3MVDA

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdA00
3LJAD 5AVCA 1P3OB 2AROC 4YS3A 2CWEA 3X1TA 3MGPB 5AV9B 4JJNB 5AV5C 3REJD 4X23C 3AFAD 5CPJD 5GT0A 3AZMA 3X1TB 4YS3B 1P3LA 2NQBD 4ZUXA 3AYWD 4KUDD 3X1VD 1P3AC 5GT0B 3AZMB 5B2JD 5B0ZA 3WTPE 3REKC 3W97A 3WA9B 1HQ3A 1P3KD 3LELC 4YM6A 2F8NA 3AZEC 1M19A 5B31B 5DNMA 5B1MA 3AZIA 5CP6C 3MNNA 3UTAD 4J8WD 5GT3B 5DNMB 5B1MB 1KX3C 4CSRA 3X1SC 5B1LB 5AV8D 1P3PC 5B2ID 4J8VD 4KUDC 2BYMB 1M1AD 5FUGA 1P3OD 1P3FA 3RELA 3MVDA 3MGPD 4DRAA 4KHAB 5AVBC 1R4VA 5AVCD 2CV5C 4YS3D 3X1TD 1KX4C 1P3BC 3B0DC 3AZMD 5B31G 1P3LD 5F99A 4ZUXD 3WKJC 5JA4A 3LZ1C 2AROA 4G92B 3C1CB 3AN2C 5AV5A 1BH9A 1TZYC 3A6NC 4X23A 3AV2C 5B0ZD 3C1BD 2AROB 3W97D 3MGQC 1HQ3D 5AY8C 5AV5B 1BH9B 4YM6D 4J8VC 4X23B 2F8ND 2BYKA 1M1AC 1M19D 3AZLC 5DNMD 4HGAC 5B1MD 5B33C 3AZID 3MNND 3REKA 3AZJB 2BYKB 1P3AB 3LELA 2F8NH 5AVCC 1H3OB 3TU4C 3AZEA 4Z66C 5AV6C 3LELB 5CP6A 1KX5A 5CPIC 1P3LC 2NZDA 3AZKC 3AZEB 2JSSA 4Z5TA 4J8XC 5CP6B 4XUJC 1P3FD 3RELD 2RVQD 1KX3A 3X1SA 3MVDD 1P3PA 3LJAB 3AZHC 2L5AA 3C1BC 3LZ0C 3W97C 1HQ3C 1KX3B 4KUDA 3X1SB 4AWLC 1ID3C 2YFWA 3VH5T 3AZNC 1M18C 2NQBB 4WZSB 1M19C 3UT9A 4KUDB 5F99D 5AVBA 2AROD 2CV5A 3NQUB 5AV5D 5AVBB 4X23D 1KX4A 2CV5B 1P3BA 5BO0A 3WKJA 3LZ1A 3B0DB 3AV1A 3AN2A 1TZYA 3A6NA 3NQJA 3UTAB 3LZ1B 3AV2A 1P3FC 2RVQC 3REKD 3MVDC 4KGCC 4LD9C 3MGQA 1S32A 3LELD 5AY8A 3AN2B 3NQJB 3AV2B 2LY8A 1M1AA 5AV8B 3MGQB 3AZED 3AZLA 1N1JB 5B33A 5AY8B 5CP6D 4J8VB 1KX5D 3KUYC 2NZDD 3O62A 1M1AB 4WV4B 4Z5TD 4HGAB 5B33B 1KX3D 3X1SD 3TU4A 4Z66A 5AV6A 1P3PD 5AVCB 5CPIA 3AZKA 4QLCC 1EQZC 5AV6B 4J8XA 4XUJA 5B0YC 1P3LB 1P3GC 4ZUXB 3UT9D 3AZHA 5AVBD 3C1BA 4J8XB 3LZ0A 3KWQC 4XUJB 1U35C 1F66C 2CV5D 5KDMA 3B0CW 1ID3A 3AZNA 5B0ZB 3AZHB 3C1BB 1M18A 3LZ0B 1KX4D 3W97B 1P3BD 1HQ3B 1B67A 1ZLAC 3VH6T 4AWLB 3WKJD 4YM6B 1ID3B 1KX5C 3V9RA 3LZ1D 2FJ7A 2NZDC 3MGRC 2F8NB 1AOIC 1M19B 3AV1D 4Z5TC 3AZIB 3AN2D 1TZYD 3A6ND 3MNNB 4DRBA 3X1UA 3AV2D 3MGQD 1S32D 5AY8D 5GXQA 1P34D 4CSRB 4G91B 3AZLD 5B33D 4KGCA 5B24A 4LD9A 3UT9C 3O62D 2HUEB 5FUGB 1P3FB 3REIC 3RELB 5JRGC 3MVDB 4KGCB 3TU4D 4Z66D 5BS7C 5AV6D 4NE6A 5CPID 3KUYA 4R8PA 4H9QA 3AZKD 4H9PA 2F8NG 5B32C 4J8XD 3B6FC 4XUJD 4Z2MH 3KUYB 3AV1C 1WWIA 5F99B 4H9QB 4UUZA 4H9PB 5JA4B 3AZHD 3LZ0D 1S32C 3UTBA 1EQZA 4QLCA 4WU8A 1ID3D 5C3IC 3AZND 5B0YA 1P34C 1M18D 5BNVA 4XZQA 1P3GA 4ZBJC 3B0BA 4QLCB 1U35A 2FJ7D 1F66A 3KWQA 3O62C 3REHC 1P3GB 2HIOA 3W98A 3REKB 3X1UD 1F66B 1ZLAA 5GXQD 3MGSC 3WAAC 3MGRA 1AOIA 3WTPA 4NFTA 1KX5B 5E5AA 1P3MA 2NZDB 3KXBC 3MGRB 1AOIB 5B24D 4KGCD 4LD9D 4H9OA 4Z5TB 3W96A 1BH8A 1P3PB 5CPKA 1JFIA 2IO5C 4R8PD 4H9RA 3KUYD 2YFWB 2FJ7C 4H9NA 3REIA 5JRGA 3B6GC 1A7WA 3UT9B 4WNNA 5BS7A 3X1UC 4E44A 4H9NB 1HTAA 3REIB 5JRGB 3UTBD 1EQZD 4QLCD 5B40A 4WU8D 5GXQC 5B32A 3B6FA 5B0YD 1KX4B 1P3BB 1P3GD 4XZQD 5BO0B 3WKJB 1U35D 1F66D 3KWQD 5B24C 3AV1B 1F1EA 1TZYB 3A6NB 4WU9C 2PYOA 2HIOD 1P34A 3W98D 2YFVA 1S32B 5B1LC 1ZLAD 5DNNA 5C3IB 4R8PC 1P34B 3MGRD 1AOID 2YFVB 3VH5A 3REHA 4J8UA 4ZBJB 3AZGD 3WTPD 3AZLB 3KSYA 5E5AD 1P3MD 3O62B 3AZFD 3REHB 4NE3A 3W96D 3MGSA 3WAAA 4EO5C 3UTBC 3TU4B 4WU8C 4Z66B 5CPKD 5CPIB 4E45A 3WAAB 4XZQC 3KXBA 3AZKB 5B32G 3REID 5JRGD 5AV9A 4JJNA 2HIOC 3W98C 5KDMB 5B40D 3AZNB 5B32D 1M18B 3B6FD 3B6GA 2IO5B 3AZGC 3WTPC 2FJ7B 3V9RB 5E5AC 1P3MC 3WA9A 3AZJC 3AZFC 3B6GB 3W96C 1P3ID 3X1UB 2PYOD 4Z2MG 5B31A 5CPKC 3W99C 1WWSA 5GXQB 5DNND 5GT3A 3REHD 4J8UD 4WU9A 5B24B 4LD9B 5B1LA 3LJAC 3VH5W 4WU9B 3MGSD 3WAAD 2BYMA 5B40C 3REJC 5GSUD 3AFAC 5CPJC 2NQBC 3VH6A 4R8PB 3KXBD 4H9SC 3AYWC 4KHAA 3X1VC 5B2JC 5AV9D 1P3IC 4UUZB 4JJND 2PYOC 4EO5B 3UTBB 1P3KC 1EQZB 1Q9CA 4WU8B 5DNNC 5B0YB 5BNVB 4XZQB 5GT0D 3C1CA 4J8UC 3B6GD 3UTAC 1U35B 3R45A 3KWQB 4J8WC 5G49A 3WA9D 2HIOB 3W98B 3R45B 5BNXA 5G49B 1BFMA 5AV8C 3AZGA 1ZLAB 3B0CT 5GSUC 5B31D 5B2IC 3AZJA 5BNXB 3AZFA 1P3AA 5GT3D 3AZGB 3WTPB 4CAYA 4WU9D 1P3OC 5E5AB 3MGPC 1P3MB 1H3OA 5AV9C 3AZFB 4JJNC 5B1LD 4H9OB 4NE5A 1KU5A 4CAYB 3W99A 3W96B 1BH8B 4YS3C 3X1TC 5CPKB 5CHLB 3W99B 5GT0C 4M6BA 3AZMC 1JFIB 4H9RB 1ULYA 4ZUXC 2F8NK 3LJAA 3WA9C 3VH6W 4WNNB 3REJA 5B0ZC 3AFAA 5CPJA 2NQBA 3AYWA 4H9SA 5B31C 5B40B 4YM6C 5BT1D 3REJB 5B32B 1TAFA 3B6FB 3AFAB 3X1VA 5CPJB 3NQUA 5GT3C 5B2JA 3AYWB 3C1CD 1P3IA 5DNMC 3AZIC 5B1MC 3MNNC 1TAFB 3X1VB 1P3KA 5B2JB 1P3IB 2PYOB 1P3KB 4G91C 3UTAA 5DNNB 4J8WA 3AZJD 1P3AD 4J8UB 2HUEC 3RELC 4J8WB 5AV8A 1N1JA 3W99D 5GSUA 1B6WA 5B2IA 4J8VA 3MGSB 5BT1C 1P3OA 5GSUB 5B2IB 3MGPA 4G92C 3KXBB 3C1CC 5F99C
