3TU4B

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
GGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4B00
3AZIC 5B0YA 3UT9D 3AFAA 3AZKD 5AY8B 4J8XA 1P34C 4DRAA 3X1VA 3AYWC 2F8NK 5B1LA 5GSUD 4WU8D 2CV5A 5B2JA 3AZMB 5GT3B 3B6FC 3KXBA 4ZUXB 5CPIC 3RELB 3AZJA 1F66B 1P3FA 1ID3B 4UUZA 5BT1D 1JFIA 5AV6D 3UTAB 4J8UB 5CP6D 3WA9B 2IO5C 3AFAC 3W97D 5B31C 3WAAA 5JA4B 1KX5A 3AZNB 2FJ7D 3X1VC 4YM6D 4KUDC 5B1LC 3MVDC 2CV5C 5B0ZB 1S32A 3AV2A 3MGRD 3REKC 4JJNA 5B24D 3MGSA 3AZJC 4M6BA 1P3MD 1P3FC 2NZDA 2BYKB 1P3OD 3UT9B 3AZKB 3LZ1D 3MNND 5GSUA 1P3KB 1HQ3A 2HIOD 3X1UD 1TAFB 3LZ0B 3WKJA 3X1SD 4WU8B 1P3AD 3LJAD 5BNVA 1H3OA 4YS3D 3WAAC 1TZYA 3B6GA 4H9NB 1EQZD 3AZHD 5AV6A 3VH5T 4AWLC 4H9SA 5AVBC 4JJNC 3REIB 3W97A 4Z66D 4Z5TD 5KDMB 3MGSC 3AZGD 5CP6B 4CSRB 2NZDC 2FJ7A 3VH6A 3REHD 1P3PA 1HQ3C 3W98D 1BH9A 1Q9CA 1P3GA 3X1TC 4YM6B 5B31G 3VH5A 4G92C 3WKJC 5B24A 3V9RA 5AV9C 3MGRB 3AZID 5CPKA 1P3OA 1M19C 1TZYC 1P3MB 3B6GC 3LZ1A 5B40B 1P34D 3AYWD 3X1SA 4H9SC 4H9RB 3MNNB 3W99A 2HIOB 4XUJA 3X1UB 1BFMA 4YS3A 2RVQC 3REJC 1P3AB 3LJAB 3B6FD 5CPID 2YFWA 3AZHA 1P3PC 1P3GC 1EQZB 4Z5TA 4Z66A 5B1MC 5CPKC 3B0BA 3AFAD 3AZGB 5B31D 3W98A 2AROC 3UTBA 3X1VD 4KUDD 1KX4B 3REHB 4G91C 3W99C 5B1LD 3MGPA 3MVDD 3B0DB 2CV5D 3AN2C 5CHLB 4QLCA 4XUJC 3C1BC 1F1EA 1ZLAC 3REKD 2BYMA 4H9QA 5AVCC 3AZJD 3AZIB 1P3FD 2PYOC 5G49B 4X23B 1P34B 2HUEC 3O62C 3AYWB 5BNXB 4H9PB 3B6FA 4J8WC 5CPIA 3B6FB 5DNMA 1M18B 3UTBC 3MGPC 5AV8C 4QLCC 3B0CT 5AVBD 4JJND 3MGSD 5B31A 2NZDD 2IO5B 5B0YB 3AFAB 3LELC 4KUDA 5B31B 3VH6W 3MVDA 4J8XB 1HQ3D 3X1VB 3X1TD 4KUDB 3KSYA 3WKJD 5B1LB 3WTPA 3REKA 5C3IC 2CV5B 5AV9D 5B2JB 3AZLC 4KGCC 1M19D 5DNMC 3KXBB 1TZYD 3AZJB 3B6GD 1P3FB 4R8PA 4UUZB 1JFIB 4H9OA 4XZQA 2RVQD 3REJD 1P3BA 1KX3A 4WNNA 3WAAB 1P3PD 1KX5B 3NQJA 1P3GD 3KWQC 5F99C 3WTPC 5AVBA 3MGQC 4AWLB 1S32B 4CAYA 3AV2B 1BH8A 1KU5A 5B1MD 5CPKD 5E5AA 4JJNB 5B2IA 3MGSB 2NZDB 4R8PC 2AROD 5AY8C 4Z2MG 3X1TA 4EO5C 3W99D 5GSUB 1HQ3B 3AN2D 5AV9A 4XUJD 3C1BD 4XZQC 3WKJB 3W96A 5FUGA 1M19A 1P3BC 4HGAC 1ZLAD 1KX3C 5BNVB 5AVCD 1H3OB 2PYOD 4ZUXC 3C1CA 1TZYB 3B6GB 5AV6B 1ID3C 4NFTA 5CPJA 3O62D 3UTAC 3REJA 1P3LA 5E5AC 5B33A 5B2IC 3W97B 4J8WD 1WWIA 2FJ7B 3UTBD 3MGPD 1P3PB 5AV8D 1BH9B 1P3GB 4QLCD 3W96C 5B1MA 5B24B 1ULYA 5BO0A 3V9RB 3C1CC 2AROA 5CPKB 1P3OB 3LELD 4WZSB 3LZ1B 3AN2A 5CPJC 3R45A 3C1BA 3X1SB 4G91B 2NQBA 1P3LC 3W99B 1ZLAA 5B33C 3LZ0C 4XUJB 5AVCA 2PYOA 3AZLD 4YS3B 1B6WA 4KGCD 5DNMD 4ZBJB 5AVCB 2YFWB 3AZHB 4LD9A 3KUYA 3O62A 1R4VA 1U35A 4Z5TB 4Z66B 4J8WA 2HUEB 3REIC 1A7WA 3A6NA 3W98B 5B32A 5AV8A 3UTBB 3KWQD 5F99D 2NQBC 3MGPB 3WTPD 4QLCB 3MGQD 5DNNA 3AZFA 5GXQA 3LELA 2BYMB 4H9QB 5JRGA 4NE6A 4LD9C 2F8NA 1M1AA 3KUYC 4R8PD 2YFVA 5AY8D 1AOIA 3LELB 1N1JA 5B40C 4Z2MH 3TU4A 4WU9A 1U35C 5AV5A 4XZQD 3AZLA 4KGCA 1P3BD 5C3IB 1KX3D 5CPIB 3A6NC 4ZUXD 5B32C 1P3IA 5DNMB 1HTAA 5BS7C 1ID3D 5GT0A 2LY8A 5DNNC 3UTAD 3AZFC 5GXQC 5E5AD 5B2ID 5JRGC 1M1AC 1AOIC 3KWQA 5F99A 3TU4C 4WU9C 3MVDB 3VH5W 3WTPE 4J8VA 1KX4C 3MGQA 5AV5C 3W96D 3WTPB 3AZEA 3REKB 3C1CD 1P3IC 5AY8A 4KHAA 5GT0C 4R8PB 4X23C 5CPJD 1P3KD 4EO5B 4KHAB 4H9OB 1P3LD 5B33D 3LZ0D 3AZMA 5GT3A 4XZQB 1F66A 4ZUXA 3RELA 1P3BB 4HGAB 1KX3B 3AV1C 1M18C 4WNNB 1ID3A 4J8VC 3NQJB 3UTAA 5B32G 4J8UA 1WWSA 5AVBB 3AZEC 3WA9A 4CAYB 1BH8B 3REID 5E5AB 5B2IB 5JA4A 5B0YC 3AZNA 1B67A 3X1TB 4G92B 4J8XC 2F8NG 5B0ZA 2NQBD 3AZMC 5GT3C 5AV9B 4NE3A 1F66C 3RELC 5FUGB 1M19B 3W96B 5B2JC 2BYKA 3UT9A 4LD9D 3KXBC 3AZKA 3C1CB 3KUYD 1P3KA 5B40D 4J8UC 1TAFA 3LZ0A 1U35D 3NQUA 3WA9C 5CPJB 4WU8A 3REJB 1P3LB 5B33B 3NQUB 4NE5A 4E44A 3AZNC 3A6ND 4H9NA 5B32D 3VH6T 4DRBA 1KX5C 5B0ZC 5DNND 3REIA 5KDMA 3AZFD 5B1MB 3AV2C 1S32C 5GXQD 5CP6A 4CSRA 5BO0B 5JRGD 3UT9C 2F8ND 3AZKC 1M1AD 2AROB 1AOID 1P3KC 3TU4D 4YM6A 4WU9D 3AN2B 1KX4D 3R45B 5GSUC 3C1BB 4WU8C 3B0CW 5AV5D 2NQBB 1ZLAB 3MGRA 2PYOB 1P3MA 1P3ID 5B40A 4LD9B 3KUYB 5GT0D 4X23D 5BT1C 3MNNA 4H9RA 5AV6C 3O62B 2HIOA 3X1UA 4WV4B 5CP6C 1U35B 4J8WB 1P3AA 3LJAA 3W97C 3AV1D 1M18D 3A6NB 2FJ7C 5BS7A 4YM6C 5B32B 5AV8B 1EQZA 4J8VD 3MGRC 3AZED 5DNNB 5B24C 2JSSA 3AZFB 1P3MC 3AZGA 5GXQB 2CWEA 5JRGB 1P3OC 5B0YD 2F8NB 1M1AB 2YFVB 3LZ1C 3MNNC 3REHA 1KX4A 1AOIB 1N1JB 4J8XD 2HIOC 3TU4B 3X1UC 4WU9B 3X1SC 3AZMD 2F8NH 5GT3D 1P3AC 5AV5B 3LJAC 3AZLB 1F66D 3RELD 4KGCB 5B2JD 3AZIA 4YS3C 5G49A 4ZBJC 3KXBD 4X23A 1P3IB 1EQZC 3AZHC 2L5AA 1P34A 3AYWA 5GT0B 4J8UD 3WA9D 5BNXA 4H9PA 4Z5TC 4Z66C 3AZGC 3AV1A 1M18A 3AZND 3REHC 3AV1B 3W98C 3KWQB 3B0DC 5F99B 3WAAD 1KX5D 5B0ZD 4E45A 4J8VB 3MGQB 1S32D 3AV2D 3AZEB
