3TU4B

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
b'GGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4B00
2NQBB 4YS3C 5B33B 5B0ZD 1JFIA 5AVBD 1P34C 3O62C 3WTPB 3WKJD 3REIA 1P3PD 3W96A 3W97A 5CPIC 3C1BC 5B0YA 1P3IC 3KXBA 5CP6C 5DNMB 2RVQC 5BNXA 5CPKB 4XZQC 3LZ1C 3AZLB 1KX4A 2F8NK 5B1LB 5JRGA 3C1CA 1JFIB 5B24D 3B6FC 3X1UC 5CHLB 5B0ZB 5B1MA 3W97B 3AZKA 4XUJA 5B0YB 3KXBB 3LELC 1S32D 2HUEC 3X1SD 1KX4B 1KX5A 2BYKB 3UT9B 4R8PA 1U35B 3AYWC 1P3OD 4JJNC 5GXQC 3X1VD 2HIOA 5B1MB 4Z5TC 3AV1C 2L5AA 3AZKB 3MGSC 5B2ID 3AV2C 1P3AC 5C3IC 4EO5B 4YM6D 5AV6C 5G49A 2F8NG 5E5AA 1S32B 1ID3A 4ZUXC 3AZGC 1M19C 5AV5A 3AZEC 1HQ3D 1EQZD 3RELD 4R8PB 5GT0A 3AZNA 4CAYB 3X1SB 5BS7A 3AZJD 5B40A 4HGAB 1HTAA 3O62A 3AFAA 4H9PB 4WU8C 1P34A 2NZDA 4J8WD 3TU4D 3W99C 4KUDA 4J8VD 4ZBJC 3WA9A 5B2IB 3AZHD 5G49B 4WU9B 5E5AB 3REKD 5AVCD 2CWEA 1ID3B 2FJ7C 3W98C 3VH5T 1P3GD 5CPJD 3AZNB 5AV9D 5B31A 3B0CT 1EQZB 5B40B 3AFAB 4Z2MH 3AZFA 2NZDB 5B33C 1M1AD 3LZ0D 4KUDB 3WTPC 3WAAA 3REHD 3WA9B 4J8WB 3KSYA 3MGRD 1TZYD 1AOIB 4J8VB 3REJA 5DNMC 3AZHB 5CPKC 5AVCB 5B31B 5GT3D 3AZLC 2PYOB 1P3LD 3UTBD 3AZFB 1BH9A 1M18D 1P3FA 4Z66A 3A6NA 3WAAB 2YFVA 4LD9A 3W96C 3AV2A 1P3AA 1P3KA 3LZ0B 3W97C 5B0YC 5AV6A 4NFTA 3KXBC 3REJB 3MNNA 4X23A 3X1TD 1KX4C 4E44A 1BH9B 5JRGC 5AV8A 3UT9C 3C1CC 1U35C 4Z66B 3A6NB 2YFVB 1P3LB 4LD9B 5B1MC 1WWSA 3AZKC 4XUJC 3MVDD 4EO5C 3MNNB 4X23B 3KWQD 3AZIA 1S32C 5F99D 4H9QA 5AV8B 4R8PC 2NQBA 2CV5D 5B33A 4J8XA 3WTPA 4H9RB 5B32D 5DNNA 3R45B 4WU9C 5E5AC 3AZIB 1ID3C 3AN2D 5CPKA 5AV5C 1KX3B 4H9QB 3VH6T 3AZNC 5B1LA 5BS7C 3NQUA 3UTAA 2AROA 1EQZC 3AFAC 5B40C 4J8XB 2NZDC 5B0ZA 5DNNB 4KUDC 5AVBA 3WA9C 4NE5A 3WTPE 3MGQD 1P3PA 3B6GD 5B2JD 1AOIC 1P3MD 1B6WA 2BYKA 2BYMA 5AVCC 5B31C 3NQUB 3UT9A 3UTAB 2AROB 1U35A 2PYOC 3AZFC 5AVBB 3WAAC 5B24A 3WKJB 1P3PB 5BT1C 4QLCD 3REJC 1S32A 2BYMB 4CAYA 3X1SA 1P3BD 1P3FC 4Z66C 4H9PA 3A6NC 5B24B 1P3OA 1R4VA 4LD9C 1N1JB 3X1VA 1P3KC 1F66D 5B2IA 4WU9A 3MNNC 3LJAD 4YM6A 4X23C 5GSUD 1KX5D 4KHAB 3B0BA 5AV8C 3KUYD 1EQZA 3RELA 3B0DB 2JSSA 3AZJA 1P3OB 2HIOD 3X1VB 4WV4B 3AZMD 2F8ND 4J8WA 3TU4A 1AOIA 4J8VA 4YM6B 3AZHA 3MGPD 3AZIC 5AVCA 5GT0D 1KX3C 5GSUB 1HQ3B 4YS3D 3RELB 1WWIA 5CPJA 1P3GA 2PYOA 2NQBC 3AZJB 5AV9A 5B31G 1P34D 4J8XC 5CPID 5DNNC 3C1BD 3TU4B 3LZ0A 1P3ID 5CP6D 3REHA 3AZMB 2RVQD 3MGRA 1TZYA 4Z2MG 4XZQD 3REKB 5BO0B 5AY8D 3LZ1D 1P3GB 5CPJB 5B1LC 5AV9B 3UTAC 2AROC 5GT3A 4CSRB 3B6FD 3X1UD 1P3LA 3UTBA 5B0ZC 1M1AB 5AVBC 1ZLAD 3LELD 3WKJC 3REHB 1P3PC 5CPIB 3MGRB 1TZYB 4M6BA 5AY8B 5FUGA 3AYWD 4AWLB 3X1TA 5GT3B 4JJND 5GXQD 4G91B 3UTBB 4Z5TD 3AV1D 1M18B 3MGSD 5B24C 1P3AD 4H9RA 3R45A 5AV6D 1ZLAB 3MVDA 4ZUXD 3AZGD 1M19D 3AZED 4J8UD 1KX3A 5FUGB 3X1TB 3KWQA 3X1SC 5F99A 3NQJA 4WU8D 4HGAC 3B0DC 1P3OC 3W99D 2CV5A 3X1VC 2IO5B 3MGSB 3VH5W 5B2IC 3MVDB 2FJ7D 3W98D 5JA4A 5B32A 3B0CW 4YM6C 3KWQB 4KGCD 5F99B 4UUZA 4J8UB 3NQJB 1HQ3C 3RELC 4WZSB 3AZJC 2CV5B 3WKJA 4J8WC 3TU4C 5JA4B 5B32B 4H9SA 4J8VC 5DNMD 3VH5A 5KDMA 3MGQA 3AZHC 2FJ7B 5B2JA 3B6GA 3W98B 3REKC 3AZLD 4UUZB 3AN2B 1P3GC 5CPJC 1P3MA 4KGCB 5AV9C 3REID 3W96D 1N1JA 3W97D 1M1AC 5B0YD 3LZ0C 3KXBD 3REHC 5KDMB 3MGQB 3MGRC 1TZYC 3B6GB 5B2JB 1KX4D 4QLCA 1P3MB 1KU5A 4KHAA 5JRGD 3UT9D 1TAFA 3C1CD 1U35D 5AY8C 4AWLC 5GT3C 4G92B 1P3LC 4G91C 3UTBC 5B1MD 1P3BA 1M18C 3AZKD 4XUJD 1Q9CA 4H9NA 2YFWA 3REIB 3W96B 1F66A 1ZLAC 1BFMA 4QLCB 5BNXB 3LJAA 1B67A 1TAFB 4R8PD 5GSUA 1HQ3A 3X1TC 4H9OA 4DRBA 5JRGB 3C1CB 2F8NH 4DRAA 1P3BB 3KUYA 4H9NB 1F1EA 2YFWB 2IO5C 4XUJB 3VH6W 1F66B 4WU9D 3AZMA 3MVDC 5E5AD 2F8NA 1ID3D 5AV5D 3LJAB 3REKA 5BO0A 3AZND 3V9RA 3KWQC 1KX5B 3MGPA 4H9OB 5F99C 1A7WA 5B40D 3AFAD 4J8UC 3O62D 4CSRA 3KUYB 4YS3A 2NZDD 4E45A 2CV5C 4KUDD 2HIOB 1M1AA 3WA9D 1AOID 2F8NB 5B32C 5CPIA 3C1BA 1P3IA 3V9RB 5CP6A 3VH6A 5B31D 3MGPB 5AV5B 4XZQA 3AN2C 3LZ1A 4WNNA 5AY8A 2PYOD 5GT0B 3AZFD 4YS3B 4KGCC 1M18A 1P34B 3O62B 3WAAD 3B6FA 3X1UA 5BT1D 4H9SC 3C1BB 1P3IB 1ZLAA 3REJD 3LELA 5CP6B 3MGQC 3B6GC 5B2JC 4XZQB 3LZ1B 4WNNB 1P3MC 1P3FD 4Z66D 3AYWA 4NE3A 3A6ND 4JJNA 4G92C 5GXQA 4LD9D 3B6FB 3AV2D 3X1UB 1P3KD 1BH8A 4Z5TA 3AV1A 3MGSA 3REIC 3MNND 3LELB 4X23D 2HUEB 4QLCC 4ZUXA 3AZGA 1M19A 5AV8D 3AZEA 4J8UA 3AYWB 4JJNB 5GXQB 4NE6A 1P3FB 1P3BC 1BH8B 4Z5TB 4WU8A 3AV1B 3AV2B 1P3AB 5C3IB 1P3KB 3W99A 5AV6B 1F66C 3AZID 2FJ7A 3W98A 5B32G 5BNVA 4ZUXB 3LJAC 3AZGB 1M19B 3AZEB 3AN2A 1KX3D 2NQBD 1H3OA 5GSUC 1KX5C 5B33D 4KGCA 4J8XD 3WTPD 4WU8B 3KUYC 5DNND 3W99B 2HIOC 4ZBJB 3AZMC 5CPKD 1ULYA 5BNVB 1H3OB 5B1LD 5DNMA 3MGPC 3UTAD 2AROD 2LY8A 3AZLA 5GT0C