chains in the Genus database with same CATH superfamily
3LJAD 5AVCA 1P3OB 2AROC 4YS3A 2CWEA 3X1TA 3MGPB 5AV9B 4JJNB 5AV5C 3REJD 4X23C 3AFAD 5CPJD 5GT0A 3AZMA 3X1TB 4YS3B 1P3LA 2NQBD 4ZUXA 3AYWD 4KUDD 3X1VD 2Y2JA 5GT0B 2UWXA 3AZMB 1P3AC 5B2JD 5B0ZA 3WTPE 3REKC 3W97A 3WA9B 1HQ3A 1P3KD 3LELC 2VQRA 4YM6A 2F8NA 3AZEC 1M19A 5B31B 5DNMA 5B1MA 3AZIA 5CP6C 3MNNA 3UTAD 4J8WD 5GT3B 5DNMB 5B1MB 1KX3C 4CSRA 3X1SC 5B1LB 5AV8D 1P3PC 5B2ID 4J8VD 4KUDC 3EPJA 2BYMB 1M1AD 2FFFB 5FUGA 1P3OD 1P3FA 3RELA 3MVDA 3MGPD 4DRAA 4KHAB 5AVBC 3EPLA 1R4VA 5AVCD 2CV5C 4YS3D 3X1TD 4WJ3C 1KX4C 1P3BC 3B0DC 3AZMD 5B31G 1P3LD 5F99A 4ZUXD 3WKJC 5JA4A 3LZ1C 2AROA 4G92B 3C1CB 3AN2C 5AV5A 1BH9A 1TZYC 3A6NC 4X23A 3AV2C 5B0ZD 3C1BD 2AROB 3W97D 3MGQC 1HQ3D 5AY8C 5AV5B 1BH9B 4YM6D 4J8VC 4X23B 2F8ND 2BYKA 1M1AC 1M19D 3AZLC 5DNMD 4HGAC 5B1MD 5B33C 3AZID 3MNND 3REKA 3AZJB 2BYKB 1P3AB 3LELA 2F8NH 5AVCC 1H3OB 3TU4C 3AZEA 4Z66C 5AV6C 3LELB 5CP6A 1KX5A 5CPIC 1P3LC 2NZDA 3AZKC 3AZEB 2JSSA 4Z5TA 4J8XC 5CP6B 4XUJC 3FDDA 1P3FD 3RELD 2RVQD 1KX3A 3X1SA 3MVDD 1P3PA 3LJAB 2ZY5A 3AZHC 2L5AA 3C1BC 3LZ0C 3W97C 1HQ3C 1KX3B 4KUDA 3X1SB 4AWLC 1ID3C 2YFWA 3IP4C 3VH5T 3AZNC 1M18C 2NQBB 4WZSB 1M19C 3UT9A 4KUDB 5F99D 2Y2HA 5AVBA 2AROD 2CV5A 3NQUB 5AV5D 5AVBB 4X23D 1KX4A 3A1IA 2Y2LA 2CV5B 1P3BA 2Y2MA 5BO0A 3WKJA 3LZ1A 3B0DB 3AV1A 3AN2A 1TZYA 3A6NA 3NQJA 3UTAB 2XD5A 2DQNC 3LZ1B 2RVQC 3AV2A 3REKD 3MVDC 1P3FC 4KGCC 4LD9C 3MGQA 1S32A 3LELD 5AY8A 3AN2B 3NQJB 3AV2B 2LY8A 2BG1A 1M1AA 5AV8B 3MGQB 3AZED 3AZLA 1N1JB 5B33A 5AY8B 5CP6D 4J8VB 1KX5D 3KUYC 2NZDD 3O62A 1M1AB 4WV4B 4Z5TD 4HGAB 5B33B 1KX3D 3X1SD 3TU4A 4Z66A 5AV6A 1P3PD 5AVCB 5CPIA 2J8PA 3AZKA 4QLCC 1EQZC 5AV6B 4J8XA 4XUJA 5B0YC 1P3LB 1P3GC 4ZUXB 3UT9D 3AZHA 5AVBD 3C1BA 4J8XB 3LZ0A 3KWQC 4XUJB 1U35C 1F66C 2CV5D 5KDMA 3B0CW 1ID3A 3AZNA 5B0ZB 3AZHB 3C1BB 1M18A 3LZ0B 1KX4D 3W97B 1P3BD 1HQ3B 1B67A 1ZLAC 3VH6T 4AWLB 3WKJD 4YM6B 1ID3B 1KX5C 3V9RA 3LZ1D 2FJ7A 2NZDC 3MGRC 2F8NB 1AOIC 1M19B 3AV1D 4Z5TC 3AZIB 3AN2D 1TZYD 3A6ND 3MNNB 4DRBA 3X1UA 3AV2D 3MGQD 1S32D 5AY8D 5GXQA 1P34D 4CSRB 4G91B 3A1KA 3AZLD 5B33D 2DF4C 4KGCA 5B24A 4LD9A 3UT9C 3O62D 2HUEB 5FUGB 1P3FB 3REIC 3RELB 5JRGC 3MVDB 4KGCB 3TU4D 4Z66D 5BS7C 5AV6D 4NE6A 2Y2OA 5CPID 3KUYA 4R8PA 2F2AC 4H9QA 3AZKD 4H9PA 2F8NG 5B32C 4J8XD 3B6FC 4XUJD 4Z2MH 3AL0C 3KUYB 3AV1C 1WWIA 5F99B 4H9QB 4UUZA 4H9PB 3F6TA 5JA4B 3AZHD 3LZ0D 1S32C 3UTBA 1EQZA 4QLCA 4WU8A 1ID3D 2W8SA 5C3IC 3AZND 5B0YA 1P34C 1M18D 2G5HC 5BNVA 4XZQA 1P3GA 4ZBJC 3B0BA 4QLCB 1U35A 2FJ7D 1F66A 3KWQA 3O62C 3REHC 1P3GB 2HIOA 3W98A 3REKB 3X1UD 1F66B 3EG5B 1ZLAA 5GXQD 3MGSC 3WAAC 3MGRA 1AOIA 3WTPA 4NFTA 2JE5A 1KX5B 5E5AA 1P3MA 2NZDB 3KXBC 3MGRB 1AOIB 5B24D 4KGCD 4LD9D 4H9OA 4Z5TB 3W96A 1BH8A 3H0MC 1P3PB 5CPKA 1JFIA 2IO5C 4R8PD 4H9RA 3KUYD 2YFWB 2FJ7C 4H9NA 3REIA 5JRGA 3B6GC 1A7WA 3UT9B 4WNNA 5BS7A 3X1UC 4E44A 4H9NB 1HTAA 3REIB 5JRGB 3UTBD 1EQZD 4QLCD 5B40A 4WU8D 5GXQC 5B32A 3B6FA 5B0YD 1KX4B 1P3BB 1P3GD 4XZQD 5BO0B 3WKJB 1U35D 2ZY4A 1F66D 3KWQD 5B24C 2ZM5A 3AV1B 1F1EA 1TZYB 3A6NB 4WU9C 2PYOA 2HIOD 1P34A 3W98D 2YFVA 1S32B 5B1LC 1ZLAD 5DNNA 5C3IB 4R8PC 1P34B 3MGRD 1AOID 2YFVB 3VH5A 3REHA 4J8UA 4ZBJB 3AZGD 3WTPD 3AZLB 3KSYA 5E5AD 1P3MD 3O62B 2G5IC 3REHB 4NE3A 3AZFD 3W96D 3MGSA 3WAAA 4EO5C 2Y2QA 3UTBC 2Y2NA 3TU4B 4WU8C 4Z66B 5CPKD 5CPIB 4E45A 3WAAB 4XZQC 3KXBA 3AZKB 5B32G 2XD1A 3H0RC 4UPKA 3REID 5JRGD 5AV9A 4JJNA 2HIOC 3W98C 5KDMB 5B40D 3AZNB 2Y2GA 5B32D 1M18B 2Y2PA 3B6FD 3B6GA 2IO5B 3AZGC 3WTPC 2FJ7B 3V9RB 5E5AC 1P3MC 3WA9A 3AZJC 3AZFC 3B6GB 3W96C 1P3ID 3X1UB 2PYOD 4Z2MG 5B31A 5CPKC 3W99C 3EPHA 1WWSA 5GXQB 5DNND 2JCHA 5GT3A 3REHD 4J8UD 4WU9A 5B24B 4LD9B 5B1LA 3LJAC 3VH5W 4WU9B 3MGSD 3WAAD 2BYMA 5B40C 3REJC 5GSUD 3AFAC 5CPJC 2NQBC 2ZY3A 1Z2CB 3VH6A 4R8PB 3KXBD 4H9SC 3AYWC 4KHAA 2RIQA 3X1VC 5B2JC 5AV9D 1P3IC 4UUZB 4JJND 2PYOC 2Y2IA 4EO5B 3UTBB 1P3KC 1EQZB 1Q9CA 4WU8B 5DNNC 5B0YB 3H0LC 5BNVB 4XZQB 5GT0D 3EPKA 3C1CA 4J8UC 3B6GD 3UTAC 1U35B 3R45A 3KWQB 4J8WC 5G49A 3WA9D 2HIOB 3W98B 3R45B 5BNXA 5G49B 1BFMA 5AV8C 3AZGA 1ZLAB 1T3UA 3B0CT 5GSUC 5B31D 5B2IC 4DQYB 3AZJA 5BNXB 3AZFA 1P3AA 5GT3D 3AZGB 3WTPB 4CAYA 4WU9D 1P3OC 5E5AB 3MGPC 1P3MB 1H3OA 5AV9C 2ZY2A 4JJNC 3AZFB 5B1LD 4H9OB 4NE5A 1KU5A 4CAYB 3W99A 3W96B 1BH8B 4YS3C 3X1TC 5CPKB 5CHLB 3W99B 5GT0C 4M6BA 3AZMC 1JFIB 4H9RB 1ULYA 4ZUXC 2F8NK 3LJAA 3WA9C 3VH6W 4WNNB 3REJA 5B0ZC 3AFAA 5CPJA 2NQBA 3AYWA 4H9SA 5B31C 3P5JB 5B40B 4YM6C 5BT1D 3REJB 5B32B 1TAFA 3B6FB 3AFAB 3X1VA 5CPJB 3NQUA 5GT3C 5B2JA 3AYWB 1W2EA 3C1CD 1P3IA 5DNMC 3AZIC 5B1MC 3MNNC 2Y2KA 1TAFB 3X1VB 1P3KA 5B2JB 1P3IB 3KFUG 2PYOB 1P3KB 4G91C 3UTAA 5DNNB 4J8WA 3AZJD 1P3AD 4J8UB 2HUEC 3RELC 4J8WB 5AV8A 1N1JA 3W99D 5GSUA 1B6WA 5B2IA 4J8VA 3MGSB 1PZRA 5BT1C 1P3OA 5GSUB 5B2IB 3MGPA 4G92C 3KXBB 3C1CC 5F99C
