3W96C

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96C00
1EQZD 4G92C 4X23A 4KUDB 4R8PC 1TAFA 3B0DB 1P3LA 5FUGA 4LD9B 5B32A 3X1UC 2FJ7D 3KUYA 5B0ZB 1AOID 3MVDA 4WU8B 1M19C 3RELB 4Z66A 1P3OB 3AZND 2PYOC 4NE6A 5DNNA 3VH6A 5AV9A 1EQZB 3MNND 3AYWD 2F8NG 1P3MC 4H9OB 1M18B 4E45A 3MGRC 3X1TB 5CP6D 1M1AC 4YM6D 3W96D 4J8UA 5CPJC 3LZ1A 5JA4B 4LD9A 3WTPA 1S32A 5B1LB 5DNMA 1H3OB 3V9RB 5AVCC 3KWQC 4KGCD 4JJNA 4QLCC 4J8XC 3W97C 2F8ND 4WU8A 3MNNB 2CV5C 4CAYB 2F8NK 5B1MC 3UTBD 3AV2B 3A6NB 2NQBC 5F99B 1EQZA 1KX3D 3R45A 3NQUB 5CP6B 5CPKA 3W96B 2JSSA 4XZQD 3MGQB 3O62D 5CPIB 2FJ7A 5GT0C 3UTAC 3AZEB 1AOIA 5B2JD 3B6FB 5B2IA 4J8WD 3V9RA 3UTBB 3AZNA 5B40D 3AYWA 5BNXA 5BT1D 3AFAC 3VH6W 3B6GB 3AV1D 1P3FB 1P3GA 4XZQB 5B31C 3C1CC 3AZHA 2HIOC 3KSYA 3MGPD 1P3ID 2AROC 3NQJB 5B33A 4YM6A 4YS3C 5AV6A 5KDMB 5B2JB 3REHC 1P3PC 4J8WB 1P3AD 3TU4D 2CWEA 4KGCA 3AZMD 1HQ3A 5GSUA 2F8NA 4M6BA 3X1SD 1WWIA 4WNNA 3B0CW 5BNVB 4XUJA 4KUDC 3B0DC 5C3IB 4NE3A 1KX3A 4LD9C 4WZSB 1TZYD 3MGSA 3UT9A 4UUZA 2NZDB 5B0ZC 3O62A 3REJD 1P3AB 5JRGA 3X1VD 5AV5D 3TU4B 4WU8C 3RELC 3AZIB 1N1JB 2BYKA 1P3OC 3WA9A 5AY8B 3X1SB 4H9SA 3AZFA 5B40A 1M18C 1F1EA 4H9QB 5B32D 3KXBB 3X1TC 3AV1A 5GXQD 5BO0B 1P3KD 4CSRA 2BYMA 3MGPA 1P3IA 4H9NA 3LELA 5B1LC 4Z5TB 1KX4D 3MNNC 3AZMA 4X23B 3AV2C 3A6NC 1TAFB 5F99C 1P3LB 5FUGB 5B32B 2IO5B 4ZUXC 5CP6C 3W96C 3WAAA 3KUYB 3MVDB 1P3KB 3MGQC 1S32D 1TZYA 4Z66B 5CPIC 5DNMD 1P34A 3AZEC 5DNNB 4WU9C 3REJA 3B6FC 1BH9A 3X1VA 5AV5A 3WKJA 3UTBC 3AZLA 3W99D 5CPKD 3B6GC 5G49A 4J8UB 3LZ1B 1P3FC 1U35D 4XZQC 5E5AD 3WTPB 4KHAA 1S32B 5DNMB 5GXQA 4JJNB 1WWSA 1P3KA 5B2JC 1JFIA 5B2ID 4J8WC 3AZGA 1KX4A 4G91B 5BS7C 4J8VA 5BT1C 3R45B 5CPKB 1P3BD 5AVBD 1P3GD 5B24D 3AZHD 5C3IC 2FJ7B 5B33D 1AOIB 5AV6D 2NZDC 3B0BA 3C1BA 5B2IB 1P3AC 3TU4C 3AZNB 3AZIC 1ID3D 3W98A 1HQ3D 5GSUD 3AYWB 5AY8C 5BNXB 3X1SC 3REKA 4WV4B 1P3GB 3W99A 2RVQC 4XUJD 3AZHB 4YM6B 3KXBC 5B33B 1F66D 3MGSD 3UT9D 1U35A 5AV6B 5E5AA 5B0YA 3LZ0D 5JRGD 2HUEB 4KGCB 4Z5TC 5AV8A 1HQ3B 4HGAB 3AN2A 5GSUB 2F8NB 3WA9D 1ZLAD 3REIA 3LJAA 4EO5B 4WNNB 4Z2MH 4X23C 2LY8A 4XUJB 3AZFD 1P3LC 1KX3B 2L5AA 5B32C 1P3BA 2IO5C 3MGSB 5GT3A 3UT9B 5AVBA 4UUZB 5B24A 3KUYC 3MVDC 3O62B 1P3KC 5JRGB 4H9RA 3LELD 2BYKB 4Z66C 4R8PD 3AZJA 3WA9B 5DNNC 5AV9C 1BH8A 3WTPE 1ID3A 3AZFB 1ULYA 5B40B 2PYOD 3AV1B 3WAAD 4J8UC 3LZ1C 4CSRB 2BYMB 3MGPB 1BFMA 1P3IB 4H9NB 1F66A 3WTPC 3LELB 1S32C 5DNMC 1P3MD 1P34D 1KX5A 4JJNC 3LZ0A 5CPJD 3WKJD 3AZMB 3AZLD 4G91C 1ZLAA 5AVCD 1EQZC 4QLCD 5CPKC 3WAAB 3W97D 2CV5D 3AZKA 5B1MD 1TZYB 2NQBD 1P34B 2FJ7C 1AOIC 3REJB 1BH9B 3X1VB 5AV5B 5B2IC 3WKJB 4H9PA 4R8PA 3AZGD 3AZLB 3AZNC 5B31G 3X1UA 4DRBA 5AVCB 5GT0D 3AYWC 4J8VD 5G49B 1P3GC 1M19A 3AZHC 4KHAB 2PYOA 5GXQB 4YM6C 5B33C 4AWLB 5AV6C 1JFIB 3C1BD 1P3MA 2HUEC 3AZGB 5B31D 3C1CD 4KGCC 3MGRA 3W98D 1KX4B 2YFWA 1HQ3C 4HGAC 5GSUC 1M1AA 4J8VB 4YS3D 5CPJA 3REKD 4EO5C 1P3PD 4XUJC 5AVCA 1KX3C 4QLCA 4J8XA 3W97A 3MGSC 3UT9C 2CV5A 5B1MA 5B0YD 3O62C 3C1BB 5JRGC 2NQBA 3W98B 5AV8D 3AN2D 3WA9C 2F8NH 3REID 3LJAD 3REKB 3W99B 4H9SC 1A7WA 3AZFC 5B40C 5GT0A 3RELD 3UTAA 5GT3D 3AV1C 1U35B 3VH5T 5E5AB 5B0YB 3MGPC 1P3IC 3LELC 5AV8B 1M18D 3AFAA 3AZJD 1HTAA 3AN2B 3REIB 3X1TD 3LJAB 5B31A 3C1CA 5CHLB 3AZMC 2HIOA 1KU5A 2AROA 5B1LD 4YS3A 1P3BB 5GT3B 3REHA 5AVBB 3WAAC 1P3PA 5B24B 2YFVA 4E44A 3AV2D 4H9RB 1KX5D 1TZYC 3A6ND 1P34C 5F99D 3AZJB 4ZUXD 3REJC 1BH8B 3X1VC 5AV5C 3WKJC 4KUDA 1ID3B 3AZLC 3MGQD 5CPID 3AZED 5B0ZA 4WU9D 3B6FD 3AZKD 3RELA 1P3OA 4DRAA 1KX5B 1F66B 5GXQC 4AWLC 4ZUXB 3LZ0B 3B6GD 1P3FD 4H9OA 1M18A 3AZGC 1KX4C 1ZLAB 3X1UD 3X1TA 4J8VC 4WU9B 5JA4A 1M19D 4ZBJB 3AZKB 5B1LA 1H3OA 3MNNA 4CAYA 4G92B 3C1BC 4NE5A 3AV2A 3A6NA 4Z2MG 4R8PB 4H9PB 5F99A 3MGRD 3W98C 4ZUXA 3NQUA 5CP6A 3X1UB 1M1AD 3W96A 3REKC 2NZDD 4NFTA 3W99C 3MGQA 1M19B 3KWQD 5CPIA 3VH5A 3AZID 3AZEA 2PYOB 4J8XD 4WU9A 3B6FA 5AY8D 1U35C 3UTBA 5E5AC 5B0YC 3VH6T 1P3MB 2RVQD 3MGRB 5AV8C 2YFWB 3AN2C 3B6GA 1M1AB 3KXBD 3REIC 5CPJB 5B32G 3LJAC 1P3FA 4XZQA 3KWQB 3NQJA 3UTAD 4Z5TD 4QLCB 4J8XB 1P3BC 3W97B 5KDMA 5GT3C 5B2JA 5AVBC 2CV5B 5B24C 4J8WA 5B1MB 1B6WA 2NQBB 4X23D 5BS7A 3B0CT 1P3LD 3AFAD 3AZJC 1Q9CA 5BNVA 3KUYD 3MVDD 2HIOD 1ID3C 2AROD 5GT0B 3UTAB 4Z66D 2NZDA 3REHD 5DNND 5AV9D 1P3AA 3KWQA 3TU4A 3AZIA 1N1JA 1F66C 1KX5C 3VH5W 5AY8A 3AFAB 3X1SA 3LZ0C 4J8UD 5B31B 3C1CB 3LZ1D 4KUDD 1R4VA 2HIOB 4LD9D 4H9QA 2AROB 3WTPD 3KXBA 1ZLAC 4YS3B 1B67A 4JJND 5BO0A 3REHB 5B0ZD 5AV9B 1P3PB 2YFVB 4WU8D 4ZBJC 3AZKC 4Z5TA 1P3OD
