3UTAA

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaA00
1P3AD 1P3LB 5B31B 3LELD 3LELA 5BNVA 3VH5T 3AYWD 4YM6A 3X1TC 5B32D 3WAAC 5B32A 1P3LD 5B31D 1AOIB 4J8XA 1AOID 3AZIB 3AFAB 3C1CA 4JJNB 5B2IC 3KWQA 4J8UB 1S32C 2FJ7A 3AZID 3AFAD 4KGCB 5CPIB 4JJND 4NE3A 5AV5A 4Z66B 4J8UD 4H9NB 5B0YC 5CPID 3X1UA 5GT3C 1EQZB 3B0CT 3REKB 5B1LB 3R45B 1EQZD 5B32G 2NZDC 3REKD 5B1LD 3REJB 5AY8C 3NQJB 5JA4A 3X1VB 3REJD 4ZUXC 5CPJD 3X1SB 5CPJA 4DRAA 3UTAC 5B40C 3AZGC 1KU5A 3AZMB 2NQBC 1P34B 3X1SD 3WTPC 3AZHC 3AZMD 5B2JB 1P34D 3WKJB 3X1TA 3WAAD 3WAAA 1HQ3C 3W97C 4J8WC 3WKJD 5CPKC 4AWLC 5B24B 1F1EA 1P3BB 3NQUA 5AV8B 4NE6A 5B2ID 4XZQB 5B2IA 3AZLC 1S32A 1P3BD 5AV8D 3A6NB 4E45A 3W96B 4Z2MG 1M19B 5B0YA 1P3OB 2AROC 4X23B 2BYKB 5DNNB 3MGSB 1KX5B 3W96D 1TZYB 2HUEC 5GT3D 5GT3A 1M19D 3WA9B 4X23D 4WNNB 3AZJB 4EO5B 5CP6C 1BH8B 5DNND 5GSUB 1TZYD 2YFVA 5GT0C 2NZDA 4H9PA 3AZJD 5BNXA 5AY8A 4CAYB 5GSUD 5AVCC 4H9RA 4R8PC 4ZUXA 3AN2B 5B40A 3UTAA 3AZGA 2NQBA 2NQBD 5B1MC 3MGQB 3AZKC 3AN2D 3WTPA 3AZHA 4WV4B 1P3GB 1U35C 1ID3B 4UUZB 3MGQD 4G92B 1B6WA 1HQ3D 1HQ3A 4G91C 3C1BB 4J8VB 3W97A 4J8WA 5GXQC 3B6GC 5CPKA 1P3AC 1JFIB 3C1BD 4M6BA 1F66B 4LD9C 3AYWC 3AZLD 3AZLA 3AZFB 5B31C 1P3LC 1F66D 1N1JB 1AOIC 3AZFD 2AROD 2AROA 3AZIC 3AFAC 4JJNC 5CP6A 5GT0D 5GT0A 4J8UC 3UTBB 4KGCC 5CPIC 1BH9B 3TU4B 4CSRB 5AVCA 3UT9B 4Z66C 4R8PD 4R8PA 3KUYB 3KSYA 3TU4D 4E44A 4XUJB 3UT9D 1EQZC 3KUYD 5B1MA 3REKC 5B1LC 2CV5B 3B0CW 3AZKA 1U35A 5FUGA 1HTAA 1P3FB 3REJC 4KHAA 3X1VC 3REHB 5E5AB 5GXQA 1ZLAB 3B6GA 3B6GD 1P3AA 3X1SC 4QLCB 2L5AA 3AZMC 3REHD 5E5AD 4LD9A 3AYWA 1P34C 1ZLAD 2CWEA 4LD9D 1P3LA 4QLCD 5B31A 5B2JC 3WKJC 5DNMB 3REIB 1AOIA 2RVQC 1KX3B 1P3MB 3AZEB 3REID 5B24C 1P3BC 3LZ1B 3AZIA 1KX3D 3AFAA 1P3MD 5AV8C 4JJNA 3AZED 1M18B 4XZQC 5AV9B 4J8UA 3LZ1D 4NE5A 4KGCD 4KGCA 5CPIA 3A6NC 1M18D 3W96C 3MVDB 5AV9D 4Z66D 4Z66A 1M19C 4H9NA 1P3OC 2YFWB 4X23C 5JRGB 5DNNC 3MGSC 1KX5C 3MVDD 1TZYC 1EQZA 3WA9C 2F8NB 5B31G 3AZJC 4EO5C 5B1LA 5B0ZB 3REKA 3R45A 5GSUC 1M1AB 4YS3B 5B0ZD 3REJA 3LZ0B 4WU9B 3NQJA 3X1VD 4YS3D 3X1VA 3LZ0D 3X1SA 4WU9D 3AN2C 3AZMA 3MGQC 5AVBB 1P34A 1P3GC 1ID3C 5B2JD 5B2JA 3MGRB 5AVBD 3WKJA 4G92C 2RVQD 3C1BC 4J8VC 1ULYA 3VH6W 5B24D 5B24A 1P3BA 4WU8B 5AV8A 1F66C 4XZQD 4XZQA 1Q9CA 3W98B 5KDMB 3AZFC 5C3IB 4WU8D 3A6ND 3A6NA 5G49B 5AV6B 3W96A 3W98D 3AV2B 1M19A 1P3OD 1P3OA 4X23A 2BYKA 2IO5B 1TAFB 1KX5D 5DNNA 5AV6D 5BO0B 3MGSA 3MGSD 1TZYA 3AV2D 1KX5A 3WA9D 3WA9A 4WNNA 3B0DB 3AZJA 1BH8A 4Z5TB 5GSUA 3UTBC 3VH6A 3TU4C 4Z5TD 4CAYA 4H9QB 3UT9C 3KUYC 3LJAB 1P3PB 2HIOB 3AN2A 4H9OB 4XUJC 3LJAD 3MGQA 1P3PD 2CV5C 2HIOD 1P3GD 1P3GA 1ID3A 1ID3D 4UUZA 1P3FC 3VH6T 3AZNB 2BYMB 3C1BA 4J8VD 4J8VA 3REHC 5E5AC 4DRBA 1ZLAC 1JFIA 1P3IB 4QLCC 3WTPE 1H3OB 1F66A 3V9RB 2F8NH 3AZFA 1P3KB 5BS7C 1N1JA 5DNMC 3REIC 3O62B 1P3KD 1KX3C 1P3MC 3AZEC 3MGPB 3LZ1C 1M18C 5AV9C 3UTBD 3UTBA 3MNNB 1BH9A 1WWIA 3TU4A 4CSRA 3MVDC 3UT9A 4Z2MH 3KUYA 3MNND 5JRGC 4XUJD 4XUJA 2CV5D 2CV5A 4KUDB 5B0ZC 1M1AC 4YS3C 1P3FD 1P3FA 4KUDD 3LZ0C 4WU9C 3B6FB 3REHA 5E5AA 1ZLAA 3RELB 4QLCA 3AV1B 1BFMA 3B6FD 3KXBB 5AVBC 3W99B 3RELD 5BS7A 3MGRC 1KX4B 3W99D 5DNMA 5DNMD 3REIA 5B33B 1KX3A 5F99B 1P3MA 3AZEA 4HGAB 3LELB 5BNVB 3LZ1A 4H9SC 4YM6B 5F99D 4WU8C 5B32B 1M18A 3W98C 5AV9A 4J8XB 5BT1D 5C3IC 4YM6D 5AV6C 3MVDA 3AV2C 3C1CB 4J8XD 2F8NK 2YFWA 3KWQB 2IO5C 5JRGD 5JRGA 2FJ7B 3C1CD 3KWQD 2F8ND 2F8NA 3B0DC 4ZBJB 5AV5B 5B0ZA 2FJ7D 4Z5TC 1M1AD 1M1AA 3X1UB 4YS3A 5AV5D 3LZ0A 4WU9A 3X1UD 3LJAC 1P3PC 2HIOC 5CHLB 5AVBA 5JA4B 5CPJB 2PYOB 3MGRD 3MGRA 2JSSA 3AZNC 2PYOD 2PYOA 1P3IC 2F8NG 4H9SA 4WU8A 3X1TB 3WAAB 3W98A 5KDMA 1P3KC 1B67A 3X1TD 5G49A 5AV6A 3B0BA 3NQUB 3O62C 3AV2A 5B2IB 1TAFA 1S32B 5BO0A 3MGPC 1S32D 5B0YB 4Z5TA 3MNNC 5GT3B 1A7WA 5B0YD 4WZSB 4H9QA 3LJAA 1P3PA 2YFVB 1WWSA 2HIOA 2NZDB 4H9PB 4H9OA 5BNXB 5AY8B 4H9RB 4KUDC 2NZDD 5AY8D 4ZUXB 3AZND 5B40B 3UTAB 3AZNA 3AZGB 2NQBB 2BYMA 2LY8A 3B6FC 4ZUXD 3WTPB 3AZHB 5B40D 3UTAD 3RELC 3AZGD 1P3IA 1P3ID 3AV1C 1H3OA 3V9RA 3KXBC 3WTPD 3W99C 3AZHD 1HQ3B 3W97B 4J8WB 1P3KA 5CPKB 4AWLB 1KX4C 3O62D 3O62A 3W97D 4J8WD 5B33C 5F99C 5CPKD 3AZLB 4HGAC 3LELC 3MGPD 3MGPA 5BT1C 4YM6C 5B32C 2AROB 4J8XC 3MNNA 3VH5W 2HUEB 3C1CC 5CP6B 3KWQC 1R4VA 5GT0B 2FJ7C 5CP6D 4NFTA 5AVCB 4ZBJC 5AV5C 4KUDA 4R8PB 3X1UC 5AVCD 5B1MB 3B6FA 3AZKB 1U35B 3VH5A 5FUGB 3RELA 5B1MD 3AV1A 3AV1D 4KHAB 3KXBD 3KXBA 3AZKD 3W99A 4G91B 1U35D 5GXQB 3B6GB 1P3AB 5CPJC 2PYOC 1KX4D 1KX4A 4LD9B 5B33D 5B33A 3AYWB 5GXQD 5F99A
