3TU4B

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
b'GGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
molecule keywords Histone H3.2
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4B00
3KUYB 2FJ7D 5BNVA 1P3OA 3RELA 3B6FD 1A7WA 1M19C 4J8UC 4Z2MH 3LZ0D 3AZEC 4UUZB 5JA4A 4WNNB 5B24C 3MGSC 3MNNC 4WU9C 1ID3C 4E44A 1P34B 3AZIA 5AY8B 1KX3A 5B1LD 4R8PA 1P3MC 1U35A 3WKJD 4XUJC 3TU4D 4CAYB 5BS7A 3MVDA 3REJC 1WWIA 4J8WD 2HIOC 1P3BD 3X1TC 5GT0A 3AZHC 4Z66C 4H9OA 3REKB 3AV1C 5AVBB 1BH8A 4Z5TB 3V9RB 3REIC 3A6ND 4EO5C 1AOID 5JRGB 4KGCD 1M18D 2RVQC 3LZ1B 3MGRB 1EQZA 3AZJB 2L5AA 2PYOD 3C1BB 2F8NB 5CHLB 3KWQB 3AYWC 5DNNC 5CPIB 3X1UC 3VH5T 3UT9C 2BYMA 5F99D 2YFVB 3AFAA 3AZFC 4J8XD 1M1AB 5AV8D 5B0ZD 5B40B 3AZLB 3WTPD 2CV5A 3W99C 4YM6D 4JJNB 1S32A 3UTAB 1P3PB 5CP6D 4LD9D 3AN2D 1P3ID 3AZKB 5KDMA 4XZQA 4X23A 2FJ7B 3AV2A 3B6FB 5AV5A 3KXBC 1F1EA 1P3AD 5AV9A 5FUGA 3LZ0B 1TZYD 3W98A 5E5AA 4QLCA 3AZGC 3AZNA 5B1LB 3WKJB 1P3FA 1H3OB 2NZDA 5B2IB 3TU4B 4WU8D 3W96C 5B1MD 1KX4C 4J8VA 5AVCC 4J8WB 3UTBD 1HTAA 1P3BB 3NQJA 5GXQD 4YS3D 2NQBD 4KUDA 1HQ3A 1P3KC 5GSUA 5CPJA 3A6NB 3B0DC 4H9NA 3WAAA 3AZMC 4KGCB 1M18B 3B6GD 1B6WA 1AOIC 2PYOB 4E45A 2JSSA 2YFWA 1M19A 1F66D 4J8UA 5F99B 3AZEA 5B24A 3MGSA 4H9RB 3C1CD 5BO0A 3MNNA 5AV8B 4WU9A 5B0ZB 1ID3A 4NE6A 4DRBA 1P3MA 4YM6B 4J8XC 4XUJA 5B31D 3MGQC 5CP6B 3REJA 4LD9B 3WTPC 5AVBD 2HIOA 3LELD 3X1TA 3AZHA 1BH9A 5B0YD 4Z66A 5DNMC 2IO5B 5JRGD 3AV1A 3AN2C 1P3IC 2F8NG 3REIA 5G49A 4H9PA 1P3AB 1TZYB 3W97C 4H9QA 2AROC 3O62D 3MGPC 1R4VA 3REHC 3AYWA 4WU8B 1P3LC 5DNNA 3AZLD 5B1MB 3X1UA 1ZLAD 4HGAB 3UT9A 3UTBB 3AZFA 4JJND 4G92B 5GXQB 4YS3B 2NQBB 3LJAC 3W99A 1P3GC 5BNXA 1N1JA 2BYKB 5GT3B 3B6GB 3B0BA 5B2JC 5B33B 3KUYC 3WTPE 5AV6D 4WZSB 1KX5B 1F66B 3KXBA 3X1VB 1P3OD 3RELD 5B2ID 3C1CB 4CSRA 4ZUXB 3WA9B 1P34C 5AY8C 3AZGA 5B31B 3W96A 4NE3A 1KX4A 3AZID 5AVCA 5BT1D 1KX3D 4R8PD 1TAFA 3LELB 1U35D 3MNNB 5B0YB 3MVDD 3REKC 5AVBC 4Z5TC 1P3KA 5GT0D 3X1SB 5JRGC 3AZMA 1JFIB 3LZ1C 3O62B 1AOIA 3MGRC 3AZJC 3C1BC 4M6BA 3KWQC 5CPIC 5C3IB 4H9SC 1ZLAB 1EQZD 1M1AC 5B40C 3AZLC 5CPKB 4JJNC 4J8XA 2CWEA 3UTAC 1P3PC 3MGQA 2CV5D 3WTPA 3NQUB 4NE5A 4AWLB 1S32D 3AZKC 5B32B 5DNMA 2FJ7C 4KHAB 5AV6B 3AN2A 1P3IA 1KU5A 3B6FC 4X23D 3LZ0C 5BNVB 1P3OB 3RELB 3W97A 3AV2D 2AROA 3MGPA 5JA4B 5B1LC 3REHA 3WKJC 3R45A 5B2IC 3TU4C 1P3LA 5E5AD 3AZIB 4J8WC 4QLCD 3AZND 1KX3B 4R8PB 1P3BC 1U35B 1P3FD 2NZDD 3MVDB 4J8VD 5BT1C 3LJAA 3VH6W 1P3GA 5GT3D 5GT0B 3A6NC 5B33D 4H9OB 4KGCC 1BH8B 1M18C 5GSUD 1KX5D 5CPJD 5B2JA 3X1VD 3KUYA 3WAAD 2PYOC 4ZUXD 3WA9D 5B31G 1EQZB 5F99C 4UUZA 4WNNA 2LY8A 5AV8C 5B0ZC 1M19D 1P34A 4J8UD 2BYMB 5AY8A 3AZED 3AFAB 4YM6C 4CAYA 4WU9D 3MNND 5CP6C 4ZBJB 1ID3D 4LD9C 2CV5B 1P3MD 4G91B 4XUJD 1S32B 1WWSA 3X1SD 2IO5C 3REKA 3KSYA 5AVBA 2HIOD 4Z5TA 3V9RA 3X1TD 4Z66D 5KDMB 4XZQB 4X23B 5JRGA 3AV1D 1P3AC 1TZYC 3REID 3AV2B 3LZ1A 5AV5B 3MGRA 3AZJA 5AV9B 5FUGB 3C1BA 2F8NA 3W98B 2RVQD 3VH6A 3KWQA 4WU8C 5CPIA 5B1MC 4H9SA 4HGAC 5E5AB 2YFVA 3B0CW 3UTBC 4QLCB 3AZNB 5CPKD 1M1AA 2NZDB 1P3FB 4G92C 2HUEB 5DNND 5B40A 3X1UD 5GXQC 3AZLA 4YS3C 4J8VB 3UT9D 2NQBC 3AZFD 4JJNA 3NQJB 3UTAA 1P3PA 5B32D 4KUDB 1HQ3B 3W99D 5GSUB 5GT3C 3B6GC 5CPJB 3AZKA 4H9NB 5B33C 2FJ7A 3WAAB 1KX5C 3B6FA 1F66C 3X1VC 3LZ0A 3C1CC 2F8NH 2YFWB 4ZUXC 1M19B 3WA9C 4J8UB 3AZEB 5B1LA 5B24B 3MGSB 1H3OA 3WKJA 5B2IA 5BO0B 3TU4A 4WU9B 5B31C 1ID3B 4J8WA 2F8NK 3AZGD 3LELC 1P3MB 1P3BA 4XUJB 5B0YC 3W96D 3REJB 1KX4D 5AVCD 2HIOB 3X1TB 3A6NA 3AZHB 1BH9B 4Z66B 3X1SC 3AV1B 1ULYA 4KGCA 1P3KD 1M18A 3REIB 5G49B 4EO5B 3O62C 4H9PB 2PYOA 3AZMD 4H9QB 5C3IC 1BFMA 1ZLAC 5F99A 3AFAD 4H9RA 3AYWB 5AV8A 5B0ZA 5DNNB 3X1UB 3UT9B 5CPKC 4YM6A 3AZFB 5CP6A 4LD9A 3W99B 4AWLC 5BNXB 5B32C 3MGQD 4XZQD 1N1JB 5AV6C 5AV5D 5DNMD 3VH5W 5AV9D 1P3AA 3VH6T 1TZYA 1P3OC 3RELC 3W98D 3KXBB 4WU8A 3W97D 2AROD 4CSRB 5B1MA 3MGPD 3AZIC 3UTBA 1KX3C 3REHD 3AZGB 4R8PC 1U35C 1P3LD 4NFTA 5BS7C 3MVDC 3W96B 5GXQA 1KX4B 4YS3A 2NQBA 1HQ3D 5AVCB 4KUDD 1TAFB 5GT0C 3LJAD 2BYKA 1P3KB 1P3GD 5GT3A 3B6GA 3B0DB 5B33A 3AZMB 1KX5A 1F66A 5B2JD 3X1VA 1AOIB 1EQZC 3KUYD 5B24D 3MGSD 3C1CA 4ZUXA 3WA9A 3AFAC 5B31A 4ZBJC 3REJD 1P34D 2CV5C 5AY8D 3VH5A 3LELA 4G91C 4J8XB 3AZHD 1S32C 5B0YA 3MGQB 3WTPB 4Z2MG 3B0CT 4XZQC 3X1SA 5DNMB 4X23C 3REKD 1B67A 1JFIA 4Z5TD 3AN2B 1P3IB 1Q9CA 3AV2C 5AV5C 3O62A 5AV9C 3W98C 3AYWD 3W97B 3LZ1D 2AROB 3MGPB 5E5AC 5B32G 3MGRD 3AZJD 1ZLAA 4QLCC 4WV4B 3C1BD 3REHB 3AZNC 2F8ND 3KWQD 3R45B 1P3FC 2NZDC 1P3LB 2HUEC 5CPID 4DRAA 4J8VC 5CPKA 1M1AD 5B40D 4KUDC 3NQUA 1HQ3C 3LJAB 5GSUC 1P3GB 3UTAD 5CPJC 1P3PD 5B32A 3WAAC 4KHAA 5AV6A 3AZKD 3KXBD 5B2JB
