3UTAA

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaA00
4X23D 5KDMB 4H9SC 5AV6D 5CPKD 5AV6B 4YS3B 5AV6C 2BYKA 3MGPB 4AWLB 4YS3C 5AV5A 4J8VB 5B0YB 3MGPC 3MNNB 1M19D 3W97D 4CAYA 4J8VC 5B0YC 3W97B 3MNNC 3WTPD 3AZNA 3C1BA 5B40A 5CPKA 4WU8D 5GT0B 3MGSA 5GT0C 5DNMD 3AZJA 4UUZA 3WTPA 3C1CD 5B31G 3VH5T 4WU8A 3LJAB 2YFVA 5AV9D 5G49B 3X1VD 3LJAC 5DNMA 4H9OB 1JFIB 3WTPE 1Q9CA 3X1UA 4J8UD 3C1CA 3W98D 4E44A 1KU5A 4QLCA 2CV5B 3AZIA 5B2ID 2F8NK 5AV9A 2CV5C 4XZQC 3X1VA 1P3OA 5BNXB 2HIOB 3MGRD 3W98A 2YFWB 1P3PB 2HIOC 1ULYA 3B0CT 1P3PC 4JJND 4R8PD 3WA9B 2RVQC 3LZ1B 3WA9C 1WWIA 3LZ1C 3WKJD 1BH9A 5B31A 2NQBD 3RELB 3A6ND 1P3BD 3RELC 4JJNA 3UTAD 1P3AB 1P3FD 3AZLA 1P3AC 1TZYB 1P3KD 2NQBA 1TZYC 3AZFD 4H9PB 1U35A 4H9RB 3KWQD 5CPJD 5GT3D 3UTAA 3REIA 3LELD 3X1TA 1B67A 1P3KA 5B1LD 3W96B 5B1LB 3AZFA 1S32C 3W96C 5CPJA 3WAAD 3AZEA 5AVCB 1ZLAD 5AVCC 4J8WC 4NFTA 1M18B 5B32B 3KXBB 2IO5B 1M18C 5B32C 3KXBC 4KUDD 3W99C 1P3LD 1P3MA 3REHD 5CPIB 3AV2D 3AN2D 1M1AD 5CPIC 3AN2B 1M1AB 1ID3A 1P34B 4NE3A 3AV1A 1M1AC 1KX5D 1P34C 1KX4B 3MVDD 5CP6D 3AZMB 1KX4C 5GSUA 1KX3D 4Z66D 3AFAD 3AZMC 2F8ND 3AV2A 2JSSA 5F99B 2F8NB 1P3GA 3UTBD 4YM6D 5F99C 4WZSB 5JRGB 3UTBB 1EQZD 1P3ID 1KX5A 5JRGC 4Z5TA 3TU4A 3X1SD 3VH5A 1AOIB 3UT9A 1KX3A 4Z66A 3AFAA 1AOIC 3B6GB 2AROA 1H3OB 3B6GC 4YM6A 1EQZA 3NQJB 5AV8A 3R45B 3O62C 5JA4B 3AYWC 3B6FD 4ZUXB 5B0ZA 3AZHB 4J8XB 4ZUXC 3MGQD 5E5AD 3AZHC 4J8XC 3AZGA 1N1JB 4HGAB 3LZ0A 5AVBD 4YS3D 4HGAC 5AVBB 3MGPD 5BS7A 3B6FA 4J8VD 5B0YD 1F66B 5AVBC 3KUYA 3MNND 3MGQA 1F66C 4KGCB 2PYOB 2FJ7B 4WU9B 5B33B 4KGCC 5KDMA 2PYOC 2FJ7C 5BNVB 4X23A 5B33C 4WU9C 5AV6A 1TAFA 4Z2MG 5GT0D 4YS3A 4J8VA 5B0YA 4Z2MH 2BYKB 1M19A 3W97A 5AV5C 4CAYB 5B40B 3LJAD 5GT0A 3C1BC 5B40C 5BT1C 3MGSB 3MGSC 3VH6W 3AZJB 4UUZB 3AZJC 2CV5D 4XZQD 3LJAA 4XZQB 5G49A 2YFVB 5DNNB 4WNNA 5DNNC 2HIOD 1P3PD 4J8UA 3X1UB 2CV5A 2RVQD 3X1UC 3WA9D 5B2IA 3AZKB 3AZIB 3LZ1D 4QLCC 3AZKC 3AZIC 4H9QA 1P3OB 1P3OC 2YFWA 3RELD 1P3PA 3MGRA 1P3AD 4R8PA 3LZ1A 1TZYD 1R4VA 3WKJA 1BH9B 5B31B 2BYMB 5B31C 5GXQB 3A6NA 1P3BA 3REJB 5B1MB 5GXQC 3REJC 1P3FA 5B1MC 1S32D 1F1EA 3W96D 1S32B 3AZLC 1B6WA 3KWQA 5B24B 5GT3A 5AVCD 4J8WD 5B24C 1U35C 3REIB 4J8WB 1M18D 3LELA 5B32D 3KXBD 3W96A 3REIC 3REKB 5B1LA 3X1TB 3W99D 3REKC 3W99B 3X1TC 4KHAA 2F8NH 3WAAA 5AVCA 5CPID 1ZLAA 5B32A 3AZEC 1P34D 4E45A 1KX4D 4KUDA 3AZMD 1P3LA 5CPIA 5F99D 3REHA 3AN2A 4LD9B 1M1AA 5JRGD 1P34A 1P3MC 2L5AA 3V9RA 4LD9C 1ID3B 4H9NB 3AV1B 1ID3C 1BH8A 3MVDA 5CP6A 1AOID 3AV1C 3B6GD 5GSUB 5B2JB 5AY8B 3NQUB 2F8NA 5GSUC 5B2JC 5AY8C 3UTBA 1P3GB 4CSRA 3O62D 1P3IA 1P3GC 3O62B 3AYWD 4Z5TB 3X1SA 3AYWB 4Z5TC 4ZUXD 3TU4C 3UT9B 3AZHD 5BO0A 4J8XD 2NZDB 5FUGB 3UT9C 2AROB 2NZDC 4NE6A 2AROC 3R45A 5AV8B 5JA4A 4NE5A 5AV8C 1HTAA 3AZHA 1F66D 4KGCD 2PYOD 2FJ7D 5E5AA 5B0ZC 4WU9D 4H9SA 5B33D 1JFIA 1HQ3B 4XUJB 1HQ3C 4XUJC 4DRBA 5AVBA 3MGPA 3LZ0C 5AV5D 3MNNA 4KGCA 2PYOA 5AV5B 5BS7C 3KUYB 5B33A 3VH6T 3KUYC 5BNVA 2CWEA 3C1BD 3AZNB 5B40D 3C1BB 4X23B 3AZNC 1TAFB 5BT1D 5CPKB 4X23C 5CPKC 3MGSD 4AWLC 3AZJD 1M19B 1M19C 3W97C 3WTPB 4G92B 3WTPC 4WU8B 5DNND 4G92C 1A7WA 4H9OA 4WU8C 5DNMB 5DNMC 3X1UD 3C1CB 4ZBJB 4XZQA 4QLCD 3AZKD 3AZID 3C1CC 4QLCB 4ZBJC 5DNNA 5AV9B 5BNXA 1P3OD 3X1VB 4DRAA 5AV9C 4WNNB 2HIOA 3X1VC 4J8UB 3W98B 4M6BA 3AZKA 3VH5W 3WA9A 4J8UC 3W98C 5B2IB 5CHLB 5B2IC 4H9QB 5B31D 5B32G 3RELA 5GXQD 3MGRB 3REJD 5B1MD 3MGRC 1P3AA 4JJNB 4R8PB 3AZLD 1TZYA 4JJNC 3AZLB 4R8PC 3B0DB 3WKJB 2NQBB 3B0DC 2BYMA 4H9PA 3WKJC 4H9RA 5GXQA 2NQBC 5B24D 1U35D 3REJA 3B0CW 5B1MA 1U35B 3A6NB 1P3BB 3REID 3UTAB 3A6NC 1P3BC 1P3FB 3UTAC 3REKD 1S32A 3X1TD 1P3FC 2F8NG 1P3KB 3AZFB 1P3KC 4WV4B 5B24A 3AZFC 4G91B 3KWQB 5CPJB 5GT3B 3AZED 4G91C 4J8WA 3AZEB 3KWQC 5CPJC 5GT3C 1M18A 3REKA 3KXBA 3LELB 3W99A 3LELC 3KSYA 5B1LC 4KHAB 3WAAB 1P3MD 5C3IB 4LD9D 3WAAC 1P3MB 1WWSA 1ZLAB 5C3IC 1ID3D 1ZLAC 3VH6A 3AV1D 1KX4A 2IO5C 3AZMA 4KUDB 4EO5B 5GSUD 5B2JD 5AY8D 4KUDC 4EO5C 1P3LB 2LY8A 5F99A 4LD9A 3REHB 1P3LC 3AV2B 1P3GD 5JRGA 3REHC 4H9NA 3AV2C 3AN2C 3V9RB 4Z5TD 3TU4D 1KX5B 1AOIA 3TU4B 1BFMA 1BH8B 5B2JA 5CP6B 3MVDB 5AY8A 3UT9D 1KX5C 3NQUA 3B6GA 2NZDD 3MVDC 1KX3B 5CP6C 4Z66B 3AFAB 1H3OA 2AROD 1KX3C 4Z66C 3B0BA 3AFAC 4YM6B 3O62A 3NQJA 4CSRB 1EQZB 3UTBC 5AV8D 4YM6C 3AYWA 1P3IB 1EQZC 1P3IC 3X1SB 2HUEB 4ZUXA 2NZDA 5FUGA 3X1SC 5B0ZD 4J8XA 2HUEC 5BO0B 5B0ZB 1HQ3D 4XUJD 1N1JA 3AZGD 3AZGB 3LZ0D 3AZGC 3LZ0B 1F66A 3B6FB 3KUYD 3B6FC 2FJ7A 4WU9A 1HQ3A 5E5AB 4XUJA 3MGQB 3AZND 3MGQC 5E5AC