chains in the Genus database with same CATH superfamily
1P3AD 1P3LB 5B31B 2Y2MA 3LELD 3LELA 5BNVA 3VH5T 3AYWD 4YM6A 3X1TC 5B32D 3WAAC 5B32A 1P3LD 5B31D 1AOIB 2ZY4A 4J8XA 2Y2HA 1AOID 3AZIB 3AFAB 2FFFB 3C1CA 4JJNB 5B2IC 3KWQA 4J8UB 1S32C 2FJ7A 3AZID 3AFAD 2Y2JA 5CPIB 4KGCB 4JJND 2XD5A 4NE3A 5AV5A 4Z66B 4J8UD 4H9NB 5B0YC 5CPID 3X1UA 5GT3C 1EQZB 2Y2NA 3B0CT 3REKB 5B1LB 3R45B 1EQZD 5B32G 2NZDC 2G5IC 5B1LD 3REJB 5AY8C 2ZY5A 3REKD 3NQJB 5JA4A 3X1VB 3REJD 4ZUXC 5CPJD 3X1SB 5CPJA 4DRAA 3UTAC 5B40C 3AZGC 1KU5A 3AZMB 2NQBC 1T3UA 1P34B 3X1SD 3WTPC 3AZHC 3EPLA 3AZMD 5B2JB 1P34D 3WKJB 3X1TA 3F6TA 3WAAD 3WAAA 1HQ3C 3W97C 4J8WC 3WKJD 5CPKC 4AWLC 5B24B 1F1EA 1P3BB 3NQUA 5AV8B 4NE6A 5B2ID 4XZQB 5B2IA 3AZLC 2DQNC 1S32A 1P3BD 5AV8D 3A6NB 4E45A 3W96B 4Z2MG 3A1IA 1M19B 5B0YA 1P3OB 2AROC 4X23B 2BYKB 5DNNB 3MGSB 1KX5B 3W96D 1TZYB 2HUEC 5GT3D 5GT3A 1M19D 3WA9B 4X23D 4WJ3C 4WNNB 3AZJB 4EO5B 5CP6C 1BH8B 5DNND 5GSUB 1TZYD 2YFVA 5GT0C 2NZDA 4H9PA 3AZJD 5BNXA 5AY8A 4CAYB 5GSUD 5AVCC 4H9RA 1Z2CB 4R8PC 4ZUXA 3AN2B 2RIQA 5B40A 3UTAA 3AZGA 2NQBA 2NQBD 5B1MC 3MGQB 3AZKC 3AN2D 3WTPA 3AZHA 4WV4B 1P3GB 1U35C 1ID3B 4UUZB 3MGQD 4G92B 1B6WA 1HQ3D 1HQ3A 4G91C 3C1BB 4J8VB 3W97A 4J8WA 5GXQC 3B6GC 5CPKA 1P3AC 1JFIB 3C1BD 2ZY2A 4M6BA 1F66B 4LD9C 3AYWC 2JCHA 3AZLD 3AZLA 3AZFB 5B31C 1P3LC 1F66D 1N1JB 1AOIC 3AZFD 2AROD 2AROA 3AZIC 3AFAC 4JJNC 5CP6A 5GT0D 2G5HC 5GT0A 4J8UC 3UTBB 4KGCC 5CPIC 1BH9B 3TU4B 4CSRB 5AVCA 3UT9B 2F2AC 4Z66C 4R8PD 4R8PA 3KUYB 3KSYA 3TU4D 4E44A 4XUJB 3UT9D 1EQZC 3KUYD 5B1MA 3REKC 5B1LC 2CV5B 3B0CW 3AZKA 1U35A 5FUGA 1HTAA 1P3FB 3REJC 4KHAA 4LD9D 3X1VC 3REHB 5E5AB 5GXQA 1ZLAB 3B6GA 3B6GD 1P3AA 3X1SC 4QLCB 2L5AA 3AZMC 3REHD 5E5AD 1W2EA 3AYWA 1P34C 1ZLAD 2CWEA 2W8SA 4LD9A 1P3LA 4QLCD 5B31A 5B2JC 3WKJC 3IP4C 5DNMB 3REIB 1AOIA 2RVQC 1KX3B 2XD1A 2Y2LA 3EG5B 3AZEB 1P3MB 3REID 5B24C 1P3BC 3LZ1B 3AZIA 1KX3D 3AFAA 1P3MD 5AV8C 4JJNA 3AZED 1M18B 4XZQC 5AV9B 4J8UA 3LZ1D 4NE5A 4KGCD 4KGCA 5CPIA 3A6NC 1M18D 3W96C 2ZY3A 3MVDB 5AV9D 4Z66D 4Z66A 1M19C 4H9NA 1P3OC 2YFWB 4X23C 5JRGB 5DNNC 3MGSC 1KX5C 3MVDD 1TZYC 1EQZA 2DF4C 3WA9C 2F8NB 5B31G 3AZJC 4EO5C 5B1LA 5B0ZB 3REKA 3R45A 5GSUC 1M1AB 4YS3B 5B0ZD 3REJA 3LZ0B 4WU9B 3NQJA 3X1VD 4YS3D 3X1VA 3LZ0D 3X1SA 4WU9D 3AN2C 3AZMA 3MGQC 5AVBB 1P34A 1P3GC 1ID3C 5B2JD 5B2JA 3MGRB 2Y2PA 5AVBD 4G92C 3WKJA 4DQYB 2RVQD 3C1BC 4J8VC 1ULYA 3VH6W 5B24D 5B24A 1P3BA 4WU8B 5AV8A 1F66C 4XZQD 4XZQA 1Q9CA 3W98B 5KDMB 3AZFC 5C3IB 4WU8D 3A6ND 3A6NA 5G49B 5AV6B 3W96A 3W98D 3AV2B 1M19A 1P3OD 1P3OA 4X23A 2BYKA 2IO5B 1TAFB 1KX5D 5DNNA 5AV6D 5BO0B 3MGSA 3MGSD 1TZYA 3AV2D 1KX5A 3WA9D 3WA9A 4WNNA 3B0DB 3AZJA 1BH8A 4Z5TB 5GSUA 3UTBC 3VH6A 2Y2IA 4Z5TD 4CAYA 3TU4C 4H9QB 3UT9C 3H0MC 3KUYC 2Y2GA 3LJAB 1P3PB 2HIOB 3AN2A 4H9OB 4XUJC 3LJAD 3MGQA 1P3PD 2CV5C 2HIOD 1P3GD 1P3GA 1ID3A 1ID3D 4UUZA 1P3FC 3VH6T 3AZNB 2BYMB 3P5JB 3C1BA 4J8VD 4J8VA 3REHC 5E5AC 4DRBA 1ZLAC 1JFIA 1P3IB 4QLCC 3WTPE 1H3OB 1F66A 3V9RB 2F8NH 3AZFA 1P3KB 5BS7C 1N1JA 5DNMC 3REIC 2J8PA 3O62B 1P3KD 1KX3C 1P3MC 3AZEC 3MGPB 2Y2KA 3LZ1C 1M18C 5AV9C 3UTBD 3UTBA 3MNNB 1BH9A 1WWIA 3TU4A 4CSRA 3H0RC 3MVDC 3UT9A 2VQRA 4Z2MH 3KUYA 3MNND 5JRGC 4XUJD 4XUJA 2Y2OA 2CV5D 2ZM5A 2CV5A 5B0ZC 4KUDB 1M1AC 4YS3C 1P3FD 1P3FA 4KUDD 3LZ0C 4WU9C 3B6FB 3REHA 5E5AA 1ZLAA 3RELB 4QLCA 3AV1B 1BFMA 3B6FD 3KXBB 5AVBC 3W99B 3RELD 2Y2QA 3FDDA 5BS7A 3MGRC 1KX4B 3W99D 5DNMA 5DNMD 3REIA 5B33B 1KX3A 5F99B 1P3MA 3AZEA 4HGAB 3LELB 5BNVB 3LZ1A 4H9SC 4YM6B 5F99D 4WU8C 5B32B 1M18A 3EPHA 3W98C 5AV9A 4J8XB 5BT1D 5C3IC 4YM6D 5AV6C 3MVDA 3AV2C 3C1CB 4J8XD 2F8NK 2YFWA 3AL0C 3KWQB 2IO5C 5JRGD 5JRGA 2FJ7B 3C1CD 3KWQD 2F8ND 2F8NA 3B0DC 4ZBJB 5AV5B 5B0ZA 2FJ7D 4Z5TC 1M1AD 1M1AA 3X1UB 4YS3A 5AV5D 3LZ0A 4WU9A 3X1UD 3KFUG 3LJAC 1P3PC 2HIOC 5CHLB 5AVBA 5JA4B 5CPJB 2PYOB 3MGRD 3A1KA 3MGRA 1PZRA 2JSSA 3AZNC 2PYOD 2PYOA 1P3IC 2F8NG 4H9SA 4WU8A 3X1TB 3WAAB 3W98A 5KDMA 1P3KC 1B67A 3X1TD 5G49A 5AV6A 3B0BA 3NQUB 3O62C 3AV2A 5B2IB 1TAFA 4UPKA 1S32B 5BO0A 3MGPC 1S32D 5B0YB 4Z5TA 3MNNC 5GT3B 1A7WA 5B0YD 4WZSB 4H9QA 3LJAA 1P3PA 2YFVB 1WWSA 2HIOA 2NZDB 4H9PB 4H9OA 5BNXB 5AY8B 4H9RB 4KUDC 2NZDD 5AY8D 4ZUXB 3AZND 5B40B 3UTAB 3AZNA 3AZGB 2NQBB 2BYMA 2LY8A 3B6FC 4ZUXD 3WTPB 3AZHB 5B40D 3UTAD 3RELC 3AZGD 1P3IA 1P3ID 3AV1C 1H3OA 3V9RA 3KXBC 3WTPD 3W99C 3AZHD 1HQ3B 3W97B 4J8WB 1P3KA 5CPKB 4AWLB 1KX4C 3O62D 3O62A 3W97D 4J8WD 5B33C 5F99C 5CPKD 3AZLB 4HGAC 3LELC 3MGPD 3MGPA 5BT1C 4YM6C 5B32C 2AROB 4J8XC 3EPJA 3MNNA 3VH5W 2HUEB 3C1CC 5CP6B 3KWQC 1R4VA 2BG1A 3H0LC 5GT0B 2FJ7C 2UWXA 5CP6D 4NFTA 5AVCB 4ZBJC 5AV5C 4KUDA 4R8PB 3EPKA 3X1UC 2JE5A 5AVCD 5B1MB 3B6FA 3AZKB 1U35B 3VH5A 5FUGB 3RELA 5B1MD 3AV1A 3AV1D 4KHAB 3KXBD 3KXBA 3AZKD 3W99A 4G91B 1U35D 5GXQB 3B6GB 1P3AB 5CPJC 2PYOC 1KX4D 1KX4A 4LD9B 5B33D 5B33A 3AYWB 5GXQD 5F99A