chains in the Genus database with same CATH superfamily
3KUYB 2FJ7D 5BNVA 1P3OA 3RELA 3B6FD 1A7WA 1M19C 4J8UC 4Z2MH 3LZ0D 3AZEC 4UUZB 2W8SA 4WNNB 5JA4A 5B24C 3MGSC 3P5JB 3MNNC 4WU9C 1ID3C 4E44A 1P34B 3AZIA 5AY8B 1KX3A 5B1LD 4R8PA 1P3MC 1U35A 3WKJD 4XUJC 3TU4D 4CAYB 5BS7A 3MVDA 3REJC 1WWIA 4J8WD 2HIOC 1P3BD 3X1TC 5GT0A 3AZHC 4Z66C 4H9OA 3REKB 3AV1C 5AVBB 1BH8A 4Z5TB 3V9RB 3REIC 3A6ND 4EO5C 1AOID 5JRGB 4KGCD 2XD5A 1M18D 2RVQC 3LZ1B 3MGRB 1EQZA 3AZJB 2L5AA 2PYOD 3C1BB 2F8NB 2F2AC 5CHLB 3KWQB 3AYWC 5DNNC 5CPIB 3X1UC 3KFUG 3VH5T 3UT9C 2BYMA 5F99D 3H0LC 2YFVB 3AFAA 3AZFC 4J8XD 1M1AB 5AV8D 5B0ZD 5B40B 3AZLB 3WTPD 2CV5A 3W99C 2RIQA 4YM6D 4JJNB 1S32A 3UTAB 1P3PB 5CP6D 4LD9D 3AN2D 1P3ID 3AZKB 5KDMA 4XZQA 1W2EA 4X23A 2FJ7B 3AV2A 3B6FB 5AV5A 3KXBC 1F1EA 1P3AD 5AV9A 5FUGA 3LZ0B 1TZYD 3W98A 5E5AA 2JCHA 3FDDA 4QLCA 3AZGC 3AZNA 5B1LB 3WKJB 3IP4C 1H3OB 1P3FA 5B2IB 3TU4B 4WU8D 2NZDA 3W96C 5B1MD 1KX4C 4J8VA 5AVCC 2Y2NA 4J8WB 3UTBD 1HTAA 1P3BB 3NQJA 5GXQD 4YS3D 2NQBD 4KUDA 1HQ3A 1P3KC 5GSUA 5CPJA 3A6NB 3B0DC 4H9NA 3WAAA 2Y2JA 3AZMC 4KGCB 1M18B 3B6GD 1B6WA 1AOIC 2PYOB 4E45A 2JSSA 2YFWA 1M19A 1F66D 4J8UA 2Y2PA 5F99B 3AZEA 5B24A 3MGSA 4H9RB 3C1CD 5BO0A 3MNNA 5AV8B 4WU9A 5B0ZB 1ID3A 2XD1A 4NE6A 4DRBA 1P3MA 4YM6B 4J8XC 4XUJA 5B31D 3MGQC 2ZM5A 5CP6B 3REJA 4LD9B 3WTPC 5AVBD 2DQNC 2HIOA 3LELD 2Y2GA 3X1TA 3AZHA 1BH9A 5B0YD 4Z66A 5DNMC 2IO5B 5JRGD 3AV1A 3AN2C 1P3IC 2F8NG 3REIA 5G49A 4H9PA 1P3AB 1TZYB 2Y2MA 3W97C 4H9QA 2AROC 2G5IC 3O62D 3MGPC 1R4VA 3REHC 3AYWA 4WU8B 1P3LC 5DNNA 3AZLD 5B1MB 3X1UA 1ZLAD 4HGAB 3UT9A 3UTBB 3AZFA 4JJND 4G92B 5GXQB 4YS3B 2NQBB 3LJAC 3W99A 1P3GC 5BNXA 1N1JA 2BYKB 2Y2OA 5GT3B 3B6GB 3B0BA 5B2JC 5B33B 3KUYC 3WTPE 5AV6D 4WZSB 1KX5B 1F66B 3KXBA 3X1VB 1P3OD 3RELD 5B2ID 3C1CB 4CSRA 4ZUXB 2UWXA 3WA9B 1P34C 5AY8C 3AZGA 5B31B 3W96A 4NE3A 1KX4A 3AZID 5AVCA 5BT1D 1KX3D 4R8PD 1TAFA 3LELB 1U35D 3MNNB 5B0YB 3MVDD 3REKC 2Y2LA 5AVBC 4Z5TC 1P3KA 5GT0D 3X1SB 5JRGC 3AZMA 1JFIB 2Y2KA 3LZ1C 3O62B 1AOIA 3MGRC 3AZJC 3C1BC 4M6BA 3KWQC 3A1IA 5CPIC 5C3IB 4H9SC 1ZLAB 1EQZD 2JE5A 1M1AC 1T3UA 5B40C 3AZLC 5CPKB 4JJNC 4J8XA 2CWEA 2Y2HA 3H0RC 3UTAC 1P3PC 3MGQA 2J8PA 2CV5D 3WTPA 3NQUB 4NE5A 1Z2CB 4AWLB 1S32D 3AZKC 5B32B 5DNMA 2FJ7C 4KHAB 5AV6B 3AN2A 1P3IA 1KU5A 3B6FC 4X23D 3LZ0C 5BNVB 1P3OB 3RELB 3W97A 3AV2D 2AROA 3MGPA 5JA4B 5B1LC 3REHA 3WKJC 3R45A 5B2IC 3TU4C 1P3LA 5E5AD 3AZIB 4J8WC 4QLCD 3AZND 1KX3B 4R8PB 1P3BC 1U35B 1P3FD 2NZDD 2Y2QA 3MVDB 4J8VD 5BT1C 3LJAA 3VH6W 1P3GA 5GT3D 5GT0B 3A6NC 4UPKA 5B33D 2BG1A 4H9OB 4KGCC 1BH8B 1M18C 5GSUD 1KX5D 5CPJD 3EPHA 5B2JA 3X1VD 3KUYA 3WAAD 2PYOC 4ZUXD 3WA9D 5B31G 1EQZB 5F99C 4UUZA 2ZY4A 4WNNA 2LY8A 5AV8C 5B0ZC 1M19D 1P34A 3EG5B 4J8UD 2BYMB 5AY8A 3AZED 3AFAB 4YM6C 4CAYA 4WU9D 3MNND 5CP6C 4ZBJB 1ID3D 4LD9C 3EPKA 2CV5B 1P3MD 4G91B 4XUJD 1S32B 1WWSA 3X1SD 2IO5C 3REKA 3KSYA 5AVBA 3KXBD 2HIOD 4Z5TA 3V9RA 3X1TD 4Z66D 5KDMB 4XZQB 4X23B 5JRGA 3AV1D 1P3AC 1TZYC 3REID 3AV2B 3LZ1A 5AV5B 3MGRA 3AZJA 5AV9B 5FUGB 3C1BA 2F8NA 3W98B 2RVQD 3VH6A 3KWQA 4WU8C 5CPIA 5B1MC 4H9SA 4HGAC 5E5AB 2YFVA 3B0CW 3UTBC 4QLCB 3AZNB 5CPKD 1M1AA 2NZDB 1P3FB 4G92C 2HUEB 5DNND 5B40A 3X1UD 5GXQC 3AZLA 4YS3C 4J8VB 3UT9D 2NQBC 3AZFD 4JJNA 3NQJB 3UTAA 1P3PA 5B32D 4KUDB 1HQ3B 3W99D 2ZY2A 5GSUB 5GT3C 3B6GC 5CPJB 3AZKA 4H9NB 5B33C 2FJ7A 3WAAB 1KX5C 3B6FA 1F66C 3X1VC 3LZ0A 3C1CC 2F8NH 3H0MC 2YFWB 4ZUXC 1M19B 3WA9C 4J8UB 3AZEB 5B1LA 5B24B 3MGSB 1H3OA 3WKJA 5B2IA 5BO0B 3TU4A 4WU9B 5B31C 1ID3B 4J8WA 2F8NK 3AZGD 3LELC 1P3MB 1P3BA 4XUJB 5B0YC 3W96D 3REJB 1KX4D 5AVCD 2HIOB 3X1TB 3A6NA 3AZHB 1BH9B 4Z66B 3X1SC 3AV1B 1ULYA 3A1KA 4KGCA 1P3KD 1M18A 3REIB 5G49B 4EO5B 3O62C 4H9PB 2VQRA 3AZMD 2PYOA 4H9QB 5C3IC 1BFMA 1ZLAC 5F99A 3AFAD 4H9RA 3AYWB 5AV8A 5B0ZA 5DNNB 3X1UB 3UT9B 5CPKC 4YM6A 3AZFB 5CP6A 4LD9A 3W99B 4AWLC 2DF4C 5BNXB 4DQYB 5B32C 2Y2IA 3MGQD 4XZQD 1N1JB 4WJ3C 5AV6C 5AV5D 5DNMD 3VH5W 5AV9D 1P3AA 3VH6T 1TZYA 1P3OC 3RELC 3W98D 3KXBB 3EPLA 4WU8A 3W97D 2AROD 4CSRB 5B1MA 3MGPD 3AZIC 3UTBA 1KX3C 3REHD 3AZGB 4R8PC 1U35C 1P3LD 4NFTA 5BS7C 3MVDC 3W96B 5GXQA 1KX4B 4YS3A 2NQBA 1HQ3D 2ZY5A 5AVCB 4KUDD 1TAFB 5GT0C 3LJAD 2G5HC 2BYKA 1P3KB 1P3GD 5GT3A 3B6GA 3B0DB 5B33A 3AZMB 1KX5A 3EPJA 1F66A 3AL0C 5B2JD 3X1VA 1AOIB 1EQZC 3KUYD 5B24D 3MGSD 3C1CA 4ZUXA 3WA9A 3AFAC 5B31A 2FFFB 4ZBJC 3REJD 1P34D 2CV5C 5AY8D 3VH5A 3LELA 4G91C 4J8XB 3AZHD 1S32C 5B0YA 3MGQB 3WTPB 4Z2MG 3B0CT 4XZQC 2ZY3A 3X1SA 4X23C 5DNMB 1B67A 3REKD 1JFIA 4Z5TD 3AN2B 1P3IB 1Q9CA 3AV2C 5AV5C 3O62A 5AV9C 3W98C 3AYWD 3W97B 3LZ1D 2AROB 3MGPB 5E5AC 5B32G 3MGRD 3AZJD 1ZLAA 4QLCC 4WV4B 3C1BD 3REHB 3AZNC 2F8ND 3KWQD 3R45B 1P3FC 2NZDC 1P3LB 2HUEC 5CPID 4DRAA 4J8VC 5CPKA 1M1AD 5B40D 3F6TA 4KUDC 3NQUA 1HQ3C 3LJAB 5GSUC 1P3GB 3UTAD 5CPJC 1P3PD 5B32A 3WAAC 4KHAA 5AV6A 3AZKD 1PZRA 5B2JB