chains in the Genus database with same CATH superfamily
4X23D 5KDMB 4H9SC 5AV6D 5CPKD 4WJ3C 5AV6B 4YS3B 5AV6C 2BYKA 3MGPB 4AWLB 4YS3C 5AV5A 4J8VB 5B0YB 3H0RC 3MGPC 3MNNB 1M19D 3W97D 4CAYA 4J8VC 5B0YC 3W97B 3MNNC 3WTPD 3AZNA 3C1BA 5B40A 5CPKA 2ZY5A 4WU8D 5GT0B 3MGSA 5GT0C 5DNMD 3F6TA 3AZJA 4UUZA 3WTPA 3C1CD 5B31G 3VH5T 4WU8A 3LJAB 2Y2KA 2YFVA 5AV9D 5G49B 3X1VD 3LJAC 5DNMA 4H9OB 1JFIB 3WTPE 1Q9CA 3X1UA 4J8UD 3C1CA 3W98D 4E44A 1KU5A 4QLCA 2CV5B 3AZIA 2Y2IA 3H0MC 5B2ID 2F8NK 5AV9A 2CV5C 4XZQC 3X1VA 1P3OA 5BNXB 2HIOB 3MGRD 3W98A 2YFWB 1P3PB 1Z2CB 2HIOC 1ULYA 3B0CT 1P3PC 4JJND 4R8PD 3WA9B 2RVQC 3EPKA 2JE5A 3LZ1B 3WA9C 1WWIA 3LZ1C 3WKJD 1BH9A 5B31A 2NQBD 3RELB 3A6ND 1P3BD 3RELC 4JJNA 3UTAD 1P3AB 1P3FD 3AZLA 1P3AC 1TZYB 2ZM5A 1P3KD 2NQBA 1TZYC 3AZFD 4H9PB 1U35A 4H9RB 1PZRA 3KWQD 5CPJD 5GT3D 3UTAA 3REIA 3LELD 3X1TA 1B67A 1P3KA 5B1LD 3W96B 5B1LB 3AZFA 2Y2PA 1S32C 3W96C 5CPJA 3WAAD 3AZEA 5AVCB 1ZLAD 2DF4C 5AVCC 4J8WC 4NFTA 1M18B 5B32B 3KXBB 2IO5B 3AL0C 1M18C 5B32C 3KXBC 4KUDD 3W99C 2Y2LA 1P3LD 2Y2JA 1P3MA 3REHD 5CPIB 3AV2D 3AN2D 1M1AD 5CPIC 3AN2B 1M1AB 1ID3A 1P34B 4NE3A 3AV1A 1M1AC 1KX5D 1P34C 1KX4B 3MVDD 5CP6D 3AZMB 1KX4C 5GSUA 1KX3D 4Z66D 3AFAD 3AZMC 2F8ND 3AV2A 2JSSA 5F99B 2F8NB 1P3GA 3UTBD 4YM6D 5F99C 4WZSB 5JRGB 3UTBB 1EQZD 1P3ID 1KX5A 5JRGC 4Z5TA 3TU4A 3X1SD 3VH5A 1AOIB 2G5IC 3UT9A 1KX3A 4Z66A 3AFAA 1AOIC 3B6GB 3H0LC 2AROA 1H3OB 3B6GC 2Y2OA 4YM6A 1EQZA 3NQJB 5AV8A 3R45B 3O62C 5JA4B 3AYWC 3B6FD 4ZUXB 5B0ZA 3AZHB 4J8XB 4ZUXC 3MGQD 5E5AD 3AZHC 4J8XC 3AZGA 1N1JB 4HGAB 3LZ0A 5AVBD 4YS3D 4HGAC 5AVBB 3A1IA 5BS7A 3MGPD 3B6FA 4J8VD 5B0YD 1F66B 5AVBC 3KUYA 3MNND 3MGQA 1F66C 4KGCB 2PYOB 2FJ7B 4WU9B 5B33B 4KGCC 5KDMA 2PYOC 2FJ7C 5BNVB 4X23A 5B33C 4WU9C 5AV6A 1TAFA 4Z2MG 5GT0D 4YS3A 3P5JB 4J8VA 1W2EA 5B0YA 4Z2MH 2BYKB 3EPHA 1M19A 3W97A 5AV5C 4CAYB 5B40B 3LJAD 2ZY4A 5GT0A 3C1BC 5B40C 5BT1C 3MGSB 3MGSC 3VH6W 3AZJB 4UUZB 3AZJC 2CV5D 4XZQD 3LJAA 4XZQB 5G49A 2YFVB 5DNNB 4WNNA 5DNNC 2HIOD 1P3PD 4J8UA 3X1UB 2CV5A 2RVQD 3X1UC 3WA9D 5B2IA 3AZKB 3AZIB 3LZ1D 4QLCC 3AZKC 3AZIC 4H9QA 1P3OB 1P3OC 2YFWA 2ZY3A 3RELD 3MGRA 1P3PA 1P3AD 4R8PA 3LZ1A 1TZYD 1R4VA 3WKJA 2FFFB 1BH9B 5B31B 2BYMB 5B31C 5GXQB 3A6NA 1P3BA 3REJB 5B1MB 5GXQC 3REJC 1P3FA 5B1MC 1S32D 1F1EA 3W96D 1S32B 3AZLC 1B6WA 3FDDA 5B24B 3KWQA 5GT3A 3EG5B 5AVCD 4J8WD 5B24C 1U35C 3REIB 4J8WB 1M18D 3LELA 5B32D 3KXBD 3W96A 3REIC 3REKB 5B1LA 3X1TB 3W99D 3REKC 3W99B 3X1TC 4KHAA 2UWXA 2F8NH 3WAAA 2Y2QA 5AVCA 5CPID 1ZLAA 2ZY2A 5B32A 3AZEC 1P34D 4E45A 1KX4D 4KUDA 3AZMD 1P3LA 5CPIA 4DQYB 5F99D 3REHA 3AN2A 4LD9B 1M1AA 5JRGD 1P34A 1P3MC 2L5AA 3V9RA 4LD9C 1ID3B 4H9NB 3AV1B 1ID3C 1BH8A 3MVDA 5CP6A 1AOID 3AV1C 3B6GD 5GSUB 5B2JB 5AY8B 4UPKA 3NQUB 2F8NA 5GSUC 5B2JC 5AY8C 3UTBA 1P3GB 2Y2HA 4CSRA 3O62D 1P3IA 1P3GC 3O62B 3AYWD 4Z5TB 3X1SA 3AYWB 4Z5TC 4ZUXD 3TU4C 3UT9B 3AZHD 5BO0A 4J8XD 2NZDB 5FUGB 3UT9C 2AROB 2NZDC 4NE6A 2AROC 3R45A 5AV8B 2Y2GA 5JA4A 4NE5A 5AV8C 1HTAA 3A1KA 3AZHA 1F66D 4KGCD 2PYOD 2FJ7D 5E5AA 5B0ZC 4WU9D 4H9SA 5B33D 1JFIA 1HQ3B 4XUJB 1HQ3C 4XUJC 3EPJA 4DRBA 5AVBA 2G5HC 3MGPA 3LZ0C 5AV5D 3MNNA 4KGCA 2PYOA 5AV5B 5BS7C 3KUYB 5B33A 3VH6T 3KUYC 2VQRA 5BNVA 2CWEA 3C1BD 3AZNB 5B40D 3C1BB 4X23B 3IP4C 3AZNC 1TAFB 5BT1D 5CPKB 4X23C 5CPKC 3MGSD 4AWLC 3AZJD 1M19B 1M19C 3W97C 3WTPB 4G92B 3WTPC 4WU8B 5DNND 4G92C 1A7WA 4H9OA 4WU8C 5DNMB 5DNMC 3X1UD 2Y2MA 3C1CB 4ZBJB 4XZQA 4QLCD 3AZKD 3AZID 3C1CC 4QLCB 4ZBJC 5DNNA 5AV9B 5BNXA 1P3OD 3X1VB 4DRAA 5AV9C 4WNNB 2HIOA 3X1VC 4J8UB 3W98B 4M6BA 3AZKA 3VH5W 3WA9A 4J8UC 3W98C 5B2IB 5CHLB 5B2IC 2Y2NA 4H9QB 5B31D 5B32G 3RELA 5GXQD 3MGRB 3REJD 5B1MD 3MGRC 1P3AA 4JJNB 2XD1A 4R8PB 3AZLD 1TZYA 4JJNC 3AZLB 4R8PC 2RIQA 3B0DB 3WKJB 3KFUG 2NQBB 3B0DC 2BYMA 4H9PA 3WKJC 4H9RA 5GXQA 2NQBC 5B24D 1U35D 3REJA 3B0CW 5B1MA 1U35B 3A6NB 1P3BB 3REID 3UTAB 3A6NC 1P3BC 1P3FB 2XD5A 3UTAC 3REKD 1S32A 3X1TD 1P3FC 2F8NG 1P3KB 3AZFB 1P3KC 4WV4B 5B24A 3AZFC 2W8SA 4G91B 3KWQB 5CPJB 5GT3B 3AZED 4G91C 4J8WA 3AZEB 3KWQC 5CPJC 5GT3C 1M18A 3EPLA 3REKA 3KXBA 3LELB 3W99A 3LELC 3KSYA 5B1LC 4KHAB 3WAAB 1P3MD 5C3IB 4LD9D 3WAAC 1P3MB 1WWSA 1ZLAB 5C3IC 2F2AC 1ID3D 1ZLAC 3VH6A 3AV1D 1KX4A 2IO5C 3AZMA 4KUDB 2BG1A 4EO5B 5GSUD 5B2JD 5AY8D 4KUDC 4EO5C 1P3LB 2LY8A 5F99A 4LD9A 3REHB 1P3LC 3AV2B 1P3GD 5JRGA 3REHC 4H9NA 3AV2C 3AN2C 3V9RB 4Z5TD 1T3UA 3TU4D 1KX5B 1AOIA 3TU4B 1BFMA 1BH8B 5B2JA 5CP6B 3MVDB 5AY8A 3UT9D 1KX5C 3NQUA 3B6GA 2NZDD 3MVDC 1KX3B 5CP6C 4Z66B 3AFAB 1H3OA 2JCHA 2AROD 1KX3C 4Z66C 3B0BA 3AFAC 4YM6B 3O62A 3NQJA 4CSRB 1EQZB 3UTBC 5AV8D 4YM6C 3AYWA 1P3IB 1EQZC 1P3IC 3X1SB 2HUEB 4ZUXA 2NZDA 5FUGA 3X1SC 5B0ZD 4J8XA 2HUEC 5BO0B 5B0ZB 1HQ3D 4XUJD 1N1JA 3AZGD 3AZGB 3LZ0D 3AZGC 3LZ0B 1F66A 3B6FB 3KUYD 3B6FC 2FJ7A 2DQNC 4WU9A 1HQ3A 2J8PA 4XUJA 5E5AB 3MGQB 3AZND 3MGQC 5E5AC
