3X1SC

Crystal structure of the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sC00
2IO5C 5GT0A 1KX5A 4J8XC 3LZ1B 3MVDD 4WU9D 3KSYA 5BNXA 4X23D 3C1BB 4J8VA 3UTAB 1P34D 1TAFA 3MGQD 3AZIA 3WTPE 5B32C 3AYWD 3MGSB 1P3BD 5AV6D 3X1VB 1EQZC 1ZLAC 4XZQB 1S32B 3KXBD 4KUDB 3X1SD 1BH9B 4UUZB 2AROC 3TU4C 5B1LD 3AZHB 1KX3B 2HUEC 1KX4D 4J8UD 2NQBA 4Z5TC 4Z66C 3KUYD 3MGPB 5AV9A 3WKJC 5B1MB 4KGCC 1AOIA 3UTBC 3KWQC 3AZJD 1P3IC 2CV5D 5CPID 1B6WA 1P3KB 4ZUXA 3LZ1C 5B40A 3WTPA 1M19B 1P3PD 1BFMA 3B6FD 3MGRB 3C1BC 4J8XD 3UTAC 1KU5A 2YFVB 5CP6B 3VH5T 5B0ZA 5AV5B 3MGSC 3C1CB 3REKA 3X1VC 5AV8A 4JJNB 4XZQC 3AZNC 4E44A 5B32D 1S32C 1EQZD 4KUDC 2RVQC 3A6NA 1ZLAD 4YS3B 3LELC 3LZ0B 3AZHC 5GT0B 3V9RA 1KX5B 1KX3C 3B0CW 1P3AA 2AROD 3TU4D 3REJA 5BNXB 5B32G 4J8VB 1BH8A 3B0DB 4XUJC 1TAFB 3AZFA 3AZIB 3B6GA 1WWSA 5B1MC 4WU8A 4Z5TD 4Z66D 1P3OA 3WKJD 3MNNA 5BO0A 3AFAA 4KGCD 3AV1A 1P3KC 3UTBD 3KWQD 1JFIA 5CPKA 1P3ID 1M19C 3W96A 3MGPA 3MGRC 3LZ1D 1ULYA 5CP6C 1P3MA 2F8NA 3O62A 3LJAA 3AZLA 3C1BD 3UTAD 5AV5C 3C1CC 2NQBB 4JJNC 5F99C 3MGSD 5AV9B 3X1VD 4H9SA 5AY8A 3VH6T 4CSRA 4XZQD 3AZND 1P3GA 1AOIB 1S32D 4YS3C 2HIOA 5BS7A 3MVDA 4KUDD 3W97A 5B2IC 3UT9C 2RVQD 1R4VA 3LZ0C 3W99C 5GT0C 4ZUXB 4NE6A 1KX5C 3X1UA 5B40B 3WTPB 4QLCA 4H9OA 5E5AA 1P3FA 3LELD 3AZHD 4J8VC 1KX3D 3B0DC 5CPJA 3AZIC 4YM6A 5B0ZB 3REKB 4XUJD 5AV8B 3WA9A 3X1SA 5B2JA 5B1MD 4WZSB 3A6NB 3AZKA 3AZMA 1P3KD 5B31A 4J8UA 4CAYA 1M19D 3V9RB 2PYOA 5DNMA 1P3AB 4ZBJB 3MGRD 3REJB 2NQBC 5CP6D 1BH8B 3AZFB 3AV2A 5AV5D 3C1CD 3AZJA 2F8NG 2CV5A 5AV9C 3REHA 5JA4A 3B6GB 5B33A 4JJND 4KHAA 4WU8B 1AOIC 5F99D 1P3OB 5C3IC 3MNNB 5BO0B 3AFAB 5GSUA 2FJ7A 3AV1B 4ZUXC 4YS3D 1JFIB 5B40C 3WTPC 5CPKB 5G49A 5B2ID 1ID3A 3UT9D 3W96B 3LZ0D 3W99D 5GT0D 1KX5D 5GT3A 5JRGA 2F8NB 1P3MB 2YFWA 3O62B 3LJAB 3AZLB 4J8VD 5B0ZC 3NQJA 3REKC 5AV8C 5BT1C 3AZID 1ZLAA 5B0YA 5DNNA 2F8NH 1F66A 4E45A 4CSRB 5AY8B 2CV5B 5KDMA 3A6NC 1P3GB 2JSSA 4AWLB 2HIOB 3MVDB 3W97B 4R8PA 3W98A 3WAAA 1TZYA 3REIA 3X1UB 3AZGA 4QLCB 5GXQA 3RELA 1P3AC 4H9OB 1M18A 5E5AB 3REJC 3AZEA 1P3FB 4J8WA 4G91B 5B31G 4LD9A 1WWIA 3AZFC 5CPJB 2NZDA 4YM6B 3B6GC 2NQBD 1M1AA 3UTBA 4G92B 5B24A 4WU8C 3WA9B 3X1SB 1P3OC 5B2JB 5AV9D 3MNNC 3AFAC 4H9RA 3AV1C 1AOID 2BYMB 3VH6A 3AZKB 5CPKC 3AZMB 3W96C 3MGPC 1U35A 5B31B 4ZUXD 4J8UB 4H9QA 4CAYB 5B40D 3WTPD 4WV4B 1P3MC 3LJAC 3AZLC 5DNMB 2PYOB 2CWEA 3AN2A 1P3LA 3X1TA 5AVBA 3AZNA 1H3OA 1HQ3A 3AV2B 5B0ZD 3AZJB 4M6BA 3REKD 3REHB 3NQUA 5JA4B 4H9SC 5AY8C 5BT1D 5B33B 5AV8D 4KHAB 1P3GC 5AVCA 4AWLC 2HIOC 5BS7C 3W97C 3LELA 5GSUB 3A6ND 2FJ7B 2IO5B 3X1UC 4QLCC 5G49B 5E5AC 1P3FC 1ID3B 1F1EA 5GT3B 4XUJA 1P3AD 5CPJC 5JRGB 3REJD 4WU9A 2YFWB 4YM6C 4WNNA 4X23A 3NQJB 4G92C 1P34A 3AZFD 1ZLAB 3MGQA 3WA9C 5B0YB 5DNNB 5B2JC 3B6GD 1F66B 3AYWA 4WU8D 2L5AA 1P3BA 5AV6A 5KDMB 3AZKC 1P3OD 3AZMC 3MNND 3AFAD 3KXBA 3AV1D 4H9NA 5B31C 4R8PB 3W98B 5CPKD 3WAAB 3W96D 3MGPD 1TZYB 3REIB 3AZGB 2PYOC 5DNMC 5GXQB 3RELB 4Z2MH 1M18B 3AZEB 5BNVA 2BYMA 4J8WB 5B1LA 2F8ND 1P3MD 3LJAD 3AZLD 1N1JA 4LD9B 5F99A 3AV2C 1KX4A 2NZDB 3REHC 5B33C 5CHLB 1M1AB 3UTBB 5B24B 3KUYA 5B2IA 3UT9A 4H9RB 5AY8D 5GSUC 2FJ7C 3W99A 1Q9CA 1P3GD 2HIOD 3W97D 5FUGA 1U35B 5CPIA 3VH5A 1ID3C 4H9QB 5GT3C 3X1UD 4QLCD 5E5AD 5JRGC 1P3FD 1P3PA 1HTAA 3B6FA 2BYKA 4HGAB 3AN2B 4J8XA 1P3LB 3X1TB 4H9PA 5CPJD 5AVBB 5B0YC 5DNNC 4YM6D 3AZNB 1H3OB 1HQ3B 1F66C 3NQUB 3WA9D 5B2JD 4DRBA 1B67A 5AVCB 5B32A 1EQZA 4R8PC 3LELB 3W98C 3AZKD 3WAAC 3AZMD 1TZYC 3REIC 3AZGC 5GXQC 3RELC 5B31D 1M18C 3AZEC 3R45A 4J8WC 2PYOD 4XUJB 5DNMD 3B0BA 4LD9C 2AROA 3TU4A 2NZDC 4WU9B 4WNNB 4X23B 1M1AC 3VH5W 1P34B 5B24C 3AV2D 4ZBJC 3MGQB 3REHD 5B33D 3AYWB 1P3BB 5AV6B 4Z5TA 4Z66A 3WKJA 1U35C 5GSUD 3KXBB 2FJ7D 4KGCA 4H9NB 3KWQA 1P3IA 1ID3D 4HGAC 3AN2C 4EO5B 5BNVB 5GT3D 1P3LC 3LZ1A 5B1LB 3X1TC 5AVBC 5JRGD 1N1JB 1HQ3C 5F99B 3C1BA 1KX4B 3UTAA 5B0YD 5DNND 3O62C 3B0CT 5AVCC 1F66D 3KUYB 3MGSA 5B2IB 3UT9B 3X1VA 3W99B 4XZQA 1S32A 5FUGB 4R8PD 5CPIB 4KUDA 3W98D 3WAAD 1TZYD 1BH9A 3REID 3AZGD 1A7WA 5GXQD 4UUZA 3RELD 1M18D 1P3PB 3MVDC 3AZED 4WU9C 4J8WD 3B6FB 4DRAA 2BYKB 3AZHA 2F8NK 4X23C 4J8XB 1KX3A 1P34C 4LD9D 4H9PB 2NZDD 3MGQC 4Z2MG 1M1AD 4G91C 3AYWC 5B24D 1P3BC 5AV6C 3VH6W 5B32B 3KXBC 5B1MA 1EQZB 3X1SC 1U35D 1P3KA 4EO5C 3R45B 5B1LC 1M19A 4NE5A 2AROB 3MGRA 3TU4B 3AN2D 1KX4C 4J8UC 3X1TD 1P3LD 5AVBD 2YFVA 5CP6A 4NE3A 1HQ3D 2HUEB 5C3IB 3KUYC 5AV5A 3C1CA 2LY8A 4JJNA 3O62D 5AVCD 4Z5TB 4Z66B 3AZJC 3WKJB 2CV5C 5CPIC 4KGCB 3KWQB 4YS3A 1P3IB 1P3PC 4NFTA 3B6FC 3LZ0A