chains in the Genus database with same CATH topology
3KUYB 2FJ7D 5BNVA 1P3OA 3RELA 3B6FD 1A7WA 1M19C 4J8UC 4Z2MH 3LZ0D 3AZEC 4UUZB 2W8SA 4WNNB 5JA4A 5B24C 3MGSC 3P5JB 3MNNC 4WU9C 1ID3C 4E44A 1P34B 3AZIA 5AY8B 1KX3A 5B1LD 4R8PA 1P3MC 1U35A 3WKJD 4XUJC 3TU4D 4CAYB 5BS7A 3MVDA 3REJC 1WWIA 4J8WD 2HIOC 1P3BD 3X1TC 5GT0A 3AZHC 4Z66C 4H9OA 3REKB 3AV1C 5AVBB 1BH8A 4Z5TB 3V9RB 3REIC 3A6ND 4EO5C 1AOID 5JRGB 4KGCD 2XD5A 1M18D 2RVQC 3LZ1B 3MGRB 1EQZA 3AZJB 2L5AA 2PYOD 3C1BB 2F8NB 2F2AC 5CHLB 3KWQB 3AYWC 5DNNC 5CPIB 3X1UC 3KFUG 3VH5T 3UT9C 2BYMA 5F99D 3H0LC 2YFVB 3AFAA 3AZFC 4J8XD 1M1AB 5AV8D 5B0ZD 5B40B 3AZLB 3WTPD 2CV5A 3W99C 2RIQA 4YM6D 4JJNB 1S32A 3UTAB 1P3PB 5CP6D 4LD9D 3AN2D 1P3ID 3AZKB 5KDMA 4XZQA 1W2EA 4X23A 2FJ7B 3AV2A 3B6FB 5AV5A 3KXBC 1F1EA 1P3AD 5AV9A 5FUGA 3LZ0B 1TZYD 3W98A 5E5AA 2JCHA 3FDDA 4QLCA 3AZGC 3AZNA 5B1LB 3WKJB 3IP4C 1H3OB 1P3FA 5B2IB 3TU4B 4WU8D 2NZDA 3W96C 5B1MD 1KX4C 4J8VA 5AVCC 2Y2NA 4J8WB 3UTBD 1HTAA 1P3BB 3NQJA 5GXQD 4YS3D 2NQBD 4KUDA 1HQ3A 1P3KC 5GSUA 5CPJA 3A6NB 3B0DC 4H9NA 3WAAA 2Y2JA 3AZMC 4KGCB 1M18B 3B6GD 1B6WA 1AOIC 2PYOB 4E45A 2JSSA 2YFWA 1M19A 1F66D 4J8UA 2Y2PA 5F99B 3AZEA 5B24A 3MGSA 4H9RB 3C1CD 5BO0A 3MNNA 5AV8B 4WU9A 5B0ZB 1ID3A 2XD1A 4NE6A 4DRBA 1P3MA 4YM6B 4J8XC 4XUJA 5B31D 3MGQC 2ZM5A 5CP6B 3REJA 4LD9B 3WTPC 5AVBD 2DQNC 2HIOA 3LELD 2Y2GA 3X1TA 3AZHA 1BH9A 5B0YD 4Z66A 5DNMC 2IO5B 5JRGD 3AV1A 3AN2C 1P3IC 2F8NG 3REIA 5G49A 4H9PA 1P3AB 1TZYB 2Y2MA 3W97C 4H9QA 2AROC 2G5IC 3O62D 3MGPC 1R4VA 3REHC 3AYWA 4WU8B 1P3LC 5DNNA 3AZLD 5B1MB 3X1UA 1ZLAD 4HGAB 3UT9A 3UTBB 3AZFA 4JJND 4G92B 5GXQB 4YS3B 2NQBB 3LJAC 3W99A 1P3GC 5BNXA 1N1JA 2BYKB 2Y2OA 5GT3B 3B6GB 3B0BA 5B2JC 5B33B 3KUYC 3WTPE 5AV6D 4WZSB 1KX5B 1F66B 3KXBA 3X1VB 1P3OD 3RELD 5B2ID 3C1CB 4CSRA 4ZUXB 2UWXA 3WA9B 1P34C 5AY8C 3AZGA 5B31B 3W96A 4NE3A 1KX4A 3AZID 5AVCA 5BT1D 1KX3D 4R8PD 1TAFA 3LELB 1U35D 3MNNB 5B0YB 3MVDD 3REKC 2Y2LA 5AVBC 4Z5TC 1P3KA 5GT0D 3X1SB 5JRGC 3AZMA 1JFIB 2Y2KA 3LZ1C 3O62B 1AOIA 3MGRC 3AZJC 3C1BC 4M6BA 3KWQC 3A1IA 5CPIC 5C3IB 4H9SC 1ZLAB 1EQZD 2JE5A 1M1AC 1T3UA 5B40C 3AZLC 5CPKB 4JJNC 4J8XA 2CWEA 2Y2HA 3H0RC 3UTAC 1P3PC 3MGQA 2J8PA 2CV5D 3WTPA 3NQUB 4NE5A 1Z2CB 4AWLB 1S32D 3AZKC 5B32B 5DNMA 2FJ7C 4KHAB 5AV6B 3AN2A 1P3IA 1KU5A 3B6FC 4X23D 3LZ0C 5BNVB 1P3OB 3RELB 3W97A 3AV2D 2AROA 3MGPA 5JA4B 5B1LC 3REHA 3WKJC 3R45A 5B2IC 3TU4C 1P3LA 5E5AD 3AZIB 4J8WC 4QLCD 3AZND 1KX3B 4R8PB 1P3BC 1U35B 1P3FD 2NZDD 2Y2QA 3MVDB 4J8VD 5BT1C 3LJAA 3VH6W 1P3GA 5GT3D 5GT0B 3A6NC 4UPKA 5B33D 2BG1A 4H9OB 4KGCC 1BH8B 1M18C 5GSUD 1KX5D 5CPJD 3EPHA 5B2JA 3X1VD 3KUYA 3WAAD 2PYOC 4ZUXD 3WA9D 5B31G 1EQZB 5F99C 4UUZA 2ZY4A 4WNNA 2LY8A 5AV8C 5B0ZC 1M19D 1P34A 3EG5B 4J8UD 2BYMB 5AY8A 3AZED 3AFAB 4YM6C 4CAYA 4WU9D 3MNND 5CP6C 4ZBJB 1ID3D 4LD9C 3EPKA 2CV5B 1P3MD 4G91B 4XUJD 1S32B 1WWSA 3X1SD 2IO5C 3REKA 3KSYA 5AVBA 3KXBD 2HIOD 4Z5TA 3V9RA 3X1TD 4Z66D 5KDMB 4XZQB 4X23B 5JRGA 3AV1D 1P3AC 1TZYC 3REID 3AV2B 3LZ1A 5AV5B 3MGRA 3AZJA 5AV9B 5FUGB 3C1BA 2F8NA 3W98B 2RVQD 3VH6A 3KWQA 4WU8C 5CPIA 5B1MC 4H9SA 4HGAC 5E5AB 2YFVA 3B0CW 3UTBC 4QLCB 3AZNB 5CPKD 1M1AA 2NZDB 1P3FB 4G92C 2HUEB 5DNND 5B40A 3X1UD 5GXQC 3AZLA 4YS3C 4J8VB 3UT9D 2NQBC 3AZFD 4JJNA 3NQJB 3UTAA 1P3PA 5B32D 4KUDB 1HQ3B 3W99D 2ZY2A 5GSUB 5GT3C 3B6GC 5CPJB 3AZKA 4H9NB 5B33C 2FJ7A 3WAAB 1KX5C 3B6FA 1F66C 3X1VC 3LZ0A 3C1CC 2F8NH 3H0MC 2YFWB 4ZUXC 1M19B 3WA9C 4J8UB 3AZEB 5B1LA 5B24B 3MGSB 1H3OA 3WKJA 5B2IA 5BO0B 3TU4A 4WU9B 5B31C 1ID3B 4J8WA 2F8NK 3AZGD 3LELC 1P3MB 1P3BA 4XUJB 5B0YC 3W96D 3REJB 1KX4D 5AVCD 2HIOB 3X1TB 3A6NA 3AZHB 1BH9B 4Z66B 3X1SC 3AV1B 1ULYA 3A1KA 4KGCA 1P3KD 1M18A 3REIB 5G49B 4EO5B 3O62C 4H9PB 2VQRA 3AZMD 2PYOA 4H9QB 5C3IC 1BFMA 1ZLAC 5F99A 3AFAD 4H9RA 3AYWB 5AV8A 5B0ZA 5DNNB 3X1UB 3UT9B 5CPKC 4YM6A 3AZFB 5CP6A 4LD9A 