A;  3WTP A;  2NZD A;  5BNV A;  1Q9C A;  3H0M C;  3X1S B;  5AV6 D;  3X1T A;  3X1U C;  3AZF A;  3B0D B;  2Y2K A;  3REJ B;  3WA9 D;  2Y2L A;  3AZJ D;  4Z66 D;  3MVD C;  4KUD D;  3LJA A;  5F99 B;  1P3B C;  3AZH B;  3AZK D;  4CSR B;  3AZG B;  2CV5 A;  4G92 B;  5AY8 B;  4H9R A;  1ID3 D;  3EPH A;  3MGR D;  3REJ D;  4XZQ A;  3AN2 B;  2FJ7 A;  4J8X D;  3WA9 C;  5DNM A;  2YFV B;  3AZJ C;  1BH9 B;  4KUD C;  4X23 A;  3A6N D;  1KX5 C;  3AZH D;  3WAA B;  5CPI B;  3R45 A;  2Y2M A;  3AZK C;  2Y2G A;  3REH B;  5AY8 D;  5B40 A;  2Y2H A;  3AZM D;  3AN2 D;  3MGR C;  1T3U A;  1P34 D;  3REJ C;  1P3G B;  3MVD A;  4ZBJ B;  3AFA B;  1KX4 B;  1F66 A;  3UTB D;  2Y2N A;  1AOI D;  1EQZ D;  2RIQ A;  5BNX B;  3WAA D;  1P3B A;  5CPI D;  1P3I D;  5F99 C;  3AZH C;  2ZY5 A;  3X1V A;  3REH D;  3AZG C;  4G92 C;  5AY8 C;  4G91 B;  3AZM C;  3MNN D;  1KX3 D;  3AN2 C;  5B0Y B;  2F2A C;  4J8U B;  3WA9 A;  1P34 C;  3VH6 A;  1H3O B;  4WU9 A;  4H9P B;  1KX5 A;  3UTB C;  3AZL A;  3O62 A;  4UUZ B;  3WAA C;  1M18 D;  5CPI C;  1P3I C;  5B2I A;  3NQU B;  3LEL D;  3REH C;  5KDM B;  3X1S A;  4NE3 A;  3REK B;  4J8W D;  1HQ3 B;  3REJ A;  4KGC B;  1P3G C;  3MNN C;  1KX3 C;  2F8N D;  2HUE B;  3AFA C;  4R8P B;  1KX4 C;  2BG1 A;  4QLC B;  5F99 A;  3AZH A;  4CSR A;  5GT3 D;  5GXQ D;  3AZG A;  5B24 D;  3LEL C;  3C1B D;  4G91 C;  4J8W C;  4J8U C;  4R8P D;  3MGQ D;  2UWX A;  3WKJ B;  3KWQ B;  1BH9 A;  4EO5 B;  5B2J B;  3MGP D;  4J8V B;  4HGA B;  3W97 D;  3H0R C;  3W99 D;  4Z2M G;  5B33 B;  4DRA A;  5B0Z D;  5GT3 C;  5GXQ C;  3AYW B;  1M19 D;  1P3G A;  5GSU B;  3AFA A;  4R8P C;  1BH8 B;  3KXB B;  3MGQ C;  1KX4 A;  3KSY A;  4Z2M H;  1P3P A;  1M1A D;  3MGP C;  4QLC C;  3W97 C;  3W99 C;  3W98 A;  1TZY D;  5B0Z C;  3AYW D;  1P3A D;  3VH6 W;  1P3K D;  5BS7 A;  5B0Y A;  4J8U A;  4H9O B;  5GSU D;  4NFT A;  1M19 C;  5B1L D;  3LZ0 D;  3KXB D;  3B6G A;  1H3O A;  5AV6 B;  3KUY B;  4EO5 C;  5B2J C;  4H9P A;  3WKJ C;  4J8V C;  4HGA C;  4KHA B;  3AZJ B;  4Z66 B;  5CP6 D;  1M1A C;  3F6T A;  