chains in the Genus database with same CATH superfamily
2IO5C 5GT0A 1KX5A 4J8XC 3LZ1B 3MVDD 4WU9D 4DQYB 3KSYA 5BNXA 4X23D 3C1BB 4J8VA 3A1IA 3UTAB 1P34D 1TAFA 3MGQD 3AZIA 3WTPE 5B32C 3AYWD 3MGSB 1P3BD 5AV6D 3X1VB 1EQZC 1ZLAC 4XZQB 1S32B 3KXBD 4KUDB 3X1SD 1BH9B 4UUZB 3AL0C 2AROC 2Y2MA 3TU4C 5B1LD 3AZHB 1KX3B 2HUEC 1KX4D 4J8UD 2NQBA 4Z5TC 4Z66C 3KUYD 3MGPB 1Z2CB 5AV9A 3WKJC 5B1MB 4KGCC 1AOIA 3UTBC 3KWQC 3AZJD 1P3IC 2CV5D 5CPID 1B6WA 1P3KB 4ZUXA 3LZ1C 5B40A 3WTPA 1M19B 1P3PD 1BFMA 3KFUG 3B6FD 3MGRB 3C1BC 4J8XD 3UTAC 1KU5A 2YFVB 5CP6B 3VH5T 5B0ZA 5AV5B 3MGSC 3C1CB 3REKA 3X1VC 5AV8A 4JJNB 4XZQC 3AZNC 4E44A 5B32D 1S32C 1EQZD 4KUDC 2RVQC 3A6NA 1ZLAD 3EPKA 4YS3B 2Y2NA 3LELC 3LZ0B 3H0MC 3AZHC 5GT0B 3V9RA 1KX5B 1KX3C 3B0CW 1P3AA 2AROD 3TU4D 3EG5B 3REJA 5BNXB 5B32G 4J8VB 1BH8A 3B0DB 4XUJC 1TAFB 3AZFA 3AZIB 3B6GA 1WWSA 5B1MC 4WU8A 4Z5TD 4Z66D 1P3OA 2DQNC 3WKJD 3MNNA 5BO0A 3AFAA 4KGCD 3AV1A 1P3KC 3UTBD 3KWQD 1JFIA 5CPKA 1P3ID 1M19C 3W96A 3MGPA 3MGRC 3LZ1D 1ULYA 2G5IC 5CP6C 2JE5A 1P3MA 3O62A 3LJAA 3AZLA 2F8NA 3C1BD 4UPKA 3UTAD 5AV5C 3C1CC 2Y2GA 2NQBB 4JJNC 5F99C 3MGSD 5AV9B 3X1VD 4H9SA 5AY8A 3VH6T 4CSRA 4XZQD 3AZND 1P3GA 1AOIB 1S32D 4YS3C 2HIOA 5BS7A 3MVDA 4KUDD 3W97A 5B2IC 3UT9C 2RVQD 1R4VA 3LZ0C 3W99C 5GT0C 4ZUXB 4NE6A 1KX5C 3X1UA 5B40B 3WTPB 4QLCA 4H9OA 2ZY3A 2BG1A 5E5AA 1P3FA 3LELD 3AZHD 4J8VC 1KX3D 3B0DC 5CPJA 3AZIC 3F6TA 4YM6A 5B0ZB 3REKB 4XUJD 5AV8B 3WA9A 3X1SA 5B2JA 5B1MD 4WZSB 3A6NB 3AZKA 3AZMA 1PZRA 1P3KD 5B31A 4J8UA 4CAYA 1M19D 3V9RB 2PYOA 5DNMA 1P3AB 4ZBJB 3MGRD 3REJB 2NQBC 5CP6D 1BH8B 3AZFB 3AV2A 5AV5D 3C1CD 3AZJA 2F8NG 2CV5A 5AV9C 3REHA 2J8PA 5JA4A 3B6GB 5B33A 4JJND 4KHAA 4WU8B 1AOIC 5F99D 1P3OB 5C3IC 3MNNB 5BO0B 3AFAB 5GSUA 2FJ7A 3AV1B 3H0LC 4ZUXC 4YS3D 1JFIB 5B40C 3WTPC 5CPKB 3IP4C 5G49A 5B2ID 3UT9D 1ID3A 2VQRA 3W96B 3LZ0D 3W99D 5GT0D 1KX5D 5GT3A 2Y2JA 5JRGA 2F8NB 1P3MB 2YFWA 3O62B 3LJAB 3AZLB 4J8VD 5B0ZC 3NQJA 1W2EA 3REKC 5AV8C 5BT1C 3AZID 1ZLAA 5B0YA 5DNNA 2F8NH 4WJ3C 1F66A 3A1KA 4E45A 4CSRB 5AY8B 2CV5B 5KDMA 3A6NC 1P3GB 2JSSA 4AWLB 2HIOB 3MVDB 3W97B 4R8PA 3W98A 3EPJA 3WAAA 2ZY2A 1TZYA 3REIA 3X1UB 3AZGA 4QLCB 5GXQA 3RELA 1P3AC 4H9OB 1M18A 5E5AB 3REJC 3AZEA 2ZY5A 4J8WA 1P3FB 4G91B 5B31G 4LD9A 1WWIA 3AZFC 5CPJB 2NZDA 4YM6B 3B6GC 2NQBD 1M1AA 2Y2QA 3UTBA 4G92B 5B24A 4WU8C 3EPHA 3WA9B 3X1SB 1P3OC 5B2JB 5AV9D 3MNNC 3AFAC 4H9RA 3AV1C 1AOID 2BYMB 3VH6A 3AZKB 5CPKC 3AZMB 3W96C 3MGPC 1U35A 5B31B 4ZUXD 4J8UB 4H9QA 4CAYB 5B40D 3WTPD 4WV4B 1P3MC 3LJAC 3AZLC 5DNMB 2PYOB 2CWEA 3AN2A 1P3LA 3X1TA 5AVBA 3AZNA 1H3OA 1HQ3A 1T3UA 5B0ZD 3AV2B 3AZJB 4M6BA 3REKD 2UWXA 3NQUA 5JA4B 4H9SC 5AY8C 5BT1D 5B33B 5AV8D 3REHB 4KHAB 1P3GC 5AVCA 4AWLC 2HIOC 5BS7C 3W97C 3LELA 5GSUB 2Y2IA 3A6ND 2FJ7B 2IO5B 2FFFB 3X1UC 4QLCC 2F2AC 2Y2HA 5G49B 5E5AC 1P3FC 1ID3B 1F1EA 5GT3B 4XUJA 1P3AD 5CPJC 5JRGB 3REJD 4WU9A 2YFWB 4YM6C 4WNNA 4X23A 3NQJB 4G92C 1P34A 3AZFD 1ZLAB 3MGQA 3WA9C 5B0YB 5DNNB 2Y2OA 5B2JC 3B6GD 1F66B 3AYWA 4WU8D 2L5AA 1P3BA 5AV6A 2W8SA 5KDMB 3AZKC 3EPLA 1P3OD 3AZMC 3MNND 3AFAD 3KXBA 3AV1D 4H9NA 5B31C 4R8PB 3W98B 5CPKD 3WAAB 3W96D 3MGPD 1TZYB 3REIB 3AZGB 2PYOC 5DNMC 5GXQB 3RELB 2DF4C 4Z2MH 1M18B 3AZEB 5BNVA 2BYMA 4J8WB 5B1LA 2F8ND 1P3MD 3LJAD 2Y2LA 3AZLD 1N1JA 4LD9B 5F99A 3AV2C 1KX4A 2NZDB 2ZY4A 3REHC 5B33C 5CHLB 1M1AB 3UTBB 5B24B 3KUYA 5B2IA 3UT9A 4H9RB 5AY8D 5GSUC 2FJ7C 3W99A 1Q9CA 1P3GD 2HIOD 3W97D 5FUGA 1U35B 5CPIA 3VH5A 1ID3C 4H9QB 5GT3C 3X1UD 4QLCD 5E5AD 5JRGC 1P3FD 1P3PA 1HTAA 3B6FA 2BYKA 4HGAB 3AN2B 4J8XA 1P3LB 3X1TB 4H9PA 5CPJD 5AVBB 5B0YC 5DNNC 4YM6D 3AZNB 1H3OB 1HQ3B 1F66C 3NQUB 3WA9D 5B2JD 4DRBA 1B67A 5AVCB 5B32A 2ZM5A 2G5HC 1EQZA 4R8PC 3LELB 3W98C 3AZKD 3WAAC 3AZMD 1TZYC 3REIC 3AZGC 5GXQC 3RELC 5B31D 1M18C 3AZEC 3R45A 4J8WC 2PYOD 4XUJB 5DNMD 3B0BA 4LD9C 2AROA 3TU4A 2NZDC 4WU9B 3H0RC 4WNNB 4X23B 1M1AC 3VH5W 1P34B 5B24C 3AV2D 4ZBJC 3MGQB 3REHD 5B33D 3AYWB 1P3BB 5AV6B 4Z5TA 4Z66A 3WKJA 1U35C 5GSUD 3KXBB 2FJ7D 4KGCA 4H9NB 3KWQA 1P3IA 1ID3D 4HGAC 3AN2C 4EO5B 5BNVB 2Y2KA 5GT3D 3LZ1A 5B1LB 3X1TC 1P3LC 5AVBC 5JRGD 1N1JB 1HQ3C 5F99B 3C1BA 1KX4B 3UTAA 5B0YD 5DNND 3O62C 3B0CT 5AVCC 1F66D 3KUYB 3MGSA 5B2IB 3UT9B 3X1VA 3W99B 4XZQA 1S32A 5FUGB 4R8PD 5CPIB 4KUDA 3W98D 3WAAD 2XD1A 1TZYD 1BH9A 3REID 3AZGD 1A7WA 5GXQD 4UUZA 3RELD 1M18D 1P3PB 3MVDC 3AZED 4WU9C 4J8WD 3B6FB 4DRAA 2BYKB 3AZHA 3FDDA 2F8NK 4X23C 4J8XB 1KX3A 1P34C 4LD9D 4H9PB 2NZDD 3MGQC 2JCHA 4Z2MG 1M1AD 4G91C 3AYWC 5B24D 1P3BC 5AV6C 3VH6W 5B32B 3KXBC 5B1MA 1EQZB 3X1SC 1U35D 3P5JB 1P3KA 4EO5C 3R45B 5B1LC 1M19A 4NE5A 2AROB 3MGRA 3TU4B 3AN2D 1KX4C 4J8UC 3X1TD 1P3LD 2RIQA 5AVBD 2YFVA 5CP6A 2Y2PA 4NE3A 1HQ3D 2HUEB 5C3IB 3KUYC 5AV5A 3C1CA 2LY8A 4JJNA 3O62D 5AVCD 4Z5TB 4Z66B 3AZJC 3WKJB 2CV5C 5CPIC 4KGCB 3KWQB 4YS3A 2XD5A 1P3IB 1P3PC 4NFTA 3B6FC 3LZ0A