3W99B 4AWLC 2DF4C 5BNXB 4DQYB 5B32C 2Y2IA 3MGQD 4XZQD 1N1JB 4WJ3C 5AV6C 5AV5D 5DNMD 3VH5W 5AV9D 1P3AA 3VH6T 1TZYA 1P3OC 3RELC 3W98D 3KXBB 3EPLA 4WU8A 3W97D 2AROD 4CSRB 5B1MA 3MGPD 3AZIC 3UTBA 1KX3C 3REHD 3AZGB 4R8PC 1U35C 1P3LD 4NFTA 5BS7C 3MVDC 3W96B 5GXQA 1KX4B 4YS3A 2NQBA 1HQ3D 2ZY5A 5AVCB 4KUDD 1TAFB 5GT0C 3LJAD 2G5HC 2BYKA 1P3KB 1P3GD 5GT3A 3B6GA 3B0DB 5B33A 3AZMB 1KX5A 3EPJA 1F66A 3AL0C 5B2JD 3X1VA 1AOIB 1EQZC 3KUYD 5B24D 3MGSD 3C1CA 4ZUXA 3WA9A 3AFAC 5B31A 2FFFB 4ZBJC 3REJD 1P34D 2CV5C 5AY8D 3VH5A 3LELA 4G91C 4J8XB 3AZHD 1S32C 5B0YA 3MGQB 3WTPB 4Z2MG 3B0CT 4XZQC 2ZY3A 3X1SA 4X23C 5DNMB 1B67A 3REKD 1JFIA 4Z5TD 3AN2B 1P3IB 1Q9CA 3AV2C 5AV5C 3O62A 5AV9C 3W98C 3AYWD 3W97B 3LZ1D 2AROB 3MGPB 5E5AC 5B32G 3MGRD 3AZJD 1ZLAA 4QLCC 4WV4B 3C1BD 3REHB 3AZNC 2F8ND 3KWQD 3R45B 1P3FC 2NZDC 1P3LB 2HUEC 5CPID 4DRAA 4J8VC 5CPKA 1M1AD 5B40D 3F6TA 4KUDC 3NQUA 1HQ3C 3LJAB 5GSUC 1P3GB 3UTAD 5CPJC 1P3PD 5B32A 3WAAC 4KHAA 5AV6A 3AZKD 1PZRA 5B2JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY B;  2FJ7 D;  5BNV A;  1P3O A;  3REL A;  3B6F D;  1A7W A;  1M19 C;  4J8U C;  4Z2M H;  3LZ0 D;  3AZE C;  4UUZ B;  5JA4 A;  4WNN B;  5B24 C;  3MGS C;  3MNN C;  4WU9 C;  1ID3 C;  4E44 A;  1P34 B;  3AZI A;  5AY8 B;  1KX3 A;  5B1L D;  4R8P A;  1P3M C;  1U35 A;  3WKJ D;  4XUJ C;  3TU4 D;  4CAY B;  5BS7 A;  3MVD A;  3REJ C;  1WWI A;  4J8W D;  2HIO C;  1P3B D;  3X1T C;  5GT0 A;  3AZH C;  4Z66 C;  4H9O A;  3REK B;  3AV1 C;  5AVB B;  1BH8 A;  4Z5T B;  3V9R B;  3REI C;  3A6N D;  4EO5 C;  1AOI D;  5JRG B;  4KGC D;  1M18 D;  2RVQ C;  3LZ1 B;  3MGR B;  1EQZ A;  3AZJ B;  2L5A A;  2PYO D;  3C1B B;  2F8N B;  5CHL B;  3KWQ B;  3AYW C;  5DNN C;  5CPI B;  3X1U C;  3VH5 T;  3UT9 C;  2BYM A;  5F99 D;  2YFV B;  3AFA A;  3AZF C;  4J8X D;  1M1A B;  5AV8 D;  5B0Z D;  5B40 B;  3AZL B;  3WTP D;  2CV5 A;  3W99 C;  4YM6 D;  4JJN B;  1S32 A;  3UTA B;  1P3P B;  5CP6 D;  4LD9 D;  3AN2 D;  1P3I D;  3AZK B;  5KDM A;  4XZQ A;  4X23 A;  2FJ7 B;  3AV2 A;  3B6F B;  5AV5 A;  3KXB C;  1F1E A;  1P3A D;  5AV9 A;  5FUG A;  3LZ0 B;  1TZY D;  3W98 A;  5E5A A;  4QLC A;  3AZG C;  3AZN A;  5B1L B;  3WKJ B;  1P3F A;  1H3O B;  2NZD A;  5B2I B;  3TU4 B;  4WU8 D;  3W96 C;  5B1M D;  1KX4 C;  4J8V A;  5AVC C;  4J8W B;  3UTB D;  1HTA A;  1P3B B;  3NQJ A;  5GXQ D;  4YS3 D;  2NQB D;  4KUD A;  1HQ3 A;  1P3K C;  5GSU A;  5CPJ A;  3A6N B;  3B0D C;  4H9N A;  3WAA A;  3AZM C;  4KGC B;  1M18 B;  3B6G D;  1B6W A;  1AOI C;  2PYO B;  4E45 A;  2JSS A;  2YFW A;  1M19 A;  1F66 D;  4J8U A;  5F99 B;  3AZE A;  5B24 A;  3MGS A;  4H9R B;  3C1C D;  5BO0 A;  3MNN A;  5AV8 B;  4WU9 A;  5B0Z B;  1ID3 A;  4NE6 A;  4DRB A;  1P3M A;  4YM6 B;  4J8X C;  4XUJ A;  5B31 D;  3MGQ C;  5CP6 B;  3REJ A;  4LD9 B;  3WTP C;  5AVB D;  2HIO A;  3LEL D;  3X1T A;  3AZH A;  1BH9 A;  5B0Y D;  4Z66 A;  5DNM C;  2IO5 B;  5JRG D;  3AV1 A;  3AN2 C;  1P3I C;  2F8N G;  3REI A;  5G49 A;  4H9P A;  1P3A B;  1TZY B;  3W97 C;  4H9Q A;  2ARO C;  3O62 D;  3MGP C;  1R4V A;  3REH C;  3AYW A;  4WU8 B;  1P3L C;  5DNN A;  3AZL D;  5B1M B;  3X1U A;  1ZLA D;  4HGA B;  3UT9 A;  3UTB B;  3AZF A;  4JJN D;  4G92 B;  5GXQ B;  4YS3 B;  2NQB B;  3LJA C;  3W99 A;  1P3G C;  5BNX A;  1N1J A;  2BYK B;  5GT3 B;  3B6G B;  3B0B A;  5B2J C;  5B33 B;  3KUY C;  3WTP E;  5AV6 D;  4WZS B;  1KX5 B;  1F66 B;  3KXB A;  3X1V B;  1P3O D;  3REL D;  5B2I D;  3C1C B;  4CSR A;  4ZUX B;  3WA9 B;  1P34 C;  5AY8 C;  3AZG A;  5B31 B;  3W96 A;  4NE3 A;  1KX4 A;  3AZI D;  5AVC A;  5BT1 D;  1KX3 D;  4R8P D;  1TAF A;  3LEL B;  1U35 D;  3MNN B;  5B0Y B;  3MVD D;  3REK C;  5AVB C;  4Z5T C;  1P3K A;  5GT0 D;  3X1S B;  5JRG C;  3AZM A;  1JFI B;  3LZ1 C;  3O62 B;  1AOI A;  3MGR C;  3AZJ C;  3C1B C;  4M6B A;  3KWQ C;  5CPI C;  5C3I B;  4H9S C;  1ZLA B;  1EQZ D;  1M1A C;  5B40 C;  3AZL C;  5CPK B;  4JJN C;  4J8X A;  2CWE A;  3UTA C;  1P3P C;  3MGQ A;  2CV5 D;  3WTP A;  3NQU B;  4NE5 A;  4AWL B;  1S32 D;  3AZK C;  5B32 B;  5DNM A;  2FJ7 C;  4KHA B;  5AV6 B;  3AN2 A;  1P3I A;  1KU5 A;  3B6F C;  4X23 D;  3LZ0 C;  5BNV B;  1P3O B;  3REL B;  3W97 A;  3AV2 D;  2ARO A;  3MGP A;  5JA4 B;  5B1L C;  3REH A;  3WKJ C;  3R45 A;  5B2I C;  3TU4 C;  1P3L A;  5E5A D;  3AZI B;  4J8W C;  4QLC D;  3AZN D;  1KX3 B;  4R8P B;  1P3B C;  1U35 B;  1P3F D;  2NZD D;  3MVD B;  4J8V D;  5BT1 C;  3LJA A;  3VH6 W;  1P3G A;  5GT3 D;  5GT0 B;  3A6N C;  5B33 D;  4H9O B;  4KGC C;  1BH8 B;  1M18 C;  5GSU D;  1KX5 D;  5CPJ D;  5B2J A;  3X1V D;  3KUY A;  3WAA D;  2PYO C;  4ZUX D;  3WA9 D;  5B31 G;  1EQZ B;  5F99 C;  4UUZ A;  4WNN A;  2LY8 A;  5AV8 C;  5B0Z C;  1M19 D;  1P34 A;  4J8U D;  2BYM B;  5AY8 A;  3AZE D;  3AFA B;  4YM6 C;  4CAY A;  4WU9 D;  3MNN D;  5CP6 C;  4ZBJ B;  1ID3 D;  4LD9 C;  2CV5 B;  1P3M D;  4G91 B;  4XUJ D;  1S32 B;  1WWS A;  3X1S D;  2IO5 C;  3REK A;  3KSY A;  5AVB A;  2HIO D;  4Z5T A;  3V9R A;  3X1T D;  4Z66 D;  5KDM B;  4XZQ B;  4X23 B;  5JRG A;  3AV1 D;  1P3A C;  1TZY C;  3REI D;  3AV2 B;  3LZ1 A;  5AV5 B;  3MGR A;  3AZJ A;  5AV9 B;  5FUG B;  3C1B A;  2F8N A;  3W98 B;  2RVQ D;  3VH6 A;  3KWQ A;  4WU8 C;  5CPI A;  5B1M C;  4H9S A;  4HGA C;  5E5A B;  2YFV A;  3B0C W;  3UTB C;  4QLC B;  3AZN B;  5CPK D;  1M1A A;  2NZD B;  1P3F B;  4G92 C;  2HUE B;  5DNN D;  5B40 A;  3X1U D;  5GXQ C;  3AZL A;  4YS3 C;  4J8V B;  3UT9 D;  2NQB C;  3AZF D;  4JJN A;  3NQJ B;  3UTA A;  1P3P A;  5B32 D;  4KUD B;  1HQ3 B;  3W99 D;  5GSU B;  5GT3 C;  3B6G C;  5CPJ B;  3AZK A;  4H9N B;  5B33 C;  2FJ7 A;  3WAA B;  1KX5 C;  3B6F A;  1F66 C;  3X1V C;  3LZ0 A;  3C1C C;  2F8N H;  2YFW B;  4ZUX C;  1M19 B;  3WA9 C;  4J8U B;  3AZE B;  5B1L A;  5B24 B;  3MGS B;  1H3O A;  3WKJ A;  5B2I A;  5BO0 B;  3TU4 A;  4WU9 B;  5B31 C;  1ID3 B;  4J8W A;  2F8N K;  3AZG D;  3LEL C;  1P3M B;  1P3B A;  4XUJ B;  5B0Y C;  3W96 D;  3REJ B;  1KX4 D;  5AVC D;  2HIO B;  3X1T B;  3A6N A;  3AZH B;  1BH9 B;  4Z66 B;  3X1S C;  3AV1 B;  1ULY A;  4KGC A;  1P3K D;  1M18 A;  3REI B;  5G49 B;  4EO5 B;  3O62 C;  4H9P B;  2PYO A;  3AZM D;  4H9Q B;  5C3I C;  1BFM A;  1ZLA C;  5F99 A;  3AFA D;  4H9R A;  3AYW B;  5AV8 A;  5B0Z A;  5DNN B;  3X1U B;  3UT9 B;  5CPK C;  4YM6 A;  3AZF B;  5CP6 A;  4LD9 A;  3W99 B;  4AWL C;  5BNX B;  5B32 C;  3MGQ D;  4XZQ D;  1N1J B;  5AV6 C;  5AV5 D;  5DNM D;  3VH5 W;  5AV9 D;  1P3A A;  3VH6 T;  1TZY A;  1P3O C;  3REL C;  3W98 D;  3KXB B;  4WU8 A;  3W97 D;  2ARO D;  4CSR B;  5B1M A;  3MGP D;  3AZI C;  3UTB A;  1KX3 C;  3REH D;  3AZG B;  4R8P C;  1U35 C;  1P3L D;  4NFT A;  5BS7 C;  3MVD C;  3W96 B;  5GXQ A;  1KX4 B;  4YS3 A;  2NQB A;  1HQ3 D;  5AVC B;  4KUD D;  1TAF B;  5GT0 C;  3LJA D;  2BYK A;  1P3K B;  1P3G D;  5GT3 A;  3B6G A;  3B0D B;  5B33 A;  3AZM B;  1KX5 A;  1F66 A;  5B2J D;  3X1V A;  1AOI B;  1EQZ C;  3KUY D;  5B24 D;  3MGS D;  3C1C A;  4ZUX A;  3WA9 A;  3AFA C;  5B31 A;  4ZBJ C;  3REJ D;  1P34 D;  2CV5 C;  5AY8 D;  3VH5 A;  3LEL A;  4G91 C;  4J8X B;  3AZH D;  1S32 C;  5B0Y A;  3MGQ B;  3WTP B;  4Z2M G;  3B0C T;  4XZQ C;  3X1S A;  5DNM B;  4X23 C;  3REK D;  1B67 A;  1JFI A;  4Z5T D;  3AN2 B;  1P3I B;  1Q9C A;  3AV2 C;  5AV5 C;  3O62 A;  5AV9 C;  3W98 C;  3AYW D;  3W97 B;  3LZ1 D;  2ARO B;  3MGP B;  5E5A C;  5B32 G;  3MGR D;  3AZJ D;  1ZLA A;  4QLC C;  4WV4 B;  3C1B D;  3REH B;  3AZN C;  2F8N D;  3KWQ D;  3R45 B;  1P3F C;  2NZD C;  1P3L B;  2HUE C;  5CPI D;  4DRA A;  4J8V C;  5CPK A;  1M1A D;  5B40 D;  4KUD C;  3NQU A;  1HQ3 C;  3LJA B;  5GSU C;  1P3G B;  3UTA D;  5CPJ C;  1P3P D;  5B32 A;  3WAA C;  4KHA A;  5AV6 A;  3AZK D;  3KXB D;  5B2J B; 
#chains in the Genus database with same CATH topology
 3KUY B;  2FJ7 D;  5BNV A;  1P3O A;  3REL A;  3B6F D;  1A7W A;  1M19 C;  4J8U C;  4Z2M H;  3LZ0 D;  3AZE C;  4UUZ B;  2W8S A;  4WNN B;  5JA4 A;  5B24 C;  3MGS C;  3P5J B;  3MNN C;  4WU9 C;  1ID3 C;  4E44 A;  1P34 B;  3AZI A;  5AY8 B;  1KX3 A;  5B1L D;  4R8P A;  1P3M C;  1U35 A;  3WKJ D;  4XUJ C;  3TU4 D;  4CAY B;  5BS7 A;  3MVD A;  3REJ C;  1WWI A;  4J8W D;  2HIO C;  1P3B D;  3X1T C;  5GT0 A;  3AZH C;  4Z66 C;  4H9O A;  3REK B;  3AV1 C;  5AVB B;  1BH8 A;  4Z5T B;  3V9R B;  3REI C;  3A6N D;  4EO5 C;  1AOI D;  5JRG B;  4KGC D;  2XD5 A;  1M18 D;  2RVQ C;  3LZ1 B;  3MGR B;  1EQZ A;  3AZJ B;  2L5A A;  2PYO D;  3C1B B;  2F8N B;  2F2A C;  5CHL B;  3KWQ B;  3AYW C;  5DNN C;  5CPI B;  3X1U C;  3KFU G;  3VH5 T;  3UT9 C;  2BYM A;  5F99 D;  3H0L C;  2YFV B;  3AFA A;  3AZF C;  4J8X D;  1M1A B;  5AV8 D;  5B0Z D;  5B40 B;  3AZL B;  3WTP D;  2CV5 A;  3W99 C;  2RIQ A;  4YM6 D;  4JJN B;  1S32 A;  3UTA B;  1P3P B;  5CP6 D;  4LD9 D;  3AN2 D;  1P3I D;  3AZK B;  5KDM A;  4XZQ A;  1W2E A;  4X23 A;  2FJ7 B;  3AV2 A;  3B6F B;  5AV5 A;  3KXB C;  1F1E A;  1P3A D;  5AV9 A;  