chains in the Genus database with same CATH superfamily
3AZIC 5B0YA 3UT9D 3AFAA 3AZKD 2G5HC 5AY8B 4J8XA 1P34C 4DRAA 3X1VA 3AYWC 2F8NK 5B1LA 5GSUD 4WU8D 2CV5A 5B2JA 3IP4C 3AZMB 5GT3B 2ZY3A 3B6FC 3KXBA 4ZUXB 5CPIC 3RELB 3AZJA 1F66B 1P3FA 1ID3B 4UUZA 5BT1D 1JFIA 5AV6D 3A1KA 3UTAB 4J8UB 5CP6D 1W2EA 3WA9B 2IO5C 3AFAC 3W97D 5B31C 4DQYB 3WAAA 5JA4B 1KX5A 3AZNB 2FJ7D 3X1VC 4YM6D 4KUDC 5B1LC 3MVDC 2CV5C 5B0ZB 1S32A 3AV2A 3MGRD 3REKC 4JJNA 5B24D 3MGSA 3AZJC 4M6BA 1P3MD 1P3FC 2NZDA 2BYKB 1P3OD 3UT9B 3AZKB 3LZ1D 3MNND 2VQRA 5GSUA 1P3KB 1HQ3A 2HIOD 3X1UD 2ZY5A 1TAFB 3LZ0B 3WKJA 3X1SD 4WU8B 1P3AD 3LJAD 5BNVA 1H3OA 4YS3D 3WAAC 1TZYA 3B6GA 4H9NB 1EQZD 3AZHD 5AV6A 2Y2QA 3VH5T 4AWLC 4H9SA 5AVBC 4JJNC 3REIB 3W97A 5KDMB 4Z5TD 4Z66D 3MGSC 3AZGD 5CP6B 4CSRB 2NZDC 2FJ7A 3VH6A 3REHD 1P3PA 1HQ3C 3W98D 1BH9A 1Q9CA 1P3GA 3X1TC 4YM6B 5B31G 3VH5A 4G92C 3WKJC 5B24A 3V9RA 5AV9C 3MGRB 3AZID 5CPKA 1P3OA 1M19C 2Y2IA 1TZYC 1P3MB 3B6GC 3LZ1A 5B40B 1P34D 3AYWD 3X1SA 4H9SC 4H9RB 3MNNB 3W99A 2HIOB 4XUJA 3X1UB 1BFMA 4YS3A 2Y2GA 2RVQC 3REJC 1P3AB 3LJAB 3B6FD 5CPID 2YFWA 3AZHA 1P3PC 1P3GC 1EQZB 4Z5TA 4Z66A 5B1MC 5CPKC 2JE5A 3B0BA 3AFAD 3AZGB 5B31D 3W98A 2AROC 2J8PA 3UTBA 3X1VD 4KUDD 1KX4B 3REHB 4G91C 3W99C 5B1LD 3MGPA 3MVDD 3B0DB 3H0LC 2CV5D 3AN2C 5CHLB 4QLCA 4XUJC 3C1BC 1F1EA 1ZLAC 3REKD 2BYMA 4H9QA 5AVCC 3AZJD 3AZIB 1P3FD 2PYOC 5G49B 3H0MC 4X23B 1P34B 2HUEC 3O62C 3AYWB 5BNXB 4H9PB 3B6FA 3F6TA 4J8WC 5CPIA 3B6FB 5DNMA 1M18B 3UTBC 3A1IA 3MGPC 3AL0C 5AV8C 4QLCC 3B0CT 5AVBD 4JJND 3MGSD 5B31A 3EPLA 1PZRA 2NZDD 2IO5B 5B0YB 3AFAB 3LELC 4KUDA 5B31B 3VH6W 3MVDA 4J8XB 1HQ3D 3X1VB 3X1TD 4KUDB 3KSYA 3WKJD 5B1LB 2RIQA 3WTPA 3REKA 5C3IC 2CV5B 5AV9D 5B2JB 3AZLC 4KGCC 1M19D 5DNMC 3KXBB 3EPHA 1TZYD 3AZJB 3B6GD 1P3FB 4R8PA 4UUZB 1JFIB 4H9OA 4UPKA 4XZQA 2RVQD 3REJD 1P3BA 1KX3A 2UWXA 4WNNA 3WAAB 1P3PD 1KX5B 3NQJA 1P3GD 3KWQC 5F99C 3WTPC 5AVBA 3MGQC 4AWLB 1S32B 4CAYA 3AV2B 1BH8A 3EG5B 1KU5A 5B1MD 5CPKD 5E5AA 4JJNB 5B2IA 3MGSB 2NZDB 4R8PC 2AROD 5AY8C 4Z2MG 3X1TA 2Y2KA 4EO5C 3W99D 5GSUB 1HQ3B 3AN2D 5AV9A 4XUJD 3C1BD 4XZQC 3WKJB 3W96A 5FUGA 1M19A 1P3BC 4HGAC 1ZLAD 1KX3C 5BNVB 5AVCD 1H3OB 2PYOD 4ZUXC 3C1CA 1TZYB 3H0RC 3B6GB 5AV6B 1ID3C 4NFTA 5CPJA 3O62D 2ZY2A 3UTAC 3REJA 1P3LA 5E5AC 5B33A 5B2IC 3W97B 4J8WD 3P5JB 1WWIA 2Y2JA 2FJ7B 2ZM5A 3UTBD 3MGPD 1P3PB 5AV8D 1BH9B 1P3GB 4QLCD 3W96C 5B1MA 1Z2CB 1ULYA 5BO0A 5B24B 3V9RB 3EPKA 3C1CC 2AROA 5CPKB 1P3OB 3LELD 2Y2LA 4WZSB 3LZ1B 3AN2A 5CPJC 3R45A 3C1BA 3X1SB 4G91B 2NQBA 1P3LC 3W99B 1ZLAA 5B33C 3LZ0C 4XUJB 5AVCA 2PYOA 3AZLD 4YS3B 1B6WA 4KGCD 5DNMD 4ZBJB 5AVCB 2YFWB 3AZHB 4LD9A 3KUYA 3O62A 1R4VA 1U35A 4Z5TB 4Z66B 4J8WA 2HUEB 3REIC 3EPJA 4WJ3C 1A7WA 3A6NA 3W98B 5B32A 5AV8A 3UTBB 3KWQD 5F99D 2NQBC 3MGPB 3WTPD 4QLCB 3MGQD 5DNNA 3AZFA 5GXQA 3LELA 2BYMB 4H9QB 5JRGA 4NE6A 4LD9C 2F8NA 1M1AA 3KUYC 4R8PD 2YFVA 5AY8D 1AOIA 3LELB 1N1JA 5B40C 4Z2MH 3TU4A 4WU9A 1U35C 5AV5A 4XZQD 3AZLA 4KGCA 1P3BD 5C3IB 1KX3D 5CPIB 3A6NC 4ZUXD 5B32C 1P3IA 5DNMB 1HTAA 5BS7C 1ID3D 5GT0A 2LY8A 5DNNC 3UTAD 3AZFC 5GXQC 5E5AD 2JCHA 1T3UA 5B2ID 2DF4C 5JRGC 1M1AC 1AOIC 3KWQA 5F99A 3TU4C 4WU9C 3MVDB 3VH5W 3WTPE 4J8VA 1KX4C 3MGQA 5AV5C 3W96D 3WTPB 3AZEA 3REKB 2ZY4A 3C1CD 1P3IC 5AY8A 4KHAA 5GT0C 4R8PB 4X23C 5CPJD 1P3KD 4EO5B 4KHAB 4H9OB 1P3LD 5B33D 3LZ0D 3AZMA 5GT3A 2Y2NA 4XZQB 1F66A 4ZUXA 3RELA 1P3BB 4HGAB 1KX3B 3AV1C 1M18C 4WNNB 1ID3A 4J8VC 3NQJB 3UTAA 5B32G 4J8UA 1WWSA 5AVBB 3AZEC 3WA9A 4CAYB 1BH8B 3REID 5E5AB 5B2IB 5JA4A 5B0YC 3AZNA 1B67A 2Y2PA 3X1TB 4G92B 4J8XC 2F8NG 5B0ZA 2NQBD 2W8SA 3AZMC 5GT3C 5AV9B 4NE3A 1F66C 3RELC 5FUGB 1M19B 3W96B 5B2JC 2BYKA 2XD1A 3UT9A 4LD9D 3KXBC 3AZKA 3C1CB 3KUYD 1P3KA 5B40D 2DQNC 1TAFA 3LZ0A 4J8UC 3NQUA 1U35D 3WA9C 5CPJB 4WU8A 3REJB 1P3LB 5B33B 3NQUB 4NE5A 4E44A 3AZNC 3A6ND 4H9NA 5B32D 2FFFB 3VH6T 4DRBA 1KX5C 5B0ZC 5DNND 3REIA 5KDMA 3AZFD 5B1MB 3AV2C 1S32C 5GXQD 5CP6A 4CSRA 5BO0B 5JRGD 3UT9C 2F8ND 3AZKC 2Y2OA 1M1AD 2AROB 1AOID 1P3KC 3TU4D 4YM6A 2Y2HA 4WU9D 3AN2B 1KX4D 3R45B 5GSUC 3C1BB 4WU8C 3B0CW 5AV5D 2NQBB 1ZLAB 3MGRA 2PYOB 1P3MA 1P3ID 5B40A 4LD9B 3KUYB 3FDDA 5GT0D 5BT1C 4X23D 3MNNA 4H9RA 5AV6C 3O62B 2HIOA 3X1UA 4WV4B 5CP6C 1U35B 4J8WB 1P3AA 3LJAA 3W97C 3AV1D 1M18D 3A6NB 2FJ7C 5BS7A 2XD5A 5B32B 5AV8B 4YM6C 4J8VD 1EQZA 2G5IC 3MGRC 3AZED 5DNNB 5B24C 2JSSA 2BG1A 3AZFB 1P3MC 3AZGA 5GXQB 2CWEA 5JRGB 1P3OC 5B0YD 2F8NB 1M1AB 2YFVB 3LZ1C 3MNNC 3REHA 1KX4A 1AOIB 1N1JB 4J8XD 3KFUG 2HIOC 3TU4B 3X1UC 4WU9B 3X1SC 3AZMD 2F8NH 5GT3D 1P3AC 5AV5B 3LJAC 3AZLB 1F66D 3RELD 4KGCB 5B2JD 3AZIA 4YS3C 5G49A 4ZBJC 3KXBD 4X23A 1P3IB 1EQZC 3AZHC 2L5AA 1P34A 3AYWA 5GT0B 4J8UD 3WA9D 5BNXA 4H9PA 4Z5TC 4Z66C 3AZGC 2F2AC 3AV1A 1M18A 3AZND 3REHC 3AV1B 3W98C 3KWQB 3B0DC 5F99B 2Y2MA 1KX5D 3WAAD 5B0ZD 4E45A 4J8VB 3MGQB 1S32D 3AV2D 3AZEB