chains in the Genus database with same CATH topology
2IO5C 5GT0A 1KX5A 4J8XC 3LZ1B 3MVDD 4WU9D 4DQYB 3KSYA 5BNXA 4X23D 3C1BB 4J8VA 3A1IA 3UTAB 1P34D 1TAFA 3MGQD 3AZIA 3WTPE 5B32C 3AYWD 3MGSB 1P3BD 5AV6D 3X1VB 1EQZC 1ZLAC 4XZQB 1S32B 3KXBD 4KUDB 3X1SD 1BH9B 4UUZB 3AL0C 2AROC 2Y2MA 3TU4C 5B1LD 3AZHB 1KX3B 2HUEC 1KX4D 4J8UD 2NQBA 4Z5TC 4Z66C 3KUYD 3MGPB 1Z2CB 5AV9A 3WKJC 5B1MB 4KGCC 1AOIA 3UTBC 3KWQC 3AZJD 1P3IC 2CV5D 5CPID 1B6WA 1P3KB 4ZUXA 3LZ1C 5B40A 3WTPA 1M19B 1P3PD 1BFMA 3KFUG 3B6FD 3MGRB 3C1BC 4J8XD 3UTAC 1KU5A 2YFVB 5CP6B 3VH5T 5B0ZA 5AV5B 3MGSC 3C1CB 3REKA 3X1VC 5AV8A 4JJNB 4XZQC 3AZNC 4E44A 5B32D 1S32C 1EQZD 4KUDC 2RVQC 3A6NA 1ZLAD 3EPKA 4YS3B 2Y2NA 3LELC 3LZ0B 3H0MC 3AZHC 5GT0B 3V9RA 1KX5B 1KX3C 3B0CW 1P3AA 2AROD 3TU4D 3EG5B 3REJA 5BNXB 5B32G 4J8VB 1BH8A 3B0DB 4XUJC 1TAFB 3AZFA 3AZIB 3B6GA 1WWSA 5B1MC 4WU8A 4Z5TD 4Z66D 1P3OA 2DQNC 3WKJD 3MNNA 5BO0A 3AFAA 4KGCD 3AV1A 1P3KC 3UTBD 3KWQD 1JFIA 5CPKA 1P3ID 1M19C 3W96A 3MGPA 3MGRC 3LZ1D 1ULYA 2G5IC 5CP6C 2JE5A 1P3MA 3O62A 3LJAA 3AZLA 2F8NA 3C1BD 4UPKA 3UTAD 5AV5C 3C1CC 2Y2GA 2NQBB 4JJNC 5F99C 3MGSD 5AV9B 3X1VD 4H9SA 5AY8A 3VH6T 4CSRA 4XZQD 3AZND 1P3GA 1AOIB 1S32D 4YS3C 2HIOA 5BS7A 3MVDA 4KUDD 3W97A 5B2IC 3UT9C 2RVQD 1R4VA 3LZ0C 3W99C 5GT0C 4ZUXB 4NE6A 1KX5C 3X1UA 5B40B 3WTPB 4QLCA 4H9OA 2ZY3A 2BG1A 5E5AA 1P3FA 3LELD 3AZHD 4J8VC 1KX3D 3B0DC 5CPJA 3AZIC 3F6TA 4YM6A 5B0ZB 3REKB 4XUJD 5AV8B 3WA9A 3X1SA 5B2JA 5B1MD 4WZSB 3A6NB 3AZKA 3AZMA 1PZRA 1P3KD 5B31A 4J8UA 4CAYA 1M19D 3V9RB 2PYOA 5DNMA 1P3AB 4ZBJB 3MGRD 3REJB 2NQBC 5CP6D 1BH8B 3AZFB 3AV2A 5AV5D 3C1CD 3AZJA 2F8NG 2CV5A 5AV9C 3REHA 2J8PA 5JA4A 3B6GB 5B33A 4JJND 4KHAA 4WU8B 1AOIC 5F99D 1P3OB 5C3IC 3MNNB 5BO0B 3AFAB 5GSUA 2FJ7A 3AV1B 3H0LC 4ZUXC 4YS3D 1JFIB 5B40C 3WTPC 5CPKB 3IP4C 5G49A 5B2ID 3UT9D 1ID3A 2VQRA 3W96B 3LZ0D 3W99D 5GT0D 1KX5D 5GT3A 2Y2JA 5JRGA 2F8NB 1P3MB 2YFWA 3O62B 3LJAB 3AZLB 4J8VD 5B0ZC 3NQJA 1W2EA 3REKC 5AV8C 5BT1C 3AZID 1ZLAA 5B0YA 5DNNA 2F8NH 4WJ3C 1F66A 3A1KA 4E45A 4CSRB 5AY8B 2CV5B 5KDMA 3A6NC 1P3GB 2JSSA 4AWLB 2HIOB 3MVDB 3W97B 4R8PA 3W98A 3EPJA 3WAAA 2ZY2A 1TZYA 3REIA 3X1UB 3AZGA 4QLCB 5GXQA 3RELA 1P3AC 4H9OB 1M18A 5E5AB 3REJC 3AZEA 2ZY5A 4J8WA 1P3FB 4G91B 5B31G 4LD9A 1WWIA 3AZFC 5CPJB 2NZDA 4YM6B 3B6GC 2NQBD 1M1AA 2Y2QA 3UTBA 4G92B 5B24A 4WU8C 3EPHA 3WA9B 3X1SB 1P3OC 5B2JB 5AV9D 3MNNC 3AFAC 4H9RA 3AV1C 1AOID 2BYMB 3VH6A 3AZKB 5CPKC 3AZMB 3W96C 3MGPC 1U35A 5B31B 4ZUXD 4J8UB 4H9QA 4CAYB 5B40D 3WTPD 4WV4B 1P3MC 3LJAC 3AZLC 5DNMB 2PYOB 2CWEA 3AN2A 1P3LA 3X1TA 5AVBA 3AZNA 1H3OA 1HQ3A 1T3UA 5B0ZD 3AV2B 3AZJB 4M6BA 3REKD 2UWXA 3NQUA 5JA4B 4H9SC 5AY8C 5BT1D 5B33B 5AV8D 3REHB 4KHAB 1P3GC 5AVCA 4AWLC 2HIOC 5BS7C 3W97C 3LELA 5GSUB 2Y2IA 3A6ND 2FJ7B 2IO5B 2FFFB 3X1UC 4QLCC 2F2AC 2Y2HA 5G49B 5E5AC 1P3FC 1ID3B 1F1EA 5GT3B 4XUJA 1P3AD 5CPJC 5JRGB 3REJD 4WU9A 2YFWB 4YM6C 4WNNA 4X23A 3NQJB 4G92C 1P34A 3AZFD 1ZLAB 3MGQA 3WA9C 5B0YB 5DNNB 2Y2OA 5B2JC 3B6GD 1F66B 3AYWA 4WU8D 2L5AA 1P3BA 5AV6A 2W8SA 5KDMB 3AZKC 3EPLA 1P3OD 3AZMC 3MNND 3AFAD 3KXBA 3AV1D 4H9NA 5B31C 4R8PB 3W98B 5CPKD 3WAAB 3W96D 3MGPD 1TZYB 3REIB 3AZGB 2PYOC 5DNMC 5GXQB 3RELB 2DF4C 4Z2MH 1M18B 3AZEB 5BNVA 2BYMA 4J8WB 5B1LA 2F8ND 1P3MD 3LJAD 2Y2LA 3AZLD 1N1JA 4LD9B 5F99A 3AV2C 1KX4A 2NZDB 2ZY4A 3REHC 5B33C 5CHLB 1M1AB 3UTBB 5B24B 3KUYA 5B2IA 3UT9A 4H9RB 5AY8D 5GSUC 2FJ7C 3W99A 1Q9CA 1P3GD 2HIOD 3W97D 5FUGA 1U35B 5CPIA 3VH5A 1ID3C 4H9QB 5GT3C 3X1UD 4QLCD 5E5AD 5JRGC 1P3FD 1P3PA 1HTAA 3B6FA 2BYKA 4HGAB 3AN2B 4J8XA 1P3LB 3X1TB 4H9PA 5CPJD 5AVBB 5B0YC 5DNNC 4YM6D 3AZNB 1H3OB 1HQ3B 1F66C 3NQUB 3WA9D 5B2JD 4DRBA 1B67A 5AVCB 5B32A 2ZM5A 2G5HC 1EQZA 4R8PC 3LELB 3W98C 3AZKD 3WAAC 3AZMD 1TZYC 3REIC 3AZGC 5GXQC 3RELC 5B31D 1M18C 3AZEC 3R45A 4J8WC 2PYOD 4XUJB 5DNMD 3B0BA 4LD9C 2AROA 3TU4A 2NZDC 4WU9B 3H0RC 4WNNB 4X23B 1M1AC 3VH5W 1P34B 5B24C 3AV2D 4ZBJC 3MGQB 