4UUZ A;  5C3I B;  1TZY C;  3AL0 C;  3NQU A;  2ZM5 A;  3AYW C;  1P3A C;  2JCH A;  3REK A;  4NE6 A;  3AZK B;  2NQB D;  1HQ3 A;  1P3K C;  4KGC A;  2DQN C;  3KUY D;  4DRB A;  5GSU C;  1ID3 B;  4Z5T D;  4H9Q A;  5B1L C;  4WV4 B;  5B31 D;  3KXB C;  3LZ0 C;  3MGR B;  3AZI D;  5GT0 B;  4QLC A;  5CP6 C;  2HIO B;  1S32 D;  4ZUX A;  4YM6 D;  3A6N B;  5B32 B;  5CPJ B;  3UTA D;  4LD9 D;  3TU4 A;  3VH5 A;  3B0C W;  3H0L C;  2BYM B;  2RVQ D;  2PYO B;  5BT1 D;  3WKJ A;  3KWQ A;  5B2J A;  5AV6 C;  3AZM B;  3KUY C;  4Z5T C;  5B31 C;  1HTA A;  5GT0 D;  4J8V A;  1ZLA B;  1P34 B;  5B33 A;  3AZI C;  4Z66 C;  2HIO D;  3VH6 T;  5JRG B;  5C3I C;  5AV5 D;  3FDD A;  3UTB B;  5B32 D;  5AVB A;  1S32 C;  1AOI B;  1EQZ B;  5CPJ D;  3EPJ A;  4YM6 C;  1P3I B;  5FUG B;  3UT9 D;  4XUJ D;  2PYO D;  5JA4 B;  5B1M B;  5GSU A;  3X1U A;  1P3O D;  1ID3 C;  1BH8 A;  5BT1 C;  1WWS A;  4WU8 B;  1ZLA D;  3MNN B;  1KX3 B;  5GT0 C;  3B6F B;  5JRG D;  4YS3 B;  2HIO C; 
#chains in the Genus database with same CATH homology
 1U35 D;  2ARO D;  3A6N C;  5B32 C;  5CPJ C;  1M18 B;  3A1I A;  2Y2J A;  4H9O A;  5B1M D;  3LEL B;  3UT9 C;  1Z2C B;  2PYO C;  1TAF B;  5AV6 A;  4WU8 D;  3KUY A;  1P3L D;  4J8W B;  1P3O C;  3REL D;  2XD1 A;  4KHA A;  1ZLA C;  4YS3 D;  4Z66 A;  3AZJ A;  3B6F D;  1P3M D;  2F8N B;  3AZE D;  4KUD A;  5JRG C;  1A7W A;  3B0C T;  4J8X C;  1EQZ C;  1AOI C;  3B0B A;  1U35 C;  3AV1 D;  3AZK A;  5GT3 B;  5G49 B;  5GXQ B;  3LZ1 D;  5B24 B;  2Y2I A;  5E5A D;  5B1M C;  1ID3 A;  3C1B B;  5AVC D;  3MGR A;  1ULY A;  2JSS A;  3AV2 D;  4WU8 C;  5CPK D;  3P5J B;  3V9R B;  3REL C;  3B6F C;  3MGQ B;  4YS3 C;  1P3M C;  3W96 B;  3AZE C;  3MGP B;  3VH5 W;  3MGS B;  3W97 B;  3A6N A;  3W99 B;  4H9S C;  1P3F D;  5B0Z B;  1M18 C;  2BYM A;  5AY8 A;  3LZ1 C;  2PYO A;  4WNN B;  5DNN D;  3AZM A;  2IO5 B;  3AN2 A;  3C1C D;  5AVC C;  1M19 B;  1P34 A;  2YFV A;  4CAY B;  3W96 D;  5BNV B;  3MGS D;  3UTB A;  4AWL B;  1AOI A;  1EQZ A;  1M1A B;  3WAA A;  5CPI A;  1P3I A;  5FUG A;  1TZY