3MVDA

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdA00
3X1TC 3R45B 4Z66C 5AVCC 1P3PA 3UT9B 3MGRA 2F8NA 5B32A 3C1CD 3UTBC 3AZLC 4J8XB 5AV9B 5BO0A 1P3GC 5GT3D 2HIOD 3LZ1B 3KWQC 1M1AD 1M18D 5B40A 1P3AB 2FJ7C 5B1LC 1ID3C 5DNND 3X1SB 3AN2B 3W98D 5CPIA 3REID 1H3OB 3WKJB 5AV8C 1KX3C 3MGRC 3UTAC 4Z5TB 4ZUXA 1ZLAB 3MGQD 3MVDD 2PYOB 3W97D 4KGCB 3AV1D 3NQJA 3AZHB 3AZGD 4CSRB 3LJAA 1U35C 1P3FB 5DNMB 3R45A 3RELB 5CPIC 3UT9A 5JRGD 5B2IB 4EO5C 1HQ3C 4J8XA 5AV9A 5GT0C 3WAAC 3B0CW 4ZUXC 5AVBD 4UUZB 5B0ZD 3LZ1A 5CP6B 4KHAB 2NZDC 1P3AA 3W99B 4E44A 3TU4D 3X1SA 3B0DB 4H9OA 3LJAC 3AN2A 4XUJD 3KUYC 1H3OA 3WKJA 4LD9D 5JA4B 4Z5TA 5GT3B 2HIOB 5AV9C 2L5AA 1M1AB 1ZLAA 5C3IB 2PYOA 4KGCA 1N1JB 3AZMD 1P3KC 3AZHA 5DNNB 1ULYA 4CSRA 3W98B 3X1UC 3REKB 2NQBD 3REIB 3AZJD 5DNMA 3RELA 1P3OD 4H9NB 5B0YD 4J8VC 3REJC 5B2IA 5B2JD 4Z2MH 4Z5TC 3X1VC 3MGQB 3MVDB 4QLCC 4UUZA 2HUEC 5G49B 4H9SA 3V9RB 5CP6A 2PYOC 3WTPC 3W97B 3AV1B 4H9RB 3AZGB 3W99A 4KUDC 5B31G 5F99D 3LELD 5AV5B 3AYWD 5JRGB 4WU8B 3AV2C 5CPJC 5JA4A 5B2IC 5B33D 4J8UC 5GT3A 2HIOA 5B0ZB 1TAFB 5B24C 4AWLB 3WA9D 1M1AA 2JSSA 3MNND 2RVQC 5CP6C 1M19B 2AROD 1N1JA 1BH9B 3REHD 3W99C 5DNNA 3TU4B 4WZSB 3W98A 5AY8D 3REKA 1KX4C 4XUJB 3REIA 4LD9B 3LZ0D 3AZNB 4H9NA 1Q9CA 1P3BC 5B31D 1P3IB 4WV4B 3MGQA 3MVDA 5G49A 3A6NB 3V9RA 5GXQA 3VH6A 3W97A 1P3LD 5E5AD 5GSUC 3W96B 4R8PB 3AV1A 4H9RA 4YM6D 3AZGA 4G92B 1P34C 3O62C 1F66B 1S32D 4ZBJB 1P3OB 5B0YB 3REKC 5AV5A 5JRGA 4WU8A 2LY8A 5B2JB 1KX5C 5B0ZA 1TAFA 2BYKB 4XZQB 4WU9D 1F1EA 2CV5B 3B6GB 5GXQC 3AZKD 1M19A 3AZFD 1AOID 1BH9A 3TU4A 3MGPD 5F99B 3AZID 4YS3C 4XUJA 3AYWB 5B1MD 4LD9A 3AZNA 5AV5C 3KXBD 4X23C 4WU8C 2IO5C 1P3IA 1EQZC 5BT1C 5B33B 3WA9B 4Z2MG 3NQUB 3MNNB 3A6NA 1P3PC 5B32C 3W96A 1P3MD 3REHB 4R8PA 3C1BD 3AFAB 1R4VA 1F66A 4JJND 5B0YA 3VH5A 5B40C 1P3OA 3AZNC 4J8WD 5B2JA 3AZED 1P3IC 3MGSD 4G91C 2BYKA 4XZQA 2CV5A 3B6GA 1JFIB 1P3LB 5E5AB 4YM6B 1TZYD 3W96C 5BS7A 5CPKD 5AV6D 5F99A 1F66C 3AYWA 3B6FB 3X1TD 1HTAA 4Z66D 5AVCD 3UTBD 5B33A 3AZLD 3WA9A 4WU9B 1P3GD 4XZQC 3NQUA 3MNNA 3KWQD 3C1CB 3AZKB 3AZFB 