3REHD 5B33D 3AYWB 1P3BB 5AV6B 4Z5TA 4Z66A 3WKJA 1U35C 5GSUD 3KXBB 2FJ7D 4KGCA 4H9NB 3KWQA 1P3IA 1ID3D 4HGAC 3AN2C 4EO5B 5BNVB 2Y2KA 5GT3D 3LZ1A 5B1LB 3X1TC 1P3LC 5AVBC 5JRGD 1N1JB 1HQ3C 5F99B 3C1BA 1KX4B 3UTAA 5B0YD 5DNND 3O62C 3B0CT 5AVCC 1F66D 3KUYB 3MGSA 5B2IB 3UT9B 3X1VA 3W99B 4XZQA 1S32A 5FUGB 4R8PD 5CPIB 4KUDA 3W98D 3WAAD 2XD1A 1TZYD 1BH9A 3REID 3AZGD 1A7WA 5GXQD 4UUZA 3RELD 1M18D 1P3PB 3MVDC 3AZED 4WU9C 4J8WD 3B6FB 4DRAA 2BYKB 3AZHA 3FDDA 2F8NK 4X23C 4J8XB 1KX3A 1P34C 4LD9D 4H9PB 2NZDD 3MGQC 2JCHA 4Z2MG 1M1AD 4G91C 3AYWC 5B24D 1P3BC 5AV6C 3VH6W 5B32B 3KXBC 5B1MA 1EQZB 3X1SC 1U35D 3P5JB 1P3KA 4EO5C 3R45B 5B1LC 1M19A 4NE5A 2AROB 3MGRA 3TU4B 3AN2D 1KX4C 4J8UC 3X1TD 1P3LD 2RIQA 5AVBD 2YFVA 5CP6A 2Y2PA 4NE3A 1HQ3D 2HUEB 5C3IB 3KUYC 5AV5A 3C1CA 2LY8A 4JJNA 3O62D 5AVCD 4Z5TB 4Z66B 3AZJC 3WKJB 2CV5C 5CPIC 4KGCB 3KWQB 4YS3A 2XD5A 1P3IB 1P3PC 4NFTA 3B6FC 3LZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO5 C;  5GT0 A;  1KX5 A;  4J8X C;  3LZ1 B;  3MVD D;  4WU9 D;  3KSY A;  5BNX A;  4X23 D;  3C1B B;  4J8V A;  3UTA B;  1P34 D;  1TAF A;  3MGQ D;  3AZI A;  3WTP E;  5B32 C;  3AYW D;  3MGS B;  1P3B D;  5AV6 D;  3X1V B;  1EQZ C;  1ZLA C;  4XZQ B;  1S32 B;  3KXB D;  4KUD B;  3X1S D;  1BH9 B;  4UUZ B;  2ARO C;  3TU4 C;  5B1L D;  3AZH B;  1KX3 B;  2HUE C;  1KX4 D;  4J8U D;  2NQB A;  4Z5T C;  4Z66 C;  3KUY D;  3MGP B;  5AV9 A;  3WKJ C;  5B1M B;  4KGC C;  1AOI A;  3UTB C;  3KWQ C;  3AZJ D;  1P3I C;  2CV5 D;  5CPI D;  1B6W A;  1P3K B;  4ZUX A;  3LZ1 C;  5B40 A;  3WTP A;  1M19 B;  1P3P D;  1BFM A;  3B6F D;  3MGR B;  3C1B C;  4J8X D;  3UTA C;  1KU5 A;  2YFV B;  5CP6 B;  3VH5 T;  5B0Z A;  5AV5 B;  3MGS C;  3C1C B;  3REK A;  3X1V C;  5AV8 A;  4JJN B;  4XZQ C;  3AZN C;  4E44 A;  5B32 D;  1S32 C;  1EQZ D;  4KUD C;  2RVQ C;  3A6N A;  1ZLA D;  4YS3 B;  3LEL C;  3LZ0 B;  3AZH C;  5GT0 B;  3V9R A;  1KX5 B;  1KX3 C;  3B0C W;  1P3A A;  2ARO D;  3TU4 D;  3REJ A;  5BNX B;  5B32 G;  4J8V B;  1BH8 A;  3B0D B;  4XUJ C;  1TAF B;  3AZF A;  3AZI B;  3B6G A;  1WWS A;  5B1M C;  4WU8 A;  4Z5T D;  4Z66 D;  1P3O A;  3WKJ D;  3MNN A;  5BO0 A;  3AFA A;  4KGC D;  3AV1 A;  1P3K C;  3UTB D;  3KWQ D;  1JFI A;  5CPK A;  1P3I D;  1M19 C;  3W96 A;  3MGP A;  3MGR C;  3LZ1 D;  1ULY A;  5CP6 C;  1P3M A;  2F8N A;  3O62 A;  3LJA A;  3AZL A;  3C1B D;  3UTA D;  5AV5 C;  3C1C C;  2NQB B;  4JJN C;  5F99 C;  3MGS D;  5AV9 B;  3X1V D;  4H9S A;  5AY8 A;  3VH6 T;  4CSR A;  4XZQ D;  3AZN D;  1P3G A;  1AOI B;  1S32 D;  4YS3 C;  2HIO A;  5BS7 A;  3MVD A;  4KUD D;  3W97 A;  5B2I C;  3UT9 C;  2RVQ D;  1R4V A;  3LZ0 C;  3W99 C;  5GT0 C;  4ZUX B;  4NE6 A;  1KX5 C;  3X1U A;  5B40 B;  3WTP B;  4QLC A;  4H9O A;  5E5A A;  1P3F A;  3LEL D;  3AZH D;  4J8V C;  1KX3 D;  3B0D C;  5CPJ A;  3AZI C;  4YM6 A;  5B0Z B;  3REK B;  4XUJ D;  5AV8 B;  3WA9 A;  3X1S A;  5B2J A;  5B1M D;  4WZS B;  3A6N B;  3AZK A;  3AZM A;  1P3K D;  5B31 A;  4J8U A;  4CAY A;  1M19 D;  3V9R B;  2PYO A;  5DNM A;  1P3A B;  4ZBJ B;  3MGR D;  3REJ B;  2NQB C;  5CP6 D;  1BH8 B;  3AZF B;  3AV2 A;  5AV5 D;  3C1C D;  3AZJ A;  2F8N G;  2CV5 A;  5AV9 C;  3REH A;  5JA4 A;  3B6G B;  5B33 A;  4JJN D;  4KHA A;  4WU8 B;  1AOI C;  5F99 D;  1P3O B;  5C3I C;  3MNN B;  5BO0 B;  3AFA B;  5GSU A;  2FJ7 A;  3AV1 B;  4ZUX C;  4YS3 D;  1JFI B;  5B40 C;  3WTP C;  5CPK B;  5G49 A;  5B2I D;  1ID3 A;  3UT9 D;  3W96 B;  3LZ0 D;  3W99 D;  5GT0 D;  1KX5 D;  5GT3 A;  5JRG A;  2F8N B;  1P3M B;  2YFW A;  3O62 B;  3LJA B;  3AZL B;  4J8V D;  5B0Z C;  3NQJ A;  3REK C;  5AV8 C;  5BT1 C;  3AZI D;  1ZLA A;  5B0Y A;  5DNN A;  2F8N H;  1F66 A;  4E45 A;  4CSR B;  5AY8 B;  2CV5 B;  5KDM A;  3A6N C;  1P3G B;  2JSS A;  4AWL B;  2HIO B;  3MVD B;  3W97 B;  4R8P A;  3W98 A;  3WAA A;  1TZY A;  3REI A;  3X1U B;  3AZG A;  4QLC B;  5GXQ A;  3REL A;  1P3A C;  4H9O B;  1M18 A;  5E5A B;  3REJ C;  3AZE A;  1P3F B;  4J8W A;  4G91 B;  5B31 G;  4LD9 A;  1WWI A;  3AZF C;  5CPJ B;  2NZD A;  4YM6 B;  3B6G C;  2NQB D;  1M1A A;  3UTB A;  4G92 B;  5B24 A;  4WU8 C;  3WA9 B;  3X1S B;  1P3O C;  5B2J B;  5AV9 D;  3MNN C;  3AFA C;  4H9R A;  3AV1 C;  1AOI D;  2BYM B;  3VH6 A;  3AZK B;  5CPK C;  3AZM B;  3W96 C;  3MGP C;  1U35 A;  5B31 B;  4ZUX D;  4J8U B;  4H9Q A;  4CAY B;  5B40 D;  3WTP D;  4WV4 B;  1P3M C;  3LJA C;  3AZL C;  5DNM B;  2PYO B;  2CWE A;  3AN2 A;  