chains in the Genus database with same CATH topology
1P3AD 1P3LB 5B31B 2Y2MA 3LELD 3LELA 5BNVA 3VH5T 3AYWD 4YM6A 3X1TC 5B32D 3WAAC 5B32A 1P3LD 5B31D 1AOIB 2ZY4A 4J8XA 2Y2HA 1AOID 3AZIB 3AFAB 2FFFB 3C1CA 4JJNB 5B2IC 3KWQA 4J8UB 1S32C 2FJ7A 3AZID 3AFAD 2Y2JA 5CPIB 4KGCB 4JJND 2XD5A 4NE3A 5AV5A 4Z66B 4J8UD 4H9NB 5B0YC 5CPID 3X1UA 5GT3C 1EQZB 2Y2NA 3B0CT 3REKB 5B1LB 3R45B 1EQZD 5B32G 2NZDC 2G5IC 5B1LD 3REJB 5AY8C 2ZY5A 3REKD 3NQJB 5JA4A 3X1VB 3REJD 4ZUXC 5CPJD 3X1SB 5CPJA 4DRAA 3UTAC 5B40C 3AZGC 1KU5A 3AZMB 2NQBC 1T3UA 1P34B 3X1SD 3WTPC 3AZHC 3EPLA 3AZMD 5B2JB 1P34D 3WKJB 3X1TA 3F6TA 3WAAD 3WAAA 1HQ3C 3W97C 4J8WC 3WKJD 5CPKC 4AWLC 5B24B 1F1EA 1P3BB 3NQUA 5AV8B 4NE6A 5B2ID 4XZQB 5B2IA 3AZLC 2DQNC 1S32A 1P3BD 5AV8D 3A6NB 4E45A 3W96B 4Z2MG 3A1IA 1M19B 5B0YA 1P3OB 2AROC 4X23B 2BYKB 5DNNB 3MGSB 1KX5B 3W96D 1TZYB 2HUEC 5GT3D 5GT3A 1M19D 3WA9B 4X23D 4WJ3C 4WNNB 3AZJB 4EO5B 5CP6C 1BH8B 5DNND 5GSUB 1TZYD 2YFVA 5GT0C 2NZDA 4H9PA 3AZJD 5BNXA 5AY8A 4CAYB 5GSUD 5AVCC 4H9RA 1Z2CB 4R8PC 4ZUXA 3AN2B 2RIQA 5B40A 3UTAA 3AZGA 2NQBA 2NQBD 5B1MC 3MGQB 3AZKC 3AN2D 3WTPA 3AZHA 4WV4B 1P3GB 1U35C 1ID3B 4UUZB 3MGQD 4G92B 1B6WA 1HQ3D 1HQ3A 4G91C 3C1BB 4J8VB 3W97A 4J8WA 5GXQC 3B6GC 5CPKA 1P3AC 1JFIB 3C1BD 2ZY2A 4M6BA 1F66B 4LD9C 3AYWC 2JCHA 3AZLD 3AZLA 3AZFB 5B31C 1P3LC 1F66D 1N1JB 1AOIC 3AZFD 2AROD 2AROA 3AZIC 3AFAC 4JJNC 5CP6A 5GT0D 2G5HC 5GT0A 4J8UC 3UTBB 4KGCC 5CPIC 1BH9B 3TU4B 4CSRB 5AVCA 3UT9B 2F2AC 4Z66C 4R8PD 4R8PA 3KUYB 3KSYA 3TU4D 4E44A 4XUJB 3UT9D 1EQZC 3KUYD 5B1MA 3REKC 5B1LC 2CV5B 3B0CW 3AZKA 1U35A 5FUGA 1HTAA 1P3FB 3REJC 4KHAA 4LD9D 3X1VC 3REHB 5E5AB 5GXQA 1ZLAB 3B6GA 3B6GD 1P3AA 3X1SC 4QLCB 2L5AA 3AZMC 3REHD 5E5AD 1W2EA 3AYWA 1P34C 1ZLAD 2CWEA 2W8SA 4LD9A 1P3LA 4QLCD 5B31A 5B2JC 3WKJC 3IP4C 5DNMB 3REIB 1AOIA 2RVQC 1KX3B 2XD1A 2Y2LA 3EG5B 3AZEB 1P3MB 3REID 5B24C 1P3BC 3LZ1B 3AZIA 1KX3D 3AFAA 1P3MD 5AV8C 4JJNA 3AZED 1M18B 4XZQC 5AV9B 4J8UA 3LZ1D 4NE5A 4KGCD 4KGCA 5CPIA 3A6NC 1M18D 3W96C 2ZY3A 3MVDB 5AV9D 4Z66D 4Z66A 1M19C 4H9NA 1P3OC 2YFWB 4X23C 5JRGB 5DNNC 3MGSC 1KX5C 3MVDD 1TZYC 1EQZA 2DF4C 3WA9C 2F8NB 5B31G 3AZJC 4EO5C 5B1LA 5B0ZB 3REKA 3R45A 5GSUC 1M1AB 4YS3B 5B0ZD 3REJA 3LZ0B 4WU9B 3NQJA 3X1VD 4YS3D 3X1VA 3LZ0D 3X1SA 4WU9D 3AN2C 3AZMA 3MGQC 5AVBB 1P34A 1P3GC 1ID3C 5B2JD 5B2JA 3MGRB 2Y2PA 5AVBD 4G92C 3WKJA 4DQYB 2RVQD 3C1BC 4J8VC 1ULYA 3VH6W 5B24D 5B24A 1P3BA 4WU8B 5AV8A 1F66C 4XZQD 4XZQA 1Q9CA 3W98B 5KDMB 3AZFC 5C3IB 4WU8D 3A6ND 3A6NA 5G49B 5AV6B 3W96A 3W98D 3AV2B 1M19A 1P3OD 1P3OA 4X23A 2BYKA 2IO5B 1TAFB 1KX5D 5DNNA 5AV6D 5BO0B 3MGSA 3MGSD 1TZYA 3AV2D 1KX5A 3WA9D 3WA9A 4WNNA 3B0DB 3AZJA 1BH8A 4Z5TB 5GSUA 3UTBC 3VH6A 2Y2IA 4Z5TD 4CAYA 3TU4C 4H9QB 3UT9C 3H0MC 3KUYC 2Y2GA 3LJAB 1P3PB 2HIOB 3AN2A 4H9OB 4XUJC 3LJAD 3MGQA 1P3PD 2CV5C 2HIOD 1P3GD 1P3GA 1ID3A 1ID3D 4UUZA 1P3FC 3VH6T 3AZNB 2BYMB 3P5JB 3C1BA 4J8VD 4J8VA 3REHC 5E5AC 4DRBA 1ZLAC 1JFIA 1P3IB 4QLCC 3WTPE 1H3OB 1F66A 3V9RB 2F8NH 3AZFA 1P3KB 5BS7C 1N1JA 5DNMC 3REIC 2J8PA 3O62B 1P3KD 1KX3C 1P3MC 3AZEC 3MGPB 2Y2KA 3LZ1C 1M18C 5AV9C 3UTBD 3UTBA 3MNNB 1BH9A 1WWIA 3TU4A 4CSRA 3H0RC 3MVDC 3UT9A 2VQRA 4Z2MH 3KUYA 3MNND 5JRGC 4XUJD 4XUJA 2Y2OA 2CV5D 2ZM5A 2CV5A 5B0ZC 4KUDB 1M1AC 4YS3C 1P3FD 1P3FA 4KUDD 3LZ0C 4WU9C 3B6FB 3REHA 5E5AA 1ZLAA 3RELB 4QLCA 3AV1B 1BFMA 3B6FD 3KXBB 5AVBC 3W99B 3RELD 2Y2QA 3FDDA 5BS7A 3MGRC 1KX4B 3W99D 5DNMA 5DNMD 3REIA 5B33B 1KX3A 5F99B 1P3MA 3AZEA 4HGAB 3LELB 5BNVB 3LZ1A 4H9SC 4YM6B 5F99D 4WU8C 5B32B 1M18A 3EPHA 3W98C 5AV9A 4J8XB 5BT1D 5C3IC 4YM6D 5AV6C 3MVDA 3AV2C 3C1CB 4J8XD 2F8NK 2YFWA 3AL0C 3KWQB 2IO5C 5JRGD 5JRGA 2FJ7B 3C1CD 3KWQD 2F8ND 2F8NA 3B0DC 4ZBJB 5AV5B 5B0ZA 2FJ7D 4Z5TC 1M1AD 1M1AA 3X1UB 4YS3A 5AV5D 3LZ0A 4WU9A 3X1UD 3KFUG 3LJAC 1P3PC 2HIOC 5CHLB 5AVBA 5JA4B 5CPJB 2PYOB 3MGRD 3A1KA 3MGRA 1PZRA 2JSSA 3AZNC 2PYOD 2PYOA 1P3IC 2F8NG 4H9SA 4WU8A 3X1TB 3WAAB 3W98A 5KDMA 