5FUG A;  3LZ0 B;  1TZY D;  3W98 A;  5E5A A;  2JCH A;  3FDD A;  4QLC A;  3AZG C;  3AZN A;  5B1L B;  3WKJ B;  3IP4 C;  1H3O B;  1P3F A;  5B2I B;  3TU4 B;  4WU8 D;  2NZD A;  3W96 C;  5B1M D;  1KX4 C;  4J8V A;  5AVC C;  2Y2N A;  4J8W B;  3UTB D;  1HTA A;  1P3B B;  3NQJ A;  5GXQ D;  4YS3 D;  2NQB D;  4KUD A;  1HQ3 A;  1P3K C;  5GSU A;  5CPJ A;  3A6N B;  3B0D C;  4H9N A;  3WAA A;  2Y2J A;  3AZM C;  4KGC B;  1M18 B;  3B6G D;  1B6W A;  1AOI C;  2PYO B;  4E45 A;  2JSS A;  2YFW A;  1M19 A;  1F66 D;  4J8U A;  2Y2P A;  5F99 B;  3AZE A;  5B24 A;  3MGS A;  4H9R B;  3C1C D;  5BO0 A;  3MNN A;  5AV8 B;  4WU9 A;  5B0Z B;  1ID3 A;  2XD1 A;  4NE6 A;  4DRB A;  1P3M A;  4YM6 B;  4J8X C;  4XUJ A;  5B31 D;  3MGQ C;  2ZM5 A;  5CP6 B;  3REJ A;  4LD9 B;  3WTP C;  5AVB D;  2DQN C;  2HIO A;  3LEL D;  2Y2G A;  3X1T A;  3AZH A;  1BH9 A;  5B0Y D;  4Z66 A;  5DNM C;  2IO5 B;  5JRG D;  3AV1 A;  3AN2 C;  1P3I C;  2F8N G;  3REI A;  5G49 A;  4H9P A;  1P3A B;  1TZY B;  2Y2M A;  3W97 C;  4H9Q A;  2ARO C;  2G5I C;  3O62 D;  3MGP C;  1R4V A;  3REH C;  3AYW A;  4WU8 B;  1P3L C;  5DNN A;  3AZL D;  5B1M B;  3X1U A;  1ZLA D;  4HGA B;  3UT9 A;  3UTB B;  3AZF A;  4JJN D;  4G92 B;  5GXQ B;  4YS3 B;  2NQB B;  3LJA C;  3W99 A;  1P3G C;  5BNX A;  1N1J A;  2BYK B;  2Y2O A;  5GT3 B;  3B6G B;  3B0B A;  5B2J C;  5B33 B;  3KUY C;  3WTP E;  5AV6 D;  4WZS B;  1KX5 B;  1F66 B;  3KXB A;  3X1V B;  1P3O D;  3REL D;  5B2I D;  3C1C B;  4CSR A;  4ZUX B;  2UWX A;  3WA9 B;  1P34 C;  5AY8 C;  3AZG A;  5B31 B;  3W96 A;  4NE3 A;  1KX4 A;  3AZI D;  5AVC A;  5BT1 D;  1KX3 D;  4R8P D;  1TAF A;  3LEL B;  1U35 D;  3MNN B;  5B0Y B;  3MVD D;  3REK C;  2Y2L A;  5AVB C;  4Z5T C;  1P3K A;  5GT0 D;  3X1S B;  5JRG C;  3AZM A;  1JFI B;  2Y2K A;  3LZ1 C;  3O62 B;  1AOI A;  3MGR C;  3AZJ C;  3C1B C;  4M6B A;  3KWQ C;  3A1I A;  5CPI C;  5C3I B;  4H9S C;  1ZLA B;  1EQZ D;  2JE5 A;  1M1A C;  1T3U A;  5B40 C;  3AZL C;  5CPK B;  4JJN C;  4J8X A;  2CWE A;  2Y2H A;  3H0R C;  3UTA C;  1P3P C;  3MGQ A;  2J8P A;  2CV5 D;  3WTP A;  3NQU B;  4NE5 A;  1Z2C B;  4AWL B;  1S32 D;  3AZK C;  5B32 B;  5DNM A;  2FJ7 C;  4KHA B;  5AV6 B;  3AN2 A;  1P3I A;  1KU5 A;  3B6F C;  4X23 D;  3LZ0 C;  5BNV B;  1P3O B;  3REL B;  3W97 A;  3AV2 D;  2ARO A;  3MGP A;  5JA4 B;  5B1L C;  3REH A;  3WKJ C;  3R45 A;  5B2I C;  3TU4 C;  1P3L A;  5E5A D;  3AZI B;  4J8W C;  4QLC D;  3AZN D;  1KX3 B;  4R8P B;  1P3B C;  1U35 B;  1P3F D;  2NZD D;  2Y2Q A;  3MVD B;  4J8V D;  5BT1 C;  3LJA A;  3VH6 W;  1P3G A;  5GT3 D;  5GT0 B;  3A6N C;  4UPK A;  5B33 D;  2BG1 A;  4H9O B;  4KGC C;  1BH8 B;  1M18 C;  5GSU D;  1KX5 D;  5CPJ D;  3EPH A;  5B2J A;  3X1V D;  3KUY A;  3WAA D;  2PYO C;  4ZUX D;  3WA9 D;  5B31 G;  1EQZ B;  5F99 C;  4UUZ A;  2ZY4 A;  4WNN A;  2LY8 A;  5AV8 C;  5B0Z C;  1M19 D;  1P34 A;  3EG5 B;  4J8U D;  2BYM B;  5AY8 A;  3AZE D;  3AFA B;  4YM6 C;  4CAY A;  4WU9 D;  3MNN D;  5CP6 C;  4ZBJ B;  1ID3 D;  4LD9 C;  3EPK A;  2CV5 B;  1P3M D;  4G91 B;  4XUJ D;  1S32 B;  1WWS A;  3X1S D;  2IO5 C;  3REK A;  3KSY A;  5AVB A;  3KXB D;  2HIO D;  4Z5T A;  3V9R A;  3X1T D;  4Z66 D;  5KDM B;  4XZQ B;  4X23 B;  5JRG A;  3AV1 D;  1P3A C;  1TZY C;  3REI D;  3AV2 B;  3LZ1 A;  5AV5 B;  3MGR A;  3AZJ A;  5AV9 B;  5FUG B;  3C1B A;  2F8N A;  3W98 B;  2RVQ D;  3VH6 A;  3KWQ A;  4WU8 C;  5CPI A;  5B1M C;  4H9S A;  4HGA C;  5E5A B;  2YFV A;  3B0C W;  3UTB C;  4QLC B;  3AZN B;  5CPK D;  1M1A A;  2NZD B;  1P3F B;  4G92 C;  2HUE B;  5DNN D;  5B40 A;  3X1U D;  5GXQ C;  3AZL A;  4YS3 C;  4J8V B;  3UT9 D;  2NQB C;  3AZF D;  4JJN A;  3NQJ B;  3UTA A;  1P3P A;  5B32 D;  4KUD B;  1HQ3 B;  3W99 D;  2ZY2 A;  5GSU B;  5GT3 C;  3B6G C;  5CPJ B;  3AZK A;  4H9N B;  5B33 C;  2FJ7 A;  3WAA B;  1KX5 C;  3B6F A;  1F66 C;  3X1V C;  3LZ0 A;  3C1C C;  2F8N H;  3H0M C;  2YFW B;  4ZUX C;  1M19 B;  3WA9 C;  4J8U B;  3AZE B;  5B1L A;  5B24 B;  3MGS B;  1H3O A;  3WKJ A;  5B2I A;  5BO0 B;  3TU4 A;  4WU9 B;  5B31 C;  1ID3 B;  4J8W A;  2F8N K;  3AZG D;  3LEL C;  1P3M B;  1P3B A;  4XUJ B;  5B0Y C;  3W96 D;  3REJ B;  1KX4 D;  5AVC D;  2HIO B;  3X1T B;  3A6N A;  3AZH B;  1BH9 B;  4Z66 B;  3X1S C;  3AV1 B;  1ULY A;  3A1K A;  4KGC A;  1P3K D;  1M18 A;  3REI B;  5G49 B;  4EO5 B;  3O62 C;  4H9P B;  2VQR A;  3AZM D;  2PYO A;  4H9Q B;  5C3I C;  1BFM A;  1ZLA C;  5F99 A;  3AFA D;  4H9R A;  3AYW