chains in the Genus database with same CATH superfamily
2Y2MA 2RIQA 1EQZD 4G92C 4UPKA 4X23A 4KUDB 4R8PC 1TAFA 3B0DB 1P3LA 5FUGA 4LD9B 5B32A 3X1UC 2FJ7D 3KUYA 5B0ZB 1AOID 3MVDA 4WU8B 1M19C 1PZRA 3RELB 4Z66A 2Y2OA 3AZND 1P3OB 2PYOC 2DQNC 4NE6A 5DNNA 3VH6A 5AV9A 1EQZB 3MNND 3AYWD 3KFUG 2F8NG 1P3MC 4H9OB 1M18B 4E45A 3MGRC 2Y2PA 3X1TB 5CP6D 1M1AC 4YM6D 3W96D 4J8UA 2JE5A 5CPJC 3LZ1A 2Y2LA 5JA4B 2ZY5A 4LD9A 3WTPA 1S32A 5B1LB 5DNMA 1H3OB 3V9RB 5AVCC 3KWQC 4KGCD 4JJNA 4QLCC 4J8XC 3W97C 2F8ND 4WU8A 3MNNB 2CV5C 4CAYB 2F8NK 5B1MC 3UTBD 2F2AC 3AV2B 3A6NB 2NQBC 5F99B 1EQZA 1KX3D 3R45A 3NQUB 5CP6B 5CPKA 3W96B 2JSSA 4XZQD 3MGQB 3O62D 5CPIB 2FJ7A 5GT0C 3UTAC 3H0MC 3AZEB 1AOIA 5B2JD 3B6FB 5B2IA 4J8WD 3V9RA 3UTBB 3AZNA 3AL0C 5B40D 3AYWA 5BNXA 5BT1D 3AFAC 3VH6W 2ZM5A 3B6GB 3AV1D 1P3FB 1P3GA 4XZQB 5B31C 3C1CC 3AZHA 2HIOC 3KSYA 3MGPD 1P3ID 2AROC 3NQJB 5B33A 4YM6A 4YS3C 5AV6A 5KDMB 5B2JB 3REHC 1P3PC 4J8WB 1P3AD 3TU4D 2CWEA 4KGCA 3AZMD 1HQ3A 5GSUA 2F8NA 4M6BA 3X1SD 1WWIA 4WNNA 3B0CW 5BNVB 4XUJA 4KUDC 3B0DC 5C3IB 4NE3A 1KX3A 4LD9C 2J8PA 4WZSB 1TZYD 3MGSA 3UT9A 4UUZA 2NZDB 2ZY4A 5B0ZC 3O62A 3REJD 1P3AB 5JRGA 3X1VD 5AV5D 3TU4B 4WU8C 3RELC 3AZIB 1N1JB 2BYKA 2JCHA 1P3OC 3WA9A 5AY8B 3X1SB 4H9SA 3AZFA 3H0LC 5B40A 1M18C 1F1EA 4H9QB 5B32D 3KXBB 3X1TC 3AV1A 5GXQD 5BO0B 1P3KD 4CSRA 2BYMA 3MGPA 1P3IA 4H9NA 3LELA 5B1LC 4Z5TB 1KX4D 3MNNC 3AZMA 4X23B 3AV2C 3A6NC 1TAFB 5F99C 1P3LB 5FUGB 5B32B 2IO5B 4ZUXC 5CP6C 3W96C 3WAAA 3KUYB 3MVDB 1Z2CB 1P3KB 3MGQC 3EPLA 1S32D 1TZYA 4Z66B 5CPIC 5DNMD 1P34A 3AZEC 5DNNB 4WU9C 3REJA 3B6FC 1BH9A 3X1VA 5AV5A 3WKJA 3UTBC 3AZLA 3W99D 2Y2IA 5CPKD 3B6GC 5G49A 4J8UB 3LZ1B 1P3FC 1U35D 4XZQC 5E5AD 3WTPB 4KHAA 1S32B 5DNMB 5GXQA 4JJNB 1WWSA 1P3KA 5B2JC 1JFIA 5B2ID 4J8WC 3AZGA 3A1IA 1KX4A 4G91B 5BS7C 3EG5B 2Y2KA 4J8VA 5BT1C 3R45B 5CPKB 1P3BD 2Y2HA 5AVBD 1P3GD 5B24D 3AZHD 5C3IC 2FJ7B 5B33D 1AOIB 5AV6D 2NZDC 3B0BA 3C1BA 5B2IB 1P3AC 3TU4C 3AZNB 3AZIC 1ID3D 3W98A 4WJ3C 1HQ3D 5GSUD 3AYWB 5AY8C 5BNXB 3FDDA 3X1SC 3REKA 4WV4B 1P3GB 3W99A 2RVQC 4XUJD 3AZHB 4YM6B 3KXBC 5B33B 1F66D 3MGSD 3UT9D 1U35A 3H0RC 5AV6B 5E5AA 5B0YA 3LZ0D 5JRGD 2HUEB 4KGCB 1T3UA 4Z5TC 5AV8A 1HQ3B 4HGAB 3AN2A 5GSUB 2F8NB 3WA9D 1ZLAD 3REIA 3LJAA 2G5HC 4EO5B 4WNNB 4Z2MH 4X23C 2LY8A 4XUJB 3AZFD 1P3LC 1KX3B 2L5AA 2VQRA 5B32C 1P3BA 2IO5C 3MGSB 5GT3A 3UT9B 5AVBA 4UUZB 5B24A 3KUYC 4DQYB 3MVDC 3O62B 1P3KC 5JRGB 4H9RA 3LELD 2BYKB 4Z66C 4R8PD 2XD5A 3AZJA 3WA9B 5DNNC 5AV9C 1BH8A 3WTPE 1ID3A 3AZFB 1ULYA 5B40B 2PYOD 3AV1B 3WAAD 4J8UC 3LZ1C 2ZY3A 3IP4C 4CSRB 2BYMB 3MGPB 1BFMA 1P3IB 4H9NB 1F66A 3WTPC 3LELB 1S32C 5DNMC 1P3MD 1P34D 1KX5A 4JJNC 3LZ0A 5CPJD 3WKJD 3AZMB 3AZLD 2Y2QA 4G91C 1ZLAA 5AVCD 1EQZC 4QLCD 5CPKC 3WAAB 3W97D 2CV5D 3AZKA 5B1MD 1TZYB 2NQBD 1P34B 2FJ7C 1AOIC 3REJB 1BH9B 3X1VB 5AV5B 5B2IC 3WKJB 4H9PA 4R8PA 3AZGD 3AZLB 3AZNC 5B31G 2ZY2A 3X1UA 4DRBA 5AVCB 5GT0D 3AYWC 4J8VD 5G49B 3P5JB 1P3GC 1M19A 3AZHC 4KHAB 2PYOA 5GXQB 4YM6C 5B33C 4AWLB 5AV6C 1JFIB 3C1BD 1P3MA 2HUEC 3AZGB 5B31D 3C1CD 4KGCC 3MGRA 3W98D 1KX4B 2Y2JA 1HQ3C 2YFWA 4HGAC 5GSUC 1M1AA 4J8VB 4YS3D 5CPJA 3REKD 4EO5C 1P3PD 3EPJA 4XUJC 5AVCA 1KX3C 4QLCA 4J8XA 3W97A 3MGSC 3UT9C 2CV5A 5B1MA 1W2EA 5B0YD 3O62C 3C1BB 5JRGC 2NQBA 2Y2NA 3W98B 2Y2GA 5AV8D 3AN2D 3WA9C 2F8NH 3REID 3LJAD 3REKB 3W99B 4H9SC 1A7WA 3AZFC 5B40C 5GT0A 3RELD 3UTAA 5GT3D 3AV1C 1U35B 3VH5T 5E5AB 5B0YB 3MGPC 1P3IC 3LELC 5AV8B 1M18D 3AFAA 3AZJD 1HTAA 3AN2B 3REIB 3X1TD 3LJAB 5B31A 3C1CA 5CHLB 3AZMC 2HIOA 2W8SA 1KU5A 2AROA 5B1LD 4YS3A 1P3BB 5GT3B 3REHA 5AVBB 3WAAC 1P3PA 5B24B 2YFVA 4E44A 3AV2D 4H9RB 1KX5D 1TZYC 3A6ND 1P34C 5F99D 3AZJB 4ZUXD 3REJC 1BH8B 3X1VC 5AV5C 3WKJC 4KUDA 1ID3B 3AZLC 3MGQD 5CPID 3AZED 5B0ZA 4WU9D 3B6FD 3AZKD 3RELA 1P3OA 4DRAA 1KX5B 2BG1A 1F66B 5GXQC 4AWLC 4ZUXB 3LZ0B 3B6GD 1P3FD 4H9OA 1M18A 3AZGC 1KX4C 1ZLAB 3X1UD 3X1TA 2FFFB 4J8VC 2XD1A 4WU9B 5JA4A 1M19D 4ZBJB 3AZKB 5B1LA 1H3OA 3EPKA 3MNNA 4CAYA 4G92B 3C1BC 4NE5A 3AV2A 3A6NA 4Z2MG 4H9PB 4R8PB 5F99A 3MGRD 3W98C 4ZUXA 3NQUA 5CP6A 3X1UB 1M1AD 3W96A 3REKC 2NZDD 4NFTA 3W99C 3MGQA 1M19B 3KWQD 5CPIA 3VH5A 3AZID 3AZEA 2PYOB 4J8XD 4WU9A 3B6FA 5AY8D 1U35C 3UTBA 5E5AC 5B0YC 3VH6T 1P3MB 2RVQD 3MGRB 5AV8C 3F6TA 2YFWB 3AN2C 3B6GA 1M1AB 3KXBD 3REIC 5CPJB 5B32G 3LJAC 1P3FA 4XZQA 3KWQB 3NQJA 3UTAD 4Z5TD 4QLCB 4J8XB 1P3BC 3W97B 5KDMA 5GT3C 5B2JA 5AVBC 2CV5B 5B24C 4J8WA 5B1MB 1B6WA 2NQBB 4X23D 5BS7A 3B0CT 1P3LD 3AFAD 3AZJC 1Q9CA 2G5IC 5BNVA 3KUYD 3MVDD 2HIOD 1ID3C 2AROD 5GT0B 3UTAB 4Z66D 2NZDA 3REHD 5DNND 5AV9D 1P3AA 3KWQA 3TU4A 3AZIA 1N1JA 1F66C 3A1KA 1KX5C 3VH5W 3EPHA 2UWXA 5AY8A 3AFAB 3X1SA 3LZ0C 4J8UD 2DF4C 5B31B 3C1CB 3LZ1D 4KUDD 1R4VA 2HIOB 4LD9D 4H9QA 2AROB 3WTPD 3KXBA 1ZLAC 4YS3B 1B67A 4JJND 5BO0A 3REHB 5B0ZD 5AV9B 1P3PB 2YFVB 4WU8D 4ZBJC 3AZKC 4Z5TA 1P3OD