1P3KC 1B67A 3X1TD 5G49A 5AV6A 3B0BA 3NQUB 3O62C 3AV2A 5B2IB 1TAFA 4UPKA 1S32B 5BO0A 3MGPC 1S32D 5B0YB 4Z5TA 3MNNC 5GT3B 1A7WA 5B0YD 4WZSB 4H9QA 3LJAA 1P3PA 2YFVB 1WWSA 2HIOA 2NZDB 4H9PB 4H9OA 5BNXB 5AY8B 4H9RB 4KUDC 2NZDD 5AY8D 4ZUXB 3AZND 5B40B 3UTAB 3AZNA 3AZGB 2NQBB 2BYMA 2LY8A 3B6FC 4ZUXD 3WTPB 3AZHB 5B40D 3UTAD 3RELC 3AZGD 1P3IA 1P3ID 3AV1C 1H3OA 3V9RA 3KXBC 3WTPD 3W99C 3AZHD 1HQ3B 3W97B 4J8WB 1P3KA 5CPKB 4AWLB 1KX4C 3O62D 3O62A 3W97D 4J8WD 5B33C 5F99C 5CPKD 3AZLB 4HGAC 3LELC 3MGPD 3MGPA 5BT1C 4YM6C 5B32C 2AROB 4J8XC 3EPJA 3MNNA 3VH5W 2HUEB 3C1CC 5CP6B 3KWQC 1R4VA 2BG1A 3H0LC 5GT0B 2FJ7C 2UWXA 5CP6D 4NFTA 5AVCB 4ZBJC 5AV5C 4KUDA 4R8PB 3EPKA 3X1UC 2JE5A 5AVCD 5B1MB 3B6FA 3AZKB 1U35B 3VH5A 5FUGB 3RELA 5B1MD 3AV1A 3AV1D 4KHAB 3KXBD 3KXBA 3AZKD 3W99A 4G91B 1U35D 5GXQB 3B6GB 1P3AB 5CPJC 2PYOC 1KX4D 1KX4A 4LD9B 5B33D 5B33A 3AYWB 5GXQD 5F99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A D;  1P3L B;  5B31 B;  3LEL D;  3LEL A;  5BNV A;  3VH5 T;  3AYW D;  4YM6 A;  3X1T C;  5B32 D;  3WAA C;  5B32 A;  1P3L D;  5B31 D;  1AOI B;  4J8X A;  1AOI D;  3AZI B;  3AFA B;  3C1C A;  4JJN B;  5B2I C;  3KWQ A;  4J8U B;  1S32 C;  2FJ7 A;  3AZI D;  3AFA D;  4KGC B;  5CPI B;  4JJN D;  4NE3 A;  5AV5 A;  4Z66 B;  4J8U D;  4H9N B;  5B0Y C;  5CPI D;  3X1U A;  5GT3 C;  1EQZ B;  3B0C T;  3REK B;  5B1L B;  3R45 B;  1EQZ D;  5B32 G;  2NZD C;  3REK D;  5B1L D;  3REJ B;  5AY8 C;  3NQJ B;  5JA4 A;  3X1V B;  3REJ D;  4ZUX C;  5CPJ D;  3X1S B;  5CPJ A;  4DRA A;  3UTA C;  5B40 C;  3AZG C;  1KU5 A;  3AZM B;  2NQB C;  1P34 B;  3X1S D;  3WTP C;  3AZH C;  3AZM D;  5B2J B;  1P34 D;  3WKJ B;  3X1T A;  3WAA D;  3WAA A;  1HQ3 C;  3W97 C;  4J8W C;  3WKJ D;  5CPK C;  4AWL C;  5B24 B;  1F1E A;  1P3B B;  3NQU A;  5AV8 B;  4NE6 A;  5B2I D;  4XZQ B;  5B2I A;  3AZL C;  1S32 A;  1P3B D;  5AV8 D;  3A6N B;  4E45 A;  3W96 B;  4Z2M G;  1M19 B;  5B0Y A;  1P3O B;  2ARO C;  4X23 B;  2BYK B;  5DNN B;  3MGS B;  1KX5 B;  3W96 D;  1TZY B;  2HUE C;  5GT3 D;  5GT3 A;  1M19 D;  3WA9 B;  4X23 D;  4WNN B;  3AZJ B;  4EO5 B;  5CP6 C;  1BH8 B;  5DNN D;  5GSU B;  1TZY D;  2YFV A;  5GT0 C;  2NZD A;  4H9P A;  3AZJ D;  5BNX A;  5AY8 A;  4CAY B;  5GSU D;  5AVC C;  4H9R A;  4R8P C;  4ZUX A;  3AN2 B;  5B40 A;  3UTA A;  3AZG A;  2NQB A;  2NQB D;  5B1M C;  3MGQ B;  3AZK C;  3AN2 D;  3WTP A;  3AZH A;  4WV4 B;  1P3G B;  1U35 C;  1ID3 B;  4UUZ B;  3MGQ D;  4G92 B;  1B6W A;  1HQ3 D;  1HQ3 A;  4G91 C;  3C1B B;  4J8V B;  3W97 A;  4J8W A;  5GXQ C;  3B6G C;  5CPK A;  1P3A C;  1JFI B;  3C1B D;  4M6B A;  1F66 B;  4LD9 C;  3AYW C;  3AZL D;  3AZL A;  3AZF B;  5B31 C;  1P3L C;  1F66 D;  1N1J B;  1AOI C;  3AZF D;  2ARO D;  2ARO A;  3AZI C;  3AFA C;  4JJN C;  5CP6 A;  5GT0 D;  5GT0 A;  4J8U C;  3UTB B;  4KGC C;  5CPI C;  1BH9 B;  3TU4 B;  4CSR B;  5AVC A;  3UT9 B;  4Z66 C;  4R8P D;  4R8P A;  3KUY B;  3KSY A;  3TU4 D;  4E44 A;  4XUJ B;  3UT9 D;  1EQZ C;  3KUY D;  5B1M A;  3REK C;  5B1L C;  2CV5 B;  3B0C W;  3AZK A;  1U35 A;  5FUG A;  1HTA A;  1P3F B;  3REJ C;  4KHA A;  3X1V C;  3REH B;  5E5A B;  5GXQ A;  1ZLA B;  3B6G A;  3B6G D;  1P3A A;  3X1S C;  4QLC B;  2L5A A;  3AZM C;  3REH D;  5E5A D;  4LD9 A;  3AYW A;  1P34 C;  1ZLA D;  2CWE A;  4LD9 D;  1P3L A;  4QLC D;  5B31 A;  5B2J C;  3WKJ C;  5DNM B;  3REI B;  1AOI A;  2RVQ C;  1KX3 B;  1P3M B;  3AZE B;  3REI D;  5B24 C;  1P3B C;  3LZ1 B;  3AZI A;  1KX3 D;  3AFA A;  1P3M D;  5AV8 C;  4JJN A;  3AZE D;  1M18 B;  4XZQ C;  5AV9 B;  4J8U A;  3LZ1 D;  4NE5 A;  4KGC D;  4KGC A;  5CPI A;  3A6N C;  1M18 D;  3W96 C;  3MVD B;  5AV9 D;  4Z66 D;  4Z66 A;  1M19 C;  4H9N A;  1P3O C;  2YFW B;  4X23 C;  5JRG B;  5DNN C;  3MGS C;  1KX5 C;  3MVD D;  1TZY C;  1EQZ A;  3WA9 C;  2F8N B;  5B31 G;  3AZJ C;  4EO5 C;  5B1L A;  5B0Z B;  3REK A;  3R45 A;  5GSU C;  1M1A B;  4YS3 B;  5B0Z D;  3REJ A;  3LZ0 B;  4WU9 B;  3NQJ A;  3X1V D;  4YS3 D;  3X1V A;  3LZ0 D;  3X1S A;  4WU9 D;  3AN2 C;  3AZM A;  3MGQ C;  5AVB B;  1P34 A;  1P3G C;  1ID3 C;  5B2J D;  5B2J A;  3MGR B;  5AVB D;  3WKJ A;  4G92 C;  2RVQ D;  3C1B C;  4J8V C;  1ULY A;  3VH6 W;  5B24 D;  5B24 A;  1P3B A;  4WU8 B;  5AV8 A;  1F66 C;  4XZQ D;  4XZQ A;  1Q9C A;  3W98 B;  5KDM B;  3AZF C;  5C3I B;  4WU8 D;  3A6N D;  3A6N A;  5G49 B;  5AV6 B;  3W96 A;  3W98 D;  3AV2 B;  1M19 A;  1P3O D;  1P3O A;  4X23 