1P3L A;  3X1T A;  5AVB A;  3AZN A;  1H3O A;  1HQ3 A;  3AV2 B;  5B0Z D;  3AZJ B;  4M6B A;  3REK D;  3REH B;  3NQU A;  5JA4 B;  4H9S C;  5AY8 C;  5BT1 D;  5B33 B;  5AV8 D;  4KHA B;  1P3G C;  5AVC A;  4AWL C;  2HIO C;  5BS7 C;  3W97 C;  3LEL A;  5GSU B;  3A6N D;  2FJ7 B;  2IO5 B;  3X1U C;  4QLC C;  5G49 B;  5E5A C;  1P3F C;  1ID3 B;  1F1E A;  5GT3 B;  4XUJ A;  1P3A D;  5CPJ C;  5JRG B;  3REJ D;  4WU9 A;  2YFW B;  4YM6 C;  4WNN A;  4X23 A;  3NQJ B;  4G92 C;  1P34 A;  3AZF D;  1ZLA B;  3MGQ A;  3WA9 C;  5B0Y B;  5DNN B;  5B2J C;  3B6G D;  1F66 B;  3AYW A;  4WU8 D;  2L5A A;  1P3B A;  5AV6 A;  5KDM B;  3AZK C;  1P3O D;  3AZM C;  3MNN D;  3AFA D;  3KXB A;  3AV1 D;  4H9N A;  5B31 C;  4R8P B;  3W98 B;  5CPK D;  3WAA B;  3W96 D;  3MGP D;  1TZY B;  3REI B;  3AZG B;  2PYO C;  5DNM C;  5GXQ B;  3REL B;  4Z2M H;  1M18 B;  3AZE B;  5BNV A;  2BYM A;  4J8W B;  5B1L A;  2F8N D;  1P3M D;  3LJA D;  3AZL D;  1N1J A;  4LD9 B;  5F99 A;  3AV2 C;  1KX4 A;  2NZD B;  3REH C;  5B33 C;  5CHL B;  1M1A B;  3UTB B;  5B24 B;  3KUY A;  5B2I A;  3UT9 A;  4H9R B;  5AY8 D;  5GSU C;  2FJ7 C;  3W99 A;  1Q9C A;  1P3G D;  2HIO D;  3W97 D;  5FUG A;  1U35 B;  5CPI A;  3VH5 A;  1ID3 C;  4H9Q B;  5GT3 C;  3X1U D;  4QLC D;  5E5A D;  5JRG C;  1P3F D;  1P3P A;  1HTA A;  3B6F A;  2BYK A;  4HGA B;  3AN2 B;  4J8X A;  1P3L B;  3X1T B;  4H9P A;  5CPJ D;  5AVB B;  5B0Y C;  5DNN C;  4YM6 D;  3AZN B;  1H3O B;  1HQ3 B;  1F66 C;  3NQU B;  3WA9 D;  5B2J D;  4DRB A;  1B67 A;  5AVC B;  5B32 A;  1EQZ A;  4R8P C;  3LEL B;  3W98 C;  3AZK D;  3WAA C;  3AZM D;  1TZY C;  3REI C;  3AZG C;  5GXQ C;  3REL C;  5B31 D;  1M18 C;  3AZE C;  3R45 A;  4J8W C;  2PYO D;  4XUJ B;  5DNM D;  3B0B A;  4LD9 C;  2ARO A;  3TU4 A;  2NZD C;  4WU9 B;  4WNN B;  4X23 B;  1M1A C;  3VH5 W;  1P34 B;  5B24 C;  3AV2 D;  4ZBJ C;  3MGQ B;  3REH D;  5B33 D;  3AYW B;  1P3B B;  5AV6 B;  4Z5T A;  4Z66 A;  3WKJ A;  1U35 C;  5GSU D;  3KXB B;  2FJ7 D;  4KGC A;  4H9N B;  3KWQ A;  1P3I A;  1ID3 D;  4HGA C;  3AN2 C;  4EO5 B;  5BNV B;  5GT3 D;  1P3L C;  3LZ1 A;  5B1L B;  3X1T C;  5AVB C;  5JRG D;  1N1J B;  1HQ3 C;  5F99 B;  3C1B A;  1KX4 B;  3UTA A;  5B0Y D;  5DNN D;  3O62 C;  3B0C T;  5AVC C;  1F66 D;  3KUY B;  3MGS A;  5B2I B;  3UT9 B;  3X1V A;  3W99 B;  4XZQ A;  1S32 A;  5FUG B;  4R8P D;  5CPI B;  4KUD A;  3W98 D;  3WAA D;  1TZY D;  1BH9 A;  3REI D;  3AZG D;  1A7W A;  5GXQ D;  4UUZ A;  3REL D;  1M18 D;  1P3P B;  3MVD C;  3AZE D;  4WU9 C;  4J8W D;  3B6F B;  4DRA A;  2BYK B;  3AZH A;  2F8N K;  4X23 C;  4J8X B;  1KX3 A;  1P34 C;  4LD9 D;  4H9P B;  2NZD D;  3MGQ C;  4Z2M G;  1M1A D;  4G91 C;  3AYW C;  5B24 D;  1P3B C;  5AV6 C;  3VH6 W;  5B32 B;  3KXB C;  5B1M A;  1EQZ B;  3X1S C;  1U35 D;  1P3K A;  4EO5 C;  3R45 B;  5B1L C;  1M19 A;  4NE5 A;  2ARO B;  3MGR A;  3TU4 B;  3AN2 D;  1KX4 C;  4J8U C;  3X1T D;  1P3L D;  5AVB D;  2YFV A;  5CP6 A;  4NE3 A;  1HQ3 D;  2HUE B;  5C3I B;  3KUY C;  5AV5 A;  3C1C A;  2LY8 A;  4JJN A;  3O62 D;  5AVC D;  4Z5T B;  4Z66 B;  3AZJ C;  3WKJ B;  2CV5 C;  5CPI C;  4KGC B;  3KWQ B;  4YS3 A;  1P3I B;  1P3P C;  4NFT A;  3B6F C;  3LZ0 A; 
#chains in the Genus database with same CATH topology
 2IO5 C;  5GT0 A;  1KX5 A;  4J8X C;  3LZ1 B;  3MVD D;  4WU9 D;  4DQY B;  3KSY A;  5BNX A;  4X23 D;  3C1B B;  4J8V A;  3A1I A;  3UTA B;  1P34 D;  1TAF A;  3MGQ D;  3AZI A;  3WTP E;  5B32 C;  3AYW D;  3MGS B;  1P3B D;  5AV6 D;  3X1V B;  1EQZ C;  1ZLA C;  4XZQ B;  1S32 B;  3KXB D;  4KUD B;  3X1S D;  1BH9 B;  4UUZ B;  3AL0 C;  2ARO C;  2Y2M A;  3TU4 C;  5B1L D;  3AZH B;  1KX3 B;  2HUE C;  1KX4 D;  4J8U D;  2NQB A;  4Z5T C;  4Z66 C;  3KUY D;  3MGP B;  1Z2C B;  5AV9 A;  3WKJ C;  5B1M B;  4KGC C;  1AOI A;  3UTB C;  3KWQ C;  3AZJ D;  1P3I C;  2CV5 D;  5CPI D;  1B6W A;  1P3K B;  4ZUX A;  3LZ1 C;  5B40 A;  3WTP A;  1M19 B;  1P3P D;  1BFM A;  3KFU G;  3B6F D;  3MGR B;  3C1B C;  4J8X D;  3UTA C;  1KU5 A;  2YFV B;  5CP6 B;  3VH5 T;  5B0Z A;  5AV5 B;  3MGS C;  3C1C B;  3REK A;  3X1V C;  5AV8 A;  4JJN B;  4XZQ C;  3AZN C;  4E44 A;  5B32 D;  1S32 C;  1EQZ D;  4KUD C;  2RVQ C;  3A6N A;  1ZLA D;  3EPK A;  4YS3 B;  2Y2N A;  3LEL C;  3LZ0 B;  3H0M C;  3AZH C;  5GT0 B;  3V9R A;  1KX5 B;  1KX3 C;  3B0C W;  1P3A A;  2ARO D;  3TU4 D;  3EG5 B;  3REJ A;  5BNX B;  5B32 G;  4J8V B;  1BH8 A;  3B0D B;  4XUJ C;  1TAF B;  