chains in the Genus database with same CATH topology
3AZIC 5B0YA 3UT9D 3AFAA 3AZKD 2G5HC 5AY8B 4J8XA 1P34C 4DRAA 3X1VA 3AYWC 2F8NK 5B1LA 5GSUD 4WU8D 2CV5A 5B2JA 3IP4C 3AZMB 5GT3B 2ZY3A 3B6FC 3KXBA 4ZUXB 5CPIC 3RELB 3AZJA 1F66B 1P3FA 1ID3B 4UUZA 5BT1D 1JFIA 5AV6D 3A1KA 3UTAB 4J8UB 5CP6D 1W2EA 3WA9B 2IO5C 3AFAC 3W97D 5B31C 4DQYB 3WAAA 5JA4B 1KX5A 3AZNB 2FJ7D 3X1VC 4YM6D 4KUDC 5B1LC 3MVDC 2CV5C 5B0ZB 1S32A 3AV2A 3MGRD 3REKC 4JJNA 5B24D 3MGSA 3AZJC 4M6BA 1P3MD 1P3FC 2NZDA 2BYKB 1P3OD 3UT9B 3AZKB 3LZ1D 3MNND 2VQRA 5GSUA 1P3KB 1HQ3A 2HIOD 3X1UD 2ZY5A 1TAFB 3LZ0B 3WKJA 3X1SD 4WU8B 1P3AD 3LJAD 5BNVA 1H3OA 4YS3D 3WAAC 1TZYA 3B6GA 4H9NB 1EQZD 3AZHD 5AV6A 2Y2QA 3VH5T 4AWLC 4H9SA 5AVBC 4JJNC 3REIB 3W97A 5KDMB 4Z5TD 4Z66D 3MGSC 3AZGD 5CP6B 4CSRB 2NZDC 2FJ7A 3VH6A 3REHD 1P3PA 1HQ3C 3W98D 1BH9A 1Q9CA 1P3GA 3X1TC 4YM6B 5B31G 3VH5A 4G92C 3WKJC 5B24A 3V9RA 5AV9C 3MGRB 3AZID 5CPKA 1P3OA 1M19C 2Y2IA 1TZYC 1P3MB 3B6GC 3LZ1A 5B40B 1P34D 3AYWD 3X1SA 4H9SC 4H9RB 3MNNB 3W99A 2HIOB 4XUJA 3X1UB 1BFMA 4YS3A 2Y2GA 2RVQC 3REJC 1P3AB 3LJAB 3B6FD 5CPID 2YFWA 3AZHA 1P3PC 1P3GC 1EQZB 4Z5TA 4Z66A 5B1MC 5CPKC 2JE5A 3B0BA 3AFAD 3AZGB 5B31D 3W98A 2AROC 2J8PA 3UTBA 3X1VD 4KUDD 1KX4B 3REHB 4G91C 3W99C 5B1LD 3MGPA 3MVDD 3B0DB 3H0LC 2CV5D 3AN2C 5CHLB 4QLCA 4XUJC 3C1BC 1F1EA 1ZLAC 3REKD 2BYMA 4H9QA 5AVCC 3AZJD 3AZIB 1P3FD 2PYOC 5G49B 3H0MC 4X23B 1P34B 2HUEC 3O62C 3AYWB 5BNXB 4H9PB 3B6FA 3F6TA 4J8WC 5CPIA 3B6FB 5DNMA 1M18B 3UTBC 3A1IA 3MGPC 3AL0C 5AV8C 4QLCC 3B0CT 5AVBD 4JJND 3MGSD 5B31A 3EPLA 1PZRA 2NZDD 2IO5B 5B0YB 3AFAB 3LELC 4KUDA 5B31B 3VH6W 3MVDA 4J8XB 1HQ3D 3X1VB 3X1TD 4KUDB 3KSYA 3WKJD 5B1LB 2RIQA 3WTPA 3REKA 5C3IC 2CV5B 5AV9D 5B2JB 3AZLC 4KGCC 1M19D 5DNMC 3KXBB 3EPHA 1TZYD 3AZJB 3B6GD 1P3FB 4R8PA 4UUZB 1JFIB 4H9OA 4UPKA 4XZQA 2RVQD 3REJD 1P3BA 1KX3A 2UWXA 4WNNA 3WAAB 1P3PD 1KX5B 3NQJA 1P3GD 3KWQC 5F99C 3WTPC 5AVBA 3MGQC 4AWLB 1S32B 4CAYA 3AV2B 1BH8A 3EG5B 1KU5A 5B1MD 5CPKD 5E5AA 4JJNB 5B2IA 3MGSB 2NZDB 4R8PC 2AROD 5AY8C 4Z2MG 3X1TA 2Y2KA 4EO5C 3W99D 5GSUB 1HQ3B 3AN2D 5AV9A 4XUJD 3C1BD 4XZQC 3WKJB 3W96A 5FUGA 1M19A 1P3BC 4HGAC 1ZLAD 1KX3C 5BNVB 5AVCD 1H3OB 2PYOD 4ZUXC 3C1CA 1TZYB 3H0RC 3B6GB 5AV6B 1ID3C 4NFTA 5CPJA 3O62D 2ZY2A 3UTAC 3REJA 1P3LA 5E5AC 5B33A 5B2IC 3W97B 4J8WD 3P5JB 1WWIA 2Y2JA 2FJ7B 2ZM5A 3UTBD 3MGPD 1P3PB 5AV8D 1BH9B 1P3GB 4QLCD 3W96C 5B1MA 1Z2CB 1ULYA 5BO0A 5B24B 3V9RB 3EPKA 3C1CC 2AROA 5CPKB 1P3OB 3LELD 2Y2LA 4WZSB 3LZ1B 3AN2A 5CPJC 3R45A 3C1BA 3X1SB 4G91B 2NQBA 1P3LC 3W99B 1ZLAA 5B33C 3LZ0C 4XUJB 5AVCA 2PYOA 3AZLD 4YS3B 1B6WA 4KGCD 5DNMD 4ZBJB 5AVCB 2YFWB 3AZHB 4LD9A 3KUYA 3O62A 1R4VA 1U35A 4Z5TB 4Z66B 4J8WA 2HUEB 3REIC 3EPJA 4WJ3C 1A7WA 3A6NA 3W98B 5B32A 5AV8A 3UTBB 3KWQD 5F99D 2NQBC 3MGPB 3WTPD 4QLCB 3MGQD 5DNNA 3AZFA 5GXQA 3LELA 2BYMB 4H9QB 5JRGA 4NE6A 4LD9C 2F8NA 1M1AA 3KUYC 4R8PD 2YFVA 5AY8D 1AOIA 3LELB 1N1JA 5B40C 4Z2MH 3TU4A 4WU9A 1U35C 5AV5A 4XZQD 3AZLA 4KGCA 1P3BD 5C3IB 1KX3D 5CPIB 3A6NC 4ZUXD 5B32C 1P3IA 5DNMB 1HTAA 5BS7C 1ID3D 5GT0A 2LY8A 5DNNC 3UTAD 3AZFC 5GXQC 5E5AD 2JCHA 1T3UA 5B2ID 2DF4C 5JRGC 1M1AC 1AOIC 3KWQA 5F99A 3TU4C 4WU9C 3MVDB 3VH5W 3WTPE 4J8VA 1KX4C 3MGQA 5AV5C 3W96D 3WTPB 3AZEA 3REKB 2ZY4A 3C1CD 1P3IC 5AY8A 4KHAA 5GT0C 4R8PB 4X23C 5CPJD 1P3KD 4EO5B 4KHAB 4H9OB 1P3LD 5B33D 3LZ0D 3AZMA 5GT3A 2Y2NA 4XZQB 1F66A 4ZUXA 3RELA 1P3BB 4HGAB 1KX3B 3AV1C 1M18C 4WNNB 1ID3A 4J8VC 3NQJB 3UTAA 5B32G 4J8UA 1WWSA 5AVBB 3AZEC 3WA9A 4CAYB 1BH8B 3REID 5E5AB 5B2IB 5JA4A 5B0YC 3AZNA 1B67A 2Y2PA 3X1TB 4G92B 4J8XC 2F8NG 5B0ZA 2NQBD 2W8SA 3AZMC 5GT3C 5AV9B 4NE3A 1F66C 3RELC 5FUGB 1M19B 3W96B 5B2JC 2BYKA 2XD1A 3UT9A 4LD9D 3KXBC 3AZKA 3C1CB 3KUYD 1P3KA 5B40D 2DQNC 1TAFA 3LZ0A 4J8UC 3NQUA 1U35D 3WA9C 5CPJB 4WU8A 3REJB 1P3LB 5B33B 3NQUB 4NE5A 4E44A 3AZNC 3A6ND 4H9NA 5B32D 2FFFB 3VH6T 4DRBA 1KX5C 5B0ZC 5DNND 3REIA 5KDMA 