chains in the Genus database with same CATH topology
3LJAD 5AVCA 1P3OB 2AROC 4YS3A 2CWEA 3X1TA 3MGPB 5AV9B 4JJNB 5AV5C 3REJD 4X23C 3AFAD 5CPJD 5GT0A 3AZMA 3X1TB 4YS3B 1P3LA 2NQBD 4ZUXA 3AYWD 4KUDD 3X1VD 2Y2JA 5GT0B 2UWXA 3AZMB 1P3AC 5B2JD 5B0ZA 3WTPE 3REKC 3W97A 3WA9B 1HQ3A 1P3KD 3LELC 2VQRA 4YM6A 2F8NA 3AZEC 1M19A 5B31B 5DNMA 5B1MA 3AZIA 5CP6C 3MNNA 3UTAD 4J8WD 5GT3B 5DNMB 5B1MB 1KX3C 4CSRA 3X1SC 5B1LB 5AV8D 1P3PC 5B2ID 4J8VD 4KUDC 3EPJA 2BYMB 1M1AD 2FFFB 5FUGA 1P3OD 1P3FA 3RELA 3MVDA 3MGPD 4DRAA 4KHAB 5AVBC 3EPLA 1R4VA 5AVCD 2CV5C 4YS3D 3X1TD 4WJ3C 1KX4C 1P3BC 3B0DC 3AZMD 5B31G 1P3LD 5F99A 4ZUXD 3WKJC 5JA4A 3LZ1C 2AROA 4G92B 3C1CB 3AN2C 5AV5A 1BH9A 1TZYC 3A6NC 4X23A 3AV2C 5B0ZD 3C1BD 2AROB 3W97D 3MGQC 1HQ3D 5AY8C 5AV5B 1BH9B 4YM6D 4J8VC 4X23B 2F8ND 2BYKA 1M1AC 1M19D 3AZLC 5DNMD 4HGAC 5B1MD 5B33C 3AZID 3MNND 3REKA 3AZJB 2BYKB 1P3AB 3LELA 2F8NH 5AVCC 1H3OB 3TU4C 3AZEA 4Z66C 5AV6C 3LELB 5CP6A 1KX5A 5CPIC 1P3LC 2NZDA 3AZKC 3AZEB 2JSSA 4Z5TA 4J8XC 5CP6B 4XUJC 3FDDA 1P3FD 3RELD 2RVQD 1KX3A 3X1SA 3MVDD 1P3PA 3LJAB 2ZY5A 3AZHC 2L5AA 3C1BC 3LZ0C 3W97C 1HQ3C 1KX3B 4KUDA 3X1SB 4AWLC 1ID3C 2YFWA 3IP4C 3VH5T 3AZNC 1M18C 2NQBB 4WZSB 1M19C 3UT9A 4KUDB 5F99D 2Y2HA 5AVBA 2AROD 2CV5A 3NQUB 5AV5D 5AVBB 4X23D 1KX4A 3A1IA 2Y2LA 2CV5B 1P3BA 2Y2MA 5BO0A 3WKJA 3LZ1A 3B0DB 3AV1A 3AN2A 1TZYA 3A6NA 3NQJA 3UTAB 2XD5A 2DQNC 3LZ1B 2RVQC 3AV2A 3REKD 3MVDC 1P3FC 4KGCC 4LD9C 3MGQA 1S32A 3LELD 5AY8A 3AN2B 3NQJB 3AV2B 2LY8A 2BG1A 1M1AA 5AV8B 3MGQB 3AZED 3AZLA 1N1JB 5B33A 5AY8B 5CP6D 4J8VB 1KX5D 3KUYC 2NZDD 3O62A 1M1AB 4WV4B 4Z5TD 4HGAB 5B33B 1KX3D 3X1SD 3TU4A 4Z66A 5AV6A 1P3PD 5AVCB 5CPIA 2J8PA 3AZKA 4QLCC 1EQZC 5AV6B 4J8XA 4XUJA 5B0YC 1P3LB 1P3GC 4ZUXB 3UT9D 3AZHA 5AVBD 3C1BA 4J8XB 3LZ0A 3KWQC 4XUJB 1U35C 1F66C 2CV5D 5KDMA 3B0CW 1ID3A 3AZNA 5B0ZB 3AZHB 3C1BB 1M18A 3LZ0B 1KX4D 3W97B 1P3BD 1HQ3B 1B67A 1ZLAC 3VH6T 4AWLB 3WKJD 4YM6B 1ID3B 1KX5C 3V9RA 3LZ1D 2FJ7A 2NZDC 3MGRC 2F8NB 1AOIC 1M19B 3AV1D 4Z5TC 3AZIB 3AN2D 1TZYD 3A6ND 3MNNB 4DRBA 3X1UA 3AV2D 3MGQD 1S32D 5AY8D 5GXQA 1P34D 4CSRB 4G91B 3A1KA 3AZLD 5B33D 2DF4C 4KGCA 5B24A 4LD9A 3UT9C 3O62D 2HUEB 5FUGB 1P3FB 3REIC 3RELB 5JRGC 3MVDB 4KGCB 3TU4D 4Z66D 5BS7C 5AV6D 4NE6A 2Y2OA 5CPID 3KUYA 4R8PA 2F2AC 4H9QA 3AZKD 4H9PA 2F8NG 5B32C 4J8XD 3B6FC 4XUJD 4Z2MH 3AL0C 3KUYB 3AV1C 1WWIA 5F99B 4H9QB 4UUZA 4H9PB 3F6TA 5JA4B 3AZHD 3LZ0D 1S32C 3UTBA 1EQZA 4QLCA 4WU8A 1ID3D 2W8SA 5C3IC 3AZND 5B0YA 1P34C 1M18D 2G5HC 5BNVA 4XZQA 1P3GA 4ZBJC 3B0BA 4QLCB 1U35A 2FJ7D 1F66A 3KWQA 3O62C 3REHC 1P3GB 2HIOA 3W98A 3REKB 3X1UD 1F66B 3EG5B 1ZLAA 5GXQD 3MGSC 3WAAC 3MGRA 1AOIA 3WTPA 4NFTA 2JE5A 1KX5B 5E5AA 1P3MA 2NZDB 3KXBC 3MGRB 1AOIB 5B24D 4KGCD 4LD9D 4H9OA 4Z5TB 3W96A 1BH8A 3H0MC 1P3PB 5CPKA 1JFIA 2IO5C 4R8PD 4H9RA 3KUYD 2YFWB 2FJ7C 4H9NA 3REIA 5JRGA 3B6GC 1A7WA 3UT9B 4WNNA 5BS7A 3X1UC 4E44A 4H9NB 1HTAA 3REIB 5JRGB 3UTBD 1EQZD 4QLCD 5B40A 4WU8D 5GXQC 5B32A 3B6FA 5B0YD 1KX4B 1P3BB 1P3GD 4XZQD 5BO0B 3WKJB 1U35D 2ZY4A 1F66D 3KWQD 5B24C 2ZM5A 3AV1B 1F1EA 1TZYB 3A6NB 4WU9C 2PYOA 2HIOD 1P34A 3W98D 2YFVA 1S32B 5B1LC 1ZLAD 5DNNA 5C3IB 4R8PC 1P34B 3MGRD 1AOID 2YFVB 3VH5A 3REHA 4J8UA 4ZBJB 3AZGD 3WTPD 3AZLB 3KSYA 5E5AD 1P3MD 3O62B 2G5IC 3REHB 4NE3A 3AZFD 3W96D 3MGSA 3WAAA 4EO5C 2Y2QA 3UTBC 2Y2NA 3TU4B 4WU8C 4Z66B 5CPKD 5CPIB 4E45A 3WAAB 4XZQC 3KXBA 3AZKB 5B32G 2XD1A 3H0RC 4UPKA 3REID 5JRGD 5AV9A 4JJNA 2HIOC 3W98C 5KDMB 5B40D 3AZNB 2Y2GA 5B32D 1M18B 2Y2PA 3B6FD 3B6GA 2IO5B 3AZGC 3WTPC 2FJ7B 3V9RB 5E5AC 1P3MC 3WA9A 3AZJC 3AZFC 3B6GB 3W96C 1P3ID 3X1UB 2PYOD 4Z2MG 5B31A 5CPKC 3W99C 3EPHA 1WWSA 5GXQB 5DNND 2JCHA 5GT3A 3REHD 4J8UD 4WU9A 5B24B 4LD9B 5B1LA 3LJAC 3VH5W 4WU9B 3MGSD 3WAAD 2BYMA 5B40C 3REJC 5GSUD 3AFAC 5CPJC 2NQBC 2ZY3A 1Z2CB 3VH6A 4R8PB 3KXBD 4H9SC 3AYWC 4KHAA 2RIQA 3X1VC 5B2JC 5AV9D 1P3IC 4UUZB 4JJND 2PYOC 2Y2IA 4EO5B 3UTBB 1P3KC 1EQZB 1Q9CA 4WU8B 