2CV5C 3UT9C 1AOIB 3B6GC 4J8XC 3REHA 2FJ7D 3MGPB 3AFAA 1M18B 5B1LD 5BS7C 1ID3D 3LZ1C 3KXBB 1P3AC 5AV8D 1KX3D 3MGRD 3UTAD 1P3FA 4H9PB 3AN2C 3X1SC 3WTPE 3WKJC 1JFIA 1P3LA 5E5AA 1P3MB 3C1BB 4YM6A 3AFAC 1ZLAC 4JJNB 1U35D 4KHAA 1A7WA 3B6FA 4J8WB 5CPID 4KGCC 3MGSB 1HQ3D 3AZHC 4WU9A 4CAYB 3VH6W 5GT0D 5CHLB 1P3FC 4ZUXD 5DNMC 3WAAD 3RELC 3C1CA 3AZKA 3AZFA 1AOIA 1TZYB 2NZDD 5AVBB 5CPKB 5AV6B 3MGPA 1M18A 3KSYA 3X1TB 4H9SC 1BFMA 3LJAD 5AVCB 3B6FC 3KXBA 3B0BA 3KUYD 2YFWB 3AZLB 2F8NH 4H9PA 5AV9D 3KWQB 3B0DC 4NE3A 2F8NK 1P3MA 3C1BA 2FJ7B 5B1LB 5GT3C 2HIOC 1ID3B 1P3KD 1M1AC 1M18C 4JJNA 5C3IC 3X1UD 4J8WA 5AV8B 4J8VD 1KU5A 3AZMB 1KX3B 3UTAB 5BNVB 3REJD 3MGSA 2NQBB 5DNNC 3AZJB 4Z5TD 5FUGB 4CAYA 3X1VD 3W98C 4QLCD 3REIC 2PYOD 3WTPD 1TZYA 5AVBA 5CPKA 3VH5W 5AV6A 3MGQC 3MVDC 4KUDD 1U35B 3X1TA 5AVCA 3W97C 3AV2D 4EO5B 2YFWA 1HQ3B 3AV1C 3AZGC 3AZLA 1WWSA 5CPJD 5B2ID 5GT0B 4J8UD 3LELB 1WWIA 3WAAB 5B24D 3KWQA 5JRGC 4NE5A 2RVQD 5CP6D 2NZDB 2FJ7A 5AVBC 5B0ZC 1ID3A 4AWLC 3W99D 3VH6T 3LJAB 1KX4D 2AROB 3KUYB 5KDMB 1M19C 1P3BD 5AV8A 3AZMA 1KX3A 3UTAA 5BNVA 4NE6A 5AY8B 2NQBA 3TU4C 2YFVB 3AZJA 3LZ0B 5FUGA 4H9QB 4XUJC 4LD9C 5B31B 1B67A 5GSUD 1P3KB 1P34D 3O62D 3X1UB 1U35A 3A6NC 4H9OB 3REKD 4J8VB 3REJB 3AZMC 4R8PC 1HQ3A 1S32B 4G92C 3X1VB 5GT0A 2NQBC 4QLCB 3AZJC 3LELA 5B32G 1KX5D 2F8NG 4ZBJC 2HUEB 5B0YC 2BYMB 1P3OC 3WAAA 3WTPB 4WNNB 5BNXB 5GXQD 2NZDA 5B2JC 4NFTA 4KUDB 4DRAA 4YS3D 2AROA 3KUYA 3AV2B 5KDMA 5AV5D 4X23D 4WU8D 5CPJB 3AZIB 1EQZD 5AY8A 5BT1D 4J8UB 3VH5T 2YFVA 5B1MB 5B24B 5F99C 3LZ0A 3LELC 4H9QA 3AYWC 5B31A 1P3PD 2F8ND 5B32D 1M19D 5B33C 3WA9C 1P3KA 3X1UA 1KX4B 3MNNC 1P3BB 5B40D 4M6BA 2AROC 4HGAB 4J8VA 3AZND 3REJA 3REHC 1S32A 3X1VA 1P3ID 5AY8C 4QLCA 3LZ0C 2BYMA 3WTPA 4WNNA 5B31C 5BNXA 3A6ND 3AZEB 5GSUB 1P34B 3O62B 3W96D 4KUDA 4R8PD 1F66D 1P3LC 3AV2A 5E5AC 4YM6C 4DRBA 5CPJA 3AZIA 1KX5B 4J8UA 1S32C 5B1MA 5B24A 4Z66B 4XZQD 5GXQB 3UTBB 2CV5D 3B6GD 3UT9D 1P3GB 4J8XD 4WU9C 1KX4A 3LZ1D 1BH8B 4YS3B 3C1CC 3AZKC 3AZFC 1P3BA 1AOIC 4X23B 2IO5B 1P3AD 1EQZB 3MGPC 3AZIC 5B1MC 3X1SD 3AN2D 1P3PB 3KXBC 3MGRB 2F8NB 5B32B 3AZEA 3WKJD 5GSUA 1P34A 5BO0B 3O62A 2CWEA 3AFAD 1ZLAD 3B0CT 5B40B 1P3MC 4HGAC 3C1BC 4KGCD 1KX5A 3AZHD 4G91B 4JJNC 5CPIB 4Z66A 1P3FD 5DNMD 3RELD 4J8WC 3UTBA 3AZEC 3MGSC 4ZUXB 1P3GA 4E45A 1BH8A 4YS3A 1B6WA 3B6FD 1TZYC 4X23A 5B1LA 1EQZA 5CPKC 3NQJB 5AV6C