3AZFD 5B1MB 3AV2C 1S32C 5GXQD 5CP6A 4CSRA 5BO0B 5JRGD 3UT9C 2F8ND 3AZKC 2Y2OA 1M1AD 2AROB 1AOID 1P3KC 3TU4D 4YM6A 2Y2HA 4WU9D 3AN2B 1KX4D 3R45B 5GSUC 3C1BB 4WU8C 3B0CW 5AV5D 2NQBB 1ZLAB 3MGRA 2PYOB 1P3MA 1P3ID 5B40A 4LD9B 3KUYB 3FDDA 5GT0D 5BT1C 4X23D 3MNNA 4H9RA 5AV6C 3O62B 2HIOA 3X1UA 4WV4B 5CP6C 1U35B 4J8WB 1P3AA 3LJAA 3W97C 3AV1D 1M18D 3A6NB 2FJ7C 5BS7A 2XD5A 5B32B 5AV8B 4YM6C 4J8VD 1EQZA 2G5IC 3MGRC 3AZED 5DNNB 5B24C 2JSSA 2BG1A 3AZFB 1P3MC 3AZGA 5GXQB 2CWEA 5JRGB 1P3OC 5B0YD 2F8NB 1M1AB 2YFVB 3LZ1C 3MNNC 3REHA 1KX4A 1AOIB 1N1JB 4J8XD 3KFUG 2HIOC 3TU4B 3X1UC 4WU9B 3X1SC 3AZMD 2F8NH 5GT3D 1P3AC 5AV5B 3LJAC 3AZLB 1F66D 3RELD 4KGCB 5B2JD 3AZIA 4YS3C 5G49A 4ZBJC 3KXBD 4X23A 1P3IB 1EQZC 3AZHC 2L5AA 1P34A 3AYWA 5GT0B 4J8UD 3WA9D 5BNXA 4H9PA 4Z5TC 4Z66C 3AZGC 2F2AC 3AV1A 1M18A 3AZND 3REHC 3AV1B 3W98C 3KWQB 3B0DC 5F99B 2Y2MA 1KX5D 3WAAD 5B0ZD 4E45A 4J8VB 3MGQB 1S32D 3AV2D 3AZEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI C;  5B0Y A;  3UT9 D;  3AFA A;  3AZK D;  5AY8 B;  4J8X A;  1P34 C;  4DRA A;  3X1V A;  3AYW C;  2F8N K;  5B1L A;  5GSU D;  4WU8 D;  2CV5 A;  5B2J A;  3AZM B;  5GT3 B;  3B6F C;  3KXB A;  4ZUX B;  5CPI C;  3REL B;  3AZJ A;  1F66 B;  1P3F A;  1ID3 B;  4UUZ A;  5BT1 D;  1JFI A;  5AV6 D;  3UTA B;  4J8U B;  5CP6 D;  3WA9 B;  2IO5 C;  3AFA C;  3W97 D;  5B31 C;  3WAA A;  5JA4 B;  1KX5 A;  3AZN B;  2FJ7 D;  3X1V C;  4YM6 D;  4KUD C;  5B1L C;  3MVD C;  2CV5 C;  5B0Z B;  1S32 A;  3AV2 A;  3MGR D;  3REK C;  4JJN A;  5B24 D;  3MGS A;  3AZJ C;  4M6B A;  1P3M D;  1P3F C;  2NZD A;  2BYK B;  1P3O D;  3UT9 B;  3AZK B;  3LZ1 D;  3MNN D;  5GSU A;  1P3K B;  1HQ3 A;  2HIO D;  3X1U D;  1TAF B;  3LZ0 B;  3WKJ A;  3X1S D;  4WU8 B;  1P3A D;  3LJA D;  5BNV A;  1H3O A;  4YS3 D;  3WAA C;  1TZY A;  3B6G A;  4H9N B;  1EQZ D;  3AZH D;  5AV6 A;  3VH5 T;  4AWL C;  4H9S A;  5AVB C;  4JJN C;  3REI B;  3W97 A;  4Z66 D;  4Z5T D;  5KDM B;  3MGS C;  3AZG D;  5CP6 B;  4CSR B;  2NZD C;  2FJ7 A;  3VH6 A;  3REH D;  1P3P A;  1HQ3 C;  3W98 D;  1BH9 A;  1Q9C A;  1P3G A;  3X1T C;  4YM6 B;  5B31 G;  3VH5 A;  4G92 C;  3WKJ C;  5B24 A;  3V9R A;  5AV9 C;  3MGR B;  3AZI D;  5CPK A;  1P3O A;  1M19 C;  1TZY C;  1P3M B;  3B6G C;  3LZ1 A;  5B40 B;  1P34 D;  3AYW D;  3X1S A;  4H9S C;  4H9R B;  3MNN B;  3W99 A;  2HIO B;  4XUJ A;  3X1U B;  1BFM A;  4YS3 A;  2RVQ C;  3REJ C;  1P3A B;  3LJA B;  3B6F D;  5CPI D;  2YFW A;  3AZH A;  1P3P C;  1P3G C;  1EQZ B;  4Z5T A;  4Z66 A;  5B1M C;  5CPK C;  3B0B A;  3AFA D;  3AZG B;  5B31 D;  3W98 A;  2ARO C;  3UTB A;  3X1V D;  4KUD D;  1KX4 B;  3REH B;  4G91 C;  3W99 C;  5B1L D;  3MGP A;  3MVD D;  3B0D B;  2CV5 D;  3AN2 C;  5CHL B;  4QLC A;  4XUJ C;  3C1B C;  1F1E A;  1ZLA C;  3REK D;  2BYM A;  4H9Q A;  5AVC C;  3AZJ D;  3AZI B;  1P3F D;  2PYO C;  5G49 B;  4X23 B;  1P34 B;  2HUE C;  3O62 C;  3AYW B;  5BNX B;  4H9P B;  3B6F A;  4J8W C;  5CPI A;  3B6F B;  5DNM A;  1M18 B;  3UTB C;  3MGP C;  5AV8 C;  4QLC C;  3B0C T;  5AVB D;  4JJN D;  3MGS D;  5B31 A;  2NZD D;  2IO5 B;  5B0Y B;  3AFA B;  3LEL C;  4KUD A;  5B31 B;  3VH6 W;  3MVD A;  4J8X B;  1HQ3 D;  3X1V B;  3X1T D;  4KUD B;  3KSY A;  3WKJ D;  5B1L B;  3WTP A;  3REK A;  5C3I C;  2CV5 B;  5AV9 D;  5B2J B;  3AZL C;  4KGC C;  1M19 D;  5DNM C;  3KXB B;  1TZY D;  3AZJ B;  3B6G D;  1P3F B;  4R8P A;  4UUZ B;  1JFI B;  4H9O A;  4XZQ A;  2RVQ D;  3REJ D;  1P3B A;  1KX3 A;  4WNN A;  3WAA B;  1P3P D;  1KX5 B;  3NQJ A;  1P3G D;  3KWQ C;  5F99 C;  3WTP C;  5AVB A;  3MGQ C;  4AWL B;  1S32 B;  4CAY A;  3AV2 B;  1BH8 A;  1KU5 A;  5B1M D;  5CPK D;  5E5A A;  4JJN B;  5B2I A;  3MGS B;  2NZD B;  4R8P C;  2ARO D;  5AY8 C;  4Z2M G;  3X1T A;  4EO5 C;  3W99 D;  5GSU B;  1HQ3 B;  3AN2 D;  5AV9 A;  4XUJ D;  3C1B D;  4XZQ C;  3WKJ B;  3W96 A;  5FUG A;  1M19 A;  1P3B C;  4HGA C;  1ZLA D;  1KX3 C;  5BNV B;  5AVC D;  1H3O B;  2PYO D;  4ZUX C;  3C1C A;  1TZY B;  3B6G B;  5AV6 B;  1ID3 C;  4NFT A;  5CPJ A;  3O62 D;  3UTA C;  3REJ A;  1P3L A;  5E5A C;  5B33 A;  5B2I C;  3W97 B;  4J8W D;  1WWI A;  2FJ7 B;  3UTB D;  3MGP D;  1P3P B;  5AV8 D;  1BH9 B;  1P3G B;  4QLC D;  3W96 C;  5B1M A;  5B24 B;  1ULY A;  5BO0 A;  3V9R B;  3C1C C;  2ARO A;  5CPK B;  1P3O B;  3LEL D;  4WZS B;  3LZ1 B;  3AN2 A;  5CPJ C;  3R45 A;  3C1B A;  3X1S B;  4G91 B;  2NQB A;  1P3L C;  3W99 B;  1ZLA A;  5B33 C;  3LZ0 