chains in the Genus database with same CATH topology
2Y2MA 2RIQA 1EQZD 4G92C 4UPKA 4X23A 4KUDB 4R8PC 1TAFA 3B0DB 1P3LA 5FUGA 4LD9B 5B32A 3X1UC 2FJ7D 3KUYA 5B0ZB 1AOID 3MVDA 4WU8B 1M19C 1PZRA 3RELB 4Z66A 2Y2OA 3AZND 1P3OB 2PYOC 2DQNC 4NE6A 5DNNA 3VH6A 5AV9A 1EQZB 3MNND 3AYWD 3KFUG 2F8NG 1P3MC 4H9OB 1M18B 4E45A 3MGRC 2Y2PA 3X1TB 5CP6D 1M1AC 4YM6D 3W96D 4J8UA 2JE5A 5CPJC 3LZ1A 2Y2LA 5JA4B 2ZY5A 4LD9A 3WTPA 1S32A 5B1LB 5DNMA 1H3OB 3V9RB 5AVCC 3KWQC 4KGCD 4JJNA 4QLCC 4J8XC 3W97C 2F8ND 4WU8A 3MNNB 2CV5C 4CAYB 2F8NK 5B1MC 3UTBD 2F2AC 3AV2B 3A6NB 2NQBC 5F99B 1EQZA 1KX3D 3R45A 3NQUB 5CP6B 5CPKA 3W96B 2JSSA 4XZQD 3MGQB 3O62D 5CPIB 2FJ7A 5GT0C 3UTAC 3H0MC 3AZEB 1AOIA 5B2JD 3B6FB 5B2IA 4J8WD 3V9RA 3UTBB 3AZNA 3AL0C 5B40D 3AYWA 5BNXA 5BT1D 3AFAC 3VH6W 2ZM5A 3B6GB 3AV1D 1P3FB 1P3GA 4XZQB 5B31C 3C1CC 3AZHA 2HIOC 3KSYA 3MGPD 1P3ID 2AROC 3NQJB 5B33A 4YM6A 4YS3C 5AV6A 5KDMB 5B2JB 3REHC 1P3PC 4J8WB 1P3AD 3TU4D 2CWEA 4KGCA 3AZMD 1HQ3A 5GSUA 2F8NA 4M6BA 3X1SD 1WWIA 4WNNA 3B0CW 5BNVB 4XUJA 4KUDC 3B0DC 5C3IB 4NE3A 1KX3A 4LD9C 2J8PA 4WZSB 1TZYD 3MGSA 3UT9A 4UUZA 2NZDB 2ZY4A 5B0ZC 3O62A 3REJD 1P3AB 5JRGA 3X1VD 5AV5D 3TU4B 4WU8C 3RELC 3AZIB 1N1JB 2BYKA 2JCHA 1P3OC 3WA9A 5AY8B 3X1SB 4H9SA 3AZFA 3H0LC 5B40A 1M18C 1F1EA 4H9QB 5B32D 3KXBB 3X1TC 3AV1A 5GXQD 5BO0B 1P3KD 4CSRA 2BYMA 3MGPA 1P3IA 4H9NA 3LELA 5B1LC 4Z5TB 1KX4D 3MNNC 3AZMA 4X23B 3AV2C 3A6NC 1TAFB 5F99C 1P3LB 5FUGB 5B32B 2IO5B 4ZUXC 5CP6C 3W96C 3WAAA 3KUYB 3MVDB 1Z2CB 1P3KB 3MGQC 3EPLA 1S32D 1TZYA 4Z66B 5CPIC 5DNMD 1P34A 3AZEC 5DNNB 4WU9C 3REJA 3B6FC 1BH9A 3X1VA 5AV5A 3WKJA 3UTBC 3AZLA 3W99D 2Y2IA 5CPKD 3B6GC 5G49A 4J8UB 3LZ1B 1P3FC 1U35D 4XZQC 5E5AD 3WTPB 4KHAA 1S32B 5DNMB 5GXQA 4JJNB 1WWSA 1P3KA 5B2JC 1JFIA 5B2ID 4J8WC 3AZGA 3A1IA 1KX4A 4G91B 5BS7C 3EG5B 2Y2KA 4J8VA 5BT1C 3R45B 5CPKB 1P3BD 2Y2HA 5AVBD 1P3GD 5B24D 3AZHD 5C3IC 2FJ7B 5B33D 1AOIB 5AV6D 2NZDC 3B0BA 3C1BA 5B2IB 1P3AC 3TU4C 3AZNB 3AZIC 1ID3D 3W98A 4WJ3C 1HQ3D 5GSUD 3AYWB 5AY8C 5BNXB 3FDDA 3X1SC 3REKA 4WV4B 1P3GB 3W99A 2RVQC 4XUJD 3AZHB 4YM6B 3KXBC 5B33B 1F66D 3MGSD 3UT9D 1U35A 3H0RC 5AV6B 5E5AA 5B0YA 3LZ0D 5JRGD 2HUEB 4KGCB 1T3UA 4Z5TC 5AV8A 1HQ3B 4HGAB 3AN2A 5GSUB 2F8NB 3WA9D 1ZLAD 3REIA 3LJAA 2G5HC 4EO5B 4WNNB 4Z2MH 4X23C 2LY8A 4XUJB 3AZFD 1P3LC 1KX3B 2L5AA 2VQRA 5B32C 1P3BA 2IO5C 3MGSB 5GT3A 3UT9B 5AVBA 4UUZB 5B24A 3KUYC 4DQYB 3MVDC 3O62B 1P3KC 5JRGB 4H9RA 3LELD 2BYKB 4Z66C 4R8PD 2XD5A 3AZJA 3WA9B 5DNNC 5AV9C 1BH8A 3WTPE 1ID3A 3AZFB 1ULYA 5B40B 2PYOD 3AV1B 3WAAD 4J8UC 3LZ1C 2ZY3A 3IP4C 4CSRB 2BYMB 3MGPB 1BFMA 1P3IB 4H9NB 1F66A 3WTPC 3LELB 1S32C 5DNMC 1P3MD 1P34D 1KX5A 4JJNC 3LZ0A 5CPJD 3WKJD 3AZMB 3AZLD 2Y2QA 4G91C 1ZLAA 5AVCD 1EQZC 4QLCD 5CPKC 3WAAB 3W97D 2CV5D 3AZKA 5B1MD 1TZYB 2NQBD 1P34B 2FJ7C 1AOIC 3REJB 1BH9B 3X1VB 5AV5B 5B2IC 3WKJB 4H9PA 4R8PA 3AZGD 3AZLB 3AZNC 5B31G 2ZY2A 3X1UA 4DRBA 5AVCB 5GT0D 3AYWC 4J8VD 5G49B 3P5JB 1P3GC 1M19A 3AZHC 4KHAB 2PYOA 5GXQB 4YM6C 5B33C 4AWLB 5AV6C 1JFIB 3C1BD 1P3MA 2HUEC 3AZGB 5B31D 3C1CD 4KGCC 3MGRA 3W98D 1KX4B 2Y2JA 1HQ3C 2YFWA 4HGAC 5GSUC 1M1AA 4J8VB 4YS3D 5CPJA 3REKD 4EO5C 1P3PD 3EPJA 4XUJC 5AVCA 1KX3C 4QLCA 4J8XA 3W97A 3MGSC 3UT9C 2CV5A 5B1MA 1W2EA 5B0YD 3O62C 3C1BB 5JRGC 2NQBA 2Y2NA 3W98B 2Y2GA 5AV8D 3AN2D 3WA9C 2F8NH 3REID 3LJAD 3REKB 3W99B 4H9SC 1A7WA 3AZFC 5B40C 5GT0A 3RELD 3UTAA 5GT3D 3AV1C 1U35B 3VH5T 5E5AB 5B0YB 3MGPC 1P3IC 3LELC 5AV8B 1M18D 3AFAA 3AZJD 1HTAA 3AN2B 3REIB 3X1TD 3LJAB 5B31A 3C1CA 5CHLB 3AZMC 2HIOA 2W8SA 1KU5A 2AROA 5B1LD 4YS3A 1P3BB 5GT3B 3REHA 5AVBB 3WAAC 1P3PA 5B24B 2YFVA 4E44A 3AV2D 4H9RB 1KX5D 1TZYC 3A6ND 1P34C 5F99D 3AZJB 4ZUXD 3REJC 1BH8B 3X1VC 5AV5C 3WKJC 4KUDA 1ID3B 3AZLC 3MGQD 5CPID 3AZED 5B0ZA 4WU9D 3B6FD 3AZKD 3RELA 1P3OA 4DRAA 1KX5B 2BG1A 1F66B 5GXQC 4AWLC 4ZUXB 3LZ0B 3B6GD 1P3FD 4H9OA 1M18A 3AZGC 1KX4C 1ZLAB 3X1UD 3X1TA 2FFFB 4J8VC 2XD1A 4WU9B 5JA4A 1M19D 