chains in the Genus database with same CATH topology
4X23D 5KDMB 4H9SC 5AV6D 5CPKD 4WJ3C 5AV6B 4YS3B 5AV6C 2BYKA 3MGPB 4AWLB 4YS3C 5AV5A 4J8VB 5B0YB 3H0RC 3MGPC 3MNNB 1M19D 3W97D 4CAYA 4J8VC 5B0YC 3W97B 3MNNC 3WTPD 3AZNA 3C1BA 5B40A 5CPKA 2ZY5A 4WU8D 5GT0B 3MGSA 5GT0C 5DNMD 3F6TA 3AZJA 4UUZA 3WTPA 3C1CD 5B31G 3VH5T 4WU8A 3LJAB 2Y2KA 2YFVA 5AV9D 5G49B 3X1VD 3LJAC 5DNMA 4H9OB 1JFIB 3WTPE 1Q9CA 3X1UA 4J8UD 3C1CA 3W98D 4E44A 1KU5A 4QLCA 2CV5B 3AZIA 2Y2IA 3H0MC 5B2ID 2F8NK 5AV9A 2CV5C 4XZQC 3X1VA 1P3OA 5BNXB 2HIOB 3MGRD 3W98A 2YFWB 1P3PB 1Z2CB 2HIOC 1ULYA 3B0CT 1P3PC 4JJND 4R8PD 3WA9B 2RVQC 3EPKA 2JE5A 3LZ1B 3WA9C 1WWIA 3LZ1C 3WKJD 1BH9A 5B31A 2NQBD 3RELB 3A6ND 1P3BD 3RELC 4JJNA 3UTAD 1P3AB 1P3FD 3AZLA 1P3AC 1TZYB 2ZM5A 1P3KD 2NQBA 1TZYC 3AZFD 4H9PB 1U35A 4H9RB 1PZRA 3KWQD 5CPJD 5GT3D 3UTAA 3REIA 3LELD 3X1TA 1B67A 1P3KA 5B1LD 3W96B 5B1LB 3AZFA 2Y2PA 1S32C 3W96C 5CPJA 3WAAD 3AZEA 5AVCB 1ZLAD 2DF4C 5AVCC 4J8WC 4NFTA 1M18B 5B32B 3KXBB 2IO5B 3AL0C 1M18C 5B32C 3KXBC 4KUDD 3W99C 2Y2LA 1P3LD 2Y2JA 1P3MA 3REHD 5CPIB 3AV2D 3AN2D 1M1AD 5CPIC 3AN2B 1M1AB 1ID3A 1P34B 4NE3A 3AV1A 1M1AC 1KX5D 1P34C 1KX4B 3MVDD 5CP6D 3AZMB 1KX4C 5GSUA 1KX3D 4Z66D 3AFAD 3AZMC 2F8ND 3AV2A 2JSSA 5F99B 2F8NB 1P3GA 3UTBD 4YM6D 5F99C 4WZSB 5JRGB 3UTBB 1EQZD 1P3ID 1KX5A 5JRGC 4Z5TA 3TU4A 3X1SD 3VH5A 1AOIB 2G5IC 3UT9A 1KX3A 4Z66A 3AFAA 1AOIC 3B6GB 3H0LC 2AROA 1H3OB 3B6GC 2Y2OA 4YM6A 1EQZA 3NQJB 5AV8A 3R45B 3O62C 5JA4B 3AYWC 3B6FD 4ZUXB 5B0ZA 3AZHB 4J8XB 4ZUXC 3MGQD 5E5AD 3AZHC 4J8XC 3AZGA 1N1JB 4HGAB 3LZ0A 5AVBD 4YS3D 4HGAC 5AVBB 3A1IA 5BS7A 3MGPD 3B6FA 4J8VD 5B0YD 1F66B 5AVBC 3KUYA 3MNND 3MGQA 1F66C 4KGCB 2PYOB 2FJ7B 4WU9B 5B33B 4KGCC 5KDMA 2PYOC 2FJ7C 5BNVB 4X23A 5B33C 4WU9C 5AV6A 1TAFA 4Z2MG 5GT0D 4YS3A 3P5JB 4J8VA 1W2EA 5B0YA 4Z2MH 2BYKB 3EPHA 1M19A 3W97A 5AV5C 4CAYB 5B40B 3LJAD 2ZY4A 5GT0A 3C1BC 5B40C 5BT1C 3MGSB 3MGSC 3VH6W 3AZJB 4UUZB 3AZJC 2CV5D 4XZQD 3LJAA 4XZQB 5G49A 2YFVB 5DNNB 4WNNA 5DNNC 2HIOD 1P3PD 4J8UA 3X1UB 2CV5A 2RVQD 3X1UC 3WA9D 5B2IA 3AZKB 3AZIB 3LZ1D 4QLCC 3AZKC 3AZIC 4H9QA 1P3OB 1P3OC 2YFWA 2ZY3A 3RELD 3MGRA 1P3PA 1P3AD 4R8PA 3LZ1A 1TZYD 1R4VA 3WKJA 2FFFB 1BH9B 5B31B 2BYMB 5B31C 5GXQB 3A6NA 1P3BA 3REJB 5B1MB 5GXQC 3REJC 1P3FA 5B1MC 1S32D 1F1EA 3W96D 1S32B 3AZLC 1B6WA 3FDDA 5B24B 3KWQA 5GT3A 3EG5B 5AVCD 4J8WD 5B24C 1U35C 3REIB 4J8WB 1M18D 3LELA 5B32D 3KXBD 3W96A 3REIC 3REKB 5B1LA 3X1TB 3W99D 3REKC 3W99B 3X1TC 4KHAA 2UWXA 2F8NH 3WAAA 2Y2QA 5AVCA 5CPID 1ZLAA 2ZY2A 5B32A 3AZEC 1P34D 4E45A 1KX4D 4KUDA 3AZMD 1P3LA 5CPIA 4DQYB 5F99D 3REHA 3AN2A 4LD9B 1M1AA 5JRGD 1P34A 1P3MC 2L5AA 3V9RA 4LD9C 1ID3B 4H9NB 3AV1B 1ID3C 1BH8A 3MVDA 5CP6A 1AOID 3AV1C 3B6GD 5GSUB 5B2JB 5AY8B 4UPKA 3NQUB 2F8NA 5GSUC 5B2JC 5AY8C 3UTBA 1P3GB 2Y2HA 4CSRA 3O62D 1P3IA 1P3GC 3O62B 3AYWD 4Z5TB 3X1SA 3AYWB 4Z5TC 4ZUXD 3TU4C 3UT9B 3AZHD 5BO0A 4J8XD 2NZDB 5FUGB 3UT9C 2AROB 2NZDC 4NE6A 2AROC 3R45A 5AV8B 2Y2GA 5JA4A 4NE5A 5AV8C 1HTAA 3A1KA 3AZHA 1F66D 4KGCD 2PYOD 2FJ7D 5E5AA 5B0ZC 4WU9D 4H9SA 5B33D 1JFIA 1HQ3B 4XUJB 1HQ3C 4XUJC 3EPJA 4DRBA 5AVBA 2G5HC 3MGPA 3LZ0C 5AV5D 3MNNA 4KGCA 2PYOA 5AV5B 5BS7C 3KUYB 5B33A 3VH6T 3KUYC 2VQRA 5BNVA 2CWEA 3C1BD 3AZNB 5B40D 3C1BB 4X23B 3IP4C 3AZNC 1TAFB 5BT1D 5CPKB 4X23C 5CPKC 3MGSD 4AWLC 3AZJD 1M19B 1M19C 3W97C 3WTPB 4G92B 3WTPC 4WU8B 5DNND 4G92C 1A7WA 4H9OA 4WU8C 5DNMB 5DNMC 3X1UD 2Y2MA 3C1CB 4ZBJB 4XZQA 4QLCD 3AZKD 3AZID 3C1CC 4QLCB 4ZBJC 5DNNA 5AV9B 5BNXA 1P3OD 3X1VB 4DRAA 5AV9C 4WNNB 2HIOA 3X1VC 4J8UB 3W98B 4M6BA 3AZKA 3VH5W 3WA9A 4J8UC 3W98C 5B2IB 5CHLB 5B2IC 2Y2NA 4H9QB 5B31D 5B32G 3RELA 5GXQD 3MGRB 3REJD 5B1MD 3MGRC 1P3AA 4JJNB 2XD1A 4R8PB 3AZLD 1TZYA 4JJNC 3AZLB 4R8PC 2RIQA 3B0DB 3WKJB 3KFUG 2NQBB 3B0DC 2BYMA 4H9PA 3WKJC 4H9RA 5GXQA 2NQBC 5B24D 1U35D 3REJA 3B0CW 5B1MA 1U35B 3A6NB 1P3BB 3REID 3UTAB 3A6NC 1P3BC 1P3FB 2XD5A 3UTAC 3REKD 1S32A 3X1TD 1P3FC 2F8NG 