C;  4XUJ B;  5AVC A;  2PYO A;  3AZL D;  4YS3 B;  1B6W A;  4KGC D;  5DNM D;  4ZBJ B;  5AVC B;  2YFW B;  3AZH B;  4LD9 A;  3KUY A;  3O62 A;  1R4V A;  1U35 A;  4Z5T B;  4Z66 B;  4J8W A;  2HUE B;  3REI C;  1A7W A;  3A6N A;  3W98 B;  5B32 A;  5AV8 A;  3UTB B;  3KWQ D;  5F99 D;  2NQB C;  3MGP B;  3WTP D;  4QLC B;  3MGQ D;  5DNN A;  3AZF A;  5GXQ A;  3LEL A;  2BYM B;  4H9Q B;  5JRG A;  4NE6 A;  4LD9 C;  2F8N A;  1M1A A;  3KUY C;  4R8P D;  2YFV A;  5AY8 D;  1AOI A;  3LEL B;  1N1J A;  5B40 C;  4Z2M H;  3TU4 A;  4WU9 A;  1U35 C;  5AV5 A;  4XZQ D;  3AZL A;  4KGC A;  1P3B D;  5C3I B;  1KX3 D;  5CPI B;  3A6N C;  4ZUX D;  5B32 C;  1P3I A;  5DNM B;  1HTA A;  5BS7 C;  1ID3 D;  5GT0 A;  2LY8 A;  5DNN C;  3UTA D;  3AZF C;  5GXQ C;  5E5A D;  5B2I D;  5JRG C;  1M1A C;  1AOI C;  3KWQ A;  5F99 A;  3TU4 C;  4WU9 C;  3MVD B;  3VH5 W;  3WTP E;  4J8V A;  1KX4 C;  3MGQ A;  5AV5 C;  3W96 D;  3WTP B;  3AZE A;  3REK B;  3C1C D;  1P3I C;  5AY8 A;  4KHA A;  5GT0 C;  4R8P B;  4X23 C;  5CPJ D;  1P3K D;  4EO5 B;  4KHA B;  4H9O B;  1P3L D;  5B33 D;  3LZ0 D;  3AZM A;  5GT3 A;  4XZQ B;  1F66 A;  4ZUX A;  3REL A;  1P3B B;  4HGA B;  1KX3 B;  3AV1 C;  1M18 C;  4WNN B;  1ID3 A;  4J8V C;  3NQJ B;  3UTA A;  5B32 G;  4J8U A;  1WWS A;  5AVB B;  3AZE C;  3WA9 A;  4CAY B;  1BH8 B;  3REI D;  5E5A B;  5B2I B;  5JA4 A;  5B0Y C;  3AZN A;  1B67 A;  3X1T B;  4G92 B;  4J8X C;  2F8N G;  5B0Z A;  2NQB D;  3AZM C;  5GT3 C;  5AV9 B;  4NE3 A;  1F66 C;  3REL C;  5FUG B;  1M19 B;  3W96 B;  5B2J C;  2BYK A;  3UT9 A;  4LD9 D;  3KXB C;  3AZK A;  3C1C B;  3KUY D;  1P3K A;  5B40 D;  4J8U C;  1TAF A;  3LZ0 A;  1U35 D;  3NQU A;  3WA9 C;  5CPJ B;  4WU8 A;  3REJ B;  1P3L B;  5B33 B;  3NQU B;  4NE5 A;  4E44 A;  3AZN C;  3A6N D;  4H9N A;  5B32 D;  3VH6 T;  4DRB A;  1KX5 C;  5B0Z C;  5DNN D;  3REI A;  5KDM A;  3AZF D;  5B1M B;  3AV2 C;  1S32 C;  5GXQ D;  5CP6 A;  4CSR A;  5BO0 B;  5JRG D;  3UT9 C;  2F8N D;  3AZK C;  1M1A D;  2ARO B;  1AOI D;  1P3K C;  3TU4 D;  4YM6 A;  4WU9 D;  3AN2 B;  1KX4 D;  3R45 B;  5GSU C;  3C1B B;  4WU8 C;  3B0C W;  5AV5 D;  2NQB B;  1ZLA B;  3MGR A;  2PYO B;  1P3M A;  1P3I D;  5B40 A;  4LD9 B;  3KUY B;  5GT0 D;  4X23 D;  5BT1 C;  3MNN A;  4H9R A;  5AV6 C;  3O62 B;  2HIO A;  3X1U A;  4WV4 B;  5CP6 C;  1U35 B;  4J8W B;  1P3A A;  3LJA A;  3W97 C;  3AV1 D;  1M18 D;  3A6N B;  2FJ7 C;  5BS7 A;  4YM6 C;  5B32 B;  5AV8 B;  1EQZ A;  4J8V D;  3MGR C;  3AZE D;  5DNN B;  5B24 C;  2JSS A;  3AZF B;  1P3M C;  3AZG A;  5GXQ B;  2CWE A;  5JRG B;  1P3O C;  5B0Y D;  2F8N B;  1M1A B;  2YFV B;  3LZ1 C;  3MNN C;  3REH A;  1KX4 A;  1AOI B;  1N1J B;  4J8X D;  2HIO C;  3TU4 B;  3X1U C;  4WU9 B;  3X1S C;  3AZM D;  2F8N H;  5GT3 D;  1P3A C;  5AV5 B;  3LJA C;  3AZL B;  1F66 D;  3REL D;  4KGC B;  5B2J D;  3AZI A;  4YS3 C;  5G49 A;  4ZBJ C;  3KXB D;  4X23 A;  1P3I B;  1EQZ C;  3AZH C;  2L5A A;  1P34 A;  3AYW A;  5GT0 B;  4J8U D;  3WA9 D;  5BNX A;  4H9P A;  4Z5T C;  4Z66 C;  3AZG C;  3AV1 A;  1M18 A;  3AZN D;  3REH C;  3AV1 B;  3W98 C;  3KWQ B;  3B0D C;  5F99 B;  3WAA D;  1KX5 D;  5B0Z D;  4E45 A;  4J8V B;  3MGQ B;  1S32 D;  3AV2 D;  3AZE B; 
#chains in the Genus database with same CATH topology
 3AZI C;  5B0Y A;  3UT9 D;  3AFA A;  3AZK D;  2G5H C;  5AY8 B;  4J8X A;  1P34 C;  4DRA A;  3X1V A;  3AYW C;  2F8N K;  5B1L A;  5GSU D;  4WU8 D;  2CV5 A;  5B2J A;  3IP4 C;  3AZM B;  5GT3 B;  2ZY3 A;  3B6F C;  3KXB A;  4ZUX B;  5CPI C;  3REL B;  3AZJ A;  1F66 B;  1P3F A;  1ID3 B;  4UUZ A;  5BT1 D;  1JFI A;  5AV6 D;  3A1K A;  3UTA B;  4J8U B;  5CP6 D;  1W2E A;  3WA9 B;  2IO5 C;  3AFA C;  3W97 D;  5B31 C;  4DQY B;  3WAA A;  5JA4 B;  1KX5 A;  3AZN B;  2FJ7 D;  3X1V C;  4YM6 D;  4KUD C;  5B1L C;  3MVD C;  2CV5 C;  5B0Z B;  1S32 A;  3AV2 A;  3MGR D;  3REK C;  4JJN A;  5B24 D;  3MGS A;  3AZJ C;  4M6B A;  1P3M D;  1P3F C;  2NZD A;  2BYK B;  1P3O D;  3UT9 B;  3AZK B;  3LZ1 D;  3MNN D;  2VQR A;  5GSU A;  1P3K B;  1HQ3 A;  2HIO D;  3X1U D;  2ZY5 A;  1TAF B;  3LZ0 B;  3WKJ A;  3X1S D;  4WU8 B;  1P3A D;  3LJA D;  5BNV A;  1H3O A;  4YS3 D;  3WAA C;  1TZY A;  3B6G A;  4H9N B;  1EQZ D;  3AZH D;  5AV6 A;  2Y2Q A;  3VH5 T;  4AWL C;  4H9S A;  5AVB C;  4JJN C;  3REI B;  3W97 A;  5KDM B;  4Z5T D;  4Z66 D;  3MGS C;  3AZG D;  5CP6 B;  4CSR B;  2NZD C;  2FJ7 A;  3VH6 A;  3REH D;  1P3P A;  1HQ3 C;  3W98 