chains in the Genus database with same CATH superfamily
2NQBB 4YS3C 5B33B 5B0ZD 1JFIA 5AVBD 1P34C 3O62C 3WTPB 3WKJD 3REIA 1P3PD 3W96A 3W97A 5CPIC 3C1BC 5B0YA 1P3IC 3KXBA 5CP6C 5DNMB 2RVQC 5BNXA 5CPKB 4XZQC 3LZ1C 3AZLB 1KX4A 2F8NK 5B1LB 5JRGA 3C1CA 2ZY4A 1JFIB 5B24D 3B6FC 3X1UC 5CHLB 5B0ZB 5B1MA 3W97B 3AZKA 2FFFB 4XUJA 5B0YB 3KXBB 3LELC 1S32D 3EPJA 3AL0C 1W2EA 2HUEC 3X1SD 1KX4B 1KX5A 2BYKB 3UT9B 4R8PA 1U35B 3AYWC 1P3OD 4JJNC 5GXQC 3X1VD 2HIOA 5B1MB 4Z5TC 3AV1C 2L5AA 3AZKB 3MGSC 5B2ID 3AV2C 1P3AC 5C3IC 4EO5B 4YM6D 2ZY3A 5AV6C 5G49A 2F8NG 5E5AA 1S32B 1ID3A 4ZUXC 3AZGC 1M19C 2Y2LA 5AV5A 3AZEC 1HQ3D 1EQZD 3RELD 2Y2HA 5GT0A 4R8PB 4CAYB 3X1SB 3AZNA 5BS7A 3AZJD 5B40A 4HGAB 1HTAA 3O62A 3AFAA 4H9PB 4WU8C 1P34A 2NZDA 4J8WD 3TU4D 3W99C 4KUDA 4J8VD 4ZBJC 3WA9A 5B2IB 3AZHD 5G49B 4WU9B 5E5AB 3REKD 5AVCD 2CWEA 1ID3B 2FJ7C 3W98C 3VH5T 1P3GD 5CPJD 3AZNB 5AV9D 5B31A 3B0CT 3A1KA 1EQZB 2Y2PA 5B40B 3AFAB 4Z2MH 3AZFA 2NZDB 5B33C 1M1AD 3LZ0D 4KUDB 3WTPC 3WAAA 3F6TA 3REHD 3WA9B 4J8WB 3KSYA 3MGRD 1TZYD 1AOIB 4J8VB 3REJA 5DNMC 3AZHB 5CPKC 5AVCB 5B31B 5GT3D 3AZLC 2PYOB 1P3LD 3UTBD 3AZFB 4WJ3C 1BH9A 1M18D 1P3FA 2ZM5A 4Z66A 3A6NA 3WAAB 2YFVA 4LD9A 3W96C 3AV2A 1P3AA 1P3KA 3LZ0B 3W97C 5B0YC 5AV6A 4NFTA 3KXBC 3REJB 3MNNA 4X23A 3X1TD 1KX4C 4E44A 1BH9B 5JRGC 5AV8A 2W8SA 3C1CC 3UT9C 1U35C 4Z66B 3A6NB 2YFVB 1P3LB 4LD9B 2BG1A 5B1MC 1WWSA 3AZKC 4XUJC 3MVDD 4EO5C 3MNNB 4X23B 3KWQD 3AZIA 1S32C 5F99D 4H9QA 5AV8B 4R8PC 2NQBA 2CV5D 5B33A 4J8XA 3WTPA 4H9RB 5B32D 5DNNA 3EG5B 3R45B 4WU9C 5E5AC 3AZIB 1ID3C 3AN2D 5CPKA 5AV5C 1KX3B 4H9QB 3VH6T 3AZNC 5B1LA 5BS7C 3NQUA 3UTAA 2AROA 1EQZC 3AFAC 3EPLA 5B40C 4J8XB 2NZDC 5B0ZA 2Y2OA 5DNNB 4KUDC 5AVBA 3WA9C 4NE5A 3WTPE 3MGQD 1P3PA 3B6GD 5B2JD 1AOIC 1P3MD 1B6WA 2BYKA 2BYMA 5AVCC 5B31C 3NQUB 3UT9A 3UTAB 2AROB 1U35A 2PYOC 3AZFC 2J8PA 5AVBB 3WAAC 5B24A 3WKJB 1P3PB 5BT1C 4QLCD 3REJC 1S32A 2BYMB 4CAYA 3X1SA 1P3BD 1P3FC 4Z66C 4H9PA 3A6NC 5B24B 1P3OA 1R4VA 4LD9C 1N1JB 3X1VA 1P3KC 1F66D 5B2IA 4WU9A 3MNNC 3LJAD 2XD1A 4YM6A 4X23C 5GSUD 1KX5D 4KHAB 3B0BA 5AV8C 3KUYD 1EQZA 3RELA 3B0DB 2UWXA 2JSSA 3AZJA 1P3OB 2HIOD 3X1VB 4WV4B 2XD5A 3AZMD 2F8ND 4J8WA 4DQYB 3TU4A 1AOIA 4J8VA 4YM6B 3AZHA 3MGPD 3AZIC 5AVCA 5GT0D 1KX3C 5GSUB 1HQ3B 4YS3D 3RELB 1WWIA 5CPJA 1P3GA 2PYOA 2NQBC 3AZJB 5AV9A 5B31G 1P34D 4J8XC 5CPID 5DNNC 3C1BD 3TU4B 3LZ0A 1P3ID 5CP6D 3REHA 3AZMB 2RVQD 3MGRA 1TZYA 4Z2MG 4XZQD 3REKB 5BO0B 2G5HC 5AY8D 3LZ1D 1P3GB 5CPJB 5B1LC 5AV9B 3UTAC 2AROC 2Y2MA 4CSRB 5GT3A 3B6FD 3X1UD 1P3LA 3UTBA 5B0ZC 1M1AB 5AVBC 1ZLAD 3LELD 3WKJC 3REHB 1P3PC 5CPIB 3MGRB 1TZYB 4M6BA 3A1IA 5AY8B 5FUGA 3H0MC 4AWLB 3AYWD 5GT3B 4JJND 5GXQD 3X1TA 2Y2KA 4G91B 3UTBB 4Z5TD 3AV1D 1M18B 3MGSD 5B24C 1P3AD 4H9RA 3R45A 5AV6D 1ZLAB 3MVDA 4ZUXD 3AZGD 1M19D 3AZED 4J8UD 1KX3A 5FUGB 3X1TB 3KWQA 3X1SC 5F99A 3NQJA 4WU8D 2DQNC 2Y2JA 4HGAC 3B0DC 1P3OC 3W99D 2CV5A 3X1VC 2IO5B 2JCHA 3MGSB 3VH5W 5B2IC 3MVDB 2FJ7D 3W98D 5JA4A 5B32A 2RIQA 3B0CW 4YM6C 3KWQB 4KGCD 5F99B 4UUZA 3P5JB 4J8UB 3NQJB 1HQ3C 3RELC 4WZSB 3AZJC 2CV5B 3WKJA 4J8WC 3TU4C 5JA4B 5B32B 4H9SA 4J8VC 5DNMD 3VH5A 5KDMA 3MGQA 3AZHC 2FJ7B 5B2JA 3B6GA 2JE5A 3W98B 3REKC 3AZLD 4UUZB 3AN2B 1P3GC 5CPJC 1P3MA 4KGCB 5AV9C 3H0RC 3REID 3EPHA 3W96D 1N1JA 3W97D 1M1AC 5B0YD 3LZ0C 1T3UA 3KXBD 2Y2GA 3REHC 5KDMB 3MGQB 3MGRC 1TZYC 3B6GB 5B2JB 1KX4D 4QLCA 1P3MB 1KU5A 4KHAA 5JRGD 3UT9D 1TAFA 3KFUG 3C1CD 1U35D 5AY8C 4AWLC 5GT3C 4G92B 1P3LC 4G91C 3UTBC 5B1MD 2F2AC 1P3BA 1M18C 3AZKD 4XUJD 1Q9CA 4H9NA 2YFWA 3REIB 3W96B 1F66A 1ZLAC 1PZRA 1BFMA 4QLCB 2Y2NA 5BNXB 3LJAA 1B67A 2ZY2A 1TAFB 4R8PD 5GSUA 1HQ3A 3X1TC 4H9OA 4DRBA 5JRGB 3FDDA 3C1CB 4DRAA 1P3BB 3KUYA 2F8NH 4H9NB 1F1EA 2YFWB 2IO5C 4XUJB 3EPKA 1Z2CB 3VH6W 4WU9D 3AZMA 3MVDC 5E5AD 1F66B 2DF4C 1ID3D 2F8NA 5AV5D 3LJAB 3REKA 5BO0A 3AZND 3V9RA 3KWQC 1KX5B 3MGPA 4H9OB 5F99C 1A7WA 5B40D 3AFAD 4J8UC 3O62D 4CSRA 3KUYB 4YS3A 2NZDD 4E45A 2CV5C 4KUDD 2HIOB 1M1AA 3WA9D 1AOID 2G5IC 2F8NB 5B32C 5CPIA 3C1BA 1P3IA 3V9RB 5CP6A 3VH6A 5B31D 3MGPB 5AV5B 4XZQA 3AN2C 3LZ1A 4WNNA 5AY8A 2PYOD 5GT0B 3AZFD 4YS3B 4KGCC 4UPKA 1M18A 1P34B 3O62B 3WAAD 3B6FA 3X1UA 5BT1D 4H9SC 3C1BB 1P3IB 1ZLAA 3REJD 3LELA 5CP6B 3MGQC 3B6GC 5B2JC 4XZQB 3H0LC 4WNNB 3LZ1B 1P3MC 1P3FD 4Z66D 3AYWA 4NE3A 3A6ND 4JJNA 4G92C 2ZY5A 5GXQA 4LD9D 3B6FB 3AV2D 2Y2QA 3X1UB 1P3KD 1BH8A 4Z5TA 3AV1A 3MGSA 3REIC 3MNND 3LELB 4X23D 2HUEB 4QLCC 4ZUXA 3AZGA 1M19A 5AV8D 3AZEA 2VQRA 4J8UA 3AYWB 4JJNB 5GXQB 4NE6A 1P3FB 1P3BC 1BH8B 4Z5TB 4WU8A 3AV1B 3AV2B 1P3AB 5C3IB 1P3KB 3W99A 5AV6B 1F66C 3AZID 2FJ7A 3W98A 5B32G 5BNVA 4ZUXB 3LJAC 3AZGB 1M19B 3AZEB 3AN2A 1KX3D 2NQBD 1H3OA 5GSUC 1KX5C 5B33D 4KGCA 4J8XD 3WTPD 4WU8B 3KUYC 3IP4C 5DNND 3W99B 2HIOC 4ZBJB 3AZMC 5CPKD 1ULYA 5BNVB 1H3OB 5B1LD 5DNMA 3MGPC 3UTAD 2AROD 2LY8A 3AZLA 2Y2IA 5GT0C