1P3KB 3AZFB 1P3KC 4WV4B 5B24A 3AZFC 2W8SA 4G91B 3KWQB 5CPJB 5GT3B 3AZED 4G91C 4J8WA 3AZEB 3KWQC 5CPJC 5GT3C 1M18A 3EPLA 3REKA 3KXBA 3LELB 3W99A 3LELC 3KSYA 5B1LC 4KHAB 3WAAB 1P3MD 5C3IB 4LD9D 3WAAC 1P3MB 1WWSA 1ZLAB 5C3IC 2F2AC 1ID3D 1ZLAC 3VH6A 3AV1D 1KX4A 2IO5C 3AZMA 4KUDB 2BG1A 4EO5B 5GSUD 5B2JD 5AY8D 4KUDC 4EO5C 1P3LB 2LY8A 5F99A 4LD9A 3REHB 1P3LC 3AV2B 1P3GD 5JRGA 3REHC 4H9NA 3AV2C 3AN2C 3V9RB 4Z5TD 1T3UA 3TU4D 1KX5B 1AOIA 3TU4B 1BFMA 1BH8B 5B2JA 5CP6B 3MVDB 5AY8A 3UT9D 1KX5C 3NQUA 3B6GA 2NZDD 3MVDC 1KX3B 5CP6C 4Z66B 3AFAB 1H3OA 2JCHA 2AROD 1KX3C 4Z66C 3B0BA 3AFAC 4YM6B 3O62A 3NQJA 4CSRB 1EQZB 3UTBC 5AV8D 4YM6C 3AYWA 1P3IB 1EQZC 1P3IC 3X1SB 2HUEB 4ZUXA 2NZDA 5FUGA 3X1SC 5B0ZD 4J8XA 2HUEC 5BO0B 5B0ZB 1HQ3D 4XUJD 1N1JA 3AZGD 3AZGB 3LZ0D 3AZGC 3LZ0B 1F66A 3B6FB 3KUYD 3B6FC 2FJ7A 2DQNC 4WU9A 1HQ3A 2J8PA 4XUJA 5E5AB 3MGQB 3AZND 3MGQC 5E5AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 D;  5KDM B;  4H9S C;  5AV6 D;  5CPK D;  5AV6 B;  4YS3 B;  5AV6 C;  2BYK A;  3MGP B;  4AWL B;  4YS3 C;  5AV5 A;  4J8V B;  5B0Y B;  3MGP C;  3MNN B;  1M19 D;  3W97 D;  4CAY A;  4J8V C;  5B0Y C;  3W97 B;  3MNN C;  3WTP D;  3AZN A;  3C1B A;  5B40 A;  5CPK A;  4WU8 D;  5GT0 B;  3MGS A;  5GT0 C;  5DNM D;  3AZJ A;  4UUZ A;  3WTP A;  3C1C D;  5B31 G;  3VH5 T;  4WU8 A;  3LJA B;  2YFV A;  5AV9 D;  5G49 B;  3X1V D;  3LJA C;  5DNM A;  4H9O B;  1JFI B;  3WTP E;  1Q9C A;  3X1U A;  4J8U D;  3C1C A;  3W98 D;  4E44 A;  1KU5 A;  4QLC A;  2CV5 B;  3AZI A;  5B2I D;  2F8N K;  5AV9 A;  2CV5 C;  4XZQ C;  3X1V A;  1P3O A;  5BNX B;  2HIO B;  3MGR D;  3W98 A;  2YFW B;  1P3P B;  2HIO C;  1ULY A;  3B0C T;  1P3P C;  4JJN D;  4R8P D;  3WA9 B;  2RVQ C;  3LZ1 B;  3WA9 C;  1WWI A;  3LZ1 C;  3WKJ D;  1BH9 A;  5B31 A;  2NQB D;  3REL B;  3A6N D;  1P3B D;  3REL C;  4JJN A;  3UTA D;  1P3A B;  1P3F D;  3AZL A;  1P3A C;  1TZY B;  1P3K D;  2NQB A;  1TZY C;  3AZF D;  4H9P B;  1U35 A;  4H9R B;  3KWQ D;  5CPJ D;  5GT3 D;  3UTA A;  3REI A;  3LEL D;  3X1T A;  1B67 A;  1P3K A;  5B1L D;  3W96 B;  5B1L B;  3AZF A;  1S32 C;  3W96 C;  5CPJ A;  3WAA D;  3AZE A;  5AVC B;  1ZLA D;  5AVC C;  4J8W C;  4NFT A;  1M18 B;  5B32 B;  3KXB B;  2IO5 B;  1M18 C;  5B32 C;  3KXB C;  4KUD D;  3W99 C;  1P3L D;  1P3M A;  3REH D;  5CPI B;  3AV2 D;  3AN2 D;  1M1A D;  5CPI C;  3AN2 B;  1M1A B;  1ID3 A;  1P34 B;  4NE3 A;  3AV1 A;  1M1A C;  1KX5 D;  1P34 C;  1KX4 B;  3MVD D;  5CP6 D;  3AZM B;  1KX4 C;  5GSU A;  1KX3 D;  4Z66 D;  3AFA D;  3AZM C;  2F8N D;  3AV2 A;  2JSS A;  5F99 B;  2F8N B;  1P3G A;  3UTB D;  4YM6 D;  5F99 C;  4WZS B;  5JRG B;  3UTB B;  1EQZ D;  1P3I D;  1KX5 A;  5JRG C;  4Z5T A;  3TU4 A;  3X1S D;  3VH5 A;  1AOI B;  3UT9 A;  1KX3 A;  4Z66 A;  3AFA A;  1AOI C;  3B6G B;  2ARO A;  1H3O B;  3B6G C;  4YM6 A;  1EQZ A;  3NQJ B;  5AV8 A;  3R45 B;  3O62 C;  5JA4 B;  3AYW C;  3B6F D;  4ZUX B;  5B0Z A;  3AZH B;  4J8X B;  4ZUX C;  3MGQ D;  5E5A D;  3AZH C;  4J8X C;  3AZG A;  1N1J B;  4HGA B;  3LZ0 A;  5AVB D;  4YS3 D;  4HGA C;  5AVB B;  3MGP D;  5BS7 A;  3B6F A;  4J8V D;  5B0Y D;  1F66 B;  5AVB C;  3KUY A;  3MNN D;  3MGQ A;  1F66 C;  4KGC B;  2PYO B;  2FJ7 B;  4WU9 B;  5B33 B;  4KGC C;  5KDM A;  2PYO C;  2FJ7 C;  5BNV B;  4X23 A;  5B33 C;  4WU9 C;  5AV6 A;  1TAF A;  4Z2M G;  5GT0 D;  4YS3 A;  4J8V A;  5B0Y A;  4Z2M H;  2BYK B;  1M19 A;  3W97 A;  5AV5 C;  4CAY B;  5B40 B;  3LJA D;  5GT0 A;  3C1B C;  5B40 C;  5BT1 C;  3MGS B;  3MGS C;  3VH6 W;  3AZJ B;  4UUZ B;  3AZJ C;  2CV5 D;  4XZQ D;  3LJA A;  4XZQ B;  5G49 A;  2YFV B;  5DNN B;  4WNN A;  5DNN C;  2HIO D;  1P3P D;  4J8U A;  3X1U B;  2CV5 A;  2RVQ D;  3X1U C;  3WA9 D;  5B2I A;  3AZK B;  3AZI B;  3LZ1 D;  4QLC C;  3AZK C;  3AZI C;  4H9Q A;  1P3O B;  1P3O C;  2YFW A;  3REL D;  1P3P A;  3MGR A;  1P3A D;  4R8P A;  3LZ1 A;  1TZY D;  1R4V A;  3WKJ A;  1BH9 B;  5B31 B;  2BYM B;  5B31 C;  5GXQ B;  3A6N A;  1P3B A;  3REJ B;  5B1M B;  5GXQ C;  3REJ C;  1P3F A;  5B1M C;  1S32 D;  1F1E A;  3W96 D;  1S32 B;  3AZL C;  1B6W A;  3KWQ A;  5B24 B;  5GT3 A;  5AVC D;  4J8W D;  5B24 C;  1U35 C;  3REI B;  4J8W B;  1M18 D;  3LEL A;  5B32 D;  3KXB D;  3W96 A;  3REI C;  3REK B;  5B1L A;  3X1T B;  3W99 D;  3REK C;  3W99 B;  3X1T C;  4KHA A;  2F8N H;  3WAA A;  5AVC A;  5CPI D;  1ZLA A;  5B32 A;  3AZE C;  1P34 D;  4E45 A;  1KX4 D;  4KUD A;  3AZM