B;  1P3F C;  3REH A;  1P3A B;  4H9N B;  5B24 C;  5JA4 A;  5AV8 D;  3C1B C;  4WU8 A;  1P3K B;  2FFF B;  3MNN A;  1KX3 A;  3EPL A;  3C1C C;  3REI D;  5B1L B;  2NZD D;  3LZ0 B;  3W96 C;  5BNX A;  3MGS C;  3X1T D;  4H9R B;  5CP6 B;  3KFU G;  3AZF D;  1M18 A;  2Y2P A;  3LEL A;  5DNM B;  1TAF A;  3EPK A;  5AV8 C;  3LJA D;  2IO5 C;  4J8W A;  2NQB B;  3VH5 T;  1B67 A;  2F8N A;  3REI C;  2CV5 D;  4Z5T B;  5B31 B;  2ZY3 A;  3AZI B;  4AWL C;  5B40 B;  4XZQ D;  2FJ7 D;  3NQJ B;  5GT3 A;  1S32 B;  5GXQ A;  5DNM D;  5KDM A;  5B24 A;  4YM6 B;  4X23 D;  3C1B A;  3UTA B;  2G5I C;  4LD9 B;  2L5A A;  3LJA C;  3V9R A;  1F1E A;  3A1K A;  4R8P A;  3MGQ A;  5B40 D;  3MGP A;  2CV5 C;  3W97 A;  1JFI B;  3W99 A;  2BYK B;  5B0Z A;  3MVD D;  5AV5 B;  5AV9 B;  1F66 D;  5DNM C;  2ZY4 A;  4WU9 B;  1M19 A;  2NQB C;  1B6W A;  3UT9 B;  4XUJ B;  2F8N K;  4CAY A;  3X1V D;  1P3O B;  5B2I B;  1M1A A;  5B40 C;  1TZY A;  4J8X B;  4DQY B;  5AV9 D;  3AYW A;  1P3A A;  4H9N A;  1U35 B;  2ARO B;  4WU9 D;  1R4V A;  1P3K A;  1F66 C;  3UTA C;  1KX5 D;  4LD9 C;  3AZL D;  3O62 D;  5B1L A;  1KU5 A;  2RVQ C;  3LZ0 A;  5B32 G;  3KXB A;  3X1V C;  5B2I D;  1P3L B;  3X1S D;  3REL B;  5CP6 A;  2VQR A;  1P3M B;  3AZE B;  4M6B A;  5AV5 C;  5AV9 C;  4WU9 C;  5CHL B;  3AV1 B;  2NQB A;  3LZ1 B;  5F99 D;  2W8S A;  4XUJ C;  5E5A B;  3O62 C;  3AZL C;  3IP4 C;  3AZG D;  4Z5T A;  5B31 A;  5AVC B;  5B2I C;  3AZI A;  3AV2 B;  5CPK B;  2J8P A;  3X1S C;  3NQJ A;  1S32 A;  3B0D C;  4YM6 A;  4JJN B;  2ARO C;  1P3F B;  3UTA A;  3EG5 B;  4LD9 A;  1P3P B;  2YFW B;  2G5H C;  3W98 B;  5DNN B;  1W2E A;  1P3L C;  5GT0 A;  3C1C B;  1JFI A;  2Y2O A;  2BYK A;  2HIO A;  5BO0 B;  3AZN B;  1P3G D;  5AV5 A;  4JJN D;  3AFA D;  5B32 A;  5AV9 A;  2CWE A;  5CPJ A;  1KX4 D;  3B6G B;  1P3P D;  3AV1 C;  2F8N G;  3UT9 A;  4XUJ A;  2Y2Q A;  3W98 D;  5E5A C;  5AV8 B;  1P3O A;  1N1J B;  1ZLA A;  3AV2 C;  5CPK C;  4NE5 A;  3REI B;  3AZN D;  3WTP B;  5JRG A;  2NZD B;  5B0Y D;  4J8X A;  4J8U D;  1U35 A;  2ARO