chains in the Genus database with same CATH topology
2NQBB 4YS3C 5B33B 5B0ZD 1JFIA 5AVBD 1P34C 3O62C 3WTPB 3WKJD 3REIA 1P3PD 3W96A 3W97A 5CPIC 3C1BC 5B0YA 1P3IC 3KXBA 5CP6C 5DNMB 2RVQC 5BNXA 5CPKB 4XZQC 3LZ1C 3AZLB 1KX4A 2F8NK 5B1LB 5JRGA 3C1CA 2ZY4A 1JFIB 5B24D 3B6FC 3X1UC 5CHLB 5B0ZB 5B1MA 3W97B 3AZKA 2FFFB 4XUJA 5B0YB 3KXBB 3LELC 1S32D 3EPJA 3AL0C 1W2EA 2HUEC 3X1SD 1KX4B 1KX5A 2BYKB 3UT9B 4R8PA 1U35B 3AYWC 1P3OD 4JJNC 5GXQC 3X1VD 2HIOA 5B1MB 4Z5TC 3AV1C 2L5AA 3AZKB 3MGSC 5B2ID 3AV2C 1P3AC 5C3IC 4EO5B 4YM6D 2ZY3A 5AV6C 5G49A 2F8NG 5E5AA 1S32B 1ID3A 4ZUXC 3AZGC 1M19C 2Y2LA 5AV5A 3AZEC 1HQ3D 1EQZD 3RELD 2Y2HA 5GT0A 4R8PB 4CAYB 3X1SB 3AZNA 5BS7A 3AZJD 5B40A 4HGAB 1HTAA 3O62A 3AFAA 4H9PB 4WU8C 1P34A 2NZDA 4J8WD 3TU4D 3W99C 4KUDA 4J8VD 4ZBJC 3WA9A 5B2IB 3AZHD 5G49B 4WU9B 5E5AB 3REKD 5AVCD 2CWEA 1ID3B 2FJ7C 3W98C 3VH5T 1P3GD 5CPJD 3AZNB 5AV9D 5B31A 3B0CT 3A1KA 1EQZB 2Y2PA 5B40B 3AFAB 4Z2MH 3AZFA 2NZDB 5B33C 1M1AD 3LZ0D 4KUDB 3WTPC 3WAAA 3F6TA 3REHD 3WA9B 4J8WB 3KSYA 3MGRD 1TZYD 1AOIB 4J8VB 3REJA 5DNMC 3AZHB 5CPKC 5AVCB 5B31B 5GT3D 3AZLC 2PYOB 1P3LD 3UTBD 3AZFB 4WJ3C 1BH9A 1M18D 1P3FA 2ZM5A 4Z66A 3A6NA 3WAAB 2YFVA 4LD9A 3W96C 3AV2A 1P3AA 1P3KA 3LZ0B 3W97C 5B0YC 5AV6A 4NFTA 3KXBC 3REJB 3MNNA 4X23A 3X1TD 1KX4C 4E44A 1BH9B 5JRGC 5AV8A 2W8SA 3C1CC 3UT9C 1U35C 4Z66B 3A6NB 2YFVB 1P3LB 4LD9B 2BG1A 5B1MC 1WWSA 3AZKC 4XUJC 3MVDD 4EO5C 3MNNB 4X23B 3KWQD 3AZIA 1S32C 5F99D 4H9QA 5AV8B 4R8PC 2NQBA 2CV5D 5B33A 4J8XA 3WTPA 4H9RB 5B32D 5DNNA 3EG5B 3R45B 4WU9C 5E5AC 3AZIB 1ID3C 3AN2D 5CPKA 5AV5C 1KX3B 4H9QB 3VH6T 3AZNC 5B1LA 5BS7C 3NQUA 3UTAA 2AROA 1EQZC 3AFAC 3EPLA 5B40C 4J8XB 2NZDC 5B0ZA 2Y2OA 5DNNB 4KUDC 5AVBA 3WA9C 4NE5A 3WTPE 3MGQD 1P3PA 3B6GD 5B2JD 1AOIC 1P3MD 1B6WA 2BYKA 2BYMA 5AVCC 5B31C 3NQUB 3UT9A 3UTAB 2AROB 1U35A 2PYOC 3AZFC 2J8PA 5AVBB 3WAAC 5B24A 3WKJB 1P3PB 5BT1C 4QLCD 3REJC 1S32A 2BYMB 4CAYA 3X1SA 1P3BD 1P3FC 4Z66C 4H9PA 3A6NC 5B24B 1P3OA 1R4VA 4LD9C 1N1JB 3X1VA 1P3KC 1F66D 5B2IA 4WU9A 3MNNC 3LJAD 2XD1A 4YM6A 4X23C 5GSUD 1KX5D 4KHAB 3B0BA 5AV8C 3KUYD 1EQZA 3RELA 3B0DB 2UWXA 2JSSA 3AZJA 1P3OB 2HIOD 3X1VB 4WV4B 2XD5A 3AZMD 2F8ND 4J8WA 4DQYB 3TU4A 1AOIA 4J8VA 4YM6B 3AZHA 3MGPD 3AZIC 5AVCA 5GT0D 1KX3C 5GSUB 1HQ3B 4YS3D 3RELB 1WWIA 5CPJA 1P3GA 2PYOA 2NQBC 3AZJB 5AV9A 5B31G 1P34D 4J8XC 5CPID 5DNNC 3C1BD 3TU4B 3LZ0A 1P3ID 5CP6D 3REHA 3AZMB 2RVQD 3MGRA 1TZYA 4Z2MG 4XZQD 3REKB 5BO0B 2G5HC 5AY8D 3LZ1D 1P3GB 5CPJB 5B1LC 5AV9B 3UTAC 2AROC 2Y2MA 4CSRB 5GT3A 3B6FD 3X1UD 1P3LA 3UTBA 5B0ZC 1M1AB 5AVBC 1ZLAD 3LELD 3WKJC 3REHB 1P3PC 5CPIB 3MGRB 1TZYB 4M6BA 3A1IA 5AY8B 5FUGA 3H0MC 4AWLB 3AYWD 5GT3B 4JJND 5GXQD 3X1TA 2Y2KA 4G91B 3UTBB 4Z5TD 3AV1D 1M18B 3MGSD 5B24C 1P3AD 4H9RA 3R45A 5AV6D 1ZLAB 3MVDA 4ZUXD 3AZGD 1M19D 3AZED 4J8UD 1KX3A 5FUGB 3X1TB 3KWQA 3X1SC 5F99A 3NQJA 4WU8D 2DQNC 2Y2JA 4HGAC 3B0DC 1P3OC 3W99D 2CV5A 3X1VC 2IO5B 2JCHA 3MGSB 3VH5W 5B2IC 3MVDB 2FJ7D 3W98D 5JA4A 5B32A 2RIQA 3B0CW 4YM6C 3KWQB 4KGCD 5F99B 4UUZA 3P5JB 4J8UB 3NQJB 1HQ3C 3RELC 4WZSB 3AZJC 2CV5B 3WKJA 4J8WC 3TU4C 5JA4B 5B32B 4H9SA 4J8VC 5DNMD 3VH5A 5KDMA 3MGQA 3AZHC 2FJ7B 5B2JA 3B6GA 2JE5A 3W98B 3REKC 3AZLD 4UUZB 3AN2B 1P3GC 5CPJC 1P3MA 4KGCB 5AV9C 3H0RC 3REID 3EPHA 3W96D 1N1JA 3W97D 1M1AC 5B0YD 3LZ0C 1T3UA 3KXBD 2Y2GA 3REHC 5KDMB 3MGQB 3MGRC 1TZYC 3B6GB 5B2JB 1KX4D 4QLCA 1P3MB 1KU5A 4KHAA 5JRGD 3UT9D 1TAFA 3KFUG 3C1CD 1U35D 5AY8C 4AWLC 5GT3C 4G92B 1P3LC 4G91C 3UTBC 5B1MD 2F2AC 1P3BA 1M18C 3AZKD 4XUJD 1Q9CA 4H9NA 2YFWA 3REIB 3W96B 1F66A 1ZLAC 1PZRA 1BFMA 4QLCB 2Y2NA 5BNXB 3LJAA 1B67A 2ZY2A 1TAFB 4R8PD 5GSUA 1HQ3A 3X1TC 4H9OA 4DRBA 5JRGB 3FDDA 3C1CB 4DRAA 1P3BB 3KUYA 2F8NH 4H9NB 1F1EA 2YFWB 2IO5C 4XUJB 3EPKA 1Z2CB 3VH6W 4WU9D 3AZMA 3MVDC 5E5AD 1F66B 2DF4C 1ID3D 2F8NA 5AV5D 3LJAB 3REKA 5BO0A 3AZND 3V9RA 3KWQC 1KX5B 3MGPA 4H9OB 5F99C 1A7WA 5B40D 