chains in the Genus database with same CATH superfamily
2FFFB 3X1TC 3R45B 3KFUG 4Z66C 5AVCC 1P3PA 3UT9B 3MGRA 2F8NA 5B32A 3C1CD 3UTBC 2Y2PA 3AZLC 4J8XB 5AV9B 5BO0A 1P3GC 5GT3D 2HIOD 3LZ1B 3KWQC 1M1AD 1M18D 5B40A 1P3AB 3EG5B 2FJ7C 2Y2MA 5B1LC 3F6TA 1ID3C 5DNND 2JCHA 3X1SB 3AN2B 3W98D 5CPIA 3REID 1H3OB 1W2EA 3WKJB 5AV8C 1KX3C 3MGRC 3UTAC 4Z5TB 4ZUXA 3H0LC 3WAAA 1ZLAB 3MGQD 3MVDD 3P5JB 2PYOB 3W97D 4KGCB 3AV1D 3NQJA 3AZHB 3AZGD 4CSRB 3LJAA 1U35C 1P3FB 5DNMB 3R45A 3RELB 5CPIC 3UT9A 5JRGD 2RIQA 5B2IB 4EO5C 1HQ3C 4J8XA 5AV9A 5GT0C 4ZUXC 2ZY4A 3B0CW 3WAAC 4UUZB 5AVBD 5B0ZD 3LZ1A 5CP6B 4KHAB 2NZDC 1P3AA 3W99B 4E44A 3TU4D 3X1SA 3B0DB 4H9OA 3LJAC 3AN2A 4XUJD 3KUYC 1H3OA 3WKJA 4LD9D 5JA4B 4Z5TA 5GT3B 2HIOB 5AV9C 2L5AA 1M1AB 1ZLAA 5C3IB 2PYOA 1T3UA 4KGCA 1N1JB 3AZMD 1P3KC 3AZHA 5DNNB 1ULYA 2J8PA 4CSRA 3W98B 3X1UC 3REKB 2NQBD 3REIB 3AZJD 5DNMA 3RELA 3FDDA 4H9NB 2Y2GA 5B0YD 4J8VC 1P3OD 3REJC 5B2IA 5B2JD 4Z2MH 4Z5TC 3X1VC 3MGQB 3MVDB 4QLCC 4UUZA 2HUEC 5G49B 4H9SA 3V9RB 5CP6A 2PYOC 3WTPC 3W97B 3AV1B 4H9RB 3AZGB 3W99A 4KUDC 5B31G 5F99D 3LELD 5AV5B 3AYWD 5JRGB 4WU8B 2XD5A 3AV2C 5CPJC 5JA4A 5B2IC 5B33D 4J8UC 5GT3A 2HIOA 5B0ZB 1TAFB 5B24C 4AWLB 3WA9D 1M1AA 2JSSA 3MNND 2RVQC 5CP6C 1M19B 2AROD 1N1JA 1BH9B 3REHD 3W99C 5DNNA 3TU4B 4WZSB 3W98A 5AY8D 3REKA 1KX4C 4XUJB 3REIA 4LD9B 3LZ0D 3AZNB 4H9NA 1Q9CA 1P3BC 5B31D 1P3IB 4WV4B 3MGQA 3MVDA 2Y2HA 5G49A 3A6NB 3V9RA 5GXQA 3VH6A 3W97A 1P3LD 2Y2KA 5E5AD 5GSUC 3W96B 4R8PB 3AV1A 4H9RA 4YM6D 3AZGA 4G92B 1P34C 3O62C 1F66B 1S32D 4ZBJB 1P3OB 5B0YB 3REKC 5AV5A 5JRGA 4WU8A 3IP4C 2LY8A 5B2JB 1KX5C 5B0ZA 1TAFA 2BYKB 4XZQB 4WU9D 1F1EA 2CV5B 3B6GB 3AL0C 5GXQC 3AZKD 1M19A 3AZFD 1AOID 1BH9A 3EPKA 3TU4A 3MGPD 5F99B 3A1IA 3AZID 2ZM5A 4YS3C 4XUJA 3AYWB 5B1MD 4LD9A 3AZNA 