5DNNC 5B0YB 3H0LC 5BNVB 4XZQB 5GT0D 3EPKA 3C1CA 4J8UC 3B6GD 3UTAC 1U35B 3R45A 3KWQB 4J8WC 5G49A 3WA9D 2HIOB 3W98B 3R45B 5BNXA 5G49B 1BFMA 5AV8C 3AZGA 1ZLAB 1T3UA 3B0CT 5GSUC 5B31D 5B2IC 4DQYB 3AZJA 5BNXB 3AZFA 1P3AA 5GT3D 3AZGB 3WTPB 4CAYA 4WU9D 1P3OC 5E5AB 3MGPC 1P3MB 1H3OA 5AV9C 2ZY2A 4JJNC 3AZFB 5B1LD 4H9OB 4NE5A 1KU5A 4CAYB 3W99A 3W96B 1BH8B 4YS3C 3X1TC 5CPKB 5CHLB 3W99B 5GT0C 4M6BA 3AZMC 1JFIB 4H9RB 1ULYA 4ZUXC 2F8NK 3LJAA 3WA9C 3VH6W 4WNNB 3REJA 5B0ZC 3AFAA 5CPJA 2NQBA 3AYWA 4H9SA 5B31C 3P5JB 5B40B 4YM6C 5BT1D 3REJB 5B32B 1TAFA 3B6FB 3AFAB 3X1VA 5CPJB 3NQUA 5GT3C 5B2JA 3AYWB 1W2EA 3C1CD 1P3IA 5DNMC 3AZIC 5B1MC 3MNNC 2Y2KA 1TAFB 3X1VB 1P3KA 5B2JB 1P3IB 3KFUG 2PYOB 1P3KB 4G91C 3UTAA 5DNNB 4J8WA 3AZJD 1P3AD 4J8UB 2HUEC 3RELC 4J8WB 5AV8A 1N1JA 3W99D 5GSUA 1B6WA 5B2IA 4J8VA 3MGSB 1PZRA 5BT1C 1P3OA 5GSUB 5B2IB 3MGPA 4G92C 3KXBB 3C1CC 5F99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA D;  5AVC A;  1P3O B;  2ARO C;  4YS3 A;  2CWE A;  3X1T A;  3MGP B;  5AV9 B;  4JJN B;  5AV5 C;  3REJ D;  4X23 C;  3AFA D;  5CPJ D;  5GT0 A;  3AZM A;  3X1T B;  4YS3 B;  1P3L A;  2NQB D;  4ZUX A;  3AYW D;  4KUD D;  3X1V D;  1P3A C;  5GT0 B;  3AZM B;  5B2J D;  5B0Z A;  3WTP E;  3REK C;  3W97 A;  3WA9 B;  1HQ3 A;  1P3K D;  3LEL C;  4YM6 A;  2F8N A;  3AZE C;  1M19 A;  5B31 B;  5DNM A;  5B1M A;  3AZI A;  5CP6 C;  3MNN A;  3UTA D;  4J8W D;  5GT3 B;  5DNM B;  5B1M B;  1KX3 C;  4CSR A;  3X1S C;  5B1L B;  5AV8 D;  1P3P C;  5B2I D;  4J8V D;  4KUD C;  2BYM B;  1M1A D;  5FUG A;  1P3O D;  1P3F A;  3REL A;  3MVD A;  3MGP D;  4DRA A;  4KHA B;  5AVB C;  1R4V A;  5AVC D;  2CV5 C;  4YS3 D;  3X1T D;  1KX4 C;  1P3B C;  3B0D C;  3AZM D;  5B31 G;  1P3L D;  5F99 A;  4ZUX D;  3WKJ C;  5JA4 A;  3LZ1 C;  2ARO A;  4G92 B;  3C1C B;  3AN2 C;  5AV5 A;  1BH9 A;  1TZY C;  3A6N C;  4X23 A;  3AV2 C;  5B0Z D;  3C1B D;  2ARO B;  3W97 D;  3MGQ C;  1HQ3 D;  5AY8 C;  5AV5 B;  1BH9 B;  4YM6 D;  4J8V C;  4X23 B;  2F8N D;  2BYK A;  1M1A C;  1M19 D;  3AZL C;  5DNM D;  4HGA C;  5B1M D;  5B33 C;  3AZI D;  3MNN D;  3REK A;  3AZJ B;  2BYK B;  1P3A B;  3LEL A;  2F8N H;  5AVC C;  1H3O B;  3TU4 C;  3AZE A;  4Z66 C;  5AV6 C;  3LEL B;  5CP6 A;  1KX5 A;  5CPI C;  1P3L C;  2NZD A;  3AZK C;  3AZE B;  2JSS A;  4Z5T A;  4J8X C;  5CP6 B;  4XUJ C;  1P3F D;  3REL D;  2RVQ D;  1KX3 A;  3X1S A;  3MVD D;  1P3P A;  3LJA B;  3AZH C;  2L5A A;  3C1B C;  3LZ0 C;  3W97 C;  1HQ3 C;  1KX3 B;  4KUD A;  3X1S B;  4AWL C;  1ID3 C;  2YFW A;  3VH5 T;  3AZN C;  1M18 C;  2NQB B;  4WZS B;  1M19 C;  3UT9 A;  4KUD B;  5F99 D;  5AVB A;  2ARO D;  2CV5 A;  3NQU B;  5AV5 D;  5AVB B;  4X23 D;  1KX4 A;  2CV5 B;  1P3B A;  5BO0 A;  3WKJ A;  3LZ1 A;  3B0D B;  3AV1 A;  3AN2 A;  1TZY A;  3A6N A;  3NQJ A;  3UTA B;  3LZ1 B;  3AV2 A;  1P3F C;  2RVQ C;  3REK D;  3MVD C;  4KGC C;  4LD9 C;  3MGQ A;  1S32 A;  3LEL D;  5AY8 A;  3AN2 B;  3NQJ B;  3AV2 B;  2LY8 A;  1M1A A;  5AV8 B;  3MGQ B;  3AZE D;  3AZL A;  1N1J B;  5B33 A;  5AY8 B;  5CP6 D;  4J8V B;  1KX5 D;  3KUY C;  2NZD D;  3O62 A;  1M1A B;  4WV4 B;  4Z5T D;  4HGA B;  5B33 B;  1KX3 D;  3X1S D;  3TU4 A;  4Z66 A;  5AV6 A;  1P3P D;  5AVC B;  5CPI A;  3AZK A;  4QLC C;  1EQZ C;  5AV6 B;  4J8X A;  4XUJ A;  5B0Y C;  1P3L B;  1P3G C;  4ZUX B;  3UT9 D;  3AZH A;  5AVB D;  3C1B A;  4J8X B;  3LZ0 A;  3KWQ C;  4XUJ B;  1U35 C;  1F66 C;  2CV5 D;  5KDM A;  3B0C W;  1ID3 A;  3AZN A;  5B0Z B;  3AZH B;  3C1B B;  1M18 A;  3LZ0 B;  1KX4 D;  3W97 B;  1P3B D;  1HQ3 B;  1B67 A;  1ZLA C;  3VH6 T;  4AWL B;  3WKJ D;  4YM6 B;  1ID3 B;  1KX5 C;  3V9R A;  3LZ1 D;  2FJ7 A;  2NZD C;  3MGR C;  2F8N B;  1AOI C;  1M19 B;  3AV1 D;  4Z5T C;  3AZI B;  3AN2 D;  1TZY D;  3A6N D;  3MNN B;  4DRB A;  3X1U A;  3AV2 D;  3MGQ D;  1S32 D;  5AY8 D;  5GXQ A;  1P34 D;  4CSR B;  4G91 B;  3AZL D;  5B33 D;  4KGC A;  5B24 A;  4LD9 A;  3UT9 C;  3O62 D;  2HUE B;  5FUG B;  1P3F B;  3REI C;  3REL B;  5JRG C;  3MVD B;  4KGC B;  3TU4 D;  4Z66 D;  5BS7 C;  5AV6 D;  4NE6 A;  5CPI D;  3KUY A;  4R8P A;  4H9Q A;  3AZK D;  4H9P A;  2F8N G;  5B32 C;  4J8X D;  3B6F C;  4XUJ D;  4Z2M H;  3KUY B;  3AV1 C;  1WWI A;  5F99 B;  4H9Q B;  4UUZ A;  4H9P B;  5JA4 B;  3AZH D;  3LZ0 D;  1S32 C;  3UTB A;  1EQZ A;  4QLC A;  4WU8 A;  1ID3 D;  5C3I C;  3AZN D;  5B0Y A;  1P34 C;  1M18 D;  5BNV A;  4XZQ A;  1P3G A;  4ZBJ C;  3B0B