4ZBJB 3AZKB 5B1LA 1H3OA 3EPKA 3MNNA 4CAYA 4G92B 3C1BC 4NE5A 3AV2A 3A6NA 4Z2MG 4H9PB 4R8PB 5F99A 3MGRD 3W98C 4ZUXA 3NQUA 5CP6A 3X1UB 1M1AD 3W96A 3REKC 2NZDD 4NFTA 3W99C 3MGQA 1M19B 3KWQD 5CPIA 3VH5A 3AZID 3AZEA 2PYOB 4J8XD 4WU9A 3B6FA 5AY8D 1U35C 3UTBA 5E5AC 5B0YC 3VH6T 1P3MB 2RVQD 3MGRB 5AV8C 3F6TA 2YFWB 3AN2C 3B6GA 1M1AB 3KXBD 3REIC 5CPJB 5B32G 3LJAC 1P3FA 4XZQA 3KWQB 3NQJA 3UTAD 4Z5TD 4QLCB 4J8XB 1P3BC 3W97B 5KDMA 5GT3C 5B2JA 5AVBC 2CV5B 5B24C 4J8WA 5B1MB 1B6WA 2NQBB 4X23D 5BS7A 3B0CT 1P3LD 3AFAD 3AZJC 1Q9CA 2G5IC 5BNVA 3KUYD 3MVDD 2HIOD 1ID3C 2AROD 5GT0B 3UTAB 4Z66D 2NZDA 3REHD 5DNND 5AV9D 1P3AA 3KWQA 3TU4A 3AZIA 1N1JA 1F66C 3A1KA 1KX5C 3VH5W 3EPHA 2UWXA 5AY8A 3AFAB 3X1SA 3LZ0C 4J8UD 2DF4C 5B31B 3C1CB 3LZ1D 4KUDD 1R4VA 2HIOB 4LD9D 4H9QA 2AROB 3WTPD 3KXBA 1ZLAC 4YS3B 1B67A 4JJND 5BO0A 3REHB 5B0ZD 5AV9B 1P3PB 2YFVB 4WU8D 4ZBJC 3AZKC 4Z5TA 1P3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ D;  4G92 C;  4X23 A;  4KUD B;  4R8P C;  1TAF A;  3B0D B;  1P3L A;  5FUG A;  4LD9 B;  5B32 A;  3X1U C;  2FJ7 D;  3KUY A;  5B0Z B;  1AOI D;  3MVD A;  4WU8 B;  1M19 C;  3REL B;  4Z66 A;  1P3O B;  3AZN D;  2PYO C;  4NE6 A;  5DNN A;  3VH6 A;  5AV9 A;  1EQZ B;  3MNN D;  3AYW D;  2F8N G;  1P3M C;  4H9O B;  1M18 B;  4E45 A;  3MGR C;  3X1T B;  5CP6 D;  1M1A C;  4YM6 D;  3W96 D;  4J8U A;  5CPJ C;  3LZ1 A;  5JA4 B;  4LD9 A;  3WTP A;  1S32 A;  5B1L B;  5DNM A;  1H3O B;  3V9R B;  5AVC C;  3KWQ C;  4KGC D;  4JJN A;  4QLC C;  4J8X C;  3W97 C;  2F8N D;  4WU8 A;  3MNN B;  2CV5 C;  4CAY B;  2F8N K;  5B1M C;  3UTB D;  3AV2 B;  3A6N B;  2NQB C;  5F99 B;  1EQZ A;  1KX3 D;  3R45 A;  3NQU B;  5CP6 B;  5CPK A;  3W96 B;  2JSS A;  4XZQ D;  3MGQ B;  3O62 D;  5CPI B;  2FJ7 A;  5GT0 C;  3UTA C;  3AZE B;  1AOI A;  5B2J D;  3B6F B;  5B2I A;  4J8W D;  3V9R A;  3UTB B;  3AZN A;  5B40 D;  3AYW A;  5BNX A;  5BT1 D;  3AFA C;  3VH6 W;  3B6G B;  3AV1 D;  1P3F B;  1P3G A;  4XZQ B;  5B31 C;  3C1C C;  3AZH A;  2HIO C;  3KSY A;  3MGP D;  1P3I D;  2ARO C;  3NQJ B;  5B33 A;  4YM6 A;  4YS3 C;  5AV6 A;  5KDM B;  5B2J B;  3REH C;  1P3P C;  4J8W B;  1P3A D;  3TU4 D;  2CWE A;  4KGC A;  3AZM D;  1HQ3 A;  5GSU A;  2F8N A;  4M6B A;  3X1S D;  1WWI A;  4WNN A;  3B0C W;  5BNV B;  4XUJ A;  4KUD C;  3B0D C;  5C3I B;  4NE3 A;  1KX3 A;  4LD9 C;  4WZS B;  1TZY D;  3MGS A;  3UT9 A;  4UUZ A;  2NZD B;  5B0Z C;  3O62 A;  3REJ D;  1P3A B;  5JRG A;  3X1V D;  5AV5 D;  3TU4 B;  4WU8 C;  3REL C;  3AZI B;  1N1J B;  2BYK A;  1P3O C;  3WA9 A;  5AY8 B;  3X1S B;  4H9S A;  3AZF A;  5B40 A;  1M18 C;  1F1E A;  4H9Q B;  5B32 D;  3KXB B;  3X1T C;  3AV1 A;  5GXQ D;  5BO0 B;  1P3K D;  4CSR A;  2BYM A;  3MGP A;  1P3I A;  4H9N A;  3LEL A;  5B1L C;  4Z5T B;  1KX4 D;  3MNN C;  3AZM A;  4X23 B;  3AV2 C;  3A6N C;  1TAF B;  5F99 C;  1P3L B;  5FUG B;  5B32 B;  2IO5 B;  4ZUX C;  5CP6 C;  3W96 C;  3WAA A;  3KUY B;  3MVD B;  1P3K B;  3MGQ C;  1S32 D;  1TZY A;  4Z66 B;  5CPI C;  5DNM D;  1P34 A;  3AZE C;  5DNN B;  4WU9 C;  3REJ A;  3B6F C;  1BH9 A;  3X1V A;  5AV5 A;  3WKJ A;  3UTB C;  3AZL A;  3W99 D;  5CPK D;  3B6G C;  5G49 A;  4J8U B;  3LZ1 B;  1P3F C;  1U35 D;  4XZQ C;  5E5A D;  3WTP B;  4KHA A;  1S32 B;  5DNM B;  5GXQ A;  4JJN B;  1WWS A;  1P3K A;  5B2J C;  1JFI A;  5B2I D;  4J8W C;  3AZG A;  1KX4 A;  4G91 B;  5BS7 C;  4J8V A;  5BT1 C;  3R45 B;  5CPK B;  1P3B D;  5AVB D;  1P3G D;  5B24 D;  3AZH D;  5C3I C;  2FJ7 B;  5B33 D;  1AOI B;  5AV6 D;  2NZD C;  3B0B A;  3C1B A;  5B2I B;  1P3A C;  3TU4 C;  3AZN B;  3AZI C;  1ID3 D;  3W98 A;  1HQ3 D;  5GSU D;  3AYW B;  5AY8 C;  5BNX B;  3X1S C;  3REK A;  4WV4 B;  1P3G B;  3W99 A;  2RVQ C;  4XUJ D;  3AZH B;  4YM6 B;  3KXB C;  5B33 B;  1F66 D;  3MGS D;  3UT9 D;  1U35 A;  5AV6 B;  5E5A A;  5B0Y A;  3LZ0 D;  5JRG D;  2HUE B;  4KGC B;  4Z5T C;  5AV8 A;  1HQ3 B;  4HGA B;  3AN2 A;  5GSU B;  2F8N B;  3WA9 D;  1ZLA D;  3REI A;  3LJA A;  4EO5 B;  4WNN B;  4Z2M H;  4X23 C;  2LY8 A;  4XUJ B;  3AZF D;  1P3L C;  1KX3 B;  2L5A A;  5B32 C;  1P3B A;  2IO5 C;  3MGS B;  5GT3 A;  3UT9 B;  5AVB A;  4UUZ B;  5B24 A;  3KUY C;  3MVD C;  3O62 B;  1P3K C;  5JRG B;  4H9R A;  3LEL D;  2BYK B;  4Z66 C;  4R8P D;  3AZJ A;  3WA9 B;  5DNN C;  5AV9 C;  1BH8 A;  3WTP E;  1ID3 A;  3AZF B;  1ULY A;  5B40 B;  2PYO D;  3AV1 B;  3WAA D;  4J8U C;  3LZ1 C;  4CSR B;  2BYM B;  3MGP B;  1BFM