3AZF A;  3AZI B;  3B6G A;  1WWS A;  5B1M C;  4WU8 A;  4Z5T D;  4Z66 D;  1P3O A;  2DQN C;  3WKJ D;  3MNN A;  5BO0 A;  3AFA A;  4KGC D;  3AV1 A;  1P3K C;  3UTB D;  3KWQ D;  1JFI A;  5CPK A;  1P3I D;  1M19 C;  3W96 A;  3MGP A;  3MGR C;  3LZ1 D;  1ULY A;  2G5I C;  5CP6 C;  2JE5 A;  1P3M A;  3O62 A;  3LJA A;  3AZL A;  2F8N A;  3C1B D;  4UPK A;  3UTA D;  5AV5 C;  3C1C C;  2Y2G A;  2NQB B;  4JJN C;  5F99 C;  3MGS D;  5AV9 B;  3X1V D;  4H9S A;  5AY8 A;  3VH6 T;  4CSR A;  4XZQ D;  3AZN D;  1P3G A;  1AOI B;  1S32 D;  4YS3 C;  2HIO A;  5BS7 A;  3MVD A;  4KUD D;  3W97 A;  5B2I C;  3UT9 C;  2RVQ D;  1R4V A;  3LZ0 C;  3W99 C;  5GT0 C;  4ZUX B;  4NE6 A;  1KX5 C;  3X1U A;  5B40 B;  3WTP B;  4QLC A;  4H9O A;  2ZY3 A;  2BG1 A;  5E5A A;  1P3F A;  3LEL D;  3AZH D;  4J8V C;  1KX3 D;  3B0D C;  5CPJ A;  3AZI C;  3F6T A;  4YM6 A;  5B0Z B;  3REK B;  4XUJ D;  5AV8 B;  3WA9 A;  3X1S A;  5B2J A;  5B1M D;  4WZS B;  3A6N B;  3AZK A;  3AZM A;  1PZR A;  1P3K D;  5B31 A;  4J8U A;  4CAY A;  1M19 D;  3V9R B;  2PYO A;  5DNM A;  1P3A B;  4ZBJ B;  3MGR D;  3REJ B;  2NQB C;  5CP6 D;  1BH8 B;  3AZF B;  3AV2 A;  5AV5 D;  3C1C D;  3AZJ A;  2F8N G;  2CV5 A;  5AV9 C;  3REH A;  2J8P A;  5JA4 A;  3B6G B;  5B33 A;  4JJN D;  4KHA A;  4WU8 B;  1AOI C;  5F99 D;  1P3O B;  5C3I C;  3MNN B;  5BO0 B;  3AFA B;  5GSU A;  2FJ7 A;  3AV1 B;  3H0L C;  4ZUX C;  4YS3 D;  1JFI B;  5B40 C;  3WTP C;  5CPK B;  3IP4 C;  5G49 A;  5B2I D;  3UT9 D;  1ID3 A;  2VQR A;  3W96 B;  3LZ0 D;  3W99 D;  5GT0 D;  1KX5 D;  5GT3 A;  2Y2J A;  5JRG A;  2F8N B;  1P3M B;  2YFW A;  3O62 B;  3LJA B;  3AZL B;  4J8V D;  5B0Z C;  3NQJ A;  1W2E A;  3REK C;  5AV8 C;  5BT1 C;  3AZI D;  1ZLA A;  5B0Y A;  5DNN A;  2F8N H;  4WJ3 C;  1F66 A;  3A1K A;  4E45 A;  4CSR B;  5AY8 B;  2CV5 B;  5KDM A;  3A6N C;  1P3G B;  2JSS A;  4AWL B;  2HIO B;  3MVD B;  3W97 B;  4R8P A;  3W98 A;  3EPJ A;  3WAA A;  2ZY2 A;  1TZY A;  3REI A;  3X1U B;  3AZG A;  4QLC B;  5GXQ A;  3REL A;  1P3A C;  4H9O B;  1M18 A;  5E5A B;  3REJ C;  3AZE A;  2ZY5 A;  4J8W A;  1P3F B;  4G91 B;  5B31 G;  4LD9 A;  1WWI A;  3AZF C;  5CPJ B;  2NZD A;  4YM6 B;  3B6G C;  2NQB D;  1M1A A;  2Y2Q A;  3UTB A;  4G92 B;  5B24 A;  4WU8 C;  3EPH A;  3WA9 B;  3X1S B;  1P3O C;  5B2J B;  5AV9 D;  3MNN C;  3AFA C;  4H9R A;  3AV1 C;  1AOI D;  2BYM B;  3VH6 A;  3AZK B;  5CPK C;  3AZM B;  3W96 C;  3MGP C;  1U35 A;  5B31 B;  4ZUX D;  4J8U B;  4H9Q A;  4CAY B;  5B40 D;  3WTP D;  4WV4 B;  1P3M C;  3LJA C;  3AZL C;  5DNM B;  2PYO B;  2CWE A;  3AN2 A;  1P3L A;  3X1T A;  5AVB A;  3AZN A;  1H3O A;  1HQ3 A;  1T3U A;  5B0Z D;  3AV2 B;  3AZJ B;  4M6B A;  3REK D;  2UWX A;  3NQU A;  5JA4 B;  4H9S C;  5AY8 C;  5BT1 D;  5B33 B;  5AV8 D;  3REH B;  4KHA B;  1P3G C;  5AVC A;  4AWL C;  2HIO C;  5BS7 C;  3W97 C;  3LEL A;  5GSU B;  2Y2I A;  3A6N D;  2FJ7 B;  2IO5 B;  2FFF B;  3X1U C;  4QLC C;  2F2A C;  2Y2H A;  5G49 B;  5E5A C;  1P3F C;  1ID3 B;  1F1E A;  5GT3 B;  4XUJ A;  1P3A D;  5CPJ C;  5JRG B;  3REJ D;  4WU9 A;  2YFW B;  4YM6 C;  4WNN A;  4X23 A;  3NQJ B;  4G92 C;  1P34 A;  3AZF D;  1ZLA B;  3MGQ A;  3WA9 C;  5B0Y B;  5DNN B;  2Y2O A;  5B2J C;  3B6G D;  1F66 B;  3AYW A;  4WU8 D;  2L5A A;  1P3B A;  5AV6 A;  2W8S A;  5KDM B;  3AZK C;  3EPL A;  1P3O D;  3AZM C;  3MNN D;  3AFA D;  3KXB A;  3AV1 D;  4H9N A;  5B31 C;  4R8P B;  3W98 B;  5CPK D;  3WAA B;  3W96 D;  3MGP D;  1TZY B;  3REI B;  3AZG B;  2PYO C;  5DNM C;  5GXQ B;  3REL B;  2DF4 C;  4Z2M H;  1M18 B;  3AZE B;  5BNV A;  2BYM A;  4J8W B;  5B1L A;  2F8N D;  1P3M D;  3LJA D;  2Y2L A;  3AZL D;  1N1J A;  4LD9 B;  5F99 A;  3AV2 C;  1KX4 A;  2NZD B;  2ZY4 A;  3REH C;  5B33 C;  5CHL B;  1M1A B;  3UTB B;  5B24 B;  3KUY A;  5B2I A;  3UT9 A;  4H9R B;  5AY8 D;  5GSU C;  2FJ7 C;  3W99 A;  1Q9C A;  1P3G D;  2HIO D;  3W97 D;  5FUG A;  1U35 B;  5CPI A;  3VH5 A;  1ID3 C;  4H9Q B;  5GT3 C;  3X1U D;  4QLC D;  5E5A D;  5JRG C;  1P3F D;  1P3P A;  1HTA A;  3B6F A;  2BYK A;  4HGA B;  3AN2 B;  4J8X A;  1P3L B;  3X1T B;  4H9P A;  5CPJ D;  5AVB B;  5B0Y C;  5DNN C;  4YM6 D;  3AZN B;  1H3O B;  1HQ3 B;  1F66 C;  3NQU B;  3WA9 D;  5B2J D;  4DRB A;  1B67 A;  5AVC B;  5B32 A;  2ZM5 A;  2G5H C;  1EQZ A;  4R8P C;  3LEL B;  3W98 C;  3AZK D;  3WAA C;  3AZM D;  1TZY C;  3REI C;  3AZG C;  5GXQ C;  3REL C;  5B31 D;  1M18 C;  3AZE C;  3R45 A;  4J8W C;  