A;  4QLC B;  1U35 A;  2FJ7 D;  1F66 A;  3KWQ A;  3O62 C;  3REH C;  1P3G B;  2HIO A;  3W98 A;  3REK B;  3X1U D;  1F66 B;  1ZLA A;  5GXQ D;  3MGS C;  3WAA C;  3MGR A;  1AOI A;  3WTP A;  4NFT A;  1KX5 B;  5E5A A;  1P3M A;  2NZD B;  3KXB C;  3MGR B;  1AOI B;  5B24 D;  4KGC D;  4LD9 D;  4H9O A;  4Z5T B;  3W96 A;  1BH8 A;  1P3P B;  5CPK A;  1JFI A;  2IO5 C;  4R8P D;  4H9R A;  3KUY D;  2YFW B;  2FJ7 C;  4H9N A;  3REI A;  5JRG A;  3B6G C;  1A7W A;  3UT9 B;  4WNN A;  5BS7 A;  3X1U C;  4E44 A;  4H9N B;  1HTA A;  3REI B;  5JRG B;  3UTB D;  1EQZ D;  4QLC D;  5B40 A;  4WU8 D;  5GXQ C;  5B32 A;  3B6F A;  5B0Y D;  1KX4 B;  1P3B B;  1P3G D;  4XZQ D;  5BO0 B;  3WKJ B;  1U35 D;  1F66 D;  3KWQ D;  5B24 C;  3AV1 B;  1F1E A;  1TZY B;  3A6N B;  4WU9 C;  2PYO A;  2HIO D;  1P34 A;  3W98 D;  2YFV A;  1S32 B;  5B1L C;  1ZLA D;  5DNN A;  5C3I B;  4R8P C;  1P34 B;  3MGR D;  1AOI D;  2YFV B;  3VH5 A;  3REH A;  4J8U A;  4ZBJ B;  3AZG D;  3WTP D;  3AZL B;  3KSY A;  5E5A D;  1P3M D;  3O62 B;  3AZF D;  3REH B;  4NE3 A;  3W96 D;  3MGS A;  3WAA A;  4EO5 C;  3UTB C;  3TU4 B;  4WU8 C;  4Z66 B;  5CPK D;  5CPI B;  4E45 A;  3WAA B;  4XZQ C;  3KXB A;  3AZK B;  5B32 G;  3REI D;  5JRG D;  5AV9 A;  4JJN A;  2HIO C;  3W98 C;  5KDM B;  5B40 D;  3AZN B;  5B32 D;  1M18 B;  3B6F D;  3B6G A;  2IO5 B;  3AZG C;  3WTP C;  2FJ7 B;  3V9R B;  5E5A C;  1P3M C;  3WA9 A;  3AZJ C;  3AZF C;  3B6G B;  3W96 C;  1P3I D;  3X1U B;  2PYO D;  4Z2M G;  5B31 A;  5CPK C;  3W99 C;  1WWS A;  5GXQ B;  5DNN D;  5GT3 A;  3REH D;  4J8U D;  4WU9 A;  5B24 B;  4LD9 B;  5B1L A;  3LJA C;  3VH5 W;  4WU9 B;  3MGS D;  3WAA D;  2BYM A;  5B40 C;  3REJ C;  5GSU D;  3AFA C;  5CPJ C;  2NQB C;  3VH6 A;  4R8P B;  3KXB D;  4H9S C;  3AYW C;  4KHA A;  3X1V C;  5B2J C;  5AV9 D;  1P3I C;  4UUZ B;  4JJN D;  2PYO C;  4EO5 B;  3UTB B;  1P3K C;  1EQZ B;  1Q9C A;  4WU8 B;  5DNN C;  5B0Y B;  5BNV B;  4XZQ B;  5GT0 D;  3C1C A;  4J8U C;  3B6G D;  3UTA C;  1U35 B;  3R45 A;  3KWQ B;  4J8W C;  5G49 A;  3WA9 D;  2HIO B;  3W98 B;  3R45 B;  5BNX A;  5G49 B;  1BFM A;  5AV8 C;  3AZG A;  1ZLA B;  3B0C T;  5GSU C;  5B31 D;  5B2I C;  3AZJ A;  5BNX B;  3AZF A;  1P3A A;  5GT3 D;  3AZG B;  3WTP B;  4CAY A;  4WU9 D;  1P3O C;  5E5A B;  3MGP C;  1P3M B;  1H3O A;  5AV9 C;  3AZF B;  4JJN C;  5B1L D;  4H9O B;  4NE5 A;  1KU5 A;  4CAY B;  3W99 A;  3W96 B;  1BH8 B;  4YS3 C;  3X1T C;  5CPK B;  5CHL B;  3W99 B;  5GT0 C;  4M6B A;  3AZM C;  1JFI B;  4H9R B;  1ULY A;  4ZUX C;  2F8N K;  3LJA A;  3WA9 C;  3VH6 W;  4WNN B;  3REJ A;  5B0Z C;  3AFA A;  5CPJ A;  2NQB A;  3AYW A;  4H9S A;  5B31 C;  5B40 B;  4YM6 C;  5BT1 D;  3REJ B;  5B32 B;  1TAF A;  3B6F B;  3AFA B;  3X1V A;  5CPJ B;  3NQU A;  5GT3 C;  5B2J A;  3AYW B;  3C1C D;  1P3I A;  5DNM C;  3AZI C;  5B1M C;  3MNN C;  1TAF B;  3X1V B;  1P3K A;  5B2J B;  1P3I B;  2PYO B;  1P3K B;  4G91 C;  3UTA A;  5DNN B;  4J8W A;  3AZJ D;  1P3A D;  4J8U B;  2HUE C;  3REL C;  4J8W B;  5AV8 A;  1N1J A;  3W99 D;  5GSU A;  1B6W A;  5B2I A;  4J8V A;  3MGS B;  5BT1 C;  1P3O A;  5GSU B;  5B2I B;  3MGP A;  4G92 C;  3KXB B;  3C1C C;  5F99 C; 
#chains in the Genus database with same CATH topology
 3LJA D;  5AVC A;  1P3O B;  2ARO C;  4YS3 A;  2CWE A;  3X1T A;  3MGP B;  5AV9 B;  4JJN B;  5AV5 C;  3REJ D;  4X23 C;  3AFA D;  5CPJ D;  5GT0 A;  3AZM A;  3X1T B;  4YS3 B;  1P3L A;  2NQB D;  4ZUX A;  3AYW D;  4KUD D;  3X1V D;  2Y2J A;  5GT0 B;  2UWX A;  3AZM B;  1P3A C;  5B2J D;  5B0Z A;  3WTP E;  3REK C;  3W97 A;  3WA9 B;  1HQ3 A;  1P3K D;  3LEL C;  2VQR A;  4YM6 A;  2F8N A;  3AZE C;  1M19 A;  5B31 B;  5DNM A;  5B1M A;  3AZI A;  5CP6 C;  3MNN A;  3UTA D;  4J8W D;  5GT3 B;  5DNM B;  5B1M B;  1KX3 C;  4CSR A;  3X1S C;  5B1L B;  5AV8 D;  1P3P C;  5B2I D;  4J8V D;  4KUD C;  3EPJ A;  2BYM B;  1M1A D;  2FFF B;  5FUG A;  1P3O D;  1P3F A;  3REL A;  3MVD A;  3MGP D;  4DRA A;  4KHA B;  5AVB C;  3EPL A;  1R4V A;  5AVC D;  2CV5 C;  4YS3 D;  3X1T D;  4WJ3 C;  1KX4 C;  1P3B C;  3B0D C;  3AZM D;  5B31 G;  1P3L D;  5F99 A;  4ZUX D;  3WKJ C;  5JA4 A;  3LZ1 C;  2ARO A;  4G92 B;  3C1C B;  3AN2 C;  5AV5 A;  1BH9 A;  1TZY C;  3A6N C;  4X23 A;  3AV2 C;  5B0Z D;  3C1B D;  2ARO B;  3W97 D;  3MGQ C;  1HQ3 D;  5AY8 C;  5AV5 B;  1BH9 B;  4YM6 D;  4J8V C;  4X23 B;  2F8N D;  2BYK A;  1M1A C;  1M19 D;  3AZL C;  5DNM D;  4HGA C;  