D;  1BH9 A;  1Q9C A;  1P3G A;  3X1T C;  4YM6 B;  5B31 G;  3VH5 A;  4G92 C;  3WKJ C;  5B24 A;  3V9R A;  5AV9 C;  3MGR B;  3AZI D;  5CPK A;  1P3O A;  1M19 C;  2Y2I A;  1TZY C;  1P3M B;  3B6G C;  3LZ1 A;  5B40 B;  1P34 D;  3AYW D;  3X1S A;  4H9S C;  4H9R B;  3MNN B;  3W99 A;  2HIO B;  4XUJ A;  3X1U B;  1BFM A;  4YS3 A;  2Y2G A;  2RVQ C;  3REJ C;  1P3A B;  3LJA B;  3B6F D;  5CPI D;  2YFW A;  3AZH A;  1P3P C;  1P3G C;  1EQZ B;  4Z5T A;  4Z66 A;  5B1M C;  5CPK C;  2JE5 A;  3B0B A;  3AFA D;  3AZG B;  5B31 D;  3W98 A;  2ARO C;  2J8P A;  3UTB A;  3X1V D;  4KUD D;  1KX4 B;  3REH B;  4G91 C;  3W99 C;  5B1L D;  3MGP A;  3MVD D;  3B0D B;  3H0L C;  2CV5 D;  3AN2 C;  5CHL B;  4QLC A;  4XUJ C;  3C1B C;  1F1E A;  1ZLA C;  3REK D;  2BYM A;  4H9Q A;  5AVC C;  3AZJ D;  3AZI B;  1P3F D;  2PYO C;  5G49 B;  3H0M C;  4X23 B;  1P34 B;  2HUE C;  3O62 C;  3AYW B;  5BNX B;  4H9P B;  3B6F A;  3F6T A;  4J8W C;  5CPI A;  3B6F B;  5DNM A;  1M18 B;  3UTB C;  3A1I A;  3MGP C;  3AL0 C;  5AV8 C;  4QLC C;  3B0C T;  5AVB D;  4JJN D;  3MGS D;  5B31 A;  3EPL A;  1PZR A;  2NZD D;  2IO5 B;  5B0Y B;  3AFA B;  3LEL C;  4KUD A;  5B31 B;  3VH6 W;  3MVD A;  4J8X B;  1HQ3 D;  3X1V B;  3X1T D;  4KUD B;  3KSY A;  3WKJ D;  5B1L B;  2RIQ A;  3WTP A;  3REK A;  5C3I C;  2CV5 B;  5AV9 D;  5B2J B;  3AZL C;  4KGC C;  1M19 D;  5DNM C;  3KXB B;  3EPH A;  1TZY D;  3AZJ B;  3B6G D;  1P3F B;  4R8P A;  4UUZ B;  1JFI B;  4H9O A;  4UPK A;  4XZQ A;  2RVQ D;  3REJ D;  1P3B A;  1KX3 A;  2UWX A;  4WNN A;  3WAA B;  1P3P D;  1KX5 B;  3NQJ A;  1P3G D;  3KWQ C;  5F99 C;  3WTP C;  5AVB A;  3MGQ C;  4AWL B;  1S32 B;  4CAY A;  3AV2 B;  1BH8 A;  3EG5 B;  1KU5 A;  5B1M D;  5CPK D;  5E5A A;  4JJN B;  5B2I A;  3MGS B;  2NZD B;  4R8P C;  2ARO D;  5AY8 C;  4Z2M G;  3X1T A;  2Y2K A;  4EO5 C;  3W99 D;  5GSU B;  1HQ3 B;  3AN2 D;  5AV9 A;  4XUJ D;  3C1B D;  4XZQ C;  3WKJ B;  3W96 A;  5FUG A;  1M19 A;  1P3B C;  4HGA C;  1ZLA D;  1KX3 C;  5BNV B;  5AVC D;  1H3O B;  2PYO D;  4ZUX C;  3C1C A;  1TZY B;  3H0R C;  3B6G B;  5AV6 B;  1ID3 C;  4NFT A;  5CPJ A;  3O62 D;  2ZY2 A;  3UTA C;  3REJ A;  1P3L A;  5E5A C;  5B33 A;  5B2I C;  3W97 B;  4J8W D;  3P5J B;  1WWI A;  2Y2J A;  2FJ7 B;  2ZM5 A;  3UTB D;  3MGP D;  1P3P B;  5AV8 D;  1BH9 B;  1P3G B;  4QLC D;  3W96 C;  5B1M A;  1Z2C B;  1ULY A;  5BO0 A;  5B24 B;  3V9R B;  3EPK A;  3C1C C;  2ARO A;  5CPK B;  1P3O B;  3LEL D;  2Y2L A;  4WZS B;  3LZ1 B;  3AN2 A;  5CPJ C;  3R45 A;  3C1B A;  3X1S B;  4G91 B;  2NQB A;  1P3L C;  3W99 B;  1ZLA A;  5B33 C;  3LZ0 C;  4XUJ B;  5AVC A;  2PYO A;  3AZL D;  4YS3 B;  1B6W A;  4KGC D;  5DNM D;  4ZBJ B;  5AVC B;  2YFW B;  3AZH B;  4LD9 A;  3KUY A;  3O62 A;  1R4V A;  1U35 A;  4Z5T B;  4Z66 B;  4J8W A;  2HUE B;  3REI C;  3EPJ A;  4WJ3 C;  1A7W A;  3A6N A;  3W98 B;  5B32 A;  5AV8 A;  3UTB B;  3KWQ D;  5F99 D;  2NQB C;  3MGP B;  3WTP D;  4QLC B;  3MGQ D;  5DNN A;  3AZF A;  5GXQ A;  3LEL A;  2BYM B;  4H9Q B;  5JRG A;  4NE6 A;  4LD9 C;  2F8N A;  1M1A A;  3KUY C;  4R8P D;  2YFV A;  5AY8 D;  1AOI A;  3LEL B;  1N1J A;  5B40 C;  4Z2M H;  3TU4 A;  4WU9 A;  1U35 C;  5AV5 A;  4XZQ D;  3AZL A;  4KGC A;  1P3B D;  5C3I B;  1KX3 D;  5CPI B;  3A6N C;  4ZUX D;  5B32 C;  1P3I A;  5DNM B;  1HTA A;  5BS7 C;  1ID3 D;  5GT0 A;  2LY8 A;  5DNN C;  3UTA D;  3AZF C;  5GXQ C;  5E5A D;  2JCH A;  1T3U A;  5B2I D;  2DF4 C;  5JRG C;  1M1A C;  1AOI C;  3KWQ A;  5F99 A;  3TU4 C;  4WU9 C;  3MVD B;  3VH5 W;  3WTP E;  4J8V A;  1KX4 C;  3MGQ A;  5AV5 C;  3W96 D;  3WTP B;  3AZE A;  3REK B;  2ZY4 A;  3C1C D;  1P3I C;  5AY8 A;  4KHA A;  5GT0 C;  4R8P B;  4X23 C;  5CPJ D;  1P3K D;  4EO5 B;  4KHA B;  4H9O B;  1P3L D;  5B33 D;  3LZ0 D;  3AZM A;  5GT3 A;  2Y2N A;  4XZQ B;  1F66 A;  4ZUX A;  3REL A;  1P3B B;  4HGA B;  1KX3 B;  3AV1 C;  1M18 C;  4WNN B;  1ID3 A;  4J8V C;  3NQJ B;  3UTA A;  5B32 G;  4J8U A;  1WWS A;  5AVB B;  3AZE C;  3WA9 A;  4CAY B;  1BH8 B;  3REI D;  5E5A B;  5B2I B;  5JA4 A;  5B0Y C;  3AZN A;  1B67 A;  2Y2P A;  3X1T B;  4G92 B;  4J8X C;  2F8N G;  5B0Z A;  2NQB D;  2W8S A;  3AZM C;  5GT3 C;  5AV9 B;  4NE3 A;  1F66 C;  3REL C;  5FUG B;  1M19 B;  3W96 B;  5B2J C;  2BYK A;  2XD1 A;  3UT9 A;  4LD9 D;  3KXB C;  3AZK A;  3C1C B;  3KUY D;  1P3K A;  5B40 D;  2DQN C;  1TAF A;  3LZ0 A;  4J8U C;  3NQU A;  1U35 D;  3WA9 C;  5CPJ B;  4WU8 A;  3REJ B;  