A;  2BYK A;  2IO5 B;  1TAF B;  1KX5 D;  5DNN A;  5AV6 D;  5BO0 B;  3MGS A;  3MGS D;  1TZY A;  3AV2 D;  1KX5 A;  3WA9 D;  3WA9 A;  4WNN A;  3B0D B;  3AZJ A;  1BH8 A;  4Z5T B;  5GSU A;  3UTB C;  3VH6 A;  3TU4 C;  4Z5T D;  4CAY A;  4H9Q B;  3UT9 C;  3KUY C;  3LJA B;  1P3P B;  2HIO B;  3AN2 A;  4H9O B;  4XUJ C;  3LJA D;  3MGQ A;  1P3P D;  2CV5 C;  2HIO D;  1P3G D;  1P3G A;  1ID3 A;  1ID3 D;  4UUZ A;  1P3F C;  3VH6 T;  3AZN B;  2BYM B;  3C1B A;  4J8V D;  4J8V A;  3REH C;  5E5A C;  4DRB A;  1ZLA C;  1JFI A;  1P3I B;  4QLC C;  3WTP E;  1H3O B;  1F66 A;  3V9R B;  2F8N H;  3AZF A;  1P3K B;  5BS7 C;  1N1J A;  5DNM C;  3REI C;  3O62 B;  1P3K D;  1KX3 C;  1P3M C;  3AZE C;  3MGP B;  3LZ1 C;  1M18 C;  5AV9 C;  3UTB D;  3UTB A;  3MNN B;  1BH9 A;  1WWI A;  3TU4 A;  4CSR A;  3MVD C;  3UT9 A;  4Z2M H;  3KUY A;  3MNN D;  5JRG C;  4XUJ D;  4XUJ A;  2CV5 D;  2CV5 A;  4KUD B;  5B0Z C;  1M1A C;  4YS3 C;  1P3F D;  1P3F A;  4KUD D;  3LZ0 C;  4WU9 C;  3B6F B;  3REH A;  5E5A A;  1ZLA A;  3REL B;  4QLC A;  3AV1 B;  1BFM A;  3B6F D;  3KXB B;  5AVB C;  3W99 B;  3REL D;  5BS7 A;  3MGR C;  1KX4 B;  3W99 D;  5DNM A;  5DNM D;  3REI A;  5B33 B;  1KX3 A;  5F99 B;  1P3M A;  3AZE A;  4HGA B;  3LEL B;  5BNV B;  3LZ1 A;  4H9S C;  4YM6 B;  5F99 D;  4WU8 C;  5B32 B;  1M18 A;  3W98 C;  5AV9 A;  4J8X B;  5BT1 D;  5C3I C;  4YM6 D;  5AV6 C;  3MVD A;  3AV2 C;  3C1C B;  4J8X D;  2F8N K;  2YFW A;  3KWQ B;  2IO5 C;  5JRG D;  5JRG A;  2FJ7 B;  3C1C D;  3KWQ D;  2F8N D;  2F8N A;  3B0D C;  4ZBJ B;  5AV5 B;  5B0Z A;  2FJ7 D;  4Z5T C;  1M1A D;  1M1A A;  3X1U B;  4YS3 A;  5AV5 D;  3LZ0 A;  4WU9 A;  3X1U D;  3LJA C;  1P3P C;  2HIO C;  5CHL B;  5AVB A;  5JA4 B;  5CPJ B;  2PYO B;  3MGR D;  3MGR A;  2JSS A;  3AZN C;  2PYO D;  2PYO A;  1P3I C;  2F8N G;  4H9S A;  4WU8 A;  3X1T B;  3WAA B;  3W98 A;  5KDM A;  1P3K C;  1B67 A;  3X1T D;  5G49 A;  5AV6 A;  3B0B A;  3NQU B;  3O62 C;  3AV2 A;  5B2I B;  1TAF A;  1S32 B;  5BO0 A;  3MGP C;  1S32 D;  5B0Y B;  4Z5T A;  3MNN C;  5GT3 B;  1A7W A;  5B0Y D;  4WZS B;  4H9Q A;  3LJA A;  1P3P A;  2YFV B;  1WWS A;  2HIO A;  2NZD B;  4H9P B;  4H9O A;  5BNX B;  5AY8 B;  4H9R B;  4KUD C;  2NZD D;  5AY8 D;  4ZUX B;  3AZN D;  5B40 B;  3UTA B;  3AZN A;  3AZG B;  2NQB B;  2BYM A;  2LY8 A;  3B6F C;  4ZUX D;  3WTP B;  3AZH B;  5B40 D;  3UTA D;  3REL C;  3AZG D;  1P3I A;  1P3I D;  3AV1 C;  1H3O A;  3V9R A;  3KXB C;  3WTP D;  3W99 C;  3AZH D;  1HQ3 B;  3W97 B;  4J8W B;  1P3K A;  5CPK B;  4AWL B;  1KX4 C;  3O62 D;  3O62 A;  3W97 D;  4J8W D;  5B33 C;  5F99 C;  5CPK D;  3AZL B;  4HGA C;  3LEL C;  3MGP D;  3MGP A;  5BT1 C;  4YM6 C;  5B32 C;  2ARO B;  4J8X C;  3MNN A;  3VH5 W;  2HUE B;  3C1C C;  5CP6 B;  3KWQ C;  1R4V A;  5GT0 B;  2FJ7 C;  5CP6 D;  4NFT A;  5AVC B;  4ZBJ C;  5AV5 C;  4KUD A;  4R8P B;  3X1U C;  5AVC D;  5B1M B;  3B6F A;  3AZK B;  1U35 B;  3VH5 A;  5FUG B;  3REL A;  5B1M D;  3AV1 A;  3AV1 D;  4KHA B;  3KXB D;  3KXB A;  3AZK D;  3W99 A;  4G91 B;  1U35 D;  5GXQ B;  3B6G B;  1P3A B;  5CPJ C;  2PYO C;  1KX4 D;  1KX4 A;  4LD9 B;  5B33 D;  5B33 A;  3AYW B;  5GXQ D;  5F99 A; 
#chains in the Genus database with same CATH topology
 1P3A D;  1P3L B;  5B31 B;  2Y2M A;  3LEL D;  3LEL A;  5BNV A;  3VH5 T;  3AYW D;  4YM6 A;  3X1T C;  5B32 D;  3WAA C;  5B32 A;  1P3L D;  5B31 D;  1AOI B;  2ZY4 A;  4J8X A;  2Y2H A;  1AOI D;  3AZI B;  3AFA B;  2FFF B;  3C1C A;  4JJN B;  5B2I C;  3KWQ A;  4J8U B;  1S32 C;  2FJ7 A;  3AZI D;  3AFA D;  2Y2J A;  5CPI B;  4KGC B;  4JJN D;  2XD5 A;  4NE3 A;  5AV5 A;  4Z66 B;  4J8U D;  4H9N B;  5B0Y C;  5CPI D;  3X1U A;  5GT3 C;  1EQZ B;  2Y2N A;  3B0C T;  3REK B;  5B1L B;  3R45 B;  1EQZ D;  5B32 G;  2NZD C;  2G5I C;  5B1L D;  3REJ B;  5AY8 C;  2ZY5 A;  3REK D;  3NQJ B;  5JA4 A;  3X1V B;  3REJ D;  4ZUX C;  5CPJ D;  3X1S B;  5CPJ A;  4DRA A;  3UTA C;  5B40 C;  3AZG C;  1KU5 A;  3AZM B;  2NQB C;  1T3U A;  1P34 B;  3X1S D;  3WTP C;  3AZH C;  3EPL A;  3AZM D;  5B2J B;  1P34 D;  3WKJ B;  3X1T A;  3F6T A;  3WAA D;  3WAA A;  1HQ3 C;  3W97 C;  4J8W C;  3WKJ D;  5CPK C;  4AWL C;  5B24 B;  1F1E A;  1P3B B;  3NQU A;  5AV8 B;  4NE6 A;  5B2I D;  4XZQ B;  5B2I A;  3AZL C;  2DQN C;  1S32 A;  1P3B D;  5AV8 D;  3A6N B;  4E45 A;  3W96 B;  4Z2M G;  3A1I A;  1M19 B;  5B0Y A;  1P3O B;  2ARO C;  4X23 B;  2BYK B;  5DNN B;  3MGS B;  