5AV5C 3KXBD 4X23C 4WU8C 2IO5C 1P3IA 1EQZC 5BT1C 5B33B 3WA9B 4Z2MG 4UPKA 3NQUB 3MNNB 3A6NA 1P3PC 5B32C 3W96A 1P3MD 3REHB 4R8PA 3C1BD 3AFAB 1R4VA 1F66A 4JJND 5B0YA 3VH5A 5B40C 1P3OA 3AZNC 4J8WD 5B2JA 3AZED 1P3IC 3MGSD 4G91C 2BYKA 4XZQA 2CV5A 3B6GA 1JFIB 1P3LB 5E5AB 4YM6B 1TZYD 3W96C 5BS7A 3H0RC 5CPKD 5AV6D 5F99A 1F66C 3AYWA 3B6FB 3X1TD 1HTAA 4Z66D 5AVCD 2ZY2A 3UTBD 5B33A 3AZLD 3WA9A 4WU9B 1P3GD 4XZQC 3NQUA 3MNNA 3KWQD 3C1CB 3AZKB 3AZFB 2CV5C 3UT9C 1AOIB 3B6GC 4J8XC 3REHA 2FJ7D 3MGPB 3AFAA 1M18B 5B1LD 5BS7C 1ID3D 3LZ1C 2DF4C 3KXBB 1P3AC 5AV8D 1KX3D 3MGRD 3UTAD 2Y2JA 1P3FA 4H9PB 3AN2C 3X1SC 3WTPE 3WKJC 1JFIA 1P3LA 5E5AA 1P3MB 3C1BB 4YM6A 3EPHA 3AFAC 1ZLAC 4JJNB 1U35D 4KHAA 1A7WA 3B6FA 4J8WB 5CPID 4KGCC 3MGSB 1HQ3D 3AZHC 4WU9A 4CAYB 3VH6W 5GT0D 5CHLB 1P3FC 4ZUXD 5DNMC 3WAAD 3RELC 3C1CA 3AZKA 3AZFA 1AOIA 2Y2LA 1TZYB 2NZDD 3H0MC 5AVBB 5CPKB 5AV6B 3MGPA 1M18A 2G5IC 3KSYA 3X1TB 4H9SC 1BFMA 3LJAD 2XD1A 5AVCB 3B6FC 3KXBA 3B0BA 3KUYD 2YFWB 2JE5A 3AZLB 2F8NH 4H9PA 5AV9D 3KWQB 3B0DC 4NE3A 2F8NK 1P3MA 3C1BA 2FJ7B 5B1LB 5GT3C 2HIOC 1ID3B 1P3KD 1M1AC 1M18C 4JJNA 5C3IC 3X1UD 4J8WA 5AV8B 4J8VD 1KU5A 3AZMB 1KX3B 3UTAB 5BNVB 3REJD 1Z2CB 3MGSA 2NQBB 5DNNC 3AZJB 4Z5TD 5FUGB 4CAYA 3X1VD 3W98C 4QLCD 3REIC 2F2AC 2VQRA 2PYOD 3WTPD 1TZYA 5AVBA 5CPKA 3VH5W 5AV6A 3MGQC 3MVDC 4KUDD 1U35B 3X1TA 5AVCA 3W97C 2ZY5A 3AV2D 4EO5B 2YFWA 1HQ3B 3AV1C 4WJ3C 3AZGC 3AZLA 1WWSA 5CPJD 5B2ID 5GT0B 4J8UD 3LELB 1WWIA 3WAAB 5B24D 3KWQA 5JRGC 4NE5A 2RVQD 2Y2IA 5CP6D 2NZDB 2FJ7A 2DQNC 5AVBC 5B0ZC 1ID3A 4AWLC 3W99D 3VH6T 3LJAB 1PZRA 1KX4D 2AROB 3KUYB 5KDMB 1M19C 1P3BD 5AV8A 3AZMA 1KX3A 3UTAA 5BNVA 4NE6A 5AY8B 2NQBA 3TU4C 2YFVB 3AZJA 3LZ0B 5FUGA 4H9QB 4XUJC 3EPLA 4LD9C 2Y2OA 5B31B 1B67A 5GSUD 1P3KB 1P34D 3O62D 3X1UB 1U35A 3A6NC 4H9OB 3REKD 4J8VB 3REJB 2UWXA 3AZMC 4R8PC 1HQ3A 1S32B 4G92C 3X1VB 5GT0A 2NQBC 4QLCB 3AZJC 3LELA 5B32G 1KX5D 2F8NG 4ZBJC 2HUEB 2BYMB 5B0YC 2G5HC 1P3OC 3WTPB 4WNNB 5BNXB 5GXQD 2NZDA 5B2JC 4NFTA 4KUDB 4DRAA 3A1KA 4YS3D 2AROA 3KUYA 3AV2B 5KDMA 5AV5D 4X23D 4WU8D 5CPJB 3AZIB 