1P3L B;  5B33 B;  3NQU B;  4NE5 A;  4E44 A;  3AZN C;  3A6N D;  4H9N A;  5B32 D;  2FFF B;  3VH6 T;  4DRB A;  1KX5 C;  5B0Z C;  5DNN D;  3REI A;  5KDM A;  3AZF D;  5B1M B;  3AV2 C;  1S32 C;  5GXQ D;  5CP6 A;  4CSR A;  5BO0 B;  5JRG D;  3UT9 C;  2F8N D;  3AZK C;  2Y2O A;  1M1A D;  2ARO B;  1AOI D;  1P3K C;  3TU4 D;  4YM6 A;  2Y2H A;  4WU9 D;  3AN2 B;  1KX4 D;  3R45 B;  5GSU C;  3C1B B;  4WU8 C;  3B0C W;  5AV5 D;  2NQB B;  1ZLA B;  3MGR A;  2PYO B;  1P3M A;  1P3I D;  5B40 A;  4LD9 B;  3KUY B;  3FDD A;  5GT0 D;  5BT1 C;  4X23 D;  3MNN A;  4H9R A;  5AV6 C;  3O62 B;  2HIO A;  3X1U A;  4WV4 B;  5CP6 C;  1U35 B;  4J8W B;  1P3A A;  3LJA A;  3W97 C;  3AV1 D;  1M18 D;  3A6N B;  2FJ7 C;  5BS7 A;  2XD5 A;  5B32 B;  5AV8 B;  4YM6 C;  4J8V D;  1EQZ A;  2G5I C;  3MGR C;  3AZE D;  5DNN B;  5B24 C;  2JSS A;  2BG1 A;  3AZF B;  1P3M C;  3AZG A;  5GXQ B;  2CWE A;  5JRG B;  1P3O C;  5B0Y D;  2F8N B;  1M1A B;  2YFV B;  3LZ1 C;  3MNN C;  3REH A;  1KX4 A;  1AOI B;  1N1J B;  4J8X D;  3KFU G;  2HIO C;  3TU4 B;  3X1U C;  4WU9 B;  3X1S C;  3AZM D;  2F8N H;  5GT3 D;  1P3A C;  5AV5 B;  3LJA C;  3AZL B;  1F66 D;  3REL D;  4KGC B;  5B2J D;  3AZI A;  4YS3 C;  5G49 A;  4ZBJ C;  3KXB D;  4X23 A;  1P3I B;  1EQZ C;  3AZH C;  2L5A A;  1P34 A;  3AYW A;  5GT0 B;  4J8U D;  3WA9 D;  5BNX A;  4H9P A;  4Z5T C;  4Z66 C;  3AZG C;  2F2A C;  3AV1 A;  1M18 A;  3AZN D;  3REH C;  3AV1 B;  3W98 C;  3KWQ B;  3B0D C;  5F99 B;  2Y2M A;  1KX5 D;  3WAA D;  5B0Z D;  4E45 A;  4J8V B;  3MGQ B;  1S32 D;  3AV2 D;  3AZE B; 
#chains in the Genus database with same CATH homology
 3AZI C;  5B0Y A;  3UT9 D;  3AFA A;  3AZK D;  2G5H C;  5AY8 B;  4J8X A;  1P34 C;  4DRA A;  3X1V A;  3AYW C;  2F8N K;  5B1L A;  5GSU D;  4WU8 D;  2CV5 A;  5B2J A;  3IP4 C;  3AZM B;  5GT3 B;  2ZY3 A;  3B6F C;  3KXB A;  4ZUX B;  5CPI C;  3REL B;  3AZJ A;  1F66 B;  1P3F A;  1ID3 B;  4UUZ A;  5BT1 D;  1JFI A;  5AV6 D;  3A1K A;  3UTA B;  4J8U B;  5CP6 D;  1W2E A;  3WA9 B;  2IO5 C;  3AFA C;  3W97 D;  5B31 C;  4DQY B;  3WAA A;  5JA4 B;  1KX5 A;  3AZN B;  2FJ7 D;  3X1V C;  4YM6 D;  4KUD C;  5B1L C;  3MVD C;  2CV5 C;  5B0Z B;  1S32 A;  3AV2 A;  3MGR D;  3REK C;  4JJN A;  5B24 D;  3MGS A;  3AZJ C;  4M6B A;  1P3M D;  1P3F C;  2NZD A;  2BYK B;  1P3O D;  3UT9 B;  3AZK B;  3LZ1 D;  3MNN D;  2VQR A;  5GSU A;  1P3K B;  1HQ3 A;  2HIO D;  3X1U D;  2ZY5 A;  1TAF B;  3LZ0 B;  3WKJ A;  3X1S D;  4WU8 B;  1P3A D;  3LJA D;  5BNV A;  1H3O A;  4YS3 D;  3WAA C;  1TZY A;  3B6G A;  4H9N B;  1EQZ D;  3AZH D;  5AV6 A;  2Y2Q A;  3VH5 T;  4AWL C;  4H9S A;  5AVB C;  4JJN C;  3REI B;  3W97 A;  5KDM B;  4Z5T D;  4Z66 D;  3MGS C;  3AZG D;  5CP6 B;  4CSR B;  2NZD C;  2FJ7 A;  3VH6 A;  3REH D;  1P3P A;  1HQ3 C;  3W98 D;  1BH9 A;  1Q9C A;  1P3G A;  3X1T C;  4YM6 B;  5B31 G;  3VH5 A;  4G92 C;  3WKJ C;  5B24 A;  3V9R A;  5AV9 C;  3MGR B;  3AZI D;  5CPK A;  1P3O A;  1M19 C;  2Y2I A;  1TZY C;  1P3M B;  3B6G C;  3LZ1 A;  5B40 B;  1P34 D;  3AYW D;  3X1S A;  4H9S C;  4H9R B;  3MNN B;  3W99 A;  2HIO B;  4XUJ A;  3X1U B;  1BFM A;  4YS3 A;  2Y2G A;  2RVQ C;  3REJ C;  1P3A B;  3LJA B;  3B6F D;  5CPI D;  2YFW A;  3AZH A;  1P3P C;  1P3G C;  1EQZ B;  4Z5T A;  4Z66 A;  5B1M C;  5CPK C;  2JE5 A;  3B0B A;  3AFA D;  3AZG B;  5B31 D;  3W98 A;  2ARO C;  2J8P A;  3UTB A;  3X1V D;  4KUD D;  1KX4 B;  3REH B;  4G91 C;  3W99 C;  5B1L D;  3MGP A;  3MVD D;  3B0D B;  3H0L C;  2CV5 D;  3AN2 C;  5CHL B;  4QLC A;  4XUJ C;  3C1B C;  1F1E A;  1ZLA C;  3REK D;  2BYM A;  4H9Q A;  5AVC C;  3AZJ D;  3AZI B;  1P3F D;  2PYO C;  5G49 B;  3H0M C;  4X23 B;  1P34 B;  2HUE C;  3O62 C;  3AYW B;  5BNX B;  4H9P B;  3B6F A;  3F6T A;  4J8W C;  5CPI A;  3B6F B;  5DNM A;  1M18 B;  3UTB C;  3A1I A;  3MGP C;  3AL0 C;  5AV8 C;  4QLC C;  3B0C T;  5AVB D;  4JJN D;  3MGS D;  5B31 A;  3EPL A;  1PZR A;  2NZD D;  2IO5 B;  5B0Y B;  3AFA B;  3LEL C;  4KUD A;  5B31 B;  3VH6 W;  3MVD A;  4J8X B;  1HQ3 D;  3X1V B;  3X1T D;  4KUD B;  3KSY A;  3WKJ D;  5B1L B;  2RIQ A;  3WTP A;  3REK A;  5C3I C;  2CV5 B;  5AV9 D;  5B2J B;  3AZL C;  4KGC C;  1M19 D;  5DNM C;  3KXB B;  3EPH A;  1TZY D;  3AZJ B;  3B6G D;  1P3F B;  4R8P A;  4UUZ B;  1JFI B;  4H9O A;  4UPK A;  4XZQ A;  2RVQ D;  3REJ D;  1P3B A;  1KX3 A;  2UWX A;  4WNN A;  3WAA B;  1P3P D;  1KX5 B;  3NQJ A;  1P3G D;  3KWQ C;  5F99 C;  3WTP C;  