1KX5 B;  3W96 D;  1TZY B;  2HUE C;  5GT3 D;  5GT3 A;  1M19 D;  3WA9 B;  4X23 D;  4WJ3 C;  4WNN B;  3AZJ B;  4EO5 B;  5CP6 C;  1BH8 B;  5DNN D;  5GSU B;  1TZY D;  2YFV A;  5GT0 C;  2NZD A;  4H9P A;  3AZJ D;  5BNX A;  5AY8 A;  4CAY B;  5GSU D;  5AVC C;  4H9R A;  1Z2C B;  4R8P C;  4ZUX A;  3AN2 B;  2RIQ A;  5B40 A;  3UTA A;  3AZG A;  2NQB A;  2NQB D;  5B1M C;  3MGQ B;  3AZK C;  3AN2 D;  3WTP A;  3AZH A;  4WV4 B;  1P3G B;  1U35 C;  1ID3 B;  4UUZ B;  3MGQ D;  4G92 B;  1B6W A;  1HQ3 D;  1HQ3 A;  4G91 C;  3C1B B;  4J8V B;  3W97 A;  4J8W A;  5GXQ C;  3B6G C;  5CPK A;  1P3A C;  1JFI B;  3C1B D;  2ZY2 A;  4M6B A;  1F66 B;  4LD9 C;  3AYW C;  2JCH A;  3AZL D;  3AZL A;  3AZF B;  5B31 C;  1P3L C;  1F66 D;  1N1J B;  1AOI C;  3AZF D;  2ARO D;  2ARO A;  3AZI C;  3AFA C;  4JJN C;  5CP6 A;  5GT0 D;  2G5H C;  5GT0 A;  4J8U C;  3UTB B;  4KGC C;  5CPI C;  1BH9 B;  3TU4 B;  4CSR B;  5AVC A;  3UT9 B;  2F2A C;  4Z66 C;  4R8P D;  4R8P A;  3KUY B;  3KSY A;  3TU4 D;  4E44 A;  4XUJ B;  3UT9 D;  1EQZ C;  3KUY D;  5B1M A;  3REK C;  5B1L C;  2CV5 B;  3B0C W;  3AZK A;  1U35 A;  5FUG A;  1HTA A;  1P3F B;  3REJ C;  4KHA A;  4LD9 D;  3X1V C;  3REH B;  5E5A B;  5GXQ A;  1ZLA B;  3B6G A;  3B6G D;  1P3A A;  3X1S C;  4QLC B;  2L5A A;  3AZM C;  3REH D;  5E5A D;  1W2E A;  3AYW A;  1P34 C;  1ZLA D;  2CWE A;  2W8S A;  4LD9 A;  1P3L A;  4QLC D;  5B31 A;  5B2J C;  3WKJ C;  3IP4 C;  5DNM B;  3REI B;  1AOI A;  2RVQ C;  1KX3 B;  2XD1 A;  2Y2L A;  3EG5 B;  3AZE B;  1P3M B;  3REI D;  5B24 C;  1P3B C;  3LZ1 B;  3AZI A;  1KX3 D;  3AFA A;  1P3M D;  5AV8 C;  4JJN A;  3AZE D;  1M18 B;  4XZQ C;  5AV9 B;  4J8U A;  3LZ1 D;  4NE5 A;  4KGC D;  4KGC A;  5CPI A;  3A6N C;  1M18 D;  3W96 C;  2ZY3 A;  3MVD B;  5AV9 D;  4Z66 D;  4Z66 A;  1M19 C;  4H9N A;  1P3O C;  2YFW B;  4X23 C;  5JRG B;  5DNN C;  3MGS C;  1KX5 C;  3MVD D;  1TZY C;  1EQZ A;  2DF4 C;  3WA9 C;  2F8N B;  5B31 G;  3AZJ C;  4EO5 C;  5B1L A;  5B0Z B;  3REK A;  3R45 A;  5GSU C;  1M1A B;  4YS3 B;  5B0Z D;  3REJ A;  3LZ0 B;  4WU9 B;  3NQJ A;  3X1V D;  4YS3 D;  3X1V A;  3LZ0 D;  3X1S A;  4WU9 D;  3AN2 C;  3AZM A;  3MGQ C;  5AVB B;  1P34 A;  1P3G C;  1ID3 C;  5B2J D;  5B2J A;  3MGR B;  2Y2P A;  5AVB D;  4G92 C;  3WKJ A;  4DQY B;  2RVQ D;  3C1B C;  4J8V C;  1ULY A;  3VH6 W;  5B24 D;  5B24 A;  1P3B A;  4WU8 B;  5AV8 A;  1F66 C;  4XZQ D;  4XZQ A;  1Q9C A;  3W98 B;  5KDM B;  3AZF C;  5C3I B;  4WU8 D;  3A6N D;  3A6N A;  5G49 B;  5AV6 B;  3W96 A;  3W98 D;  3AV2 B;  1M19 A;  1P3O D;  1P3O A;  4X23 A;  2BYK A;  2IO5 B;  1TAF B;  1KX5 D;  5DNN A;  5AV6 D;  5BO0 B;  3MGS A;  3MGS D;  1TZY A;  3AV2 D;  1KX5 A;  3WA9 D;  3WA9 A;  4WNN A;  3B0D B;  3AZJ A;  1BH8 A;  4Z5T B;  5GSU A;  3UTB C;  3VH6 A;  2Y2I A;  4Z5T D;  4CAY A;  3TU4 C;  4H9Q B;  3UT9 C;  3H0M C;  3KUY C;  2Y2G A;  3LJA B;  1P3P B;  2HIO B;  3AN2 A;  4H9O B;  4XUJ C;  3LJA D;  3MGQ A;  1P3P D;  2CV5 C;  2HIO D;  1P3G D;  1P3G A;  1ID3 A;  1ID3 D;  4UUZ A;  1P3F C;  3VH6 T;  3AZN B;  2BYM B;  3P5J B;  3C1B A;  4J8V D;  4J8V A;  3REH C;  5E5A C;  4DRB A;  1ZLA C;  1JFI A;  1P3I B;  4QLC C;  3WTP E;  1H3O B;  1F66 A;  3V9R B;  2F8N H;  3AZF A;  1P3K B;  5BS7 C;  1N1J A;  5DNM C;  3REI C;  2J8P A;  3O62 B;  1P3K D;  1KX3 C;  1P3M C;  3AZE C;  3MGP B;  2Y2K A;  3LZ1 C;  1M18 C;  5AV9 C;  3UTB D;  3UTB A;  3MNN B;  1BH9 A;  1WWI A;  3TU4 A;  4CSR A;  3H0R C;  3MVD C;  3UT9 A;  2VQR A;  4Z2M H;  3KUY A;  3MNN D;  5JRG C;  4XUJ D;  4XUJ A;  2Y2O A;  2CV5 D;  2ZM5 A;  2CV5 A;  5B0Z C;  4KUD B;  1M1A C;  4YS3 C;  1P3F D;  1P3F A;  4KUD D;  3LZ0 C;  4WU9 C;  3B6F B;  3REH A;  5E5A A;  1ZLA A;  3REL B;  4QLC A;  3AV1 B;  1BFM A;  3B6F D;  3KXB B;  5AVB C;  3W99 B;  3REL D;  2Y2Q A;  3FDD A;  5BS7 A;  3MGR C;  1KX4 B;  3W99 D;  5DNM A;  5DNM D;  3REI A;  5B33 B;  1KX3 A;  5F99 B;  1P3M A;  3AZE A;  4HGA B;  3LEL B;  5BNV B;  3LZ1 A;  4H9S C;  4YM6 B;  5F99 D;  4WU8 C;  5B32 B;  1M18 A;  3EPH A;  3W98 C;  5AV9 A;  4J8X B;  5BT1 D;  5C3I C;  4YM6 D;  5AV6 C;  3MVD A;  3AV2 C;  3C1C B;  4J8X D;  2F8N K;  2YFW A;  3AL0 C;  3KWQ B;  2IO5 C;  5JRG D;  5JRG A;  2FJ7 B;  3C1C D;  3KWQ D;  2F8N D;  2F8N A;  3B0D C;  4ZBJ B;  5AV5 B;  5B0Z A;  2FJ7 D;  4Z5T C;  1M1A D;  1M1A A;  3X1U B;  4YS3 A;  5AV5 D;  3LZ0 A;  4WU9 A;  3X1U D;  3KFU G;  3LJA C;  1P3P C;  2HIO