5B1M D;  5B33 C;  3AZI D;  3MNN D;  3REK A;  3AZJ B;  2BYK B;  1P3A B;  3LEL A;  2F8N H;  5AVC C;  1H3O B;  3TU4 C;  3AZE A;  4Z66 C;  5AV6 C;  3LEL B;  5CP6 A;  1KX5 A;  5CPI C;  1P3L C;  2NZD A;  3AZK C;  3AZE B;  2JSS A;  4Z5T A;  4J8X C;  5CP6 B;  4XUJ C;  3FDD A;  1P3F D;  3REL D;  2RVQ D;  1KX3 A;  3X1S A;  3MVD D;  1P3P A;  3LJA B;  2ZY5 A;  3AZH C;  2L5A A;  3C1B C;  3LZ0 C;  3W97 C;  1HQ3 C;  1KX3 B;  4KUD A;  3X1S B;  4AWL C;  1ID3 C;  2YFW A;  3IP4 C;  3VH5 T;  3AZN C;  1M18 C;  2NQB B;  4WZS B;  1M19 C;  3UT9 A;  4KUD B;  5F99 D;  2Y2H A;  5AVB A;  2ARO D;  2CV5 A;  3NQU B;  5AV5 D;  5AVB B;  4X23 D;  1KX4 A;  3A1I A;  2Y2L A;  2CV5 B;  1P3B A;  2Y2M A;  5BO0 A;  3WKJ A;  3LZ1 A;  3B0D B;  3AV1 A;  3AN2 A;  1TZY A;  3A6N A;  3NQJ A;  3UTA B;  2XD5 A;  2DQN C;  3LZ1 B;  2RVQ C;  3AV2 A;  3REK D;  3MVD C;  1P3F C;  4KGC C;  4LD9 C;  3MGQ A;  1S32 A;  3LEL D;  5AY8 A;  3AN2 B;  3NQJ B;  3AV2 B;  2LY8 A;  2BG1 A;  1M1A A;  5AV8 B;  3MGQ B;  3AZE D;  3AZL A;  1N1J B;  5B33 A;  5AY8 B;  5CP6 D;  4J8V B;  1KX5 D;  3KUY C;  2NZD D;  3O62 A;  1M1A B;  4WV4 B;  4Z5T D;  4HGA B;  5B33 B;  1KX3 D;  3X1S D;  3TU4 A;  4Z66 A;  5AV6 A;  1P3P D;  5AVC B;  5CPI A;  2J8P A;  3AZK A;  4QLC C;  1EQZ C;  5AV6 B;  4J8X A;  4XUJ A;  5B0Y C;  1P3L B;  1P3G C;  4ZUX B;  3UT9 D;  3AZH A;  5AVB D;  3C1B A;  4J8X B;  3LZ0 A;  3KWQ C;  4XUJ B;  1U35 C;  1F66 C;  2CV5 D;  5KDM A;  3B0C W;  1ID3 A;  3AZN A;  5B0Z B;  3AZH B;  3C1B B;  1M18 A;  3LZ0 B;  1KX4 D;  3W97 B;  1P3B D;  1HQ3 B;  1B67 A;  1ZLA C;  3VH6 T;  4AWL B;  3WKJ D;  4YM6 B;  1ID3 B;  1KX5 C;  3V9R A;  3LZ1 D;  2FJ7 A;  2NZD C;  3MGR C;  2F8N B;  1AOI C;  1M19 B;  3AV1 D;  4Z5T C;  3AZI B;  3AN2 D;  1TZY D;  3A6N D;  3MNN B;  4DRB A;  3X1U A;  3AV2 D;  3MGQ D;  1S32 D;  5AY8 D;  5GXQ A;  1P34 D;  4CSR B;  4G91 B;  3A1K A;  3AZL D;  5B33 D;  2DF4 C;  4KGC A;  5B24 A;  4LD9 A;  3UT9 C;  3O62 D;  2HUE B;  5FUG B;  1P3F B;  3REI C;  3REL B;  5JRG C;  3MVD B;  4KGC B;  3TU4 D;  4Z66 D;  5BS7 C;  5AV6 D;  4NE6 A;  2Y2O A;  5CPI D;  3KUY A;  4R8P A;  2F2A C;  4H9Q A;  3AZK D;  4H9P A;  2F8N G;  5B32 C;  4J8X D;  3B6F C;  4XUJ D;  4Z2M H;  3AL0 C;  3KUY B;  3AV1 C;  1WWI A;  5F99 B;  4H9Q B;  4UUZ A;  4H9P B;  3F6T A;  5JA4 B;  3AZH D;  3LZ0 D;  1S32 C;  3UTB A;  1EQZ A;  4QLC A;  4WU8 A;  1ID3 D;  2W8S A;  5C3I C;  3AZN D;  5B0Y A;  1P34 C;  1M18 D;  2G5H C;  5BNV A;  4XZQ A;  1P3G A;  4ZBJ C;  3B0B A;  4QLC B;  1U35 A;  2FJ7 D;  1F66 A;  3KWQ A;  3O62 C;  3REH C;  1P3G B;  2HIO A;  3W98 A;  3REK B;  3X1U D;  1F66 B;  3EG5 B;  1ZLA A;  5GXQ D;  3MGS C;  3WAA C;  3MGR A;  1AOI A;  3WTP A;  4NFT A;  2JE5 A;  1KX5 B;  5E5A A;  1P3M A;  2NZD B;  3KXB C;  3MGR B;  1AOI B;  5B24 D;  4KGC D;  4LD9 D;  4H9O A;  4Z5T B;  3W96 A;  1BH8 A;  3H0M C;  1P3P B;  5CPK A;  1JFI A;  2IO5 C;  4R8P D;  4H9R A;  3KUY D;  2YFW B;  2FJ7 C;  4H9N A;  3REI A;  5JRG A;  3B6G C;  1A7W A;  3UT9 B;  4WNN A;  5BS7 A;  3X1U C;  4E44 A;  4H9N B;  1HTA A;  3REI B;  5JRG B;  3UTB D;  1EQZ D;  4QLC D;  5B40 A;  4WU8 D;  5GXQ C;  5B32 A;  3B6F A;  5B0Y D;  1KX4 B;  1P3B B;  1P3G D;  4XZQ D;  5BO0 B;  3WKJ B;  1U35 D;  2ZY4 A;  1F66 D;  3KWQ D;  5B24 C;  2ZM5 A;  3AV1 B;  1F1E A;  1TZY B;  3A6N B;  4WU9 C;  2PYO A;  2HIO D;  1P34 A;  3W98 D;  2YFV A;  1S32 B;  5B1L C;  1ZLA D;  5DNN A;  5C3I B;  4R8P C;  1P34 B;  3MGR D;  1AOI D;  2YFV B;  3VH5 A;  3REH A;  4J8U A;  4ZBJ B;  3AZG D;  3WTP D;  3AZL B;  3KSY A;  5E5A D;  1P3M D;  3O62 B;  2G5I C;  3REH B;  4NE3 A;  3AZF D;  3W96 D;  3MGS A;  3WAA A;  4EO5 C;  2Y2Q A;  3UTB C;  2Y2N A;  3TU4 B;  4WU8 C;  4Z66 B;  5CPK D;  5CPI B;  4E45 A;  3WAA B;  4XZQ C;  3KXB A;  3AZK B;  5B32 G;  2XD1 A;  3H0R C;  4UPK A;  3REI D;  5JRG D;  5AV9 A;  4JJN A;  2HIO C;  3W98 C;  5KDM B;  5B40 D;  3AZN B;  2Y2G A;  5B32 D;  1M18 B;  2Y2P A;  3B6F D;  3B6G A;  2IO5 B;  3AZG C;  3WTP C;  2FJ7 B;  3V9R B;  5E5A C;  1P3M C;  3WA9 A;  3AZJ C;  3AZF C;  3B6G B;  3W96 C;  1P3I D;  3X1U B;  2PYO D;  4Z2M G;  5B31 A;  5CPK C;  3W99 C;  3EPH A;  1WWS A;  5GXQ B;  5DNN D;  2JCH A;  5GT3 A;  3REH D;  4J8U D;  4WU9 A;  5B24 B;  4LD9 B;  5B1L A;  3LJA C;  3VH5 W;  4WU9 B;  3MGS D;  3WAA D;  2BYM A;  5B40 C;  3REJ C;  5GSU D;  3AFA C;  5CPJ C;  2NQB C;  2ZY3 A;  1Z2C