3AFAD 4J8UC 3O62D 4CSRA 3KUYB 4YS3A 2NZDD 4E45A 2CV5C 4KUDD 2HIOB 1M1AA 3WA9D 1AOID 2G5IC 2F8NB 5B32C 5CPIA 3C1BA 1P3IA 3V9RB 5CP6A 3VH6A 5B31D 3MGPB 5AV5B 4XZQA 3AN2C 3LZ1A 4WNNA 5AY8A 2PYOD 5GT0B 3AZFD 4YS3B 4KGCC 4UPKA 1M18A 1P34B 3O62B 3WAAD 3B6FA 3X1UA 5BT1D 4H9SC 3C1BB 1P3IB 1ZLAA 3REJD 3LELA 5CP6B 3MGQC 3B6GC 5B2JC 4XZQB 3H0LC 4WNNB 3LZ1B 1P3MC 1P3FD 4Z66D 3AYWA 4NE3A 3A6ND 4JJNA 4G92C 2ZY5A 5GXQA 4LD9D 3B6FB 3AV2D 2Y2QA 3X1UB 1P3KD 1BH8A 4Z5TA 3AV1A 3MGSA 3REIC 3MNND 3LELB 4X23D 2HUEB 4QLCC 4ZUXA 3AZGA 1M19A 5AV8D 3AZEA 2VQRA 4J8UA 3AYWB 4JJNB 5GXQB 4NE6A 1P3FB 1P3BC 1BH8B 4Z5TB 4WU8A 3AV1B 3AV2B 1P3AB 5C3IB 1P3KB 3W99A 5AV6B 1F66C 3AZID 2FJ7A 3W98A 5B32G 5BNVA 4ZUXB 3LJAC 3AZGB 1M19B 3AZEB 3AN2A 1KX3D 2NQBD 1H3OA 5GSUC 1KX5C 5B33D 4KGCA 4J8XD 3WTPD 4WU8B 3KUYC 3IP4C 5DNND 3W99B 2HIOC 4ZBJB 3AZMC 5CPKD 1ULYA 5BNVB 1H3OB 5B1LD 5DNMA 3MGPC 3UTAD 2AROD 2LY8A 3AZLA 2Y2IA 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB B;  4YS3 C;  5B33 B;  5B0Z D;  1JFI A;  5AVB D;  1P34 C;  3O62 C;  3WTP B;  3WKJ D;  3REI A;  1P3P D;  3W96 A;  3W97 A;  5CPI C;  3C1B C;  5B0Y A;  1P3I C;  3KXB A;  5CP6 C;  5DNM B;  2RVQ C;  5BNX A;  5CPK B;  4XZQ C;  3LZ1 C;  3AZL B;  1KX4 A;  2F8N K;  5B1L B;  5JRG A;  3C1C A;  1JFI B;  5B24 D;  3B6F C;  3X1U C;  5CHL B;  5B0Z B;  5B1M A;  3W97 B;  3AZK A;  4XUJ A;  5B0Y B;  3KXB B;  3LEL C;  1S32 D;  2HUE C;  3X1S D;  1KX4 B;  1KX5 A;  2BYK B;  3UT9 B;  4R8P A;  1U35 B;  3AYW C;  1P3O D;  4JJN C;  5GXQ C;  3X1V D;  2HIO A;  5B1M B;  4Z5T C;  3AV1 C;  2L5A A;  3AZK B;  3MGS C;  5B2I D;  3AV2 C;  1P3A C;  5C3I C;  4EO5 B;  4YM6 D;  5AV6 C;  5G49 A;  2F8N G;  5E5A A;  1S32 B;  1ID3 A;  4ZUX C;  3AZG C;  1M19 C;  5AV5 A;  3AZE C;  1HQ3 D;  1EQZ D;  3REL D;  4R8P B;  5GT0 A;  3AZN A;  4CAY B;  3X1S B;  5BS7 A;  3AZJ D;  5B40 A;  4HGA B;  1HTA A;  3O62 A;  3AFA A;  4H9P B;  4WU8 C;  1P34 A;  2NZD A;  4J8W D;  3TU4 D;  3W99 C;  4KUD A;  4J8V D;  4ZBJ C;  3WA9 A;  5B2I B;  3AZH D;  5G49 B;  4WU9 B;  5E5A B;  3REK D;  5AVC D;  2CWE A;  1ID3 B;  2FJ7 C;  3W98 C;  3VH5 T;  1P3G D;  5CPJ D;  3AZN B;  5AV9 D;  5B31 A;  3B0C T;  1EQZ B;  5B40 B;  3AFA B;  4Z2M H;  3AZF A;  2NZD B;  5B33 C;  1M1A D;  3LZ0 D;  4KUD B;  3WTP C;  3WAA A;  3REH D;  3WA9 B;  4J8W B;  3KSY A;  3MGR D;  1TZY D;  1AOI B;  4J8V B;  3REJ A;  5DNM C;  3AZH B;  5CPK C;  5AVC B;  5B31 B;  5GT3 D;  3AZL C;  2PYO B;  1P3L D;  3UTB D;  3AZF B;  1BH9 A;  1M18 D;  1P3F A;  4Z66 A;  3A6N A;  3WAA B;  2YFV A;  4LD9 A;  3W96 C;  3AV2 A;  1P3A A;  1P3K A;  3LZ0 B;  3W97 C;  5B0Y C;  5AV6 A;  4NFT A;  3KXB C;  3REJ B;  3MNN A;  4X23 A;  3X1T D;  1KX4 C;  4E44 A;  1BH9 B;  5JRG C;  5AV8 A;  3UT9 C;  3C1C C;  1U35 C;  4Z66 B;  3A6N B;  2YFV B;  1P3L B;  4LD9 B;  5B1M C;  1WWS A;  3AZK C;  4XUJ C;  3MVD D;  4EO5 C;  3MNN B;  4X23 B;  3KWQ D;  3AZI A;  1S32 C;  5F99 D;  4H9Q A;  5AV8 B;  4R8P C;  2NQB A;  2CV5 D;  5B33 A;  4J8X A;  3WTP A;  4H9R B;  5B32 D;  5DNN A;  3R45 B;  4WU9 C;  5E5A C;  3AZI B;  1ID3 C;  3AN2 D;  5CPK A;  5AV5 C;  1KX3 B;  4H9Q B;  3VH6 T;  3AZN C;  5B1L A;  5BS7 C;  3NQU A;  3UTA A;  2ARO A;  1EQZ C;  3AFA C;  5B40 C;  4J8X B;  2NZD C;  5B0Z A;  5DNN B;  4KUD C;  5AVB A;  3WA9 C;  4NE5 A;  3WTP E;  3MGQ D;  1P3P A;  3B6G D;  5B2J D;  1AOI C;  1P3M D;  1B6W A;  2BYK A;  2BYM A;  5AVC C;  5B31 C;  3NQU B;  3UT9 A;  3UTA B;  2ARO B;  1U35 A;  2PYO C;  3AZF C;  5AVB B;  3WAA C;  5B24 A;  3WKJ B;  1P3P B;  5BT1 C;  4QLC D;  3REJ C;  1S32 A;  2BYM B;  4CAY A;  3X1S A;  1P3B D;  1P3F C;  4Z66 C;  4H9P A;  3A6N C;  5B24 B;  1P3O A;  1R4V A;  4LD9 C;  1N1J B;  3X1V A;  1P3K C;  1F66 D;  5B2I A;  4WU9 A;  3MNN C;  3LJA D;  4YM6 A;  4X23 C;  5GSU D;  1KX5 D;  4KHA B;  3B0B A;  5AV8 C;  3KUY D;  1EQZ A;  3REL A;  3B0D B;  2JSS A;  3AZJ A;  1P3O B;  2HIO D;  3X1V B;  4WV4 B;  3AZM D;  2F8N D;  4J8W A;  3TU4 A;  1AOI A;  4J8V A;  4YM6 B;  3AZH A;  3MGP D;  3AZI C;  5AVC A;  5GT0 D;  1KX3 C;  5GSU B;  1HQ3 B;  4YS3 D;  3REL B;  1WWI A;  5CPJ A;  1P3G A;  2PYO A;  2NQB C;  3AZJ B;  5AV9 A;  5B31 G;  1P34 D;  4J8X C;  5CPI D;  5DNN C;  3C1B D;  3TU4 B;  3LZ0 A;  1P3I D;  5CP6 D;  3REH A;  3AZM B;  2RVQ D;  3MGR A;  1TZY A;  4Z2M G;  4XZQ D;  3REK B;  5BO0 B;  5AY8 D;  3LZ1 D;  1P3G B;  5CPJ B;  5B1L C;  5AV9 B;  