2PYO D;  4XUJ B;  5DNM D;  3B0B A;  4LD9 C;  2ARO A;  3TU4 A;  2NZD C;  4WU9 B;  3H0R C;  4WNN B;  4X23 B;  1M1A C;  3VH5 W;  1P34 B;  5B24 C;  3AV2 D;  4ZBJ C;  3MGQ B;  3REH D;  5B33 D;  3AYW B;  1P3B B;  5AV6 B;  4Z5T A;  4Z66 A;  3WKJ A;  1U35 C;  5GSU D;  3KXB B;  2FJ7 D;  4KGC A;  4H9N B;  3KWQ A;  1P3I A;  1ID3 D;  4HGA C;  3AN2 C;  4EO5 B;  5BNV B;  2Y2K A;  5GT3 D;  3LZ1 A;  5B1L B;  3X1T C;  1P3L C;  5AVB C;  5JRG D;  1N1J B;  1HQ3 C;  5F99 B;  3C1B A;  1KX4 B;  3UTA A;  5B0Y D;  5DNN D;  3O62 C;  3B0C T;  5AVC C;  1F66 D;  3KUY B;  3MGS A;  5B2I B;  3UT9 B;  3X1V A;  3W99 B;  4XZQ A;  1S32 A;  5FUG B;  4R8P D;  5CPI B;  4KUD A;  3W98 D;  3WAA D;  2XD1 A;  1TZY D;  1BH9 A;  3REI D;  3AZG D;  1A7W A;  5GXQ D;  4UUZ A;  3REL D;  1M18 D;  1P3P B;  3MVD C;  3AZE D;  4WU9 C;  4J8W D;  3B6F B;  4DRA A;  2BYK B;  3AZH A;  3FDD A;  2F8N K;  4X23 C;  4J8X B;  1KX3 A;  1P34 C;  4LD9 D;  4H9P B;  2NZD D;  3MGQ C;  2JCH A;  4Z2M G;  1M1A D;  4G91 C;  3AYW C;  5B24 D;  1P3B C;  5AV6 C;  3VH6 W;  5B32 B;  3KXB C;  5B1M A;  1EQZ B;  3X1S C;  1U35 D;  3P5J B;  1P3K A;  4EO5 C;  3R45 B;  5B1L C;  1M19 A;  4NE5 A;  2ARO B;  3MGR A;  3TU4 B;  3AN2 D;  1KX4 C;  4J8U C;  3X1T D;  1P3L D;  2RIQ A;  5AVB D;  2YFV A;  5CP6 A;  2Y2P A;  4NE3 A;  1HQ3 D;  2HUE B;  5C3I B;  3KUY C;  5AV5 A;  3C1C A;  2LY8 A;  4JJN A;  3O62 D;  5AVC D;  4Z5T B;  4Z66 B;  3AZJ C;  3WKJ B;  2CV5 C;  5CPI C;  4KGC B;  3KWQ B;  4YS3 A;  2XD5 A;  1P3I B;  1P3P C;  4NFT A;  3B6F C;  3LZ0 A; 
#chains in the Genus database with same CATH homology
 2IO5 C;  5GT0 A;  1KX5 A;  4J8X C;  3LZ1 B;  3MVD D;  4WU9 D;  4DQY B;  3KSY A;  5BNX A;  4X23 D;  3C1B B;  4J8V A;  3A1I A;  3UTA B;  1P34 D;  1TAF A;  3MGQ D;  3AZI A;  3WTP E;  5B32 C;  3AYW D;  3MGS B;  1P3B D;  5AV6 D;  3X1V B;  1EQZ C;  1ZLA C;  4XZQ B;  1S32 B;  3KXB D;  4KUD B;  3X1S D;  1BH9 B;  4UUZ B;  3AL0 C;  2ARO C;  2Y2M A;  3TU4 C;  5B1L D;  3AZH B;  1KX3 B;  2HUE C;  1KX4 D;  4J8U D;  2NQB A;  4Z5T C;  4Z66 C;  3KUY D;  3MGP B;  1Z2C B;  5AV9 A;  3WKJ C;  5B1M B;  4KGC C;  1AOI A;  3UTB C;  3KWQ C;  3AZJ D;  1P3I C;  2CV5 D;  5CPI D;  1B6W A;  1P3K B;  4ZUX A;  3LZ1 C;  5B40 A;  3WTP A;  1M19 B;  1P3P D;  1BFM A;  3KFU G;  3B6F D;  3MGR B;  3C1B C;  4J8X D;  3UTA C;  1KU5 A;  2YFV B;  5CP6 B;  3VH5 T;  5B0Z A;  5AV5 B;  3MGS C;  3C1C B;  3REK A;  3X1V C;  5AV8 A;  4JJN B;  4XZQ C;  3AZN C;  4E44 A;  5B32 D;  1S32 C;  1EQZ D;  4KUD C;  2RVQ C;  3A6N A;  1ZLA D;  3EPK A;  4YS3 B;  2Y2N A;  3LEL C;  3LZ0 B;  3H0M C;  3AZH C;  5GT0 B;  3V9R A;  1KX5 B;  1KX3 C;  3B0C W;  1P3A A;  2ARO D;  3TU4 D;  3EG5 B;  3REJ A;  5BNX B;  5B32 G;  4J8V B;  1BH8 A;  3B0D B;  4XUJ C;  1TAF B;  3AZF A;  3AZI B;  3B6G A;  1WWS A;  5B1M C;  4WU8 A;  4Z5T D;  4Z66 D;  1P3O A;  2DQN C;  3WKJ D;  3MNN A;  5BO0 A;  3AFA A;  4KGC D;  3AV1 A;  1P3K C;  3UTB D;  3KWQ D;  1JFI A;  5CPK A;  1P3I D;  1M19 C;  3W96 A;  3MGP A;  3MGR C;  3LZ1 D;  1ULY A;  2G5I C;  5CP6 C;  2JE5 A;  1P3M A;  3O62 A;  3LJA A;  3AZL A;  2F8N A;  3C1B D;  4UPK A;  3UTA D;  5AV5 C;  3C1C C;  2Y2G A;  2NQB B;  4JJN C;  5F99 C;  3MGS D;  5AV9 B;  3X1V D;  4H9S A;  5AY8 A;  3VH6 T;  4CSR A;  4XZQ D;  3AZN D;  1P3G A;  1AOI B;  1S32 D;  4YS3 C;  2HIO A;  5BS7 A;  3MVD A;  4KUD D;  3W97 A;  5B2I C;  3UT9 C;  2RVQ D;  1R4V A;  3LZ0 C;  3W99 C;  5GT0 C;  4ZUX B;  4NE6 A;  1KX5 C;  3X1U A;  5B40 B;  3WTP B;  4QLC A;  4H9O A;  2ZY3 A;  2BG1 A;  5E5A A;  1P3F A;  3LEL D;  3AZH D;  4J8V C;  1KX3 D;  3B0D C;  5CPJ A;  3AZI C;  3F6T A;  4YM6 A;  5B0Z B;  3REK B;  4XUJ D;  5AV8 B;  3WA9 A;  3X1S A;  5B2J A;  5B1M D;  4WZS B;  3A6N B;  3AZK A;  3AZM A;  1PZR A;  1P3K D;  5B31 A;  4J8U A;  4CAY A;  1M19 D;  3V9R B;  2PYO A;  5DNM A;  1P3A B;  4ZBJ B;  3MGR D;  3REJ B;  2NQB C;  5CP6 D;  1BH8 B;  3AZF B;  3AV2 A;  5AV5 D;  3C1C D;  3AZJ A;  2F8N G;  2CV5 A;  5AV9 C;  3REH A;  2J8P A;  5JA4 A;  3B6G B;  5B33 A;  4JJN D;  4KHA A;  4WU8 B;  1AOI C;  5F99 D;  1P3O B;  5C3I C;  3MNN B;  5BO0 B;  3AFA B;  5GSU A;  2FJ7 A;  3AV1 B;  3H0L C;  4ZUX C;  4YS3 D;  1JFI B;  5B40 C;  3WTP C;  5CPK B;  3IP4 C;  5G49 A;  5B2I D;  3UT9 D;  1ID3 A;  2VQR A;  3W96 B;  3LZ0 D;  3W99 D;  5GT0 D;  1KX5 D;  5GT3 A;  2Y2J A;  5JRG A;  2F8N B;  1P3M B;  2YFW A;  3O62 