A;  3B6G D;  4JJN C;  4ZBJ C;  3X1T B;  4H9Q B;  2F8N H;  3AZF B;  4UPK A;  1P3P C;  5B1M A;  3W98 C;  5DNN C;  1WWI A;  4ZUX B;  1P3L A;  3LJA B;  3REL A;  3B6F A;  3WTP D;  3REK D;  2LY8 A;  4YS3 A;  1HQ3 D;  1P3M A;  4E45 A;  4KGC D;  5BS7 C;  3AZE A;  3AZN C;  2CV5 B;  3TU4 B;  5B0Y C;  4H9S A;  2ZY2 A;  3B6G C;  4XZQ B;  3AV1 A;  2FJ7 B;  4QLC D;  3LZ1 A;  5E5A A;  4ZUX D;  4X23 B;  5AVC A;  3AV2 A;  5AVB B;  5CPK A;  3R45 B;  3WTP C;  3REK C;  3TU4 D;  2NZD C;  1BFM A;  1HQ3 C;  2DF4 C;  4KGC C;  3WKJ D;  3KWQ D;  4JJN A;  5B2J D;  3X1U B;  2HUE C;  3X1T C;  1P3F A;  4J8V D;  5G49 A;  3AZF C;  4WJ3 C;  5B33 D;  2YFW A;  3MVD B;  4WZS B;  5DNN A;  1F66 B;  5AVB D;  4ZUX C;  3WTP E;  4E44 A;  3C1C A;  1P3B B;  3X1V B;  5BO0 A;  3AZN A;  3W96 A;  3TU4 C;  3MGS A;  3X1U D;  2XD5 A;  3KWQ C;  4XZQ C;  2FJ7 C;  2JE5 A;  5B31 G;  3WA9 B;  5B33 C;  4WNN A;  5AV8 A;  4KUD B;  4X23 C;  1KX5 B;  1N1J A;  1P3B D;  5AVB C;  3AZL B;  3O62 B;  3REI A;  1PZR A;  3WTP A;  2NZD A;  5BNV A;  1Q9C A;  3H0M C;  3X1S B;  5AV6 D;  3X1T A;  3X1U C;  3AZF A;  3B0D B;  2Y2K A;  3REJ B;  3WA9 D;  2Y2L A;  3AZJ D;  4Z66 D;  3MVD C;  4KUD D;  3LJA A;  5F99 B;  1P3B C;  3AZH B;  3AZK D;  4CSR B;  3AZG B;  2CV5 A;  4G92 B;  5AY8 B;  4H9R A;  1ID3 D;  3EPH A;  3MGR D;  3REJ D;  4XZQ A;  3AN2 B;  2FJ7 A;  4J8X D;  3WA9 C;  5DNM A;  2YFV B;  3AZJ C;  1BH9 B;  4KUD C;  4X23 A;  3A6N D;  1KX5 C;  3AZH D;  3WAA B;  5CPI B;  3R45 A;  2Y2M A;  3AZK C;  2Y2G A;  3REH B;  5AY8 D;  5B40 A;  2Y2H A;  3AZM D;  3AN2 D;  3MGR C;  1T3U A;  1P34 D;  3REJ C;  1P3G B;  3MVD A;  4ZBJ B;  3AFA B;  1KX4 B;  1F66 A;  3UTB D;  2Y2N A;  1AOI D;  1EQZ D;  2RIQ A;  5BNX B;  3WAA D;  1P3B A;  5CPI D;  1P3I D;  5F99 C;  3AZH C;  2ZY5 A;  3X1V A;  3REH D;  3AZG C;  4G92 C;  5AY8 C;  4G91 B;  3AZM C;  3MNN D;  1KX3 D;  3AN2 C;  5B0Y B;  2F2A C;  4J8U B;  3WA9 A;  1P34 C;  3VH6 A;  1H3O B;  4WU9 A;  4H9P B;  1KX5 A;  3UTB C;  3AZL A;  3O62 A;  4UUZ B;  3WAA C;  1M18 D;  