3UTA C;  2ARO C;  5GT3 A;  4CSR B;  3B6F D;  3X1U D;  1P3L A;  3UTB A;  5B0Z C;  1M1A B;  5AVB C;  1ZLA D;  3LEL D;  3WKJ C;  3REH B;  1P3P C;  5CPI B;  3MGR B;  1TZY B;  4M6B A;  5AY8 B;  5FUG A;  3AYW D;  4AWL B;  3X1T A;  5GT3 B;  4JJN D;  5GXQ D;  4G91 B;  3UTB B;  4Z5T D;  3AV1 D;  1M18 B;  3MGS D;  5B24 C;  1P3A D;  4H9R A;  3R45 A;  5AV6 D;  1ZLA B;  3MVD A;  4ZUX D;  3AZG D;  1M19 D;  3AZE D;  4J8U D;  1KX3 A;  5FUG B;  3X1T B;  3KWQ A;  3X1S C;  5F99 A;  3NQJ A;  4WU8 D;  4HGA C;  3B0D C;  1P3O C;  3W99 D;  2CV5 A;  3X1V C;  2IO5 B;  3MGS B;  3VH5 W;  5B2I C;  3MVD B;  2FJ7 D;  3W98 D;  5JA4 A;  5B32 A;  3B0C W;  4YM6 C;  3KWQ B;  4KGC D;  5F99 B;  4UUZ A;  4J8U B;  3NQJ B;  1HQ3 C;  3REL C;  4WZS B;  3AZJ C;  2CV5 B;  3WKJ A;  4J8W C;  3TU4 C;  5JA4 B;  5B32 B;  4H9S A;  4J8V C;  5DNM D;  3VH5 A;  5KDM A;  3MGQ A;  3AZH C;  2FJ7 B;  5B2J A;  3B6G A;  3W98 B;  3REK C;  3AZL D;  4UUZ B;  3AN2 B;  1P3G C;  5CPJ C;  1P3M A;  4KGC B;  5AV9 C;  3REI D;  3W96 D;  1N1J A;  3W97 D;  1M1A C;  5B0Y D;  3LZ0 C;  3KXB D;  3REH C;  5KDM B;  3MGQ B;  3MGR C;  1TZY C;  3B6G B;  5B2J B;  1KX4 D;  4QLC A;  1P3M B;  1KU5 A;  4KHA A;  5JRG D;  3UT9 D;  1TAF A;  3C1C D;  1U35 D;  5AY8 C;  4AWL C;  5GT3 C;  4G92 B;  1P3L C;  4G91 C;  3UTB C;  5B1M D;  1P3B A;  1M18 C;  3AZK D;  4XUJ D;  1Q9C A;  4H9N A;  2YFW A;  3REI B;  3W96 B;  1F66 A;  1ZLA C;  1BFM A;  4QLC B;  5BNX B;  3LJA A;  1B67 A;  1TAF B;  4R8P D;  5GSU A;  1HQ3 A;  3X1T C;  4H9O A;  4DRB A;  5JRG B;  3C1C B;  2F8N H;  4DRA A;  1P3B B;  3KUY A;  4H9N B;  1F1E A;  2YFW B;  2IO5 C;  4XUJ B;  3VH6 W;  1F66 B;  4WU9 D;  3AZM A;  3MVD C;  5E5A D;  2F8N A;  1ID3 D;  5AV5 D;  3LJA B;  3REK A;  5BO0 A;  3AZN D;  3V9R A;  3KWQ C;  1KX5 B;  3MGP A;  4H9O B;  5F99 C;  1A7W A;  5B40 D;  3AFA D;  4J8U C;  3O62 D;  4CSR A;  3KUY B;  4YS3 A;  2NZD D;  4E45 A;  2CV5 C;  4KUD D;  2HIO B;  1M1A A;  3WA9 D;  1AOI D;  2F8N B;  5B32 C;  5CPI A;  3C1B A;  1P3I A;  3V9R B;  5CP6 A;  3VH6 A;  5B31 D;  3MGP B;  5AV5 B;  4XZQ A;  3AN2 C;  3LZ1 A;  4WNN A;  5AY8 A;  2PYO D;  5GT0 B;  3AZF D;  4YS3 B;  4KGC C;  1M18 A;  1P34 B;  3O62 B;  3WAA D;  3B6F A;  3X1U A;  5BT1 D;  4H9S C;  3C1B B;  1P3I B;  1ZLA A;  3REJ D;  3LEL A;  5CP6 B;  3MGQ C;  3B6G C;  5B2J C;  4XZQ B;  3LZ1 B;  4WNN B;  1P3M C;  1P3F D;  4Z66 D;  3AYW A;  4NE3 A;  3A6N D;  4JJN A;  4G92 C;  5GXQ A;  4LD9 D;  3B6F B;  3AV2 D;  3X1U B;  1P3K D;  1BH8 A;  4Z5T A;  3AV1 A;  3MGS A;  3REI C;  3MNN D;  3LEL B;  4X23 D;  2HUE B;  4QLC C;  4ZUX A;  3AZG A;  1M19 A;  5AV8 D;  3AZE A;  4J8U A;  3AYW B;  4JJN B;  5GXQ B;  4NE6 A;  1P3F B;  1P3B C;  1BH8 B;  4Z5T B;  4WU8 A;  3AV1 B;  3AV2 B;  1P3A B;  5C3I B;  1P3K B;  3W99 A;  5AV6 B;  1F66 C;  3AZI D;  2FJ7 A;  3W98 A;  5B32 G;  5BNV A;  4ZUX B;  3LJA C;  3AZG B;  1M19 B;  3AZE B;  3AN2 A;  1KX3 D;  2NQB D;  1H3O A;  5GSU C;  1KX5 C;  5B33 D;  4KGC A;  4J8X D;  3WTP D;  4WU8 B;  3KUY C;  5DNN D;  3W99 B;  2HIO C;  4ZBJ B;  3AZM C;  5CPK D;  1ULY A;  5BNV B;  1H3O B;  5B1L D;  5DNM A;  3MGP C;  3UTA D;  2ARO D;  2LY8 A;  3AZL A;  5GT0 C; 
#chains in the Genus database with same CATH topology
 2NQB B;  4YS3 C;  5B33 B;  5B0Z D;  1JFI A;  5AVB D;  1P34 C;  3O62 C;  3WTP B;  3WKJ D;  3REI A;  1P3P D;  3W96 A;  3W97 A;  5CPI C;  3C1B C;  5B0Y A;  1P3I C;  3KXB A;  5CP6 C;  5DNM B;  2RVQ C;  5BNX A;  5CPK B;  4XZQ C;  3LZ1 C;  3AZL B;  1KX4 A;  2F8N K;  5B1L B;  5JRG A;  3C1C A;  2ZY4 A;  1JFI B;  5B24 D;  3B6F C;  3X1U C;  5CHL B;  5B0Z B;  5B1M A;  3W97 B;  3AZK A;  2FFF B;  4XUJ A;  5B0Y B;  3KXB B;  3LEL C;  1S32 D;  3EPJ A;  3AL0 C;  1W2E A;  2HUE C;  3X1S D;  1KX4 B;  1KX5 A;  2BYK B;  3UT9 B;  4R8P A;  1U35 B;  3AYW C;  1P3O D;  4JJN C;  5GXQ C;  3X1V D;  2HIO A;  5B1M B;  4Z5T C;  3AV1 C;  2L5A A;  3AZK B;  3MGS C;  5B2I D;  3AV2 C;  1P3A C;  5C3I C;  4EO5 B;  4YM6 D;  2ZY3 A;  5AV6 C;  5G49 A;  2F8N G;  5E5A A;  1S32 B;  1ID3 A;  4ZUX C;  3AZG C;  1M19 C;  2Y2L A;  5AV5 A;  3AZE C;  1HQ3 D;  1EQZ D;  3REL D;  2Y2H A;  5GT0 A;  4R8P B;  4CAY B;  3X1S B;  3AZN A;  5BS7 A;  3AZJ D;  5B40 A;  4HGA B;  1HTA A;  3O62 A;  3AFA A;  4H9P B;  4WU8 C;  1P34 A;  2NZD A;  4J8W D;  3TU4 D;  3W99 C;  4KUD A;  4J8V D;  4ZBJ C;  3WA9 A;  5B2I B;  3AZH D;  5G49 B;  4WU9 B;  