1EQZD 5AY8A 5BT1D 4J8UB 3VH5T 2YFVA 5B1MB 5B24B 5F99C 3LZ0A 3LELC 4H9QA 3AYWC 5B31A 1P3PD 2F8ND 5B32D 1M19D 5B33C 3WA9C 1P3KA 3X1UA 1KX4B 3MNNC 1P3BB 5B40D 4M6BA 2AROC 4HGAB 4J8VA 3AZND 3REJA 3REHC 1S32A 3X1VA 1P3ID 5AY8C 4QLCA 3LZ0C 2BYMA 2W8SA 5B31C 2Y2QA 4WNNA 5BNXA 3WTPA 3A6ND 5GSUB 3AZEB 1P34B 3O62B 3W96D 4KUDA 4R8PD 3EPJA 1F66D 1P3LC 3AV2A 5E5AC 4YM6C 4DRBA 5CPJA 3AZIA 1KX5B 4J8UA 1S32C 5B1MA 5B24A 4Z66B 4XZQD 5GXQB 3UTBB 2CV5D 3B6GD 3UT9D 1P3GB 4J8XD 4WU9C 1KX4A 3LZ1D 1BH8B 4YS3B 3C1CC 3AZKC 3AZFC 1P3BA 1AOIC 4X23B 2IO5B 1P3AD 1EQZB 3MGPC 3AZIC 5B1MC 3X1SD 3AN2D 2Y2NA 1P3PB 3KXBC 3MGRB 2F8NB 5B32B 3AZEA 3WKJD 5GSUA 1P34A 5BO0B 3O62A 2CWEA 3AFAD 1ZLAD 3B0CT 5B40B 1P3MC 4HGAC 3C1BC 4KGCD 1KX5A 3AZHD 4G91B 4JJNC 5CPIB 4Z66A 1P3FD 5DNMD 3RELD 4J8WC 2ZY3A 3UTBA 3AZEC 3MGSC 4ZUXB 1P3GA 2BG1A 4E45A 1BH8A 4DQYB 4YS3A 1B6WA 3B6FD 1TZYC 4X23A 5B1LA 1EQZA 5CPKC 3NQJB 5AV6C
chains in the Genus database with same CATH topology
2FFFB 3X1TC 3R45B 3KFUG 4Z66C 5AVCC 1P3PA 3UT9B 3MGRA 2F8NA 5B32A 3C1CD 3UTBC 2Y2PA 3AZLC 4J8XB 5AV9B 5BO0A 1P3GC 5GT3D 2HIOD 3LZ1B 3KWQC 1M1AD 1M18D 5B40A 1P3AB 3EG5B 2FJ7C 2Y2MA 5B1LC 3F6TA 1ID3C 5DNND 2JCHA 3X1SB 3AN2B 3W98D 5CPIA 3REID 1H3OB 1W2EA 3WKJB 5AV8C 1KX3C 3MGRC 3UTAC 4Z5TB 4ZUXA 3H0LC 3WAAA 1ZLAB 3MGQD 3MVDD 3P5JB 2PYOB 3W97D 4KGCB 3AV1D 3NQJA 3AZHB 3AZGD 4CSRB 3LJAA 1U35C 1P3FB 5DNMB 3R45A 3RELB 5CPIC 3UT9A 5JRGD 2RIQA 5B2IB 4EO5C 1HQ3C 4J8XA 5AV9A 5GT0C 4ZUXC 2ZY4A 3B0CW 3WAAC 4UUZB 5AVBD 5B0ZD 3LZ1A 5CP6B 4KHAB 2NZDC 1P3AA 3W99B 4E44A 3TU4D 3X1SA 3B0DB 4H9OA 3LJAC 3AN2A 4XUJD 3KUYC 1H3OA 3WKJA 4LD9D 5JA4B 4Z5TA 5GT3B 2HIOB 5AV9C 2L5AA 1M1AB 1ZLAA 5C3IB 2PYOA 1T3UA 4KGCA 1N1JB 3AZMD 1P3KC 3AZHA 5DNNB 1ULYA 2J8PA 4CSRA 3W98B 3X1UC 3REKB 2NQBD 3REIB 3AZJD 5DNMA 3RELA 3FDDA 4H9NB 2Y2GA 5B0YD 4J8VC 1P3OD 3REJC 5B2IA 5B2JD 4Z2MH 4Z5TC 3X1VC 3MGQB 3MVDB 4QLCC 4UUZA 2HUEC 5G49B 4H9SA 3V9RB 5CP6A 2PYOC 3WTPC 3W97B 3AV1B 4H9RB 3AZGB 3W99A 4KUDC 5B31G 5F99D 3LELD 5AV5B 3AYWD 5JRGB 4WU8B 2XD5A 3AV2C 5CPJC 5JA4A 5B2IC 5B33D 