5CPI C;  1P3I C;  5B2I A;  3NQU B;  3LEL D;  3REH C;  5KDM B;  3X1S A;  4NE3 A;  3REK B;  4J8W D;  1HQ3 B;  3REJ A;  4KGC B;  1P3G C;  3MNN C;  1KX3 C;  2F8N D;  2HUE B;  3AFA C;  4R8P B;  1KX4 C;  2BG1 A;  4QLC B;  5F99 A;  3AZH A;  4CSR A;  5GT3 D;  5GXQ D;  3AZG A;  5B24 D;  3LEL C;  3C1B D;  4G91 C;  4J8W C;  4J8U C;  4R8P D;  3MGQ D;  2UWX A;  3WKJ B;  3KWQ B;  1BH9 A;  4EO5 B;  5B2J B;  3MGP D;  4J8V B;  4HGA B;  3W97 D;  3H0R C;  3W99 D;  4Z2M G;  5B33 B;  4DRA A;  5B0Z D;  5GT3 C;  5GXQ C;  3AYW B;  1M19 D;  1P3G A;  5GSU B;  3AFA A;  4R8P C;  1BH8 B;  3KXB B;  3MGQ C;  1KX4 A;  3KSY A;  4Z2M H;  1P3P A;  1M1A D;  3MGP C;  4QLC C;  3W97 C;  3W99 C;  3W98 A;  1TZY D;  5B0Z C;  3AYW D;  1P3A D;  3VH6 W;  1P3K D;  5BS7 A;  5B0Y A;  4J8U A;  4H9O B;  5GSU D;  4NFT A;  1M19 C;  5B1L D;  3LZ0 D;  3KXB D;  3B6G A;  1H3O A;  5AV6 B;  3KUY B;  4EO5 C;  5B2J C;  4H9P A;  3WKJ C;  4J8V C;  4HGA C;  4KHA B;  3AZJ B;  4Z66 B;  5CP6 D;  1M1A C;  3F6T A;  4UUZ A;  5C3I B;  1TZY C;  3AL0 C;  3NQU A;  2ZM5 A;  3AYW C;  1P3A C;  2JCH A;  3REK A;  4NE6 A;  3AZK B;  2NQB D;  1HQ3 A;  1P3K C;  4KGC A;  2DQN C;  3KUY D;  4DRB A;  5GSU C;  1ID3 B;  4Z5T D;  4H9Q A;  5B1L C;  4WV4 B;  5B31 D;  3KXB C;  3LZ0 C;  3MGR B;  3AZI D;  5GT0 B;  4QLC A;  5CP6 C;  2HIO B;  1S32 D;  4ZUX A;  4YM6 D;  3A6N B;  5B32 B;  5CPJ B;  3UTA D;  4LD9 D;  3TU4 A;  3VH5 A;  3B0C W;  3H0L C;  2BYM B;  2RVQ D;  2PYO B;  5BT1 D;  3WKJ A;  3KWQ A;  5B2J A;  5AV6 C;  3AZM B;  3KUY C;  4Z5T C;  5B31 C;  1HTA A;  5GT0 D;  4J8V A;  1ZLA B;  1P34 B;  5B33 A;  3AZI C;  4Z66 C;  2HIO D;  3VH6 T;  5JRG B;  5C3I C;  5AV5 D;  3FDD A;  3UTB B;  5B32 D;  5AVB A;  1S32 C;  1AOI B;  1EQZ B;  5CPJ D;  3EPJ A;  4YM6 C;  1P3I B;  5FUG B;  3UT9 D;  4XUJ D;  2PYO D;  5JA4 B;  5B1M B;  5GSU A;  3X1U A;  1P3O D;  1ID3 C;  1BH8 A;  5BT1 C;  1WWS A;  4WU8 B;  1ZLA D;  3MNN B;  1KX3 B;  5GT0 C;  3B6F B;  5JRG D;  4YS3 B;  2HIO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...