B;  3VH6 A;  4R8P B;  3KXB D;  4H9S C;  3AYW C;  4KHA A;  2RIQ A;  3X1V C;  5B2J C;  5AV9 D;  1P3I C;  4UUZ B;  4JJN D;  2PYO C;  2Y2I A;  4EO5 B;  3UTB B;  1P3K C;  1EQZ B;  1Q9C A;  4WU8 B;  5DNN C;  5B0Y B;  3H0L C;  5BNV B;  4XZQ B;  5GT0 D;  3EPK A;  3C1C A;  4J8U C;  3B6G D;  3UTA C;  1U35 B;  3R45 A;  3KWQ B;  4J8W C;  5G49 A;  3WA9 D;  2HIO B;  3W98 B;  3R45 B;  5BNX A;  5G49 B;  1BFM A;  5AV8 C;  3AZG A;  1ZLA B;  1T3U A;  3B0C T;  5GSU C;  5B31 D;  5B2I C;  4DQY B;  3AZJ A;  5BNX B;  3AZF A;  1P3A A;  5GT3 D;  3AZG B;  3WTP B;  4CAY A;  4WU9 D;  1P3O C;  5E5A B;  3MGP C;  1P3M B;  1H3O A;  5AV9 C;  2ZY2 A;  4JJN C;  3AZF B;  5B1L D;  4H9O B;  4NE5 A;  1KU5 A;  4CAY B;  3W99 A;  3W96 B;  1BH8 B;  4YS3 C;  3X1T C;  5CPK B;  5CHL B;  3W99 B;  5GT0 C;  4M6B A;  3AZM C;  1JFI B;  4H9R B;  1ULY A;  4ZUX C;  2F8N K;  3LJA A;  3WA9 C;  3VH6 W;  4WNN B;  3REJ A;  5B0Z C;  3AFA A;  5CPJ A;  2NQB A;  3AYW A;  4H9S A;  5B31 C;  3P5J B;  5B40 B;  4YM6 C;  5BT1 D;  3REJ B;  5B32 B;  1TAF A;  3B6F B;  3AFA B;  3X1V A;  5CPJ B;  3NQU A;  5GT3 C;  5B2J A;  3AYW B;  1W2E A;  3C1C D;  1P3I A;  5DNM C;  3AZI C;  5B1M C;  3MNN C;  2Y2K A;  1TAF B;  3X1V B;  1P3K A;  5B2J B;  1P3I B;  3KFU G;  2PYO B;  1P3K B;  4G91 C;  3UTA A;  5DNN B;  4J8W A;  3AZJ D;  1P3A D;  4J8U B;  2HUE C;  3REL C;  4J8W B;  5AV8 A;  1N1J A;  3W99 D;  5GSU A;  1B6W A;  5B2I A;  4J8V A;  3MGS B;  1PZR A;  5BT1 C;  1P3O A;  5GSU B;  5B2I B;  3MGP A;  4G92 C;  3KXB B;  3C1C C;  5F99 C; 
#chains in the Genus database with same CATH homology
 3LJA D;  5AVC A;  1P3O B;  2ARO C;  4YS3 A;  2CWE A;  3X1T A;  3MGP B;  5AV9 B;  4JJN B;  5AV5 C;  3REJ D;  4X23 C;  3AFA D;  5CPJ D;  5GT0 A;  3AZM A;  3X1T B;  4YS3 B;  1P3L A;  2NQB D;  4ZUX A;  3AYW D;  4KUD D;  3X1V D;  2Y2J A;  5GT0 B;  2UWX A;  3AZM B;  1P3A C;  5B2J D;  5B0Z A;  3WTP E;  3REK C;  3W97 A;  3WA9 B;  1HQ3 A;  1P3K D;  3LEL C;  2VQR A;  4YM6 A;  2F8N A;  3AZE C;  1M19 A;  5B31 B;  5DNM A;  5B1M A;  3AZI A;  5CP6 C;  3MNN A;  3UTA D;  4J8W D;  5GT3 B;  5DNM B;  5B1M B;  1KX3 C;  4CSR A;  3X1S C;  5B1L B;  5AV8 D;  1P3P C;  5B2I D;  4J8V D;  4KUD C;  3EPJ A;  2BYM B;  1M1A D;  2FFF B;  5FUG A;  1P3O D;  1P3F A;  3REL A;  3MVD A;  3MGP D;  4DRA A;  4KHA B;  5AVB C;  3EPL A;  1R4V A;  5AVC D;  2CV5 C;  4YS3 D;  3X1T D;  4WJ3 C;  1KX4 C;  1P3B C;  3B0D C;  3AZM D;  5B31 G;  1P3L D;  5F99 A;  4ZUX D;  3WKJ C;  5JA4 A;  3LZ1 C;  2ARO A;  4G92 B;  3C1C B;  3AN2 C;  5AV5 A;  1BH9 A;  1TZY C;  3A6N C;  4X23 A;  3AV2 C;  5B0Z D;  3C1B D;  2ARO B;  3W97 D;  3MGQ C;  1HQ3 D;  5AY8 C;  5AV5 B;  1BH9 B;  4YM6 D;  4J8V C;  4X23 B;  2F8N D;  2BYK A;  1M1A C;  1M19 D;  3AZL C;  5DNM D;  4HGA C;  5B1M D;  5B33 C;  3AZI D;  3MNN D;  3REK A;  3AZJ B;  2BYK B;  1P3A B;  3LEL A;  2F8N H;  5AVC C;  1H3O B;  3TU4 C;  3AZE A;  4Z66 C;  5AV6 C;  3LEL B;  5CP6 A;  1KX5 A;  5CPI C;  1P3L C;  2NZD A;  3AZK C;  3AZE B;  2JSS A;  4Z5T A;  4J8X C;  5CP6 B;  4XUJ C;  3FDD A;  1P3F D;  3REL D;  2RVQ D;  1KX3 A;  3X1S A;  3MVD D;  1P3P A;  3LJA B;  2ZY5 A;  3AZH C;  2L5A A;  3C1B C;  3LZ0 C;  3W97 C;  1HQ3 C;  1KX3 B;  4KUD A;  3X1S B;  4AWL C;  1ID3 C;  2YFW A;  3IP4 C;  3VH5 T;  3AZN C;  1M18 C;  2NQB B;  4WZS B;  1M19 C;  3UT9 A;  4KUD B;  5F99 D;  2Y2H A;  5AVB A;  2ARO D;  2CV5 A;  3NQU B;  5AV5 D;  5AVB B;  4X23 D;  1KX4 A;  3A1I A;  2Y2L A;  2CV5 B;  1P3B A;  2Y2M A;  5BO0 A;  3WKJ A;  3LZ1 A;  3B0D B;  3AV1 A;  3AN2 A;  1TZY A;  3A6N A;  3NQJ A;  3UTA B;  2XD5 A;  2DQN C;  3LZ1 B;  2RVQ C;  3AV2 A;  3REK D;  3MVD C;  1P3F C;  4KGC C;  4LD9 C;  3MGQ A;  1S32 A;  3LEL D;  5AY8 A;  3AN2 B;  3NQJ B;  3AV2 B;  2LY8 A;  2BG1 A;  1M1A A;  5AV8 B;  3MGQ B;  3AZE D;  3AZL A;  1N1J B;  5B33 A;  5AY8 B;  5CP6 D;  4J8V B;  1KX5 D;  3KUY C;  2NZD D;  3O62 A;  1M1A B;  4WV4 B;  4Z5T D;  4HGA B;  5B33 B;  1KX3 D;  3X1S D;  3TU4 A;  4Z66 A;  5AV6 A;  1P3P D;  5AVC B;  5CPI A;  2J8P A;  3AZK A;  4QLC C;  1EQZ C;  5AV6 B;  4J8X A;  4XUJ A;  5B0Y C;  1P3L B;  1P3G C;  4ZUX B;  3UT9 D;  3AZH A;  5AVB D;  3C1B A;  4J8X B;  3LZ0 A;  3KWQ C;  4XUJ B;  1U35 C;  1F66 C;  2CV5 D;  5KDM A;  3B0C W;  1ID3 A;  3AZN A;  5B0Z B;  3AZH B;  3C1B B;  1M18 A;  3LZ0 B;  1KX4 D;  3W97 B;  1P3B D;  1HQ3 B;  1B67 A;  1ZLA C;  3VH6 T;  