4J8UC 5GT3A 2HIOA 5B0ZB 1TAFB 5B24C 4AWLB 3WA9D 1M1AA 2JSSA 3MNND 2RVQC 5CP6C 1M19B 2AROD 1N1JA 1BH9B 3REHD 3W99C 5DNNA 3TU4B 4WZSB 3W98A 5AY8D 3REKA 1KX4C 4XUJB 3REIA 4LD9B 3LZ0D 3AZNB 4H9NA 1Q9CA 1P3BC 5B31D 1P3IB 4WV4B 3MGQA 3MVDA 2Y2HA 5G49A 3A6NB 3V9RA 5GXQA 3VH6A 3W97A 1P3LD 2Y2KA 5E5AD 5GSUC 3W96B 4R8PB 3AV1A 4H9RA 4YM6D 3AZGA 4G92B 1P34C 3O62C 1F66B 1S32D 4ZBJB 1P3OB 5B0YB 3REKC 5AV5A 5JRGA 4WU8A 3IP4C 2LY8A 5B2JB 1KX5C 5B0ZA 1TAFA 2BYKB 4XZQB 4WU9D 1F1EA 2CV5B 3B6GB 3AL0C 5GXQC 3AZKD 1M19A 3AZFD 1AOID 1BH9A 3EPKA 3TU4A 3MGPD 5F99B 3A1IA 3AZID 2ZM5A 4YS3C 4XUJA 3AYWB 5B1MD 4LD9A 3AZNA 5AV5C 3KXBD 4X23C 4WU8C 2IO5C 1P3IA 1EQZC 5BT1C 5B33B 3WA9B 4Z2MG 4UPKA 3NQUB 3MNNB 3A6NA 1P3PC 5B32C 3W96A 1P3MD 3REHB 4R8PA 3C1BD 3AFAB 1R4VA 1F66A 4JJND 5B0YA 3VH5A 5B40C 1P3OA 3AZNC 4J8WD 5B2JA 3AZED 1P3IC 3MGSD 4G91C 2BYKA 4XZQA 2CV5A 3B6GA 1JFIB 1P3LB 5E5AB 4YM6B 1TZYD 3W96C 5BS7A 3H0RC 5CPKD 5AV6D 5F99A 1F66C 3AYWA 3B6FB 3X1TD 1HTAA 4Z66D 5AVCD 2ZY2A 3UTBD 5B33A 3AZLD 3WA9A 4WU9B 1P3GD 4XZQC 3NQUA 3MNNA 3KWQD 3C1CB 3AZKB 3AZFB 2CV5C 3UT9C 1AOIB 3B6GC 4J8XC 3REHA 2FJ7D 3MGPB 3AFAA 1M18B 5B1LD 5BS7C 1ID3D 3LZ1C 2DF4C 3KXBB 1P3AC 5AV8D 1KX3D 3MGRD 3UTAD 2Y2JA 1P3FA 4H9PB 3AN2C 3X1SC 3WTPE 3WKJC 1JFIA 1P3LA 5E5AA 1P3MB 3C1BB 4YM6A 3EPHA 3AFAC 1ZLAC 4JJNB 1U35D 4KHAA 1A7WA 3B6FA 4J8WB 5CPID 4KGCC 3MGSB 1HQ3D 3AZHC 4WU9A 4CAYB 3VH6W 5GT0D 5CHLB 1P3FC 4ZUXD 5DNMC 3WAAD 3RELC 3C1CA 3AZKA 3AZFA 1AOIA 2Y2LA 1TZYB 2NZDD 3H0MC 5AVBB 5CPKB 5AV6B 3MGPA 1M18A 2G5IC 3KSYA 3X1TB 4H9SC 1BFMA 3LJAD 2XD1A 5AVCB 3B6FC 3KXBA 3B0BA 3KUYD 2YFWB 2JE5A 3AZLB 2F8NH 4H9PA 5AV9D 3KWQB 3B0DC 4NE3A 2F8NK 1P3MA 3C1BA 2FJ7B 5B1LB 5GT3C 2HIOC 1ID3B 1P3KD 1M1AC 1M18C 4JJNA 5C3IC 3X1UD 4J8WA 5AV8B 4J8VD 1KU5A 3AZMB 1KX3B 3UTAB 5BNVB 3REJD 1Z2CB 3MGSA 2NQBB 5DNNC 3AZJB 4Z5TD 5FUGB 4CAYA 3X1VD 3W98C 4QLCD 3REIC 2F2AC 2VQRA 2PYOD 3WTPD 1TZYA 5AVBA 5CPKA 3VH5W 5AV6A 3MGQC 3MVDC 4KUDD 1U35B 3X1TA 5AVCA 3W97C 2ZY5A 3AV2D 4EO5B 2YFWA 1HQ3B 3AV1C 4WJ3C 3AZGC 3AZLA 1WWSA 5CPJD 5B2ID 5GT0B 