D;  1P3L A;  5CPI A;  5F99 D;  3REH A;  3AN2 A;  4LD9 B;  1M1A A;  5JRG D;  1P34 A;  1P3M C;  2L5A A;  3V9R A;  4LD9 C;  1ID3 B;  4H9N B;  3AV1 B;  1ID3 C;  1BH8 A;  3MVD A;  5CP6 A;  1AOI D;  3AV1 C;  3B6G D;  5GSU B;  5B2J B;  5AY8 B;  3NQU B;  2F8N A;  5GSU C;  5B2J C;  5AY8 C;  3UTB A;  1P3G B;  4CSR A;  3O62 D;  1P3I A;  1P3G C;  3O62 B;  3AYW D;  4Z5T B;  3X1S A;  3AYW B;  4Z5T C;  4ZUX D;  3TU4 C;  3UT9 B;  3AZH D;  5BO0 A;  4J8X D;  2NZD B;  5FUG B;  3UT9 C;  2ARO B;  2NZD C;  4NE6 A;  2ARO C;  3R45 A;  5AV8 B;  5JA4 A;  4NE5 A;  5AV8 C;  1HTA A;  3AZH A;  1F66 D;  4KGC D;  2PYO D;  2FJ7 D;  5E5A A;  5B0Z C;  4WU9 D;  4H9S A;  5B33 D;  1JFI A;  1HQ3 B;  4XUJ B;  1HQ3 C;  4XUJ C;  4DRB A;  5AVB A;  3MGP A;  3LZ0 C;  5AV5 D;  3MNN A;  4KGC A;  2PYO A;  5AV5 B;  5BS7 C;  3KUY B;  5B33 A;  3VH6 T;  3KUY C;  5BNV A;  2CWE A;  3C1B D;  3AZN B;  5B40 D;  3C1B B;  4X23 B;  3AZN C;  1TAF B;  5BT1 D;  5CPK B;  4X23 C;  5CPK C;  3MGS D;  4AWL C;  3AZJ D;  1M19 B;  1M19 C;  3W97 C;  3WTP B;  4G92 B;  3WTP C;  4WU8 B;  5DNN D;  4G92 C;  1A7W A;  4H9O A;  4WU8 C;  5DNM B;  5DNM C;  3X1U D;  3C1C B;  4ZBJ B;  4XZQ A;  4QLC D;  3AZK D;  3AZI D;  3C1C C;  4QLC B;  4ZBJ C;  5DNN A;  5AV9 B;  5BNX A;  1P3O D;  3X1V B;  4DRA A;  5AV9 C;  4WNN B;  2HIO A;  3X1V C;  4J8U B;  3W98 B;  4M6B A;  3AZK A;  3VH5 W;  3WA9 A;  4J8U C;  3W98 C;  5B2I B;  5CHL B;  5B2I C;  4H9Q B;  5B31 D;  5B32 G;  3REL A;  5GXQ D;  3MGR B;  3REJ D;  5B1M D;  3MGR C;  1P3A A;  4JJN B;  4R8P B;  3AZL D;  1TZY A;  4JJN C;  3AZL B;  4R8P C;  3B0D B;  3WKJ B;  2NQB B;  3B0D C;  2BYM A;  4H9P A;  3WKJ C;  4H9R A;  5GXQ A;  2NQB C;  5B24 D;  1U35 D;  3REJ A;  3B0C W;  5B1M A;  1U35 B;  3A6N B;  1P3B B;  3REI D;  3UTA B;  3A6N C;  1P3B C;  1P3F B;  3UTA C;  3REK D;  1S32 A;  3X1T D;  1P3F C;  2F8N G;  1P3K B;  3AZF B;  1P3K C;  4WV4 B;  5B24 A;  3AZF C;  4G91 B;  3KWQ B;  5CPJ B;  5GT3 B;  3AZE D;  4G91 C;  4J8W A;  3AZE B;  3KWQ C;  5CPJ C;  5GT3 C;  1M18 A;  3REK A;  3KXB A;  3LEL B;  3W99 A;  3LEL C;  3KSY A;  5B1L C;  4KHA B;  3WAA B;  1P3M D;  5C3I B;  4LD9 D;  3WAA C;  1P3M B;  1WWS A;  1ZLA B;  5C3I C;  1ID3 D;  1ZLA C;  3VH6 A;  3AV1 D;  1KX4 A;  2IO5 C;  3AZM A;  4KUD B;  4EO5 B;  5GSU D;  5B2J D;  5AY8 D;  4KUD C;  4EO5 C;  1P3L B;  2LY8 A;  5F99 A;  4LD9 A;  3REH B;  1P3L C;  3AV2 B;  1P3G D;  5JRG A;  3REH C;  4H9N A;  3AV2 C;  3AN2 C;  3V9R B;  4Z5T D;  3TU4 D;  1KX5 B;  1AOI A;  3TU4 B;  1BFM A;  1BH8 B;  5B2J A;  5CP6 B;  3MVD B;  5AY8 A;  3UT9 D;  1KX5 C;  3NQU A;  3B6G A;  2NZD D;  3MVD C;  1KX3 B;  5CP6 C;  4Z66 B;  3AFA B;  1H3O A;  2ARO D;  1KX3 C;  4Z66 C;  3B0B A;  3AFA C;  4YM6 B;  3O62 A;  3NQJ A;  4CSR B;  1EQZ B;  3UTB C;  5AV8 D;  4YM6 C;  3AYW A;  1P3I B;  1EQZ C;  1P3I C;  3X1S B;  2HUE B;  4ZUX A;  2NZD A;  5FUG A;  3X1S C;  5B0Z D;  4J8X A;  2HUE C;  5BO0 B;  5B0Z B;  1HQ3 D;  4XUJ D;  1N1J A;  3AZG D;  3AZG B;  3LZ0 D;  3AZG C;  3LZ0 B;  1F66 A;  3B6F B;  3KUY D;  3B6F C;  2FJ7 A;  4WU9 A;  1HQ3 A;  5E5A B;  4XUJ A;  3MGQ B;  3AZN D;  3MGQ C;  5E5A C; 
#chains in the Genus database with same CATH topology
 4X23 D;  5KDM B;  4H9S C;  5AV6 D;  5CPK D;  4WJ3 C;  5AV6 B;  4YS3 B;  5AV6 C;  2BYK A;  3MGP B;  4AWL B;  4YS3 C;  5AV5 A;  4J8V B;  5B0Y B;  3H0R C;  3MGP C;  3MNN B;  1M19 D;  3W97 D;  4CAY A;  4J8V C;  5B0Y C;  3W97 B;  3MNN C;  3WTP D;  3AZN A;  3C1B A;  5B40 A;  5CPK A;  2ZY5 A;  4WU8 D;  5GT0 B;  3MGS A;  5GT0 C;  5DNM D;  3F6T A;  3AZJ A;  4UUZ A;  3WTP A;  3C1C D;  5B31 G;  3VH5 T;  4WU8 A;  3LJA B;  2Y2K A;  2YFV A;  5AV9 D;  5G49 B;  3X1V D;  3LJA C;  5DNM A;  4H9O B;  1JFI B;  3WTP E;  1Q9C A;  3X1U A;  4J8U D;  3C1C A;  3W98 D;  4E44 A;  1KU5 A;  4QLC A;  2CV5 B;  3AZI A;  2Y2I A;  3H0M C;  5B2I D;  2F8N K;  5AV9 A;  2CV5 C;  4XZQ C;  3X1V A;  1P3O A;  5BNX B;  2HIO B;  3MGR D;  3W98 A;  2YFW B;  1P3P B;  1Z2C B;  2HIO C;  1ULY A;  3B0C T;  1P3P C;  4JJN D;  4R8P D;  3WA9 B;  2RVQ C;  3EPK A;  2JE5 A;  3LZ1 B;  3WA9 C;  1WWI A;  3LZ1 C;  3WKJ D;  1BH9 A;  5B31 A;  2NQB D;  3REL B;  3A6N D;  1P3B D;  3REL C;  4JJN A;  3UTA D;  1P3A B;  1P3F D;  3AZL A;  1P3A C;  1TZY B;  2ZM5 A;  1P3K D;  2NQB A;  1TZY C;  3AZF D;  4H9P B;  1U35 A;  4H9R B;  1PZR A;  3KWQ D;  5CPJ D;  5GT3 D;  3UTA A;  