B;  5AV8 A;  5B0Z A;  5DNN B;  3X1U B;  3UT9 B;  5CPK C;  4YM6 A;  3AZF B;  5CP6 A;  4LD9 A;  3W99 B;  4AWL C;  2DF4 C;  5BNX B;  4DQY B;  5B32 C;  2Y2I A;  3MGQ D;  4XZQ D;  1N1J B;  4WJ3 C;  5AV6 C;  5AV5 D;  5DNM D;  3VH5 W;  5AV9 D;  1P3A A;  3VH6 T;  1TZY A;  1P3O C;  3REL C;  3W98 D;  3KXB B;  3EPL A;  4WU8 A;  3W97 D;  2ARO D;  4CSR B;  5B1M A;  3MGP D;  3AZI C;  3UTB A;  1KX3 C;  3REH D;  3AZG B;  4R8P C;  1U35 C;  1P3L D;  4NFT A;  5BS7 C;  3MVD C;  3W96 B;  5GXQ A;  1KX4 B;  4YS3 A;  2NQB A;  1HQ3 D;  2ZY5 A;  5AVC B;  4KUD D;  1TAF B;  5GT0 C;  3LJA D;  2G5H C;  2BYK A;  1P3K B;  1P3G D;  5GT3 A;  3B6G A;  3B0D B;  5B33 A;  3AZM B;  1KX5 A;  3EPJ A;  1F66 A;  3AL0 C;  5B2J D;  3X1V A;  1AOI B;  1EQZ C;  3KUY D;  5B24 D;  3MGS D;  3C1C A;  4ZUX A;  3WA9 A;  3AFA C;  5B31 A;  2FFF B;  4ZBJ C;  3REJ D;  1P34 D;  2CV5 C;  5AY8 D;  3VH5 A;  3LEL A;  4G91 C;  4J8X B;  3AZH D;  1S32 C;  5B0Y A;  3MGQ B;  3WTP B;  4Z2M G;  3B0C T;  4XZQ C;  2ZY3 A;  3X1S A;  4X23 C;  5DNM B;  1B67 A;  3REK D;  1JFI A;  4Z5T D;  3AN2 B;  1P3I B;  1Q9C A;  3AV2 C;  5AV5 C;  3O62 A;  5AV9 C;  3W98 C;  3AYW D;  3W97 B;  3LZ1 D;  2ARO B;  3MGP B;  5E5A C;  5B32 G;  3MGR D;  3AZJ D;  1ZLA A;  4QLC C;  4WV4 B;  3C1B D;  3REH B;  3AZN C;  2F8N D;  3KWQ D;  3R45 B;  1P3F C;  2NZD C;  1P3L B;  2HUE C;  5CPI D;  4DRA A;  4J8V C;  5CPK A;  1M1A D;  5B40 D;  3F6T A;  4KUD C;  3NQU A;  1HQ3 C;  3LJA B;  5GSU C;  1P3G B;  3UTA D;  5CPJ C;  1P3P D;  5B32 A;  3WAA C;  4KHA A;  5AV6 A;  3AZK D;  1PZR A;  5B2J B; 
#chains in the Genus database with same CATH homology
 3KUY B;  2FJ7 D;  5BNV A;  1P3O A;  3REL A;  3B6F D;  1A7W A;  1M19 C;  4J8U C;  4Z2M H;  3LZ0 D;  3AZE C;  4UUZ B;  2W8S A;  4WNN B;  5JA4 A;  5B24 C;  3MGS C;  3P5J B;  3MNN C;  4WU9 C;  1ID3 C;  4E44 A;  1P34 B;  3AZI A;  5AY8 B;  1KX3 A;  5B1L D;  4R8P A;  1P3M C;  1U35 A;  3WKJ D;  4XUJ C;  3TU4 D;  4CAY B;  5BS7 A;  3MVD A;  3REJ C;  1WWI A;  4J8W D;  2HIO C;  1P3B D;  3X1T C;  5GT0 A;  3AZH C;  4Z66 C;  4H9O A;  3REK B;  3AV1 C;  5AVB B;  1BH8 A;  4Z5T B;  3V9R B;  3REI C;  3A6N D;  4EO5 C;  1AOI D;  5JRG B;  4KGC D;  2XD5 A;  1M18 D;  2RVQ C;  3LZ1 B;  3MGR B;  1EQZ A;  3AZJ B;  2L5A A;  2PYO D;  3C1B B;  2F8N B;  2F2A C;  5CHL B;  3KWQ B;  3AYW C;  5DNN C;  5CPI B;  3X1U C;  3KFU G;  3VH5 T;  3UT9 C;  2BYM A;  5F99 D;  3H0L C;  2YFV B;  3AFA A;  3AZF C;  4J8X D;  1M1A B;  5AV8 D;  5B0Z D;  5B40 B;  3AZL B;  3WTP D;  2CV5 A;  3W99 C;  2RIQ A;  4YM6 D;  4JJN B;  1S32 A;  3UTA B;  1P3P B;  5CP6 D;  4LD9 D;  3AN2 D;  1P3I D;  3AZK B;  5KDM A;  4XZQ A;  1W2E A;  4X23 A;  2FJ7 B;  3AV2 A;  3B6F B;  5AV5 A;  3KXB C;  1F1E A;  1P3A D;  5AV9 A;  5FUG A;  3LZ0 B;  1TZY D;  3W98 A;  5E5A A;  2JCH A;  3FDD A;  4QLC A;  3AZG C;  3AZN A;  5B1L B;  3WKJ B;  3IP4 C;  1H3O B;  1P3F A;  5B2I B;  3TU4 B;  4WU8 D;  2NZD A;  3W96 C;  5B1M D;  1KX4 C;  4J8V A;  5AVC C;  2Y2N A;  4J8W B;  3UTB D;  1HTA A;  1P3B B;  3NQJ A;  5GXQ D;  4YS3 D;  2NQB D;  4KUD A;  1HQ3 A;  1P3K C;  5GSU A;  5CPJ A;  3A6N B;  3B0D C;  4H9N A;  3WAA A;  2Y2J A;  3AZM C;  4KGC B;  1M18 B;  3B6G D;  1B6W A;  1AOI C;  2PYO B;  4E45 A;  2JSS A;  2YFW A;  1M19 A;  1F66 D;  4J8U A;  2Y2P A;  5F99 B;  3AZE A;  5B24 A;  3MGS A;  4H9R B;  3C1C D;  5BO0 A;  3MNN A;  5AV8 B;  4WU9 A;  5B0Z B;  1ID3 A;  2XD1 A;  4NE6 A;  4DRB A;  1P3M A;  4YM6 B;  4J8X C;  4XUJ A;  5B31 D;  3MGQ C;  2ZM5 A;  5CP6 B;  3REJ A;  4LD9 B;  3WTP C;  5AVB D;  2DQN C;  2HIO A;  3LEL D;  2Y2G A;  3X1T A;  3AZH A;  1BH9 A;  5B0Y D;  4Z66 A;  5DNM C;  2IO5 B;  5JRG D;  3AV1 A;  3AN2 C;  1P3I C;  2F8N G;  3REI A;  5G49 A;  4H9P A;  1P3A B;  1TZY B;  2Y2M A;  3W97 C;  4H9Q A;  2ARO C;  2G5I C;  3O62 D;  3MGP C;  1R4V A;  3REH C;  3AYW A;  4WU8 B;  1P3L C;  5DNN A;  3AZL D;  5B1M B;  3X1U A;  1ZLA D;  4HGA B;  3UT9 A;  3UTB B;  3AZF A;  4JJN D;  4G92 B;  5GXQ B;  4YS3 B;  2NQB B;  3LJA C;  3W99 A;  1P3G C;  5BNX A;  1N1J A;  2BYK B;  2Y2O A;  5GT3 B;  3B6G B;  3B0B A;  5B2J C;  5B33 B;  3KUY C;  3WTP E;  5AV6 D;  4WZS B;  1KX5 B;  1F66 B;  3KXB A;  3X1V B;  1P3O D;  3REL D;  5B2I D;  3C1C B;  4CSR A;  4ZUX B;  2UWX A;  3WA9 B;  1P34 C;  5AY8 C;  3AZG A;  5B31 B;  3W96 A;  4NE3 A;  1KX4 A;  3AZI D;  5AVC A;  5BT1 D;  1KX3 D;  4R8P D;  1TAF A;  3LEL B;  