5E5A B;  3REK D;  5AVC D;  2CWE A;  1ID3 B;  2FJ7 C;  3W98 C;  3VH5 T;  1P3G D;  5CPJ D;  3AZN B;  5AV9 D;  5B31 A;  3B0C T;  3A1K A;  1EQZ B;  2Y2P A;  5B40 B;  3AFA B;  4Z2M H;  3AZF A;  2NZD B;  5B33 C;  1M1A D;  3LZ0 D;  4KUD B;  3WTP C;  3WAA A;  3F6T A;  3REH D;  3WA9 B;  4J8W B;  3KSY A;  3MGR D;  1TZY D;  1AOI B;  4J8V B;  3REJ A;  5DNM C;  3AZH B;  5CPK C;  5AVC B;  5B31 B;  5GT3 D;  3AZL C;  2PYO B;  1P3L D;  3UTB D;  3AZF B;  4WJ3 C;  1BH9 A;  1M18 D;  1P3F A;  2ZM5 A;  4Z66 A;  3A6N A;  3WAA B;  2YFV A;  4LD9 A;  3W96 C;  3AV2 A;  1P3A A;  1P3K A;  3LZ0 B;  3W97 C;  5B0Y C;  5AV6 A;  4NFT A;  3KXB C;  3REJ B;  3MNN A;  4X23 A;  3X1T D;  1KX4 C;  4E44 A;  1BH9 B;  5JRG C;  5AV8 A;  2W8S A;  3C1C C;  3UT9 C;  1U35 C;  4Z66 B;  3A6N B;  2YFV B;  1P3L B;  4LD9 B;  2BG1 A;  5B1M C;  1WWS A;  3AZK C;  4XUJ C;  3MVD D;  4EO5 C;  3MNN B;  4X23 B;  3KWQ D;  3AZI A;  1S32 C;  5F99 D;  4H9Q A;  5AV8 B;  4R8P C;  2NQB A;  2CV5 D;  5B33 A;  4J8X A;  3WTP A;  4H9R B;  5B32 D;  5DNN A;  3EG5 B;  3R45 B;  4WU9 C;  5E5A C;  3AZI B;  1ID3 C;  3AN2 D;  5CPK A;  5AV5 C;  1KX3 B;  4H9Q B;  3VH6 T;  3AZN C;  5B1L A;  5BS7 C;  3NQU A;  3UTA A;  2ARO A;  1EQZ C;  3AFA C;  3EPL A;  5B40 C;  4J8X B;  2NZD C;  5B0Z A;  2Y2O A;  5DNN B;  4KUD C;  5AVB A;  3WA9 C;  4NE5 A;  3WTP E;  3MGQ D;  1P3P A;  3B6G D;  5B2J D;  1AOI C;  1P3M D;  1B6W A;  2BYK A;  2BYM A;  5AVC C;  5B31 C;  3NQU B;  3UT9 A;  3UTA B;  2ARO B;  1U35 A;  2PYO C;  3AZF C;  2J8P A;  5AVB B;  3WAA C;  5B24 A;  3WKJ B;  1P3P B;  5BT1 C;  4QLC D;  3REJ C;  1S32 A;  2BYM B;  4CAY A;  3X1S A;  1P3B D;  1P3F C;  4Z66 C;  4H9P A;  3A6N C;  5B24 B;  1P3O A;  1R4V A;  4LD9 C;  1N1J B;  3X1V A;  1P3K C;  1F66 D;  5B2I A;  4WU9 A;  3MNN C;  3LJA D;  2XD1 A;  4YM6 A;  4X23 C;  5GSU D;  1KX5 D;  4KHA B;  3B0B A;  5AV8 C;  3KUY D;  1EQZ A;  3REL A;  3B0D B;  2UWX A;  2JSS A;  3AZJ A;  1P3O B;  2HIO D;  3X1V B;  4WV4 B;  2XD5 A;  3AZM D;  2F8N D;  4J8W A;  4DQY B;  3TU4 A;  1AOI A;  4J8V A;  4YM6 B;  3AZH A;  3MGP D;  3AZI C;  5AVC A;  5GT0 D;  1KX3 C;  5GSU B;  1HQ3 B;  4YS3 D;  3REL B;  1WWI A;  5CPJ A;  1P3G A;  2PYO A;  2NQB C;  3AZJ B;  5AV9 A;  5B31 G;  1P34 D;  4J8X C;  5CPI D;  5DNN C;  3C1B D;  3TU4 B;  3LZ0 A;  1P3I D;  5CP6 D;  3REH A;  3AZM B;  2RVQ D;  3MGR A;  1TZY A;  4Z2M G;  4XZQ D;  3REK B;  5BO0 B;  2G5H C;  5AY8 D;  3LZ1 D;  1P3G B;  5CPJ B;  5B1L C;  5AV9 B;  3UTA C;  2ARO C;  2Y2M A;  4CSR B;  5GT3 A;  3B6F D;  3X1U D;  1P3L A;  3UTB A;  5B0Z C;  1M1A B;  5AVB C;  1ZLA D;  3LEL D;  3WKJ C;  3REH B;  1P3P C;  5CPI B;  3MGR B;  1TZY B;  4M6B A;  3A1I A;  5AY8 B;  5FUG A;  3H0M C;  4AWL B;  3AYW D;  5GT3 B;  4JJN D;  5GXQ D;  3X1T A;  2Y2K A;  4G91 B;  3UTB B;  4Z5T D;  3AV1 D;  1M18 B;  3MGS D;  5B24 C;  1P3A D;  4H9R A;  3R45 A;  5AV6 D;  1ZLA B;  3MVD A;  4ZUX D;  3AZG D;  1M19 D;  3AZE D;  4J8U D;  1KX3 A;  5FUG B;  3X1T B;  3KWQ A;  3X1S C;  5F99 A;  3NQJ A;  4WU8 D;  2DQN C;  2Y2J A;  4HGA C;  3B0D C;  1P3O C;  3W99 D;  2CV5 A;  3X1V C;  2IO5 B;  2JCH A;  3MGS B;  3VH5 W;  5B2I C;  3MVD B;  2FJ7 D;  3W98 D;  5JA4 A;  5B32 A;  2RIQ A;  3B0C W;  4YM6 C;  3KWQ B;  4KGC D;  5F99 B;  4UUZ A;  3P5J B;  4J8U B;  3NQJ B;  1HQ3 C;  3REL C;  4WZS B;  3AZJ C;  2CV5 B;  3WKJ A;  4J8W C;  3TU4 C;  5JA4 B;  5B32 B;  4H9S A;  4J8V C;  5DNM D;  3VH5 A;  5KDM A;  3MGQ A;  3AZH C;  2FJ7 B;  5B2J A;  3B6G A;  2JE5 A;  3W98 B;  3REK C;  3AZL D;  4UUZ B;  3AN2 B;  1P3G C;  5CPJ C;  1P3M A;  4KGC B;  5AV9 C;  3H0R C;  3REI D;  3EPH A;  3W96 D;  1N1J A;  3W97 D;  1M1A C;  5B0Y D;  3LZ0 C;  1T3U A;  3KXB D;  2Y2G A;  3REH C;  5KDM B;  3MGQ B;  3MGR C;  1TZY C;  3B6G B;  5B2J B;  1KX4 D;  4QLC A;  1P3M B;  1KU5 A;  4KHA A;  5JRG D;  3UT9 D;  1TAF A;  3KFU G;  3C1C D;  1U35 D;  5AY8 C;  4AWL C;  5GT3 C;  4G92 B;  1P3L C;  4G91 C;  3UTB C;  5B1M D;  2F2A C;  1P3B A;  1M18 C;  3AZK D;  4XUJ D;  1Q9C A;  4H9N A;  2YFW A;  3REI B;  3W96 B;  1F66 A;  1ZLA C;  1PZR A;  1BFM A;  4QLC B;  2Y2N A;  5BNX B;  3LJA A;  1B67 A;  2ZY2 A;  1TAF B;  4R8P D;  5GSU A;  1HQ3 A;  3X1T C;  4H9O A;  4DRB A;  5JRG B;  3FDD A;  3C1C B;  4DRA A;  1P3B B;  3KUY A;  2F8N H;  4H9N B;  1F1E A;  2YFW B;  2IO5 C;  4XUJ B;  3EPK A;  1Z2C B;  3VH6 W;  4WU9 D;  3AZM A;  3MVD C;  5E5A D;  1F66 