4J8UD 3LELB 1WWIA 3WAAB 5B24D 3KWQA 5JRGC 4NE5A 2RVQD 2Y2IA 5CP6D 2NZDB 2FJ7A 2DQNC 5AVBC 5B0ZC 1ID3A 4AWLC 3W99D 3VH6T 3LJAB 1PZRA 1KX4D 2AROB 3KUYB 5KDMB 1M19C 1P3BD 5AV8A 3AZMA 1KX3A 3UTAA 5BNVA 4NE6A 5AY8B 2NQBA 3TU4C 2YFVB 3AZJA 3LZ0B 5FUGA 4H9QB 4XUJC 3EPLA 4LD9C 2Y2OA 5B31B 1B67A 5GSUD 1P3KB 1P34D 3O62D 3X1UB 1U35A 3A6NC 4H9OB 3REKD 4J8VB 3REJB 2UWXA 3AZMC 4R8PC 1HQ3A 1S32B 4G92C 3X1VB 5GT0A 2NQBC 4QLCB 3AZJC 3LELA 5B32G 1KX5D 2F8NG 4ZBJC 2HUEB 2BYMB 5B0YC 2G5HC 1P3OC 3WTPB 4WNNB 5BNXB 5GXQD 2NZDA 5B2JC 4NFTA 4KUDB 4DRAA 3A1KA 4YS3D 2AROA 3KUYA 3AV2B 5KDMA 5AV5D 4X23D 4WU8D 5CPJB 3AZIB 1EQZD 5AY8A 5BT1D 4J8UB 3VH5T 2YFVA 5B1MB 5B24B 5F99C 3LZ0A 3LELC 4H9QA 3AYWC 5B31A 1P3PD 2F8ND 5B32D 1M19D 5B33C 3WA9C 1P3KA 3X1UA 1KX4B 3MNNC 1P3BB 5B40D 4M6BA 2AROC 4HGAB 4J8VA 3AZND 3REJA 3REHC 1S32A 3X1VA 1P3ID 5AY8C 4QLCA 3LZ0C 2BYMA 2W8SA 5B31C 2Y2QA 4WNNA 5BNXA 3WTPA 3A6ND 5GSUB 3AZEB 1P34B 3O62B 3W96D 4KUDA 4R8PD 3EPJA 1F66D 1P3LC 3AV2A 5E5AC 4YM6C 4DRBA 5CPJA 3AZIA 1KX5B 4J8UA 1S32C 5B1MA 5B24A 4Z66B 4XZQD 5GXQB 3UTBB 2CV5D 3B6GD 3UT9D 1P3GB 4J8XD 4WU9C 1KX4A 3LZ1D 1BH8B 4YS3B 3C1CC 3AZKC 3AZFC 1P3BA 1AOIC 4X23B 2IO5B 1P3AD 1EQZB 3MGPC 3AZIC 5B1MC 3X1SD 3AN2D 2Y2NA 1P3PB 3KXBC 3MGRB 2F8NB 5B32B 3AZEA 3WKJD 5GSUA 1P34A 5BO0B 3O62A 2CWEA 3AFAD 1ZLAD 3B0CT 5B40B 1P3MC 4HGAC 3C1BC 4KGCD 1KX5A 3AZHD 4G91B 4JJNC 5CPIB 4Z66A 1P3FD 5DNMD 3RELD 4J8WC 2ZY3A 3UTBA 3AZEC 3MGSC 4ZUXB 1P3GA 2BG1A 4E45A 1BH8A 4DQYB 4YS3A 1B6WA 3B6FD 1TZYC 4X23A 5B1LA 1EQZA 5CPKC 3NQJB 5AV6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T C;  3R45 B;  4Z66 C;  5AVC C;  1P3P A;  3UT9 B;  3MGR A;  2F8N A;  5B32 A;  3C1C D;  3UTB C;  3AZL C;  4J8X B;  5AV9 B;  5BO0 A;  1P3G C;  5GT3 D;  2HIO D;  3LZ1 B;  3KWQ C;  1M1A D;  1M18 D;  5B40 A;  1P3A B;  2FJ7 C;  5B1L C;  1ID3 C;  5DNN D;  3X1S B;  3AN2 B;  3W98 D;  5CPI A;  3REI D;  1H3O B;  3WKJ B;  5AV8 C;  1KX3 C;  3MGR C;  3UTA C;  4Z5T B;  4ZUX A;  1ZLA B;  3MGQ D;  3MVD D;  2PYO B;  3W97 D;  4KGC B;  3AV1 D;  3NQJ A;  3AZH B;  