5AVB A;  3MGQ C;  4AWL B;  1S32 B;  4CAY A;  3AV2 B;  1BH8 A;  3EG5 B;  1KU5 A;  5B1M D;  5CPK D;  5E5A A;  4JJN B;  5B2I A;  3MGS B;  2NZD B;  4R8P C;  2ARO D;  5AY8 C;  4Z2M G;  3X1T A;  2Y2K A;  4EO5 C;  3W99 D;  5GSU B;  1HQ3 B;  3AN2 D;  5AV9 A;  4XUJ D;  3C1B D;  4XZQ C;  3WKJ B;  3W96 A;  5FUG A;  1M19 A;  1P3B C;  4HGA C;  1ZLA D;  1KX3 C;  5BNV B;  5AVC D;  1H3O B;  2PYO D;  4ZUX C;  3C1C A;  1TZY B;  3H0R C;  3B6G B;  5AV6 B;  1ID3 C;  4NFT A;  5CPJ A;  3O62 D;  2ZY2 A;  3UTA C;  3REJ A;  1P3L A;  5E5A C;  5B33 A;  5B2I C;  3W97 B;  4J8W D;  3P5J B;  1WWI A;  2Y2J A;  2FJ7 B;  2ZM5 A;  3UTB D;  3MGP D;  1P3P B;  5AV8 D;  1BH9 B;  1P3G B;  4QLC D;  3W96 C;  5B1M A;  1Z2C B;  1ULY A;  5BO0 A;  5B24 B;  3V9R B;  3EPK A;  3C1C C;  2ARO A;  5CPK B;  1P3O B;  3LEL D;  2Y2L A;  4WZS B;  3LZ1 B;  3AN2 A;  5CPJ C;  3R45 A;  3C1B A;  3X1S B;  4G91 B;  2NQB A;  1P3L C;  3W99 B;  1ZLA A;  5B33 C;  3LZ0 C;  4XUJ B;  5AVC A;  2PYO A;  3AZL D;  4YS3 B;  1B6W A;  4KGC D;  5DNM D;  4ZBJ B;  5AVC B;  2YFW B;  3AZH B;  4LD9 A;  3KUY A;  3O62 A;  1R4V A;  1U35 A;  4Z5T B;  4Z66 B;  4J8W A;  2HUE B;  3REI C;  3EPJ A;  4WJ3 C;  1A7W A;  3A6N A;  3W98 B;  5B32 A;  5AV8 A;  3UTB B;  3KWQ D;  5F99 D;  2NQB C;  3MGP B;  3WTP D;  4QLC B;  3MGQ D;  5DNN A;  3AZF A;  5GXQ A;  3LEL A;  2BYM B;  4H9Q B;  5JRG A;  4NE6 A;  4LD9 C;  2F8N A;  1M1A A;  3KUY C;  4R8P D;  2YFV A;  5AY8 D;  1AOI A;  3LEL B;  1N1J A;  5B40 C;  4Z2M H;  3TU4 A;  4WU9 A;  1U35 C;  5AV5 A;  4XZQ D;  3AZL A;  4KGC A;  1P3B D;  5C3I B;  1KX3 D;  5CPI B;  3A6N C;  4ZUX D;  5B32 C;  1P3I A;  5DNM B;  1HTA A;  5BS7 C;  1ID3 D;  5GT0 A;  2LY8 A;  5DNN C;  3UTA D;  3AZF C;  5GXQ C;  5E5A D;  2JCH A;  1T3U A;  5B2I D;  2DF4 C;  5JRG C;  1M1A C;  1AOI C;  3KWQ A;  5F99 A;  3TU4 C;  4WU9 C;  3MVD B;  3VH5 W;  3WTP E;  4J8V A;  1KX4 C;  3MGQ A;  5AV5 C;  3W96 D;  3WTP B;  3AZE A;  3REK B;  2ZY4 A;  3C1C D;  1P3I C;  5AY8 A;  4KHA A;  5GT0 C;  4R8P B;  4X23 C;  5CPJ D;  1P3K D;  4EO5 B;  4KHA B;  4H9O B;  1P3L D;  5B33 D;  3LZ0 D;  3AZM A;  5GT3 A;  2Y2N A;  4XZQ B;  1F66 A;  4ZUX A;  3REL A;  1P3B B;  4HGA B;  1KX3 B;  3AV1 C;  1M18 C;  4WNN B;  1ID3 A;  4J8V C;  3NQJ B;  3UTA A;  5B32 G;  4J8U A;  1WWS A;  5AVB B;  3AZE C;  3WA9 A;  4CAY B;  1BH8 B;  3REI D;  5E5A B;  5B2I B;  5JA4 A;  5B0Y C;  3AZN A;  1B67 A;  2Y2P A;  3X1T B;  4G92 B;  4J8X C;  2F8N G;  5B0Z A;  2NQB D;  2W8S A;  3AZM C;  5GT3 C;  5AV9 B;  4NE3 A;  1F66 C;  3REL C;  5FUG B;  1M19 B;  3W96 B;  5B2J C;  2BYK A;  2XD1 A;  3UT9 A;  4LD9 D;  3KXB C;  3AZK A;  3C1C B;  3KUY D;  1P3K A;  5B40 D;  2DQN C;  1TAF A;  3LZ0 A;  4J8U C;  3NQU A;  1U35 D;  3WA9 C;  5CPJ B;  4WU8 A;  3REJ B;  1P3L B;  5B33 B;  3NQU B;  4NE5 A;  4E44 A;  3AZN C;  3A6N D;  4H9N A;  5B32 D;  2FFF B;  3VH6 T;  4DRB A;  1KX5 C;  5B0Z C;  5DNN D;  3REI A;  5KDM A;  3AZF D;  5B1M B;  3AV2 C;  1S32 C;  5GXQ D;  5CP6 A;  4CSR A;  5BO0 B;  5JRG D;  3UT9 C;  2F8N D;  3AZK C;  2Y2O A;  1M1A D;  2ARO B;  1AOI D;  1P3K C;  3TU4 D;  4YM6 A;  2Y2H A;  4WU9 D;  3AN2 B;  1KX4 D;  3R45 B;  5GSU C;  3C1B B;  4WU8 C;  3B0C W;  5AV5 D;  2NQB B;  1ZLA B;  3MGR A;  2PYO B;  1P3M A;  1P3I D;  5B40 A;  4LD9 B;  3KUY B;  3FDD A;  5GT0 D;  5BT1 C;  4X23 D;  3MNN A;  4H9R A;  5AV6 C;  3O62 B;  2HIO A;  3X1U A;  4WV4 B;  5CP6 C;  1U35 B;  4J8W B;  1P3A A;  3LJA A;  3W97 C;  3AV1 D;  1M18 D;  3A6N B;  2FJ7 C;  5BS7 A;  2XD5 A;  5B32 B;  5AV8 B;  4YM6 C;  4J8V D;  1EQZ A;  2G5I C;  3MGR C;  3AZE D;  5DNN B;  5B24 C;  2JSS A;  2BG1 A;  3AZF B;  1P3M C;  3AZG A;  5GXQ B;  2CWE A;  5JRG B;  1P3O C;  5B0Y D;  2F8N B;  1M1A B;  2YFV B;  3LZ1 C;  3MNN C;  3REH A;  1KX4 A;  1AOI B;  1N1J B;  4J8X D;  3KFU G;  2HIO C;  3TU4 B;  3X1U C;  4WU9 B;  3X1S C;  3AZM D;  2F8N H;  5GT3 D;  1P3A C;  5AV5 B;  3LJA C;  3AZL B;  1F66 D;  3REL D;  4KGC B;  5B2J D;  3AZI A;  4YS3 C;  5G49 A;  4ZBJ C;  3KXB D;  4X23 A;  1P3I B;  1EQZ C;  3AZH C;  2L5A A;  1P34 A;  3AYW A;  5GT0 B;  4J8U D;  3WA9 D;  5BNX A;  4H9P A;  4Z5T C;  4Z66 C;  3AZG C;  2F2A C;  3AV1 A;  1M18 A;  3AZN D;  3REH C;  3AV1 B;  3W98 C;  3KWQ B;  3B0D C;  5F99 B;  2Y2M A;  1KX5 D;  3WAA D;  5B0Z D;  4E45 A;  4J8V B;  3MGQ B;  1S32 D;  3AV2 D;  3AZE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...