C;  5CHL B;  5AVB A;  5JA4 B;  5CPJ B;  2PYO B;  3MGR D;  3A1K A;  3MGR A;  1PZR A;  2JSS A;  3AZN C;  2PYO D;  2PYO A;  1P3I C;  2F8N G;  4H9S A;  4WU8 A;  3X1T B;  3WAA B;  3W98 A;  5KDM A;  1P3K C;  1B67 A;  3X1T D;  5G49 A;  5AV6 A;  3B0B A;  3NQU B;  3O62 C;  3AV2 A;  5B2I B;  1TAF A;  4UPK A;  1S32 B;  5BO0 A;  3MGP C;  1S32 D;  5B0Y B;  4Z5T A;  3MNN C;  5GT3 B;  1A7W A;  5B0Y D;  4WZS B;  4H9Q A;  3LJA A;  1P3P A;  2YFV B;  1WWS A;  2HIO A;  2NZD B;  4H9P B;  4H9O A;  5BNX B;  5AY8 B;  4H9R B;  4KUD C;  2NZD D;  5AY8 D;  4ZUX B;  3AZN D;  5B40 B;  3UTA B;  3AZN A;  3AZG B;  2NQB B;  2BYM A;  2LY8 A;  3B6F C;  4ZUX D;  3WTP B;  3AZH B;  5B40 D;  3UTA D;  3REL C;  3AZG D;  1P3I A;  1P3I D;  3AV1 C;  1H3O A;  3V9R A;  3KXB C;  3WTP D;  3W99 C;  3AZH D;  1HQ3 B;  3W97 B;  4J8W B;  1P3K A;  5CPK B;  4AWL B;  1KX4 C;  3O62 D;  3O62 A;  3W97 D;  4J8W D;  5B33 C;  5F99 C;  5CPK D;  3AZL B;  4HGA C;  3LEL C;  3MGP D;  3MGP A;  5BT1 C;  4YM6 C;  5B32 C;  2ARO B;  4J8X C;  3EPJ A;  3MNN A;  3VH5 W;  2HUE B;  3C1C C;  5CP6 B;  3KWQ C;  1R4V A;  2BG1 A;  3H0L C;  5GT0 B;  2FJ7 C;  2UWX A;  5CP6 D;  4NFT A;  5AVC B;  4ZBJ C;  5AV5 C;  4KUD A;  4R8P B;  3EPK A;  3X1U C;  2JE5 A;  5AVC D;  5B1M B;  3B6F A;  3AZK B;  1U35 B;  3VH5 A;  5FUG B;  3REL A;  5B1M D;  3AV1 A;  3AV1 D;  4KHA B;  3KXB D;  3KXB A;  3AZK D;  3W99 A;  4G91 B;  1U35 D;  5GXQ B;  3B6G B;  1P3A B;  5CPJ C;  2PYO C;  1KX4 D;  1KX4 A;  4LD9 B;  5B33 D;  5B33 A;  3AYW B;  5GXQ D;  5F99 A; 
#chains in the Genus database with same CATH homology
 1P3A D;  1P3L B;  5B31 B;  2Y2M A;  3LEL D;  3LEL A;  5BNV A;  3VH5 T;  3AYW D;  4YM6 A;  3X1T C;  5B32 D;  3WAA C;  5B32 A;  1P3L D;  5B31 D;  1AOI B;  2ZY4 A;  4J8X A;  2Y2H A;  1AOI D;  3AZI B;  3AFA B;  2FFF B;  3C1C A;  4JJN B;  5B2I C;  3KWQ A;  4J8U B;  1S32 C;  2FJ7 A;  3AZI D;  3AFA D;  2Y2J A;  5CPI B;  4KGC B;  4JJN D;  2XD5 A;  4NE3 A;  5AV5 A;  4Z66 B;  4J8U D;  4H9N B;  5B0Y C;  5CPI D;  3X1U A;  5GT3 C;  1EQZ B;  2Y2N A;  3B0C T;  3REK B;  5B1L B;  3R45 B;  1EQZ D;  5B32 G;  2NZD C;  2G5I C;  5B1L D;  3REJ B;  5AY8 C;  2ZY5 A;  3REK D;  3NQJ B;  5JA4 A;  3X1V B;  3REJ D;  4ZUX C;  5CPJ D;  3X1S B;  5CPJ A;  4DRA A;  3UTA C;  5B40 C;  3AZG C;  1KU5 A;  3AZM B;  2NQB C;  1T3U A;  1P34 B;  3X1S D;  3WTP C;  3AZH C;  3EPL A;  3AZM D;  5B2J B;  1P34 D;  3WKJ B;  3X1T A;  3F6T A;  3WAA D;  3WAA A;  1HQ3 C;  3W97 C;  4J8W C;  3WKJ D;  5CPK C;  4AWL C;  5B24 B;  1F1E A;  1P3B B;  3NQU A;  5AV8 B;  4NE6 A;  5B2I D;  4XZQ B;  5B2I A;  3AZL C;  2DQN C;  1S32 A;  1P3B D;  5AV8 D;  3A6N B;  4E45 A;  3W96 B;  4Z2M G;  3A1I A;  1M19 B;  5B0Y A;  1P3O B;  2ARO C;  4X23 B;  2BYK B;  5DNN B;  3MGS B;  1KX5 B;  3W96 D;  1TZY B;  2HUE C;  5GT3 D;  5GT3 A;  1M19 D;  3WA9 B;  4X23 D;  4WJ3 C;  4WNN B;  3AZJ B;  4EO5 B;  5CP6 C;  1BH8 B;  5DNN D;  5GSU B;  1TZY D;  2YFV A;  5GT0 C;  2NZD A;  4H9P A;  3AZJ D;  5BNX A;  5AY8 A;  4CAY B;  5GSU D;  5AVC C;  4H9R A;  1Z2C B;  4R8P C;  4ZUX A;  3AN2 B;  2RIQ A;  5B40 A;  3UTA A;  3AZG A;  2NQB A;  2NQB D;  5B1M C;  3MGQ B;  3AZK C;  3AN2 D;  3WTP A;  3AZH A;  4WV4 B;  1P3G B;  1U35 C;  1ID3 B;  4UUZ B;  3MGQ D;  4G92 B;  1B6W A;  1HQ3 D;  1HQ3 A;  4G91 C;  3C1B B;  4J8V B;  3W97 A;  4J8W A;  5GXQ C;  3B6G C;  5CPK A;  1P3A C;  1JFI B;  3C1B D;  2ZY2 A;  4M6B A;  1F66 B;  4LD9 C;  3AYW C;  2JCH A;  3AZL D;  3AZL A;  3AZF B;  5B31 C;  1P3L C;  1F66 D;  1N1J B;  1AOI C;  3AZF D;  2ARO D;  2ARO A;  3AZI C;  3AFA C;  4JJN C;  5CP6 A;  5GT0 D;  2G5H C;  5GT0 A;  4J8U C;  3UTB B;  4KGC C;  5CPI C;  1BH9 B;  3TU4 B;  4CSR B;  5AVC A;  3UT9 B;  2F2A C;  4Z66 C;  4R8P D;  4R8P A;  3KUY B;  3KSY A;  3TU4 D;  4E44 A;  4XUJ B;  3UT9 D;  1EQZ C;  3KUY D;  5B1M A;  3REK C;  5B1L C;  2CV5 B;  3B0C W;  3AZK A;  1U35 A;  5FUG A;  1HTA A;  1P3F B;  3REJ C;  4KHA A;  4LD9 D;  3X1V C;  3REH B;  5E5A B;  5GXQ A;  1ZLA B;  3B6G A;  3B6G D;  1P3A A;  3X1S C;  4QLC B;  2L5A A;  3AZM C;  3REH D;  5E5A D;  1W2E A;  3AYW A;  1P34 C;  1ZLA D;  2CWE A;  2W8S A;  4LD9 A;  1P3L A;  4QLC D;  5B31 A;  5B2J C;  3WKJ C;  3IP4 C;  5DNM B;  3REI B;  1AOI A;  2RVQ C;  1KX3 B;  2XD1 A;  2Y2L A;  3EG5 B;  3AZE B;  1P3M B;  3REI D;  5B24 C;  1P3B C;  3LZ1 B;  3AZI A;  1KX3 D;  3AFA A;  1P3M D;  