B;  3LJA B;  3AZL B;  4J8V D;  5B0Z C;  3NQJ A;  1W2E A;  3REK C;  5AV8 C;  5BT1 C;  3AZI D;  1ZLA A;  5B0Y A;  5DNN A;  2F8N H;  4WJ3 C;  1F66 A;  3A1K A;  4E45 A;  4CSR B;  5AY8 B;  2CV5 B;  5KDM A;  3A6N C;  1P3G B;  2JSS A;  4AWL B;  2HIO B;  3MVD B;  3W97 B;  4R8P A;  3W98 A;  3EPJ A;  3WAA A;  2ZY2 A;  1TZY A;  3REI A;  3X1U B;  3AZG A;  4QLC B;  5GXQ A;  3REL A;  1P3A C;  4H9O B;  1M18 A;  5E5A B;  3REJ C;  3AZE A;  2ZY5 A;  4J8W A;  1P3F B;  4G91 B;  5B31 G;  4LD9 A;  1WWI A;  3AZF C;  5CPJ B;  2NZD A;  4YM6 B;  3B6G C;  2NQB D;  1M1A A;  2Y2Q A;  3UTB A;  4G92 B;  5B24 A;  4WU8 C;  3EPH A;  3WA9 B;  3X1S B;  1P3O C;  5B2J B;  5AV9 D;  3MNN C;  3AFA C;  4H9R A;  3AV1 C;  1AOI D;  2BYM B;  3VH6 A;  3AZK B;  5CPK C;  3AZM B;  3W96 C;  3MGP C;  1U35 A;  5B31 B;  4ZUX D;  4J8U B;  4H9Q A;  4CAY B;  5B40 D;  3WTP D;  4WV4 B;  1P3M C;  3LJA C;  3AZL C;  5DNM B;  2PYO B;  2CWE A;  3AN2 A;  1P3L A;  3X1T A;  5AVB A;  3AZN A;  1H3O A;  1HQ3 A;  1T3U A;  5B0Z D;  3AV2 B;  3AZJ B;  4M6B A;  3REK D;  2UWX A;  3NQU A;  5JA4 B;  4H9S C;  5AY8 C;  5BT1 D;  5B33 B;  5AV8 D;  3REH B;  4KHA B;  1P3G C;  5AVC A;  4AWL C;  2HIO C;  5BS7 C;  3W97 C;  3LEL A;  5GSU B;  2Y2I A;  3A6N D;  2FJ7 B;  2IO5 B;  2FFF B;  3X1U C;  4QLC C;  2F2A C;  2Y2H A;  5G49 B;  5E5A C;  1P3F C;  1ID3 B;  1F1E A;  5GT3 B;  4XUJ A;  1P3A D;  5CPJ C;  5JRG B;  3REJ D;  4WU9 A;  2YFW B;  4YM6 C;  4WNN A;  4X23 A;  3NQJ B;  4G92 C;  1P34 A;  3AZF D;  1ZLA B;  3MGQ A;  3WA9 C;  5B0Y B;  5DNN B;  2Y2O A;  5B2J C;  3B6G D;  1F66 B;  3AYW A;  4WU8 D;  2L5A A;  1P3B A;  5AV6 A;  2W8S A;  5KDM B;  3AZK C;  3EPL A;  1P3O D;  3AZM C;  3MNN D;  3AFA D;  3KXB A;  3AV1 D;  4H9N A;  5B31 C;  4R8P B;  3W98 B;  5CPK D;  3WAA B;  3W96 D;  3MGP D;  1TZY B;  3REI B;  3AZG B;  2PYO C;  5DNM C;  5GXQ B;  3REL B;  2DF4 C;  4Z2M H;  1M18 B;  3AZE B;  5BNV A;  2BYM A;  4J8W B;  5B1L A;  2F8N D;  1P3M D;  3LJA D;  2Y2L A;  3AZL D;  1N1J A;  4LD9 B;  5F99 A;  3AV2 C;  1KX4 A;  2NZD B;  2ZY4 A;  3REH C;  5B33 C;  5CHL B;  1M1A B;  3UTB B;  5B24 B;  3KUY A;  5B2I A;  3UT9 A;  4H9R B;  5AY8 D;  5GSU C;  2FJ7 C;  3W99 A;  1Q9C A;  1P3G D;  2HIO D;  3W97 D;  5FUG A;  1U35 B;  5CPI A;  3VH5 A;  1ID3 C;  4H9Q B;  5GT3 C;  3X1U D;  4QLC D;  5E5A D;  5JRG C;  1P3F D;  1P3P A;  1HTA A;  3B6F A;  2BYK A;  4HGA B;  3AN2 B;  4J8X A;  1P3L B;  3X1T B;  4H9P A;  5CPJ D;  5AVB B;  5B0Y C;  5DNN C;  4YM6 D;  3AZN B;  1H3O B;  1HQ3 B;  1F66 C;  3NQU B;  3WA9 D;  5B2J D;  4DRB A;  1B67 A;  5AVC B;  5B32 A;  2ZM5 A;  2G5H C;  1EQZ A;  4R8P C;  3LEL B;  3W98 C;  3AZK D;  3WAA C;  3AZM D;  1TZY C;  3REI C;  3AZG C;  5GXQ C;  3REL C;  5B31 D;  1M18 C;  3AZE C;  3R45 A;  4J8W C;  2PYO D;  4XUJ B;  5DNM D;  3B0B A;  4LD9 C;  2ARO A;  3TU4 A;  2NZD C;  4WU9 B;  3H0R C;  4WNN B;  4X23 B;  1M1A C;  3VH5 W;  1P34 B;  5B24 C;  3AV2 D;  4ZBJ C;  3MGQ B;  3REH D;  5B33 D;  3AYW B;  1P3B B;  5AV6 B;  4Z5T A;  4Z66 A;  3WKJ A;  1U35 C;  5GSU D;  3KXB B;  2FJ7 D;  4KGC A;  4H9N B;  3KWQ A;  1P3I A;  1ID3 D;  4HGA C;  3AN2 C;  4EO5 B;  5BNV B;  2Y2K A;  5GT3 D;  3LZ1 A;  5B1L B;  3X1T C;  1P3L C;  5AVB C;  5JRG D;  1N1J B;  1HQ3 C;  5F99 B;  3C1B A;  1KX4 B;  3UTA A;  5B0Y D;  5DNN D;  3O62 C;  3B0C T;  5AVC C;  1F66 D;  3KUY B;  3MGS A;  5B2I B;  3UT9 B;  3X1V A;  3W99 B;  4XZQ A;  1S32 A;  5FUG B;  4R8P D;  5CPI B;  4KUD A;  3W98 D;  3WAA D;  2XD1 A;  1TZY D;  1BH9 A;  3REI D;  3AZG D;  1A7W A;  5GXQ D;  4UUZ A;  3REL D;  1M18 D;  1P3P B;  3MVD C;  3AZE D;  4WU9 C;  4J8W D;  3B6F B;  4DRA A;  2BYK B;  3AZH A;  3FDD A;  2F8N K;  4X23 C;  4J8X B;  1KX3 A;  1P34 C;  4LD9 D;  4H9P B;  2NZD D;  3MGQ C;  2JCH A;  4Z2M G;  1M1A D;  4G91 C;  3AYW C;  5B24 D;  1P3B C;  5AV6 C;  3VH6 W;  5B32 B;  3KXB C;  5B1M A;  1EQZ B;  3X1S C;  1U35 D;  3P5J B;  1P3K A;  4EO5 C;  3R45 B;  5B1L C;  1M19 A;  4NE5 A;  2ARO B;  3MGR A;  3TU4 B;  3AN2 D;  1KX4 C;  4J8U C;  3X1T D;  1P3L D;  2RIQ A;  5AVB D;  2YFV A;  5CP6 A;  2Y2P A;  4NE3 A;  1HQ3 D;  2HUE B;  5C3I B;  3KUY C;  5AV5 A;  3C1C A;  2LY8 A;  4JJN A;  3O62 D;  5AVC D;  4Z5T B;  4Z66 B;  3AZJ C;  3WKJ B;  2CV5 C;  5CPI C;  4KGC B;  3KWQ B;  4YS3 A;  2XD5 A;  1P3I B;  1P3P C;  4NFT A;  3B6F C;  3LZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...