3REI A;  3LEL D;  3X1T A;  1B67 A;  1P3K A;  5B1L D;  3W96 B;  5B1L B;  3AZF A;  2Y2P A;  1S32 C;  3W96 C;  5CPJ A;  3WAA D;  3AZE A;  5AVC B;  1ZLA D;  2DF4 C;  5AVC C;  4J8W C;  4NFT A;  1M18 B;  5B32 B;  3KXB B;  2IO5 B;  3AL0 C;  1M18 C;  5B32 C;  3KXB C;  4KUD D;  3W99 C;  2Y2L A;  1P3L D;  2Y2J A;  1P3M A;  3REH D;  5CPI B;  3AV2 D;  3AN2 D;  1M1A D;  5CPI C;  3AN2 B;  1M1A B;  1ID3 A;  1P34 B;  4NE3 A;  3AV1 A;  1M1A C;  1KX5 D;  1P34 C;  1KX4 B;  3MVD D;  5CP6 D;  3AZM B;  1KX4 C;  5GSU A;  1KX3 D;  4Z66 D;  3AFA D;  3AZM C;  2F8N D;  3AV2 A;  2JSS A;  5F99 B;  2F8N B;  1P3G A;  3UTB D;  4YM6 D;  5F99 C;  4WZS B;  5JRG B;  3UTB B;  1EQZ D;  1P3I D;  1KX5 A;  5JRG C;  4Z5T A;  3TU4 A;  3X1S D;  3VH5 A;  1AOI B;  2G5I C;  3UT9 A;  1KX3 A;  4Z66 A;  3AFA A;  1AOI C;  3B6G B;  3H0L C;  2ARO A;  1H3O B;  3B6G C;  2Y2O A;  4YM6 A;  1EQZ A;  3NQJ B;  5AV8 A;  3R45 B;  3O62 C;  5JA4 B;  3AYW C;  3B6F D;  4ZUX B;  5B0Z A;  3AZH B;  4J8X B;  4ZUX C;  3MGQ D;  5E5A D;  3AZH C;  4J8X C;  3AZG A;  1N1J B;  4HGA B;  3LZ0 A;  5AVB D;  4YS3 D;  4HGA C;  5AVB B;  3A1I A;  5BS7 A;  3MGP D;  3B6F A;  4J8V D;  5B0Y D;  1F66 B;  5AVB C;  3KUY A;  3MNN D;  3MGQ A;  1F66 C;  4KGC B;  2PYO B;  2FJ7 B;  4WU9 B;  5B33 B;  4KGC C;  5KDM A;  2PYO C;  2FJ7 C;  5BNV B;  4X23 A;  5B33 C;  4WU9 C;  5AV6 A;  1TAF A;  4Z2M G;  5GT0 D;  4YS3 A;  3P5J B;  4J8V A;  1W2E A;  5B0Y A;  4Z2M H;  2BYK B;  3EPH A;  1M19 A;  3W97 A;  5AV5 C;  4CAY B;  5B40 B;  3LJA D;  2ZY4 A;  5GT0 A;  3C1B C;  5B40 C;  5BT1 C;  3MGS B;  3MGS C;  3VH6 W;  3AZJ B;  4UUZ B;  3AZJ C;  2CV5 D;  4XZQ D;  3LJA A;  4XZQ B;  5G49 A;  2YFV B;  5DNN B;  4WNN A;  5DNN C;  2HIO D;  1P3P D;  4J8U A;  3X1U B;  2CV5 A;  2RVQ D;  3X1U C;  3WA9 D;  5B2I A;  3AZK B;  3AZI B;  3LZ1 D;  4QLC C;  3AZK C;  3AZI C;  4H9Q A;  1P3O B;  1P3O C;  2YFW A;  2ZY3 A;  3REL D;  3MGR A;  1P3P A;  1P3A D;  4R8P A;  3LZ1 A;  1TZY D;  1R4V A;  3WKJ A;  2FFF B;  1BH9 B;  5B31 B;  2BYM B;  5B31 C;  5GXQ B;  3A6N A;  1P3B A;  3REJ B;  5B1M B;  5GXQ C;  3REJ C;  1P3F A;  5B1M C;  1S32 D;  1F1E A;  3W96 D;  1S32 B;  3AZL C;  1B6W A;  3FDD A;  5B24 B;  3KWQ A;  5GT3 A;  3EG5 B;  5AVC D;  4J8W D;  5B24 C;  1U35 C;  3REI B;  4J8W B;  1M18 D;  3LEL A;  5B32 D;  3KXB D;  3W96 A;  3REI C;  3REK B;  5B1L A;  3X1T B;  3W99 D;  3REK C;  3W99 B;  3X1T C;  4KHA A;  2UWX A;  2F8N H;  3WAA A;  2Y2Q A;  5AVC A;  5CPI D;  1ZLA A;  2ZY2 A;  5B32 A;  3AZE C;  1P34 D;  4E45 A;  1KX4 D;  4KUD A;  3AZM D;  1P3L A;  5CPI A;  4DQY B;  5F99 D;  3REH A;  3AN2 A;  4LD9 B;  1M1A A;  5JRG D;  1P34 A;  1P3M C;  2L5A A;  3V9R A;  4LD9 C;  1ID3 B;  4H9N B;  3AV1 B;  1ID3 C;  1BH8 A;  3MVD A;  5CP6 A;  1AOI D;  3AV1 C;  3B6G D;  5GSU B;  5B2J B;  5AY8 B;  4UPK A;  3NQU B;  2F8N A;  5GSU C;  5B2J C;  5AY8 C;  3UTB A;  1P3G B;  2Y2H A;  4CSR A;  3O62 D;  1P3I A;  1P3G C;  3O62 B;  3AYW D;  4Z5T B;  3X1S A;  3AYW B;  4Z5T C;  4ZUX D;  3TU4 C;  3UT9 B;  3AZH D;  5BO0 A;  4J8X D;  2NZD B;  5FUG B;  3UT9 C;  2ARO B;  2NZD C;  4NE6 A;  2ARO C;  3R45 A;  5AV8 B;  2Y2G A;  5JA4 A;  4NE5 A;  5AV8 C;  1HTA A;  3A1K A;  3AZH A;  1F66 D;  4KGC D;  2PYO D;  2FJ7 D;  5E5A A;  5B0Z C;  4WU9 D;  4H9S A;  5B33 D;  1JFI A;  1HQ3 B;  4XUJ B;  1HQ3 C;  4XUJ C;  3EPJ A;  4DRB A;  5AVB A;  2G5H C;  3MGP A;  3LZ0 C;  5AV5 D;  3MNN A;  4KGC A;  2PYO A;  5AV5 B;  5BS7 C;  3KUY B;  5B33 A;  3VH6 T;  3KUY C;  2VQR A;  5BNV A;  2CWE A;  3C1B D;  3AZN B;  5B40 D;  3C1B B;  4X23 B;  3IP4 C;  3AZN C;  1TAF B;  5BT1 D;  5CPK B;  4X23 C;  5CPK C;  3MGS D;  4AWL C;  3AZJ D;  1M19 B;  1M19 C;  3W97 C;  3WTP B;  4G92 B;  3WTP C;  4WU8 B;  5DNN D;  4G92 C;  1A7W A;  4H9O A;  4WU8 C;  5DNM B;  5DNM C;  3X1U D;  2Y2M A;  3C1C B;  4ZBJ B;  4XZQ A;  4QLC D;  3AZK D;  3AZI D;  3C1C C;  4QLC B;  4ZBJ C;  5DNN A;  5AV9 B;  5BNX A;  1P3O D;  3X1V B;  4DRA A;  5AV9 C;  4WNN B;  2HIO A;  3X1V C;  4J8U B;  3W98 B;  4M6B A;  3AZK A;  3VH5 W;  3WA9 A;  4J8U C;  3W98 C;  5B2I B;  5CHL B;  5B2I C;  2Y2N A;  4H9Q B;  5B31 D;  5B32 G;  3REL A;  5GXQ D;  3MGR B;  3REJ D;  5B1M D;  3MGR C;  1P3A A;  4JJN B;  2XD1 A;  4R8P B;  3AZL D;  1TZY A;  4JJN C;  3AZL B;  4R8P C;  2RIQ A;  3B0D B;  3WKJ B;  3KFU G;  2NQB B;  3B0D C;  2BYM A;  4H9P A;  3WKJ C;  4H9R A;  5GXQ A;  2NQB C;  5B24 D;  1U35 D;  3REJ A;  3B0C W;  5B1M A;  1U35 B;  3A6N B;  1P3B B;  3REI D;  3UTA B;  3A6N C;  1P3B C;  1P3F B;  2XD5 A;  3UTA C;  3REK D;  1S32 A;  3X1T D;  1P3F C;  2F8N G;  1P3K B;  3AZF B;  1P3K C;  4WV4 B;  5B24 A;  3AZF C;  2W8S A;  4G91 B;  3KWQ B;  5CPJ B;  5GT3 B;  3AZE D;  4G91 C;  4J8W A;  3AZE B;  3KWQ C;  5CPJ C;  5GT3 C;  1M18 A;  3EPL A;  3REK A;  3KXB A;  3LEL B;  3W99 A;  3LEL C;  3KSY A;  5B1L C;  4KHA B;  3WAA B;  1P3M D;  5C3I B;  4LD9 D;  3WAA C;  1P3M B;  1WWS A;  1ZLA B;  5C3I C;  2F2A C;  1ID3 D;  1ZLA C;  3VH6 A;  3AV1 D;  1KX4 A;  2IO5 C;  3AZM A;  4KUD B;  2BG1 A;  4EO5 B;  5GSU D;  5B2J D;  5AY8 D;  4KUD C;  4EO5 C;  1P3L B;  2LY8 A;  5F99 A;  4LD9 A;  3REH B;  1P3L C;  3AV2 B;  1P3G D;  5JRG A;  3REH C;  4H9N A;  3AV2 C;  3AN2 C;  3V9R B;  4Z5T D;  1T3U A;  3TU4 D;  1KX5 B;  1AOI A;  3TU4 B;  1BFM A;  1BH8 B;  5B2J A;  5CP6 B;  3MVD B;  5AY8 A;  3UT9 D;  1KX5 C;  3NQU A;  3B6G A;  2NZD D;  3MVD C;  1KX3 B;  5CP6 C;  4Z66 B;  3AFA B;  1H3O A;  2JCH A;  2ARO D;  1KX3 C;  4Z66 C;  3B0B A;  3AFA C;  4YM6 B;  3O62 A;  3NQJ A;  4CSR B;  1EQZ B;  3UTB C;  5AV8 D;  4YM6 C;  3AYW A;  1P3I B;  1EQZ C;  1P3I C;  3X1S B;  2HUE B;  4ZUX A;  2NZD A;  5FUG A;  3X1S C;  5B0Z D;  4J8X A;  2HUE C;  5BO0 B;  5B0Z B;  1HQ3 D;  4XUJ D;  1N1J A;  3AZG D;  3AZG B;  3LZ0 D;  3AZG C;  3LZ0 B;  1F66 A;  3B6F B;  3KUY D;  3B6F C;  2FJ7 A;  2DQN C;  4WU9 A;  1HQ3 A;  2J8P A;  4XUJ A;  5E5A B;  3MGQ B;  3AZN D;  3MGQ C;  5E5A C; 
#chains in the Genus database with same CATH homology
 4X23 D;  5KDM B;  4H9S C;  5AV6 D;  5CPK D;  4WJ3 C;  5AV6 B;  4YS3 B;  5AV6 C;  2BYK A;  3MGP B;  4AWL B;  4YS3 C;  5AV5 A;  4J8V B;  5B0Y B;  3H0R C;  3MGP C;  3MNN B;  1M19 D;  3W97 D;  4CAY A;  4J8V C;  5B0Y C;  3W97 B;  3MNN C;  3WTP D;  3AZN A;  3C1B A;  5B40 A;  5CPK A;  2ZY5 A;  4WU8 D;  5GT0 B;  3MGS A;  5GT0 C;  5DNM D;  3F6T A;  3AZJ A;  4UUZ A;  3WTP A;  3C1C D;  5B31 G;  3VH5 T;  4WU8 A;  3LJA B;  2Y2K A;  2YFV A;  5AV9 D;  5G49 B;  3X1V D;  3LJA C;  5DNM A;  4H9O B;  1JFI B;  3WTP E;  1Q9C A;  3X1U A;  4J8U D;  3C1C A;  3W98 D;  4E44 A;  1KU5 A;  4QLC A;  2CV5 B;  3AZI A;  2Y2I A;  3H0M C;  5B2I D;  2F8N K;  5AV9 A;  2CV5 C;  4XZQ C;  3X1V A;  1P3O A;  5BNX B;  2HIO B;  3MGR D;  3W98 A;  2YFW B;  1P3P B;  1Z2C B;  2HIO C;  1ULY A;  3B0C T;  1P3P C;  4JJN D;  4R8P D;  3WA9 B;  2RVQ C;  3EPK A;  2JE5 A;  3LZ1 B;  3WA9 C;  1WWI A;  3LZ1 C;  3WKJ D;  1BH9 A;  5B31 A;  2NQB D;  3REL B;  3A6N D;  1P3B D;  3REL C;  4JJN A;  3UTA D;  1P3A B;  1P3F D;  3AZL A;  1P3A C;  1TZY B;  2ZM5 A;  1P3K D;  2NQB A;  1TZY C;  3AZF D;  4H9P B;  1U35 A;  4H9R B;  1PZR A;  3KWQ D;  5CPJ D;  5GT3 D;  3UTA A;  3REI A;  3LEL D;  3X1T A;  1B67 A;  1P3K A;  5B1L D;  3W96 B;  5B1L B;  3AZF A;  2Y2P A;  1S32 C;  3W96 C;  5CPJ A;  3WAA D;  3AZE A;  5AVC B;  1ZLA D;  2DF4 C;  5AVC C;  4J8W C;  4NFT A;  1M18 B;  5B32 B;  3KXB B;  2IO5 B;  3AL0 C;  1M18 C;  5B32 C;  3KXB C;  4KUD D;  3W99 C;  2Y2L A;  1P3L D;  2Y2J A;  1P3M A;  3REH D;  5CPI B;  3AV2 D;  3AN2 D;  1M1A D;  5CPI C;  3AN2 B;  1M1A B;  1ID3 A;  1P34 B;  4NE3 A;  3AV1 A;  1M1A C;  1KX5 D;  1P34 C;  1KX4 B;  3MVD D;  5CP6 D;  3AZM B;  1KX4 C;  5GSU A;  1KX3 D;  4Z66 D;  3AFA D;  3AZM C;  2F8N D;  3AV2 A;  2JSS A;  5F99 B;  2F8N B;  1P3G A;  3UTB D;  4YM6 D;  5F99 C;  4WZS B;  5JRG B;  3UTB B;  1EQZ D;  1P3I D;  1KX5 A;  5JRG C;  4Z5T A;  3TU4 A;  3X1S D;  3VH5 A;  1AOI B;  2G5I C;  3UT9 A;  1KX3 A;  4Z66 A;  3AFA A;  1AOI C;  3B6G B;  3H0L C;  2ARO A;  1H3O B;  3B6G C;  2Y2O A;  4YM6 A;  1EQZ A;  3NQJ B;  5AV8 A;  3R45 B;  3O62 C;  5JA4 B;  3AYW C;  3B6F D;  4ZUX B;  5B0Z A;  3AZH B;  4J8X B;  4ZUX C;  3MGQ D;  5E5A D;  3AZH C;  4J8X C;  3AZG A;  1N1J B;  4HGA B;  3LZ0 A;  5AVB D;  4YS3 D;  4HGA C;  5AVB B;  3A1I A;  5BS7 A;  3MGP D;  3B6F A;  4J8V D;  5B0Y D;  1F66 B;  5AVB C;  3KUY A;  3MNN D;  3MGQ A;  1F66 C;  4KGC B;  2PYO B;  2FJ7 B;  4WU9 B;  5B33 B;  4KGC C;  5KDM A;  2PYO C;  2FJ7 C;  5BNV B;  4X23 A;  5B33 C;  4WU9 C;  5AV6 A;  1TAF A;  4Z2M G;  5GT0 D;  4YS3 A;  3P5J B;  4J8V A;  1W2E A;  5B0Y A;  4Z2M H;  2BYK B;  3EPH A;  1M19 A;  3W97 A;  5AV5 C;  4CAY B;  5B40 B;  3LJA D;  2ZY4 A;  5GT0 A;  3C1B C;  5B40 C;  5BT1 C;  3MGS B;  3MGS C;  