A;  1P3I B;  4H9N B;  1F66 A;  3WTP C;  3LEL B;  1S32 C;  5DNM C;  1P3M D;  1P34 D;  1KX5 A;  4JJN C;  3LZ0 A;  5CPJ D;  3WKJ D;  3AZM B;  3AZL D;  4G91 C;  1ZLA A;  5AVC D;  1EQZ C;  4QLC D;  5CPK C;  3WAA B;  3W97 D;  2CV5 D;  3AZK A;  5B1M D;  1TZY B;  2NQB D;  1P34 B;  2FJ7 C;  1AOI C;  3REJ B;  1BH9 B;  3X1V B;  5AV5 B;  5B2I C;  3WKJ B;  4H9P A;  4R8P A;  3AZG D;  3AZL B;  3AZN C;  5B31 G;  3X1U A;  4DRB A;  5AVC B;  5GT0 D;  3AYW C;  4J8V D;  5G49 B;  1P3G C;  1M19 A;  3AZH C;  4KHA B;  2PYO A;  5GXQ B;  4YM6 C;  5B33 C;  4AWL B;  5AV6 C;  1JFI B;  3C1B D;  1P3M A;  2HUE C;  3AZG B;  5B31 D;  3C1C D;  4KGC C;  3MGR A;  3W98 D;  1KX4 B;  2YFW A;  1HQ3 C;  4HGA C;  5GSU C;  1M1A A;  4J8V B;  4YS3 D;  5CPJ A;  3REK D;  4EO5 C;  1P3P D;  4XUJ C;  5AVC A;  1KX3 C;  4QLC A;  4J8X A;  3W97 A;  3MGS C;  3UT9 C;  2CV5 A;  5B1M A;  5B0Y D;  3O62 C;  3C1B B;  5JRG C;  2NQB A;  3W98 B;  5AV8 D;  3AN2 D;  3WA9 C;  2F8N H;  3REI D;  3LJA D;  3REK B;  3W99 B;  4H9S C;  1A7W A;  3AZF C;  5B40 C;  5GT0 A;  3REL D;  3UTA A;  5GT3 D;  3AV1 C;  1U35 B;  3VH5 T;  5E5A B;  5B0Y B;  3MGP C;  1P3I C;  3LEL C;  5AV8 B;  1M18 D;  3AFA A;  3AZJ D;  1HTA A;  3AN2 B;  3REI B;  3X1T D;  3LJA B;  5B31 A;  3C1C A;  5CHL B;  3AZM C;  2HIO A;  1KU5 A;  2ARO A;  5B1L D;  4YS3 A;  1P3B B;  5GT3 B;  3REH A;  5AVB B;  3WAA C;  1P3P A;  5B24 B;  2YFV A;  4E44 A;  3AV2 D;  4H9R B;  1KX5 D;  1TZY C;  3A6N D;  1P34 C;  5F99 D;  3AZJ B;  4ZUX D;  3REJ C;  1BH8 B;  3X1V C;  5AV5 C;  3WKJ C;  4KUD A;  1ID3 B;  3AZL C;  3MGQ D;  5CPI D;  3AZE D;  5B0Z A;  4WU9 D;  3B6F D;  3AZK D;  3REL A;  1P3O A;  4DRA A;  1KX5 B;  1F66 B;  5GXQ C;  4AWL C;  4ZUX B;  3LZ0 B;  3B6G D;  1P3F D;  4H9O A;  1M18 A;  3AZG C;  1KX4 C;  1ZLA B;  3X1U D;  3X1T A;  4J8V C;  4WU9 B;  5JA4 A;  1M19 D;  4ZBJ B;  3AZK B;  5B1L A;  1H3O A;  3MNN A;  4CAY A;  4G92 B;  3C1B C;  4NE5 A;  3AV2 A;  3A6N A;  4Z2M G;  4R8P B;  4H9P B;  5F99 A;  3MGR D;  3W98 C;  4ZUX A;  3NQU A;  5CP6 A;  3X1U B;  1M1A D;  3W96 A;  3REK C;  2NZD D;  4NFT A;  3W99 C;  3MGQ A;  1M19 B;  3KWQ D;  5CPI A;  3VH5 A;  3AZI D;  3AZE A;  2PYO B;  4J8X D;  4WU9 A;  3B6F A;  5AY8 D;  1U35 C;  3UTB A;  5E5A C;  5B0Y C;  3VH6 T;  1P3M B;  2RVQ D;  3MGR B;  5AV8 C;  2YFW B;  3AN2 C;  3B6G A;  1M1A B;  3KXB D;  3REI C;  5CPJ B;  5B32 G;  3LJA C;  1P3F A;  4XZQ A;  3KWQ B;  3NQJ A;  3UTA D;  4Z5T D;  4QLC B;  4J8X B;  1P3B C;  3W97 B;  5KDM A;  5GT3 C;  5B2J A;  5AVB C;  2CV5 B;  5B24 C;  4J8W A;  5B1M B;  1B6W A;  2NQB B;  4X23 D;  5BS7 A;  3B0C T;  1P3L D;  3AFA D;  3AZJ C;  1Q9C A;  5BNV A;  3KUY D;  3MVD D;  2HIO D;  1ID3 C;  2ARO D;  5GT0 B;  3UTA B;  4Z66 D;  2NZD A;  3REH D;  5DNN D;  5AV9 D;  1P3A A;  3KWQ A;  3TU4 A;  3AZI A;  1N1J A;  1F66 C;  1KX5 C;  3VH5 W;  5AY8 A;  3AFA B;  3X1S A;  3LZ0 C;  4J8U D;  5B31 B;  3C1C B;  3LZ1 D;  4KUD D;  1R4V A;  2HIO B;  4LD9 D;  4H9Q A;  2ARO B;  3WTP D;  3KXB A;  1ZLA C;  4YS3 B;  1B67 A;  4JJN D;  5BO0 A;  3REH B;  5B0Z D;  5AV9 B;  1P3P B;  2YFV B;  4WU8 D;  4ZBJ C;  3AZK C;  4Z5T A;  1P3O D; 
#chains in the Genus database with same CATH topology
 2Y2M A;  2RIQ A;  1EQZ D;  4G92 C;  4UPK A;  4X23 A;  4KUD B;  4R8P C;  1TAF A;  3B0D B;  1P3L A;  5FUG A;  4LD9 B;  5B32 A;  3X1U C;  2FJ7 D;  3KUY A;  5B0Z B;  1AOI D;  3MVD A;  4WU8 B;  1M19 C;  1PZR A;  3REL B;  4Z66 A;  2Y2O A;  3AZN D;  1P3O B;  2PYO C;  2DQN C;  4NE6 A;  5DNN A;  3VH6 A;  5AV9 A;  1EQZ B;  3MNN D;  3AYW D;  3KFU G;  2F8N G;  1P3M C;  4H9O B;  1M18 B;  4E45 A;  3MGR C;  2Y2P A;  3X1T B;  5CP6 D;  1M1A C;  4YM6 D;  3W96 D;  4J8U A;  2JE5 A;  5CPJ C;  3LZ1 A;  2Y2L A;  5JA4 B;  2ZY5 A;  4LD9 A;  3WTP A;  1S32 A;  5B1L B;  5DNM A;  1H3O B;  3V9R B;  5AVC C;  3KWQ C;  4KGC D;  4JJN A;  4QLC C;  4J8X C;  3W97 C;  2F8N D;  4WU8 A;  3MNN B;  2CV5 C;  4CAY B;  2F8N K;  5B1M C;  3UTB D;  2F2A C;  3AV2 B;  3A6N B;  2NQB C;  5F99 B;  1EQZ A;  1KX3 D;  3R45 A;  3NQU B;  5CP6 B;  5CPK A;  3W96 B;  2JSS A;  4XZQ D;  3MGQ B;  3O62 D;  5CPI B;  2FJ7 A;  5GT0 C;  3UTA C;  3H0M C;  3AZE B;  1AOI A;  5B2J D;  3B6F B;  5B2I A;  4J8W D;  3V9R A;  3UTB B;  3AZN A;  3AL0 C;  5B40 D;  3AYW A;  5BNX A;  5BT1 D;  3AFA C;  3VH6 W;  2ZM5 A;  3B6G B;  3AV1 D;  1P3F B;  1P3G A;  4XZQ B;  5B31 C;  3C1C C;  