B;  2DF4 C;  1ID3 D;  2F8N A;  5AV5 D;  3LJA B;  3REK A;  5BO0 A;  3AZN D;  3V9R A;  3KWQ C;  1KX5 B;  3MGP A;  4H9O B;  5F99 C;  1A7W A;  5B40 D;  3AFA D;  4J8U C;  3O62 D;  4CSR A;  3KUY B;  4YS3 A;  2NZD D;  4E45 A;  2CV5 C;  4KUD D;  2HIO B;  1M1A A;  3WA9 D;  1AOI D;  2G5I C;  2F8N B;  5B32 C;  5CPI A;  3C1B A;  1P3I A;  3V9R B;  5CP6 A;  3VH6 A;  5B31 D;  3MGP B;  5AV5 B;  4XZQ A;  3AN2 C;  3LZ1 A;  4WNN A;  5AY8 A;  2PYO D;  5GT0 B;  3AZF D;  4YS3 B;  4KGC C;  4UPK A;  1M18 A;  1P34 B;  3O62 B;  3WAA D;  3B6F A;  3X1U A;  5BT1 D;  4H9S C;  3C1B B;  1P3I B;  1ZLA A;  3REJ D;  3LEL A;  5CP6 B;  3MGQ C;  3B6G C;  5B2J C;  4XZQ B;  3H0L C;  4WNN B;  3LZ1 B;  1P3M C;  1P3F D;  4Z66 D;  3AYW A;  4NE3 A;  3A6N D;  4JJN A;  4G92 C;  2ZY5 A;  5GXQ A;  4LD9 D;  3B6F B;  3AV2 D;  2Y2Q A;  3X1U B;  1P3K D;  1BH8 A;  4Z5T A;  3AV1 A;  3MGS A;  3REI C;  3MNN D;  3LEL B;  4X23 D;  2HUE B;  4QLC C;  4ZUX A;  3AZG A;  1M19 A;  5AV8 D;  3AZE A;  2VQR A;  4J8U A;  3AYW B;  4JJN B;  5GXQ B;  4NE6 A;  1P3F B;  1P3B C;  1BH8 B;  4Z5T B;  4WU8 A;  3AV1 B;  3AV2 B;  1P3A B;  5C3I B;  1P3K B;  3W99 A;  5AV6 B;  1F66 C;  3AZI D;  2FJ7 A;  3W98 A;  5B32 G;  5BNV A;  4ZUX B;  3LJA C;  3AZG B;  1M19 B;  3AZE B;  3AN2 A;  1KX3 D;  2NQB D;  1H3O A;  5GSU C;  1KX5 C;  5B33 D;  4KGC A;  4J8X D;  3WTP D;  4WU8 B;  3KUY C;  3IP4 C;  5DNN D;  3W99 B;  2HIO C;  4ZBJ B;  3AZM C;  5CPK D;  1ULY A;  5BNV B;  1H3O B;  5B1L D;  5DNM A;  3MGP C;  3UTA D;  2ARO D;  2LY8 A;  3AZL A;  2Y2I A;  5GT0 C; 
#chains in the Genus database with same CATH homology
 2NQB B;  4YS3 C;  5B33 B;  5B0Z D;  1JFI A;  5AVB D;  1P34 C;  3O62 C;  3WTP B;  3WKJ D;  3REI A;  1P3P D;  3W96 A;  3W97 A;  5CPI C;  3C1B C;  5B0Y A;  1P3I C;  3KXB A;  5CP6 C;  5DNM B;  2RVQ C;  5BNX A;  5CPK B;  4XZQ C;  3LZ1 C;  3AZL B;  1KX4 A;  2F8N K;  5B1L B;  5JRG A;  3C1C A;  2ZY4 A;  1JFI B;  5B24 D;  3B6F C;  3X1U C;  5CHL B;  5B0Z B;  5B1M A;  3W97 B;  3AZK A;  2FFF B;  4XUJ A;  5B0Y B;  3KXB B;  3LEL C;  1S32 D;  3EPJ A;  3AL0 C;  1W2E A;  2HUE C;  3X1S D;  1KX4 B;  1KX5 A;  2BYK B;  3UT9 B;  4R8P A;  1U35 B;  3AYW C;  1P3O D;  4JJN C;  5GXQ C;  3X1V D;  2HIO A;  5B1M B;  4Z5T C;  3AV1 C;  2L5A A;  3AZK B;  3MGS C;  5B2I D;  3AV2 C;  1P3A C;  5C3I C;  4EO5 B;  4YM6 D;  2ZY3 A;  5AV6 C;  5G49 A;  2F8N G;  5E5A A;  1S32 B;  1ID3 A;  4ZUX C;  3AZG C;  1M19 C;  2Y2L A;  5AV5 A;  3AZE C;  1HQ3 D;  1EQZ D;  3REL D;  2Y2H A;  5GT0 A;  4R8P B;  4CAY B;  3X1S B;  3AZN A;  5BS7 A;  3AZJ D;  5B40 A;  4HGA B;  1HTA A;  3O62 A;  3AFA A;  4H9P B;  4WU8 C;  1P34 A;  2NZD A;  4J8W D;  3TU4 D;  3W99 C;  4KUD A;  4J8V D;  4ZBJ C;  3WA9 A;  5B2I B;  3AZH D;  5G49 B;  4WU9 B;  5E5A B;  3REK D;  5AVC D;  2CWE A;  1ID3 B;  2FJ7 C;  3W98 C;  3VH5 T;  1P3G D;  5CPJ D;  3AZN B;  5AV9 D;  5B31 A;  3B0C T;  3A1K A;  1EQZ B;  2Y2P A;  5B40 B;  3AFA B;  4Z2M H;  3AZF A;  2NZD B;  5B33 C;  1M1A D;  3LZ0 D;  4KUD B;  3WTP C;  3WAA A;  3F6T A;  3REH D;  3WA9 B;  4J8W B;  3KSY A;  3MGR D;  1TZY D;  1AOI B;  4J8V B;  3REJ A;  5DNM C;  3AZH B;  5CPK C;  5AVC B;  5B31 B;  5GT3 D;  3AZL C;  2PYO B;  1P3L D;  3UTB D;  3AZF B;  4WJ3 C;  1BH9 A;  1M18 D;  1P3F A;  2ZM5 A;  4Z66 A;  3A6N A;  3WAA B;  2YFV A;  4LD9 A;  3W96 C;  3AV2 A;  1P3A A;  1P3K A;  3LZ0 B;  3W97 C;  5B0Y C;  5AV6 A;  4NFT A;  3KXB C;  3REJ B;  3MNN A;  4X23 A;  3X1T D;  1KX4 C;  4E44 A;  1BH9 B;  5JRG C;  5AV8 A;  2W8S A;  3C1C C;  3UT9 C;  1U35 C;  4Z66 B;  3A6N B;  2YFV B;  1P3L B;  4LD9 B;  2BG1 A;  5B1M C;  1WWS A;  3AZK C;  4XUJ C;  3MVD D;  4EO5 C;  3MNN B;  4X23 B;  3KWQ D;  3AZI A;  1S32 C;  5F99 D;  4H9Q A;  5AV8 B;  4R8P C;  2NQB A;  2CV5 D;  5B33 A;  4J8X A;  3WTP A;  4H9R B;  5B32 D;  5DNN A;  3EG5 B;  3R45 B;  4WU9 C;  5E5A C;  3AZI B;  1ID3 C;  3AN2 D;  5CPK A;  5AV5 C;  1KX3 B;  4H9Q B;  3VH6 T;  3AZN C;  5B1L A;  5BS7 C;  3NQU A;  3UTA A;  2ARO A;  1EQZ C;  3AFA C;  3EPL A;  5B40 C;  4J8X B;  2NZD C;  5B0Z A;  2Y2O A;  5DNN B;  4KUD C;  5AVB A;  3WA9 C;  4NE5 A;  3WTP E;  3MGQ D;  1P3P A;  3B6G D;  5B2J D;  1AOI C;  1P3M D;  1B6W A;  2BYK A;  2BYM A;  5AVC C;  5B31 C;  3NQU B;  3UT9 A;  3UTA B;  2ARO B;  1U35 A;  2PYO C;  3AZF C;  2J8P A;  5AVB B;  3WAA C;  5B24 A;  3WKJ B;  1P3P B;  5BT1 C;  4QLC D;  3REJ C;  1S32 