4AWL B;  3WKJ D;  4YM6 B;  1ID3 B;  1KX5 C;  3V9R A;  3LZ1 D;  2FJ7 A;  2NZD C;  3MGR C;  2F8N B;  1AOI C;  1M19 B;  3AV1 D;  4Z5T C;  3AZI B;  3AN2 D;  1TZY D;  3A6N D;  3MNN B;  4DRB A;  3X1U A;  3AV2 D;  3MGQ D;  1S32 D;  5AY8 D;  5GXQ A;  1P34 D;  4CSR B;  4G91 B;  3A1K A;  3AZL D;  5B33 D;  2DF4 C;  4KGC A;  5B24 A;  4LD9 A;  3UT9 C;  3O62 D;  2HUE B;  5FUG B;  1P3F B;  3REI C;  3REL B;  5JRG C;  3MVD B;  4KGC B;  3TU4 D;  4Z66 D;  5BS7 C;  5AV6 D;  4NE6 A;  2Y2O A;  5CPI D;  3KUY A;  4R8P A;  2F2A C;  4H9Q A;  3AZK D;  4H9P A;  2F8N G;  5B32 C;  4J8X D;  3B6F C;  4XUJ D;  4Z2M H;  3AL0 C;  3KUY B;  3AV1 C;  1WWI A;  5F99 B;  4H9Q B;  4UUZ A;  4H9P B;  3F6T A;  5JA4 B;  3AZH D;  3LZ0 D;  1S32 C;  3UTB A;  1EQZ A;  4QLC A;  4WU8 A;  1ID3 D;  2W8S A;  5C3I C;  3AZN D;  5B0Y A;  1P34 C;  1M18 D;  2G5H C;  5BNV A;  4XZQ A;  1P3G A;  4ZBJ C;  3B0B A;  4QLC B;  1U35 A;  2FJ7 D;  1F66 A;  3KWQ A;  3O62 C;  3REH C;  1P3G B;  2HIO A;  3W98 A;  3REK B;  3X1U D;  1F66 B;  3EG5 B;  1ZLA A;  5GXQ D;  3MGS C;  3WAA C;  3MGR A;  1AOI A;  3WTP A;  4NFT A;  2JE5 A;  1KX5 B;  5E5A A;  1P3M A;  2NZD B;  3KXB C;  3MGR B;  1AOI B;  5B24 D;  4KGC D;  4LD9 D;  4H9O A;  4Z5T B;  3W96 A;  1BH8 A;  3H0M C;  1P3P B;  5CPK A;  1JFI A;  2IO5 C;  4R8P D;  4H9R A;  3KUY D;  2YFW B;  2FJ7 C;  4H9N A;  3REI A;  5JRG A;  3B6G C;  1A7W A;  3UT9 B;  4WNN A;  5BS7 A;  3X1U C;  4E44 A;  4H9N B;  1HTA A;  3REI B;  5JRG B;  3UTB D;  1EQZ D;  4QLC D;  5B40 A;  4WU8 D;  5GXQ C;  5B32 A;  3B6F A;  5B0Y D;  1KX4 B;  1P3B B;  1P3G D;  4XZQ D;  5BO0 B;  3WKJ B;  1U35 D;  2ZY4 A;  1F66 D;  3KWQ D;  5B24 C;  2ZM5 A;  3AV1 B;  1F1E A;  1TZY B;  3A6N B;  4WU9 C;  2PYO A;  2HIO D;  1P34 A;  3W98 D;  2YFV A;  1S32 B;  5B1L C;  1ZLA D;  5DNN A;  5C3I B;  4R8P C;  1P34 B;  3MGR D;  1AOI D;  2YFV B;  3VH5 A;  3REH A;  4J8U A;  4ZBJ B;  3AZG D;  3WTP D;  3AZL B;  3KSY A;  5E5A D;  1P3M D;  3O62 B;  2G5I C;  3REH B;  4NE3 A;  3AZF D;  3W96 D;  3MGS A;  3WAA A;  4EO5 C;  2Y2Q A;  3UTB C;  2Y2N A;  3TU4 B;  4WU8 C;  4Z66 B;  5CPK D;  5CPI B;  4E45 A;  3WAA B;  4XZQ C;  3KXB A;  3AZK B;  5B32 G;  2XD1 A;  3H0R C;  4UPK A;  3REI D;  5JRG D;  5AV9 A;  4JJN A;  2HIO C;  3W98 C;  5KDM B;  5B40 D;  3AZN B;  2Y2G A;  5B32 D;  1M18 B;  2Y2P A;  3B6F D;  3B6G A;  2IO5 B;  3AZG C;  3WTP C;  2FJ7 B;  3V9R B;  5E5A C;  1P3M C;  3WA9 A;  3AZJ C;  3AZF C;  3B6G B;  3W96 C;  1P3I D;  3X1U B;  2PYO D;  4Z2M G;  5B31 A;  5CPK C;  3W99 C;  3EPH A;  1WWS A;  5GXQ B;  5DNN D;  2JCH A;  5GT3 A;  3REH D;  4J8U D;  4WU9 A;  5B24 B;  4LD9 B;  5B1L A;  3LJA C;  3VH5 W;  4WU9 B;  3MGS D;  3WAA D;  2BYM A;  5B40 C;  3REJ C;  5GSU D;  3AFA C;  5CPJ C;  2NQB C;  2ZY3 A;  1Z2C B;  3VH6 A;  4R8P B;  3KXB D;  4H9S C;  3AYW C;  4KHA A;  2RIQ A;  3X1V C;  5B2J C;  5AV9 D;  1P3I C;  4UUZ B;  4JJN D;  2PYO C;  2Y2I A;  4EO5 B;  3UTB B;  1P3K C;  1EQZ B;  1Q9C A;  4WU8 B;  5DNN C;  5B0Y B;  3H0L C;  5BNV B;  4XZQ B;  5GT0 D;  3EPK A;  3C1C A;  4J8U C;  3B6G D;  3UTA C;  1U35 B;  3R45 A;  3KWQ B;  4J8W C;  5G49 A;  3WA9 D;  2HIO B;  3W98 B;  3R45 B;  5BNX A;  5G49 B;  1BFM A;  5AV8 C;  3AZG A;  1ZLA B;  1T3U A;  3B0C T;  5GSU C;  5B31 D;  5B2I C;  4DQY B;  3AZJ A;  5BNX B;  3AZF A;  1P3A A;  5GT3 D;  3AZG B;  3WTP B;  4CAY A;  4WU9 D;  1P3O C;  5E5A B;  3MGP C;  1P3M B;  1H3O A;  5AV9 C;  2ZY2 A;  4JJN C;  3AZF B;  5B1L D;  4H9O B;  4NE5 A;  1KU5 A;  4CAY B;  3W99 A;  3W96 B;  1BH8 B;  4YS3 C;  3X1T C;  5CPK B;  5CHL B;  3W99 B;  5GT0 C;  4M6B A;  3AZM C;  1JFI B;  4H9R B;  1ULY A;  4ZUX C;  2F8N K;  3LJA A;  3WA9 C;  3VH6 W;  4WNN B;  3REJ A;  5B0Z C;  3AFA A;  5CPJ A;  2NQB A;  3AYW A;  4H9S A;  5B31 C;  3P5J B;  5B40 B;  4YM6 C;  5BT1 D;  3REJ B;  5B32 B;  1TAF A;  3B6F B;  3AFA B;  3X1V A;  5CPJ B;  3NQU A;  5GT3 C;  5B2J A;  3AYW B;  1W2E A;  3C1C D;  1P3I A;  5DNM C;  3AZI C;  5B1M C;  3MNN C;  2Y2K A;  1TAF B;  3X1V B;  1P3K A;  5B2J B;  1P3I B;  3KFU G;  2PYO B;  1P3K B;  4G91 C;  3UTA A;  5DNN B;  4J8W A;  3AZJ D;  1P3A D;  4J8U B;  2HUE C;  3REL C;  4J8W B;  5AV8 A;  1N1J A;  3W99 D;  5GSU A;  1B6W A;  5B2I A;  4J8V A;  3MGS B;  1PZR A;  5BT1 C;  1P3O A;  5GSU B;  5B2I B;  3MGP A;  4G92 C;  3KXB B;  3C1C C;  5F99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...