3AZH A;  2HIO C;  3KSY A;  3MGP D;  1P3I D;  2ARO C;  3NQJ B;  5B33 A;  4YM6 A;  4YS3 C;  5AV6 A;  5KDM B;  5B2J B;  3REH C;  1P3P C;  4J8W B;  1P3A D;  3TU4 D;  2CWE A;  4KGC A;  3AZM D;  1HQ3 A;  5GSU A;  2F8N A;  4M6B A;  3X1S D;  1WWI A;  4WNN A;  3B0C W;  5BNV B;  4XUJ A;  4KUD C;  3B0D C;  5C3I B;  4NE3 A;  1KX3 A;  4LD9 C;  2J8P A;  4WZS B;  1TZY D;  3MGS A;  3UT9 A;  4UUZ A;  2NZD B;  2ZY4 A;  5B0Z C;  3O62 A;  3REJ D;  1P3A B;  5JRG A;  3X1V D;  5AV5 D;  3TU4 B;  4WU8 C;  3REL C;  3AZI B;  1N1J B;  2BYK A;  2JCH A;  1P3O C;  3WA9 A;  5AY8 B;  3X1S B;  4H9S A;  3AZF A;  3H0L C;  5B40 A;  1M18 C;  1F1E A;  4H9Q B;  5B32 D;  3KXB B;  3X1T C;  3AV1 A;  5GXQ D;  5BO0 B;  1P3K D;  4CSR A;  2BYM A;  3MGP A;  1P3I A;  4H9N A;  3LEL A;  5B1L C;  4Z5T B;  1KX4 D;  3MNN C;  3AZM A;  4X23 B;  3AV2 C;  3A6N C;  1TAF B;  5F99 C;  1P3L B;  5FUG B;  5B32 B;  2IO5 B;  4ZUX C;  5CP6 C;  3W96 C;  3WAA A;  3KUY B;  3MVD B;  1Z2C B;  1P3K B;  3MGQ C;  3EPL A;  1S32 D;  1TZY A;  4Z66 B;  5CPI C;  5DNM D;  1P34 A;  3AZE C;  5DNN B;  4WU9 C;  3REJ A;  3B6F C;  1BH9 A;  3X1V A;  5AV5 A;  3WKJ A;  3UTB C;  3AZL A;  3W99 D;  2Y2I A;  5CPK D;  3B6G C;  5G49 A;  4J8U B;  3LZ1 B;  1P3F C;  1U35 D;  4XZQ C;  5E5A D;  3WTP B;  4KHA A;  1S32 B;  5DNM B;  5GXQ A;  4JJN B;  1WWS A;  1P3K A;  5B2J C;  1JFI A;  5B2I D;  4J8W C;  3AZG A;  3A1I A;  1KX4 A;  4G91 B;  5BS7 C;  3EG5 B;  2Y2K A;  4J8V A;  5BT1 C;  3R45 B;  5CPK B;  1P3B D;  2Y2H A;  5AVB D;  1P3G D;  5B24 D;  3AZH D;  5C3I C;  2FJ7 B;  5B33 D;  1AOI B;  5AV6 D;  2NZD C;  3B0B A;  3C1B A;  5B2I B;  1P3A C;  3TU4 C;  3AZN B;  3AZI C;  1ID3 D;  3W98 A;  4WJ3 C;  1HQ3 D;  5GSU D;  3AYW B;  5AY8 C;  5BNX B;  3FDD A;  3X1S C;  3REK A;  4WV4 B;  1P3G B;  3W99 A;  2RVQ C;  4XUJ D;  3AZH B;  4YM6 B;  3KXB C;  5B33 B;  1F66 D;  3MGS D;  3UT9 D;  1U35 A;  3H0R C;  5AV6 B;  5E5A A;  5B0Y A;  3LZ0 D;  5JRG D;  2HUE B;  4KGC B;  1T3U A;  4Z5T C;  5AV8 A;  1HQ3 B;  4HGA B;  3AN2 A;  5GSU B;  2F8N B;  3WA9 D;  1ZLA D;  3REI A;  3LJA A;  2G5H C;  4EO5 B;  4WNN B;  4Z2M H;  4X23 C;  2LY8 A;  4XUJ B;  3AZF D;  1P3L C;  1KX3 B;  2L5A A;  2VQR A;  5B32 C;  1P3B A;  2IO5 C;  3MGS B;  5GT3 A;  3UT9 B;  5AVB A;  4UUZ B;  5B24 A;  3KUY C;  4DQY B;  3MVD C;  3O62 B;  1P3K C;  5JRG B;  4H9R A;  3LEL D;  2BYK B;  4Z66 C;  4R8P D;  2XD5 A;  3AZJ A;  3WA9 B;  5DNN C;  5AV9 C;  1BH8 A;  3WTP E;  1ID3 A;  3AZF B;  1ULY A;  5B40 B;  2PYO D;  3AV1 B;  3WAA D;  4J8U C;  3LZ1 C;  2ZY3 A;  3IP4 C;  4CSR B;  2BYM B;  3MGP B;  1BFM A;  1P3I B;  4H9N B;  1F66 A;  3WTP C;  3LEL B;  1S32 C;  5DNM C;  1P3M D;  1P34 D;  1KX5 A;  4JJN C;  3LZ0 A;  5CPJ D;  3WKJ D;  3AZM B;  3AZL D;  2Y2Q A;  4G91 C;  1ZLA A;  5AVC D;  1EQZ C;  4QLC D;  5CPK C;  3WAA B;  3W97 D;  2CV5 D;  3AZK A;  5B1M D;  1TZY B;  2NQB D;  1P34 B;  2FJ7 C;  1AOI C;  3REJ B;  1BH9 B;  3X1V B;  5AV5 B;  5B2I C;  3WKJ B;  4H9P A;  4R8P A;  3AZG D;  3AZL B;  3AZN C;  5B31 G;  2ZY2 A;  3X1U A;  4DRB A;  5AVC B;  5GT0 D;  3AYW C;  4J8V D;  5G49 B;  3P5J B;  1P3G C;  1M19 A;  3AZH C;  4KHA B;  2PYO A;  5GXQ B;  4YM6 C;  5B33 C;  4AWL B;  5AV6 C;  1JFI B;  3C1B D;  1P3M A;  2HUE C;  3AZG B;  5B31 D;  3C1C D;  4KGC C;  3MGR A;  3W98 D;  1KX4 B;  2Y2J A;  1HQ3 C;  2YFW A;  4HGA C;  5GSU C;  1M1A A;  4J8V B;  4YS3 D;  5CPJ A;  3REK D;  4EO5 C;  1P3P D;  3EPJ A;  4XUJ C;  5AVC A;  1KX3 C;  4QLC A;  4J8X A;  3W97 A;  3MGS C;  3UT9 C;  2CV5 A;  5B1M A;  1W2E A;  5B0Y D;  3O62 C;  3C1B B;  5JRG C;  2NQB A;  2Y2N A;  3W98 B;  2Y2G A;  5AV8 D;  3AN2 D;  3WA9 C;  2F8N H;  3REI D;  3LJA D;  3REK B;  3W99 B;  4H9S C;  1A7W A;  3AZF C;  5B40 C;  5GT0 A;  3REL D;  3UTA A;  5GT3 D;  3AV1 C;  1U35 B;  3VH5 T;  5E5A B;  5B0Y B;  3MGP C;  1P3I C;  3LEL C;  5AV8 B;  1M18 D;  3AFA A;  3AZJ D;  1HTA A;  3AN2 B;  3REI B;  3X1T D;  3LJA B;  5B31 A;  3C1C A;  5CHL B;  3AZM C;  2HIO A;  2W8S A;  1KU5 A;  2ARO A;  5B1L D;  4YS3 A;  1P3B B;  5GT3 B;  3REH A;  5AVB B;  3WAA C;  1P3P A;  5B24 B;  2YFV A;  4E44 A;  3AV2 D;  4H9R B;  1KX5 D;  1TZY C;  3A6N D;  1P34 C;  5F99 D;  3AZJ B;  4ZUX D;  3REJ C;  1BH8 B;  3X1V C;  5AV5 C;  3WKJ C;  4KUD A;  1ID3 B;  3AZL C;  3MGQ D;  5CPI D;  3AZE D;  5B0Z A;  4WU9 D;  3B6F D;  3AZK D;  3REL A;  1P3O A;  4DRA A;  1KX5 B;  2BG1 