5AV8 C;  4JJN A;  3AZE D;  1M18 B;  4XZQ C;  5AV9 B;  4J8U A;  3LZ1 D;  4NE5 A;  4KGC D;  4KGC A;  5CPI A;  3A6N C;  1M18 D;  3W96 C;  2ZY3 A;  3MVD B;  5AV9 D;  4Z66 D;  4Z66 A;  1M19 C;  4H9N A;  1P3O C;  2YFW B;  4X23 C;  5JRG B;  5DNN C;  3MGS C;  1KX5 C;  3MVD D;  1TZY C;  1EQZ A;  2DF4 C;  3WA9 C;  2F8N B;  5B31 G;  3AZJ C;  4EO5 C;  5B1L A;  5B0Z B;  3REK A;  3R45 A;  5GSU C;  1M1A B;  4YS3 B;  5B0Z D;  3REJ A;  3LZ0 B;  4WU9 B;  3NQJ A;  3X1V D;  4YS3 D;  3X1V A;  3LZ0 D;  3X1S A;  4WU9 D;  3AN2 C;  3AZM A;  3MGQ C;  5AVB B;  1P34 A;  1P3G C;  1ID3 C;  5B2J D;  5B2J A;  3MGR B;  2Y2P A;  5AVB D;  4G92 C;  3WKJ A;  4DQY B;  2RVQ D;  3C1B C;  4J8V C;  1ULY A;  3VH6 W;  5B24 D;  5B24 A;  1P3B A;  4WU8 B;  5AV8 A;  1F66 C;  4XZQ D;  4XZQ A;  1Q9C A;  3W98 B;  5KDM B;  3AZF C;  5C3I B;  4WU8 D;  3A6N D;  3A6N A;  5G49 B;  5AV6 B;  3W96 A;  3W98 D;  3AV2 B;  1M19 A;  1P3O D;  1P3O A;  4X23 A;  2BYK A;  2IO5 B;  1TAF B;  1KX5 D;  5DNN A;  5AV6 D;  5BO0 B;  3MGS A;  3MGS D;  1TZY A;  3AV2 D;  1KX5 A;  3WA9 D;  3WA9 A;  4WNN A;  3B0D B;  3AZJ A;  1BH8 A;  4Z5T B;  5GSU A;  3UTB C;  3VH6 A;  2Y2I A;  4Z5T D;  4CAY A;  3TU4 C;  4H9Q B;  3UT9 C;  3H0M C;  3KUY C;  2Y2G A;  3LJA B;  1P3P B;  2HIO B;  3AN2 A;  4H9O B;  4XUJ C;  3LJA D;  3MGQ A;  1P3P D;  2CV5 C;  2HIO D;  1P3G D;  1P3G A;  1ID3 A;  1ID3 D;  4UUZ A;  1P3F C;  3VH6 T;  3AZN B;  2BYM B;  3P5J B;  3C1B A;  4J8V D;  4J8V A;  3REH C;  5E5A C;  4DRB A;  1ZLA C;  1JFI A;  1P3I B;  4QLC C;  3WTP E;  1H3O B;  1F66 A;  3V9R B;  2F8N H;  3AZF A;  1P3K B;  5BS7 C;  1N1J A;  5DNM C;  3REI C;  2J8P A;  3O62 B;  1P3K D;  1KX3 C;  1P3M C;  3AZE C;  3MGP B;  2Y2K A;  3LZ1 C;  1M18 C;  5AV9 C;  3UTB D;  3UTB A;  3MNN B;  1BH9 A;  1WWI A;  3TU4 A;  4CSR A;  3H0R C;  3MVD C;  3UT9 A;  2VQR A;  4Z2M H;  3KUY A;  3MNN D;  5JRG C;  4XUJ D;  4XUJ A;  2Y2O A;  2CV5 D;  2ZM5 A;  2CV5 A;  5B0Z C;  4KUD B;  1M1A C;  4YS3 C;  1P3F D;  1P3F A;  4KUD D;  3LZ0 C;  4WU9 C;  3B6F B;  3REH A;  5E5A A;  1ZLA A;  3REL B;  4QLC A;  3AV1 B;  1BFM A;  3B6F D;  3KXB B;  5AVB C;  3W99 B;  3REL D;  2Y2Q A;  3FDD A;  5BS7 A;  3MGR C;  1KX4 B;  3W99 D;  5DNM A;  5DNM D;  3REI A;  5B33 B;  1KX3 A;  5F99 B;  1P3M A;  3AZE A;  4HGA B;  3LEL B;  5BNV B;  3LZ1 A;  4H9S C;  4YM6 B;  5F99 D;  4WU8 C;  5B32 B;  1M18 A;  3EPH A;  3W98 C;  5AV9 A;  4J8X B;  5BT1 D;  5C3I C;  4YM6 D;  5AV6 C;  3MVD A;  3AV2 C;  3C1C B;  4J8X D;  2F8N K;  2YFW A;  3AL0 C;  3KWQ B;  2IO5 C;  5JRG D;  5JRG A;  2FJ7 B;  3C1C D;  3KWQ D;  2F8N D;  2F8N A;  3B0D C;  4ZBJ B;  5AV5 B;  5B0Z A;  2FJ7 D;  4Z5T C;  1M1A D;  1M1A A;  3X1U B;  4YS3 A;  5AV5 D;  3LZ0 A;  4WU9 A;  3X1U D;  3KFU G;  3LJA C;  1P3P C;  2HIO C;  5CHL B;  5AVB A;  5JA4 B;  5CPJ B;  2PYO B;  3MGR D;  3A1K A;  3MGR A;  1PZR A;  2JSS A;  3AZN C;  2PYO D;  2PYO A;  1P3I C;  2F8N G;  4H9S A;  4WU8 A;  3X1T B;  3WAA B;  3W98 A;  5KDM A;  1P3K C;  1B67 A;  3X1T D;  5G49 A;  5AV6 A;  3B0B A;  3NQU B;  3O62 C;  3AV2 A;  5B2I B;  1TAF A;  4UPK A;  1S32 B;  5BO0 A;  3MGP C;  1S32 D;  5B0Y B;  4Z5T A;  3MNN C;  5GT3 B;  1A7W A;  5B0Y D;  4WZS B;  4H9Q A;  3LJA A;  1P3P A;  2YFV B;  1WWS A;  2HIO A;  2NZD B;  4H9P B;  4H9O A;  5BNX B;  5AY8 B;  4H9R B;  4KUD C;  2NZD D;  5AY8 D;  4ZUX B;  3AZN D;  5B40 B;  3UTA B;  3AZN A;  3AZG B;  2NQB B;  2BYM A;  2LY8 A;  3B6F C;  4ZUX D;  3WTP B;  3AZH B;  5B40 D;  3UTA D;  3REL C;  3AZG D;  1P3I A;  1P3I D;  3AV1 C;  1H3O A;  3V9R A;  3KXB C;  3WTP D;  3W99 C;  3AZH D;  1HQ3 B;  3W97 B;  4J8W B;  1P3K A;  5CPK B;  4AWL B;  1KX4 C;  3O62 D;  3O62 A;  3W97 D;  4J8W D;  5B33 C;  5F99 C;  5CPK D;  3AZL B;  4HGA C;  3LEL C;  3MGP D;  3MGP A;  5BT1 C;  4YM6 C;  5B32 C;  2ARO B;  4J8X C;  3EPJ A;  3MNN A;  3VH5 W;  2HUE B;  3C1C C;  5CP6 B;  3KWQ C;  1R4V A;  2BG1 A;  3H0L C;  5GT0 B;  2FJ7 C;  2UWX A;  5CP6 D;  4NFT A;  5AVC B;  4ZBJ C;  5AV5 C;  4KUD A;  4R8P B;  3EPK A;  3X1U C;  2JE5 A;  5AVC D;  5B1M B;  3B6F A;  3AZK B;  1U35 B;  3VH5 A;  5FUG B;  3REL A;  5B1M D;  3AV1 A;  3AV1 D;  4KHA B;  3KXB D;  3KXB A;  3AZK D;  3W99 A;  4G91 B;  1U35 D;  5GXQ B;  3B6G B;  1P3A B;  5CPJ C;  2PYO C;  1KX4 D;  1KX4 A;  4LD9 B;  5B33 D;  5B33 A;  3AYW B;  5GXQ D;  5F99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...