3VH6 W;  3AZJ B;  4UUZ B;  3AZJ C;  2CV5 D;  4XZQ D;  3LJA A;  4XZQ B;  5G49 A;  2YFV B;  5DNN B;  4WNN A;  5DNN C;  2HIO D;  1P3P D;  4J8U A;  3X1U B;  2CV5 A;  2RVQ D;  3X1U C;  3WA9 D;  5B2I A;  3AZK B;  3AZI B;  3LZ1 D;  4QLC C;  3AZK C;  3AZI C;  4H9Q A;  1P3O B;  1P3O C;  2YFW A;  2ZY3 A;  3REL D;  3MGR A;  1P3P A;  1P3A D;  4R8P A;  3LZ1 A;  1TZY D;  1R4V A;  3WKJ A;  2FFF B;  1BH9 B;  5B31 B;  2BYM B;  5B31 C;  5GXQ B;  3A6N A;  1P3B A;  3REJ B;  5B1M B;  5GXQ C;  3REJ C;  1P3F A;  5B1M C;  1S32 D;  1F1E A;  3W96 D;  1S32 B;  3AZL C;  1B6W A;  3FDD A;  5B24 B;  3KWQ A;  5GT3 A;  3EG5 B;  5AVC D;  4J8W D;  5B24 C;  1U35 C;  3REI B;  4J8W B;  1M18 D;  3LEL A;  5B32 D;  3KXB D;  3W96 A;  3REI C;  3REK B;  5B1L A;  3X1T B;  3W99 D;  3REK C;  3W99 B;  3X1T C;  4KHA A;  2UWX A;  2F8N H;  3WAA A;  2Y2Q A;  5AVC A;  5CPI D;  1ZLA A;  2ZY2 A;  5B32 A;  3AZE C;  1P34 D;  4E45 A;  1KX4 D;  4KUD A;  3AZM D;  1P3L A;  5CPI A;  4DQY B;  5F99 D;  3REH A;  3AN2 A;  4LD9 B;  1M1A A;  5JRG D;  1P34 A;  1P3M C;  2L5A A;  3V9R A;  4LD9 C;  1ID3 B;  4H9N B;  3AV1 B;  1ID3 C;  1BH8 A;  3MVD A;  5CP6 A;  1AOI D;  3AV1 C;  3B6G D;  5GSU B;  5B2J B;  5AY8 B;  4UPK A;  3NQU B;  2F8N A;  5GSU C;  5B2J C;  5AY8 C;  3UTB A;  1P3G B;  2Y2H A;  4CSR A;  3O62 D;  1P3I A;  1P3G C;  3O62 B;  3AYW D;  4Z5T B;  3X1S A;  3AYW B;  4Z5T C;  4ZUX D;  3TU4 C;  3UT9 B;  3AZH D;  5BO0 A;  4J8X D;  2NZD B;  5FUG B;  3UT9 C;  2ARO B;  2NZD C;  4NE6 A;  2ARO C;  3R45 A;  5AV8 B;  2Y2G A;  5JA4 A;  4NE5 A;  5AV8 C;  1HTA A;  3A1K A;  3AZH A;  1F66 D;  4KGC D;  2PYO D;  2FJ7 D;  5E5A A;  5B0Z C;  4WU9 D;  4H9S A;  5B33 D;  1JFI A;  1HQ3 B;  4XUJ B;  1HQ3 C;  4XUJ C;  3EPJ A;  4DRB A;  5AVB A;  2G5H C;  3MGP A;  3LZ0 C;  5AV5 D;  3MNN A;  4KGC A;  2PYO A;  5AV5 B;  5BS7 C;  3KUY B;  5B33 A;  3VH6 T;  3KUY C;  2VQR A;  5BNV A;  2CWE A;  3C1B D;  3AZN B;  5B40 D;  3C1B B;  4X23 B;  3IP4 C;  3AZN C;  1TAF B;  5BT1 D;  5CPK B;  4X23 C;  5CPK C;  3MGS D;  4AWL C;  3AZJ D;  1M19 B;  1M19 C;  3W97 C;  3WTP B;  4G92 B;  3WTP C;  4WU8 B;  5DNN D;  4G92 C;  1A7W A;  4H9O A;  4WU8 C;  5DNM B;  5DNM C;  3X1U D;  2Y2M A;  3C1C B;  4ZBJ B;  4XZQ A;  4QLC D;  3AZK D;  3AZI D;  3C1C C;  4QLC B;  4ZBJ C;  5DNN A;  5AV9 B;  5BNX A;  1P3O D;  3X1V B;  4DRA A;  5AV9 C;  4WNN B;  2HIO A;  3X1V C;  4J8U B;  3W98 B;  4M6B A;  3AZK A;  3VH5 W;  3WA9 A;  4J8U C;  3W98 C;  5B2I B;  5CHL B;  5B2I C;  2Y2N A;  4H9Q B;  5B31 D;  5B32 G;  3REL A;  5GXQ D;  3MGR B;  3REJ D;  5B1M D;  3MGR C;  1P3A A;  4JJN B;  2XD1 A;  4R8P B;  3AZL D;  1TZY A;  4JJN C;  3AZL B;  4R8P C;  2RIQ A;  3B0D B;  3WKJ B;  3KFU G;  2NQB B;  3B0D C;  2BYM A;  4H9P A;  3WKJ C;  4H9R A;  5GXQ A;  2NQB C;  5B24 D;  1U35 D;  3REJ A;  3B0C W;  5B1M A;  1U35 B;  3A6N B;  1P3B B;  3REI D;  3UTA B;  3A6N C;  1P3B C;  1P3F B;  2XD5 A;  3UTA C;  3REK D;  1S32 A;  3X1T D;  1P3F C;  2F8N G;  1P3K B;  3AZF B;  1P3K C;  4WV4 B;  5B24 A;  3AZF C;  2W8S A;  4G91 B;  3KWQ B;  5CPJ B;  5GT3 B;  3AZE D;  4G91 C;  4J8W A;  3AZE B;  3KWQ C;  5CPJ C;  5GT3 C;  1M18 A;  3EPL A;  3REK A;  3KXB A;  3LEL B;  3W99 A;  3LEL C;  3KSY A;  5B1L C;  4KHA B;  3WAA B;  1P3M D;  5C3I B;  4LD9 D;  3WAA C;  1P3M B;  1WWS A;  1ZLA B;  5C3I C;  2F2A C;  1ID3 D;  1ZLA C;  3VH6 A;  3AV1 D;  1KX4 A;  2IO5 C;  3AZM A;  4KUD B;  2BG1 A;  4EO5 B;  5GSU D;  5B2J D;  5AY8 D;  4KUD C;  4EO5 C;  1P3L B;  2LY8 A;  5F99 A;  4LD9 A;  3REH B;  1P3L C;  3AV2 B;  1P3G D;  5JRG A;  3REH C;  4H9N A;  3AV2 C;  3AN2 C;  3V9R B;  4Z5T D;  1T3U A;  3TU4 D;  1KX5 B;  1AOI A;  3TU4 B;  1BFM A;  1BH8 B;  5B2J A;  5CP6 B;  3MVD B;  5AY8 A;  3UT9 D;  1KX5 C;  3NQU A;  3B6G A;  2NZD D;  3MVD C;  1KX3 B;  5CP6 C;  4Z66 B;  3AFA B;  1H3O A;  2JCH A;  2ARO D;  1KX3 C;  4Z66 C;  3B0B A;  3AFA C;  4YM6 B;  3O62 A;  3NQJ A;  4CSR B;  1EQZ B;  3UTB C;  5AV8 D;  4YM6 C;  3AYW A;  1P3I B;  1EQZ C;  1P3I C;  3X1S B;  2HUE B;  4ZUX A;  2NZD A;  5FUG A;  3X1S C;  5B0Z D;  4J8X A;  2HUE C;  5BO0 B;  5B0Z B;  1HQ3 D;  4XUJ D;  1N1J A;  3AZG D;  3AZG B;  3LZ0 D;  3AZG C;  3LZ0 B;  1F66 A;  3B6F B;  3KUY D;  3B6F C;  2FJ7 A;  2DQN C;  4WU9 A;  1HQ3 A;  2J8P A;  4XUJ A;  5E5A B;  3MGQ B;  3AZN D;  3MGQ C;  5E5A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...