A;  1F66 B;  5GXQ C;  4AWL C;  4ZUX B;  3LZ0 B;  3B6G D;  1P3F D;  4H9O A;  1M18 A;  3AZG C;  1KX4 C;  1ZLA B;  3X1U D;  3X1T A;  2FFF B;  4J8V C;  2XD1 A;  4WU9 B;  5JA4 A;  1M19 D;  4ZBJ B;  3AZK B;  5B1L A;  1H3O A;  3EPK A;  3MNN A;  4CAY A;  4G92 B;  3C1B C;  4NE5 A;  3AV2 A;  3A6N A;  4Z2M G;  4H9P B;  4R8P B;  5F99 A;  3MGR D;  3W98 C;  4ZUX A;  3NQU A;  5CP6 A;  3X1U B;  1M1A D;  3W96 A;  3REK C;  2NZD D;  4NFT A;  3W99 C;  3MGQ A;  1M19 B;  3KWQ D;  5CPI A;  3VH5 A;  3AZI D;  3AZE A;  2PYO B;  4J8X D;  4WU9 A;  3B6F A;  5AY8 D;  1U35 C;  3UTB A;  5E5A C;  5B0Y C;  3VH6 T;  1P3M B;  2RVQ D;  3MGR B;  5AV8 C;  3F6T A;  2YFW B;  3AN2 C;  3B6G A;  1M1A B;  3KXB D;  3REI C;  5CPJ B;  5B32 G;  3LJA C;  1P3F A;  4XZQ A;  3KWQ B;  3NQJ A;  3UTA D;  4Z5T D;  4QLC B;  4J8X B;  1P3B C;  3W97 B;  5KDM A;  5GT3 C;  5B2J A;  5AVB C;  2CV5 B;  5B24 C;  4J8W A;  5B1M B;  1B6W A;  2NQB B;  4X23 D;  5BS7 A;  3B0C T;  1P3L D;  3AFA D;  3AZJ C;  1Q9C A;  2G5I C;  5BNV A;  3KUY D;  3MVD D;  2HIO D;  1ID3 C;  2ARO D;  5GT0 B;  3UTA B;  4Z66 D;  2NZD A;  3REH D;  5DNN D;  5AV9 D;  1P3A A;  3KWQ A;  3TU4 A;  3AZI A;  1N1J A;  1F66 C;  3A1K A;  1KX5 C;  3VH5 W;  3EPH A;  2UWX A;  5AY8 A;  3AFA B;  3X1S A;  3LZ0 C;  4J8U D;  2DF4 C;  5B31 B;  3C1C B;  3LZ1 D;  4KUD D;  1R4V A;  2HIO B;  4LD9 D;  4H9Q A;  2ARO B;  3WTP D;  3KXB A;  1ZLA C;  4YS3 B;  1B67 A;  4JJN D;  5BO0 A;  3REH B;  5B0Z D;  5AV9 B;  1P3P B;  2YFV B;  4WU8 D;  4ZBJ C;  3AZK C;  4Z5T A;  1P3O D; 
#chains in the Genus database with same CATH homology
 2Y2M A;  2RIQ A;  1EQZ D;  4G92 C;  4UPK A;  4X23 A;  4KUD B;  4R8P C;  1TAF A;  3B0D B;  1P3L A;  5FUG A;  4LD9 B;  5B32 A;  3X1U C;  2FJ7 D;  3KUY A;  5B0Z B;  1AOI D;  3MVD A;  4WU8 B;  1M19 C;  1PZR A;  3REL B;  4Z66 A;  2Y2O A;  3AZN D;  1P3O B;  2PYO C;  2DQN C;  4NE6 A;  5DNN A;  3VH6 A;  5AV9 A;  1EQZ B;  3MNN D;  3AYW D;  3KFU G;  2F8N G;  1P3M C;  4H9O B;  1M18 B;  4E45 A;  3MGR C;  2Y2P A;  3X1T B;  5CP6 D;  1M1A C;  4YM6 D;  3W96 D;  4J8U A;  2JE5 A;  5CPJ C;  3LZ1 A;  2Y2L A;  5JA4 B;  2ZY5 A;  4LD9 A;  3WTP A;  1S32 A;  5B1L B;  5DNM A;  1H3O B;  3V9R B;  5AVC C;  3KWQ C;  4KGC D;  4JJN A;  4QLC C;  4J8X C;  3W97 C;  2F8N D;  4WU8 A;  3MNN B;  2CV5 C;  4CAY B;  2F8N K;  5B1M C;  3UTB D;  2F2A C;  3AV2 B;  3A6N B;  2NQB C;  5F99 B;  1EQZ A;  1KX3 D;  3R45 A;  3NQU B;  5CP6 B;  5CPK A;  3W96 B;  2JSS A;  4XZQ D;  3MGQ B;  3O62 D;  5CPI B;  2FJ7 A;  5GT0 C;  3UTA C;  3H0M C;  3AZE B;  1AOI A;  5B2J D;  3B6F B;  5B2I A;  4J8W D;  3V9R A;  3UTB B;  3AZN A;  3AL0 C;  5B40 D;  3AYW A;  5BNX A;  5BT1 D;  3AFA C;  3VH6 W;  2ZM5 A;  3B6G B;  3AV1 D;  1P3F B;  1P3G A;  4XZQ B;  5B31 C;  3C1C C;  3AZH A;  2HIO C;  3KSY A;  3MGP D;  1P3I D;  2ARO C;  3NQJ B;  5B33 A;  4YM6 A;  4YS3 C;  5AV6 A;  5KDM B;  5B2J B;  3REH C;  1P3P C;  4J8W B;  1P3A D;  3TU4 D;  2CWE A;  4KGC A;  3AZM D;  1HQ3 A;  5GSU A;  2F8N A;  4M6B A;  3X1S D;  1WWI A;  4WNN A;  3B0C W;  5BNV B;  4XUJ A;  4KUD C;  3B0D C;  5C3I B;  4NE3 A;  1KX3 A;  4LD9 C;  2J8P A;  4WZS B;  1TZY D;  3MGS A;  3UT9 A;  4UUZ A;  2NZD B;  2ZY4 A;  5B0Z C;  3O62 A;  3REJ D;  1P3A B;  5JRG A;  3X1V D;  5AV5 D;  3TU4 B;  4WU8 C;  3REL C;  3AZI B;  1N1J B;  2BYK A;  2JCH A;  1P3O C;  3WA9 A;  5AY8 B;  3X1S B;  4H9S A;  3AZF A;  3H0L C;  5B40 A;  1M18 C;  1F1E A;  4H9Q B;  5B32 D;  3KXB B;  3X1T C;  3AV1 A;  5GXQ D;  5BO0 B;  1P3K D;  4CSR A;  2BYM A;  3MGP A;  1P3I A;  4H9N A;  3LEL A;  5B1L C;  4Z5T B;  1KX4 D;  3MNN C;  3AZM A;  4X23 B;  3AV2 C;  3A6N C;  1TAF B;  5F99 C;  1P3L B;  5FUG B;  5B32 B;  2IO5 B;  4ZUX C;  5CP6 C;  3W96 C;  3WAA A;  3KUY B;  3MVD B;  1Z2C B;  1P3K B;  3MGQ C;  3EPL A;  1S32 D;  1TZY A;  4Z66 B;  5CPI C;  5DNM D;  1P34 A;  3AZE C;  5DNN B;  4WU9 C;  3REJ A;  3B6F C;  1BH9 A;  3X1V A;  5AV5 A;  3WKJ A;  3UTB C;  3AZL A;  3W99 D;  2Y2I A;  5CPK D;  3B6G C;  5G49 A;  4J8U B;  3LZ1 B;  1P3F C;  1U35 D;  4XZQ C;  5E5A D;  3WTP B;  4KHA A;  1S32 B;  5DNM B;  5GXQ A;  4JJN B;  1WWS A;  1P3K A;  5B2J C;  1JFI A;  5B2I D;  4J8W C;  3AZG A;  3A1I A;  1KX4 A;  4G91 B;  5BS7 C;  3EG5 B;  2Y2K A;  4J8V A;  5BT1 C;  3R45 B;  5CPK B;  1P3B D;  2Y2H A;  5AVB D;  1P3G D;  5B24 D;  3AZH D;  5C3I C;  2FJ7 B;  5B33 D;  1AOI B;  5AV6 D;  