1U35 D;  3MNN B;  5B0Y B;  3MVD D;  3REK C;  2Y2L A;  5AVB C;  4Z5T C;  1P3K A;  5GT0 D;  3X1S B;  5JRG C;  3AZM A;  1JFI B;  2Y2K A;  3LZ1 C;  3O62 B;  1AOI A;  3MGR C;  3AZJ C;  3C1B C;  4M6B A;  3KWQ C;  3A1I A;  5CPI C;  5C3I B;  4H9S C;  1ZLA B;  1EQZ D;  2JE5 A;  1M1A C;  1T3U A;  5B40 C;  3AZL C;  5CPK B;  4JJN C;  4J8X A;  2CWE A;  2Y2H A;  3H0R C;  3UTA C;  1P3P C;  3MGQ A;  2J8P A;  2CV5 D;  3WTP A;  3NQU B;  4NE5 A;  1Z2C B;  4AWL B;  1S32 D;  3AZK C;  5B32 B;  5DNM A;  2FJ7 C;  4KHA B;  5AV6 B;  3AN2 A;  1P3I A;  1KU5 A;  3B6F C;  4X23 D;  3LZ0 C;  5BNV B;  1P3O B;  3REL B;  3W97 A;  3AV2 D;  2ARO A;  3MGP A;  5JA4 B;  5B1L C;  3REH A;  3WKJ C;  3R45 A;  5B2I C;  3TU4 C;  1P3L A;  5E5A D;  3AZI B;  4J8W C;  4QLC D;  3AZN D;  1KX3 B;  4R8P B;  1P3B C;  1U35 B;  1P3F D;  2NZD D;  2Y2Q A;  3MVD B;  4J8V D;  5BT1 C;  3LJA A;  3VH6 W;  1P3G A;  5GT3 D;  5GT0 B;  3A6N C;  4UPK A;  5B33 D;  2BG1 A;  4H9O B;  4KGC C;  1BH8 B;  1M18 C;  5GSU D;  1KX5 D;  5CPJ D;  3EPH A;  5B2J A;  3X1V D;  3KUY A;  3WAA D;  2PYO C;  4ZUX D;  3WA9 D;  5B31 G;  1EQZ B;  5F99 C;  4UUZ A;  2ZY4 A;  4WNN A;  2LY8 A;  5AV8 C;  5B0Z C;  1M19 D;  1P34 A;  3EG5 B;  4J8U D;  2BYM B;  5AY8 A;  3AZE D;  3AFA B;  4YM6 C;  4CAY A;  4WU9 D;  3MNN D;  5CP6 C;  4ZBJ B;  1ID3 D;  4LD9 C;  3EPK A;  2CV5 B;  1P3M D;  4G91 B;  4XUJ D;  1S32 B;  1WWS A;  3X1S D;  2IO5 C;  3REK A;  3KSY A;  5AVB A;  3KXB D;  2HIO D;  4Z5T A;  3V9R A;  3X1T D;  4Z66 D;  5KDM B;  4XZQ B;  4X23 B;  5JRG A;  3AV1 D;  1P3A C;  1TZY C;  3REI D;  3AV2 B;  3LZ1 A;  5AV5 B;  3MGR A;  3AZJ A;  5AV9 B;  5FUG B;  3C1B A;  2F8N A;  3W98 B;  2RVQ D;  3VH6 A;  3KWQ A;  4WU8 C;  5CPI A;  5B1M C;  4H9S A;  4HGA C;  5E5A B;  2YFV A;  3B0C W;  3UTB C;  4QLC B;  3AZN B;  5CPK D;  1M1A A;  2NZD B;  1P3F B;  4G92 C;  2HUE B;  5DNN D;  5B40 A;  3X1U D;  5GXQ C;  3AZL A;  4YS3 C;  4J8V B;  3UT9 D;  2NQB C;  3AZF D;  4JJN A;  3NQJ B;  3UTA A;  1P3P A;  5B32 D;  4KUD B;  1HQ3 B;  3W99 D;  2ZY2 A;  5GSU B;  5GT3 C;  3B6G C;  5CPJ B;  3AZK A;  4H9N B;  5B33 C;  2FJ7 A;  3WAA B;  1KX5 C;  3B6F A;  1F66 C;  3X1V C;  3LZ0 A;  3C1C C;  2F8N H;  3H0M C;  2YFW B;  4ZUX C;  1M19 B;  3WA9 C;  4J8U B;  3AZE B;  5B1L A;  5B24 B;  3MGS B;  1H3O A;  3WKJ A;  5B2I A;  5BO0 B;  3TU4 A;  4WU9 B;  5B31 C;  1ID3 B;  4J8W A;  2F8N K;  3AZG D;  3LEL C;  1P3M B;  1P3B A;  4XUJ B;  5B0Y C;  3W96 D;  3REJ B;  1KX4 D;  5AVC D;  2HIO B;  3X1T B;  3A6N A;  3AZH B;  1BH9 B;  4Z66 B;  3X1S C;  3AV1 B;  1ULY A;  3A1K A;  4KGC A;  1P3K D;  1M18 A;  3REI B;  5G49 B;  4EO5 B;  3O62 C;  4H9P B;  2VQR A;  3AZM D;  2PYO A;  4H9Q B;  5C3I C;  1BFM A;  1ZLA C;  5F99 A;  3AFA D;  4H9R A;  3AYW B;  5AV8 A;  5B0Z A;  5DNN B;  3X1U B;  3UT9 B;  5CPK C;  4YM6 A;  3AZF B;  5CP6 A;  4LD9 A;  3W99 B;  4AWL C;  2DF4 C;  5BNX B;  4DQY B;  5B32 C;  2Y2I A;  3MGQ D;  4XZQ D;  1N1J B;  4WJ3 C;  5AV6 C;  5AV5 D;  5DNM D;  3VH5 W;  5AV9 D;  1P3A A;  3VH6 T;  1TZY A;  1P3O C;  3REL C;  3W98 D;  3KXB B;  3EPL A;  4WU8 A;  3W97 D;  2ARO D;  4CSR B;  5B1M A;  3MGP D;  3AZI C;  3UTB A;  1KX3 C;  3REH D;  3AZG B;  4R8P C;  1U35 C;  1P3L D;  4NFT A;  5BS7 C;  3MVD C;  3W96 B;  5GXQ A;  1KX4 B;  4YS3 A;  2NQB A;  1HQ3 D;  2ZY5 A;  5AVC B;  4KUD D;  1TAF B;  5GT0 C;  3LJA D;  2G5H C;  2BYK A;  1P3K B;  1P3G D;  5GT3 A;  3B6G A;  3B0D B;  5B33 A;  3AZM B;  1KX5 A;  3EPJ A;  1F66 A;  3AL0 C;  5B2J D;  3X1V A;  1AOI B;  1EQZ C;  3KUY D;  5B24 D;  3MGS D;  3C1C A;  4ZUX A;  3WA9 A;  3AFA C;  5B31 A;  2FFF B;  4ZBJ C;  3REJ D;  1P34 D;  2CV5 C;  5AY8 D;  3VH5 A;  3LEL A;  4G91 C;  4J8X B;  3AZH D;  1S32 C;  5B0Y A;  3MGQ B;  3WTP B;  4Z2M G;  3B0C T;  4XZQ C;  2ZY3 A;  3X1S A;  4X23 C;  5DNM B;  1B67 A;  3REK D;  1JFI A;  4Z5T D;  3AN2 B;  1P3I B;  1Q9C A;  3AV2 C;  5AV5 C;  3O62 A;  5AV9 C;  3W98 C;  3AYW D;  3W97 B;  3LZ1 D;  2ARO B;  3MGP B;  5E5A C;  5B32 G;  3MGR D;  3AZJ D;  1ZLA A;  4QLC C;  4WV4 B;  3C1B D;  3REH B;  3AZN C;  2F8N D;  3KWQ D;  3R45 B;  1P3F C;  2NZD C;  1P3L B;  2HUE C;  5CPI D;  4DRA A;  4J8V C;  5CPK A;  1M1A D;  5B40 D;  3F6T A;  4KUD C;  3NQU A;  1HQ3 C;  3LJA B;  5GSU C;  1P3G B;  3UTA D;  5CPJ C;  1P3P D;  5B32 A;  3WAA C;  4KHA A;  5AV6 A;  3AZK D;  1PZR A;  5B2J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...