A;  2BYM B;  4CAY A;  3X1S A;  1P3B D;  1P3F C;  4Z66 C;  4H9P A;  3A6N C;  5B24 B;  1P3O A;  1R4V A;  4LD9 C;  1N1J B;  3X1V A;  1P3K C;  1F66 D;  5B2I A;  4WU9 A;  3MNN C;  3LJA D;  2XD1 A;  4YM6 A;  4X23 C;  5GSU D;  1KX5 D;  4KHA B;  3B0B A;  5AV8 C;  3KUY D;  1EQZ A;  3REL A;  3B0D B;  2UWX A;  2JSS A;  3AZJ A;  1P3O B;  2HIO D;  3X1V B;  4WV4 B;  2XD5 A;  3AZM D;  2F8N D;  4J8W A;  4DQY B;  3TU4 A;  1AOI A;  4J8V A;  4YM6 B;  3AZH A;  3MGP D;  3AZI C;  5AVC A;  5GT0 D;  1KX3 C;  5GSU B;  1HQ3 B;  4YS3 D;  3REL B;  1WWI A;  5CPJ A;  1P3G A;  2PYO A;  2NQB C;  3AZJ B;  5AV9 A;  5B31 G;  1P34 D;  4J8X C;  5CPI D;  5DNN C;  3C1B D;  3TU4 B;  3LZ0 A;  1P3I D;  5CP6 D;  3REH A;  3AZM B;  2RVQ D;  3MGR A;  1TZY A;  4Z2M G;  4XZQ D;  3REK B;  5BO0 B;  2G5H C;  5AY8 D;  3LZ1 D;  1P3G B;  5CPJ B;  5B1L C;  5AV9 B;  3UTA C;  2ARO C;  2Y2M A;  4CSR B;  5GT3 A;  3B6F D;  3X1U D;  1P3L A;  3UTB A;  5B0Z C;  1M1A B;  5AVB C;  1ZLA D;  3LEL D;  3WKJ C;  3REH B;  1P3P C;  5CPI B;  3MGR B;  1TZY B;  4M6B A;  3A1I A;  5AY8 B;  5FUG A;  3H0M C;  4AWL B;  3AYW D;  5GT3 B;  4JJN D;  5GXQ D;  3X1T A;  2Y2K A;  4G91 B;  3UTB B;  4Z5T D;  3AV1 D;  1M18 B;  3MGS D;  5B24 C;  1P3A D;  4H9R A;  3R45 A;  5AV6 D;  1ZLA B;  3MVD A;  4ZUX D;  3AZG D;  1M19 D;  3AZE D;  4J8U D;  1KX3 A;  5FUG B;  3X1T B;  3KWQ A;  3X1S C;  5F99 A;  3NQJ A;  4WU8 D;  2DQN C;  2Y2J A;  4HGA C;  3B0D C;  1P3O C;  3W99 D;  2CV5 A;  3X1V C;  2IO5 B;  2JCH A;  3MGS B;  3VH5 W;  5B2I C;  3MVD B;  2FJ7 D;  3W98 D;  5JA4 A;  5B32 A;  2RIQ A;  3B0C W;  4YM6 C;  3KWQ B;  4KGC D;  5F99 B;  4UUZ A;  3P5J B;  4J8U B;  3NQJ B;  1HQ3 C;  3REL C;  4WZS B;  3AZJ C;  2CV5 B;  3WKJ A;  4J8W C;  3TU4 C;  5JA4 B;  5B32 B;  4H9S A;  4J8V C;  5DNM D;  3VH5 A;  5KDM A;  3MGQ A;  3AZH C;  2FJ7 B;  5B2J A;  3B6G A;  2JE5 A;  3W98 B;  3REK C;  3AZL D;  4UUZ B;  3AN2 B;  1P3G C;  5CPJ C;  1P3M A;  4KGC B;  5AV9 C;  3H0R C;  3REI D;  3EPH A;  3W96 D;  1N1J A;  3W97 D;  1M1A C;  5B0Y D;  3LZ0 C;  1T3U A;  3KXB D;  2Y2G A;  3REH C;  5KDM B;  3MGQ B;  3MGR C;  1TZY C;  3B6G B;  5B2J B;  1KX4 D;  4QLC A;  1P3M B;  1KU5 A;  4KHA A;  5JRG D;  3UT9 D;  1TAF A;  3KFU G;  3C1C D;  1U35 D;  5AY8 C;  4AWL C;  5GT3 C;  4G92 B;  1P3L C;  4G91 C;  3UTB C;  5B1M D;  2F2A C;  1P3B A;  1M18 C;  3AZK D;  4XUJ D;  1Q9C A;  4H9N A;  2YFW A;  3REI B;  3W96 B;  1F66 A;  1ZLA C;  1PZR A;  1BFM A;  4QLC B;  2Y2N A;  5BNX B;  3LJA A;  1B67 A;  2ZY2 A;  1TAF B;  4R8P D;  5GSU A;  1HQ3 A;  3X1T C;  4H9O A;  4DRB A;  5JRG B;  3FDD A;  3C1C B;  4DRA A;  1P3B B;  3KUY A;  2F8N H;  4H9N B;  1F1E A;  2YFW B;  2IO5 C;  4XUJ B;  3EPK A;  1Z2C B;  3VH6 W;  4WU9 D;  3AZM A;  3MVD C;  5E5A D;  1F66 B;  2DF4 C;  1ID3 D;  2F8N A;  5AV5 D;  3LJA B;  3REK A;  5BO0 A;  3AZN D;  3V9R A;  3KWQ C;  1KX5 B;  3MGP A;  4H9O B;  5F99 C;  1A7W A;  5B40 D;  3AFA D;  4J8U C;  3O62 D;  4CSR A;  3KUY B;  4YS3 A;  2NZD D;  4E45 A;  2CV5 C;  4KUD D;  2HIO B;  1M1A A;  3WA9 D;  1AOI D;  2G5I C;  2F8N B;  5B32 C;  5CPI A;  3C1B A;  1P3I A;  3V9R B;  5CP6 A;  3VH6 A;  5B31 D;  3MGP B;  5AV5 B;  4XZQ A;  3AN2 C;  3LZ1 A;  4WNN A;  5AY8 A;  2PYO D;  5GT0 B;  3AZF D;  4YS3 B;  4KGC C;  4UPK A;  1M18 A;  1P34 B;  3O62 B;  3WAA D;  3B6F A;  3X1U A;  5BT1 D;  4H9S C;  3C1B B;  1P3I B;  1ZLA A;  3REJ D;  3LEL A;  5CP6 B;  3MGQ C;  3B6G C;  5B2J C;  4XZQ B;  3H0L C;  4WNN B;  3LZ1 B;  1P3M C;  1P3F D;  4Z66 D;  3AYW A;  4NE3 A;  3A6N D;  4JJN A;  4G92 C;  2ZY5 A;  5GXQ A;  4LD9 D;  3B6F B;  3AV2 D;  2Y2Q A;  3X1U B;  1P3K D;  1BH8 A;  4Z5T A;  3AV1 A;  3MGS A;  3REI C;  3MNN D;  3LEL B;  4X23 D;  2HUE B;  4QLC C;  4ZUX A;  3AZG A;  1M19 A;  5AV8 D;  3AZE A;  2VQR A;  4J8U A;  3AYW B;  4JJN B;  5GXQ B;  4NE6 A;  1P3F B;  1P3B C;  1BH8 B;  4Z5T B;  4WU8 A;  3AV1 B;  3AV2 B;  1P3A B;  5C3I B;  1P3K B;  3W99 A;  5AV6 B;  1F66 C;  3AZI D;  2FJ7 A;  3W98 A;  5B32 G;  5BNV A;  4ZUX B;  3LJA C;  3AZG B;  1M19 B;  3AZE B;  3AN2 A;  1KX3 D;  2NQB D;  1H3O A;  5GSU C;  1KX5 C;  5B33 D;  4KGC A;  4J8X D;  3WTP D;  4WU8 B;  3KUY C;  3IP4 C;  5DNN D;  3W99 B;  2HIO C;  4ZBJ B;  3AZM C;  5CPK D;  1ULY A;  5BNV B;  1H3O B;  5B1L D;  5DNM A;  3MGP C;  3UTA D;  2ARO D;  2LY8 A;  3AZL A;  2Y2I A;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...