2NZD C;  3B0B A;  3C1B A;  5B2I B;  1P3A C;  3TU4 C;  3AZN B;  3AZI C;  1ID3 D;  3W98 A;  4WJ3 C;  1HQ3 D;  5GSU D;  3AYW B;  5AY8 C;  5BNX B;  3FDD A;  3X1S C;  3REK A;  4WV4 B;  1P3G B;  3W99 A;  2RVQ C;  4XUJ D;  3AZH B;  4YM6 B;  3KXB C;  5B33 B;  1F66 D;  3MGS D;  3UT9 D;  1U35 A;  3H0R C;  5AV6 B;  5E5A A;  5B0Y A;  3LZ0 D;  5JRG D;  2HUE B;  4KGC B;  1T3U A;  4Z5T C;  5AV8 A;  1HQ3 B;  4HGA B;  3AN2 A;  5GSU B;  2F8N B;  3WA9 D;  1ZLA D;  3REI A;  3LJA A;  2G5H C;  4EO5 B;  4WNN B;  4Z2M H;  4X23 C;  2LY8 A;  4XUJ B;  3AZF D;  1P3L C;  1KX3 B;  2L5A A;  2VQR A;  5B32 C;  1P3B A;  2IO5 C;  3MGS B;  5GT3 A;  3UT9 B;  5AVB A;  4UUZ B;  5B24 A;  3KUY C;  4DQY B;  3MVD C;  3O62 B;  1P3K C;  5JRG B;  4H9R A;  3LEL D;  2BYK B;  4Z66 C;  4R8P D;  2XD5 A;  3AZJ A;  3WA9 B;  5DNN C;  5AV9 C;  1BH8 A;  3WTP E;  1ID3 A;  3AZF B;  1ULY A;  5B40 B;  2PYO D;  3AV1 B;  3WAA D;  4J8U C;  3LZ1 C;  2ZY3 A;  3IP4 C;  4CSR B;  2BYM B;  3MGP B;  1BFM A;  1P3I B;  4H9N B;  1F66 A;  3WTP C;  3LEL B;  1S32 C;  5DNM C;  1P3M D;  1P34 D;  1KX5 A;  4JJN C;  3LZ0 A;  5CPJ D;  3WKJ D;  3AZM B;  3AZL D;  2Y2Q A;  4G91 C;  1ZLA A;  5AVC D;  1EQZ C;  4QLC D;  5CPK C;  3WAA B;  3W97 D;  2CV5 D;  3AZK A;  5B1M D;  1TZY B;  2NQB D;  1P34 B;  2FJ7 C;  1AOI C;  3REJ B;  1BH9 B;  3X1V B;  5AV5 B;  5B2I C;  3WKJ B;  4H9P A;  4R8P A;  3AZG D;  3AZL B;  3AZN C;  5B31 G;  2ZY2 A;  3X1U A;  4DRB A;  5AVC B;  5GT0 D;  3AYW C;  4J8V D;  5G49 B;  3P5J B;  1P3G C;  1M19 A;  3AZH C;  4KHA B;  2PYO A;  5GXQ B;  4YM6 C;  5B33 C;  4AWL B;  5AV6 C;  1JFI B;  3C1B D;  1P3M A;  2HUE C;  3AZG B;  5B31 D;  3C1C D;  4KGC C;  3MGR A;  3W98 D;  1KX4 B;  2Y2J A;  1HQ3 C;  2YFW A;  4HGA C;  5GSU C;  1M1A A;  4J8V B;  4YS3 D;  5CPJ A;  3REK D;  4EO5 C;  1P3P D;  3EPJ A;  4XUJ C;  5AVC A;  1KX3 C;  4QLC A;  4J8X A;  3W97 A;  3MGS C;  3UT9 C;  2CV5 A;  5B1M A;  1W2E A;  5B0Y D;  3O62 C;  3C1B B;  5JRG C;  2NQB A;  2Y2N A;  3W98 B;  2Y2G A;  5AV8 D;  3AN2 D;  3WA9 C;  2F8N H;  3REI D;  3LJA D;  3REK B;  3W99 B;  4H9S C;  1A7W A;  3AZF C;  5B40 C;  5GT0 A;  3REL D;  3UTA A;  5GT3 D;  3AV1 C;  1U35 B;  3VH5 T;  5E5A B;  5B0Y B;  3MGP C;  1P3I C;  3LEL C;  5AV8 B;  1M18 D;  3AFA A;  3AZJ D;  1HTA A;  3AN2 B;  3REI B;  3X1T D;  3LJA B;  5B31 A;  3C1C A;  5CHL B;  3AZM C;  2HIO A;  2W8S A;  1KU5 A;  2ARO A;  5B1L D;  4YS3 A;  1P3B B;  5GT3 B;  3REH A;  5AVB B;  3WAA C;  1P3P A;  5B24 B;  2YFV A;  4E44 A;  3AV2 D;  4H9R B;  1KX5 D;  1TZY C;  3A6N D;  1P34 C;  5F99 D;  3AZJ B;  4ZUX D;  3REJ C;  1BH8 B;  3X1V C;  5AV5 C;  3WKJ C;  4KUD A;  1ID3 B;  3AZL C;  3MGQ D;  5CPI D;  3AZE D;  5B0Z A;  4WU9 D;  3B6F D;  3AZK D;  3REL A;  1P3O A;  4DRA A;  1KX5 B;  2BG1 A;  1F66 B;  5GXQ C;  4AWL C;  4ZUX B;  3LZ0 B;  3B6G D;  1P3F D;  4H9O A;  1M18 A;  3AZG C;  1KX4 C;  1ZLA B;  3X1U D;  3X1T A;  2FFF B;  4J8V C;  2XD1 A;  4WU9 B;  5JA4 A;  1M19 D;  4ZBJ B;  3AZK B;  5B1L A;  1H3O A;  3EPK A;  3MNN A;  4CAY A;  4G92 B;  3C1B C;  4NE5 A;  3AV2 A;  3A6N A;  4Z2M G;  4H9P B;  4R8P B;  5F99 A;  3MGR D;  3W98 C;  4ZUX A;  3NQU A;  5CP6 A;  3X1U B;  1M1A D;  3W96 A;  3REK C;  2NZD D;  4NFT A;  3W99 C;  3MGQ A;  1M19 B;  3KWQ D;  5CPI A;  3VH5 A;  3AZI D;  3AZE A;  2PYO B;  4J8X D;  4WU9 A;  3B6F A;  5AY8 D;  1U35 C;  3UTB A;  5E5A C;  5B0Y C;  3VH6 T;  1P3M B;  2RVQ D;  3MGR B;  5AV8 C;  3F6T A;  2YFW B;  3AN2 C;  3B6G A;  1M1A B;  3KXB D;  3REI C;  5CPJ B;  5B32 G;  3LJA C;  1P3F A;  4XZQ A;  3KWQ B;  3NQJ A;  3UTA D;  4Z5T D;  4QLC B;  4J8X B;  1P3B C;  3W97 B;  5KDM A;  5GT3 C;  5B2J A;  5AVB C;  2CV5 B;  5B24 C;  4J8W A;  5B1M B;  1B6W A;  2NQB B;  4X23 D;  5BS7 A;  3B0C T;  1P3L D;  3AFA D;  3AZJ C;  1Q9C A;  2G5I C;  5BNV A;  3KUY D;  3MVD D;  2HIO D;  1ID3 C;  2ARO D;  5GT0 B;  3UTA B;  4Z66 D;  2NZD A;  3REH D;  5DNN D;  5AV9 D;  1P3A A;  3KWQ A;  3TU4 A;  3AZI A;  1N1J A;  1F66 C;  3A1K A;  1KX5 C;  3VH5 W;  3EPH A;  2UWX A;  5AY8 A;  3AFA B;  3X1S A;  3LZ0 C;  4J8U D;  2DF4 C;  5B31 B;  3C1C B;  3LZ1 D;  4KUD D;  1R4V A;  2HIO B;  4LD9 D;  4H9Q A;  2ARO B;  3WTP D;  3KXB A;  1ZLA C;  4YS3 B;  1B67 A;  4JJN D;  5BO0 A;  3REH B;  5B0Z D;  5AV9 B;  1P3P B;  2YFV B;  4WU8 D;  4ZBJ C;  3AZK C;  4Z5T A;  1P3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...