3AZG D;  4CSR B;  3LJA A;  1U35 C;  1P3F B;  5DNM B;  3R45 A;  3REL B;  5CPI C;  3UT9 A;  5JRG D;  5B2I B;  4EO5 C;  1HQ3 C;  4J8X A;  5AV9 A;  5GT0 C;  3WAA C;  3B0C W;  4ZUX C;  5AVB D;  4UUZ B;  5B0Z D;  3LZ1 A;  5CP6 B;  4KHA B;  2NZD C;  1P3A A;  3W99 B;  4E44 A;  3TU4 D;  3X1S A;  3B0D B;  4H9O A;  3LJA C;  3AN2 A;  4XUJ D;  3KUY C;  1H3O A;  3WKJ A;  4LD9 D;  5JA4 B;  4Z5T A;  5GT3 B;  2HIO B;  5AV9 C;  2L5A A;  1M1A B;  1ZLA A;  5C3I B;  2PYO A;  4KGC A;  1N1J B;  3AZM D;  1P3K C;  3AZH A;  5DNN B;  1ULY A;  4CSR A;  3W98 B;  3X1U C;  3REK B;  2NQB D;  3REI B;  3AZJ D;  5DNM A;  3REL A;  1P3O D;  4H9N B;  5B0Y D;  4J8V C;  3REJ C;  5B2I A;  5B2J D;  4Z2M H;  4Z5T C;  3X1V C;  3MGQ B;  3MVD B;  4QLC C;  4UUZ A;  2HUE C;  5G49 B;  4H9S A;  3V9R B;  5CP6 A;  2PYO C;  3WTP C;  3W97 B;  3AV1 B;  4H9R B;  3AZG B;  3W99 A;  4KUD C;  5B31 G;  5F99 D;  3LEL D;  5AV5 B;  3AYW D;  5JRG B;  4WU8 B;  3AV2 C;  5CPJ C;  5JA4 A;  5B2I C;  5B33 D;  4J8U C;  5GT3 A;  2HIO A;  5B0Z B;  1TAF B;  5B24 C;  4AWL B;  3WA9 D;  1M1A A;  2JSS A;  3MNN D;  2RVQ C;  5CP6 C;  1M19 B;  2ARO D;  1N1J A;  1BH9 B;  3REH D;  3W99 C;  5DNN A;  3TU4 B;  4WZS B;  3W98 A;  5AY8 D;  3REK A;  1KX4 C;  4XUJ B;  3REI A;  4LD9 B;  3LZ0 D;  3AZN B;  4H9N A;  1Q9C A;  1P3B C;  5B31 D;  1P3I B;  4WV4 B;  3MGQ A;  3MVD A;  5G49 A;  3A6N B;  3V9R A;  5GXQ A;  3VH6 A;  3W97 A;  1P3L D;  5E5A D;  5GSU C;  3W96 B;  4R8P B;  3AV1 A;  4H9R A;  4YM6 D;  3AZG A;  4G92 B;  1P34 C;  3O62 C;  1F66 B;  1S32 D;  4ZBJ B;  1P3O B;  5B0Y B;  3REK C;  5AV5 A;  5JRG A;  4WU8 A;  2LY8 A;  5B2J B;  1KX5 C;  5B0Z A;  1TAF A;  2BYK B;  4XZQ B;  4WU9 D;  1F1E A;  2CV5 B;  3B6G B;  5GXQ C;  3AZK D;  1M19 A;  3AZF D;  1AOI D;  1BH9 A;  3TU4 A;  3MGP D;  5F99 B;  3AZI D;  4YS3 C;  4XUJ A;  3AYW B;  5B1M D;  4LD9 A;  3AZN A;  5AV5 C;  3KXB D;  4X23 C;  4WU8 C;  2IO5 C;  1P3I A;  1EQZ C;  5BT1 C;  5B33 B;  3WA9 B;  4Z2M G;  3NQU B;  3MNN B;  3A6N A;  1P3P C;  5B32 C;  3W96 A;  1P3M D;  3REH B;  4R8P A;  3C1B D;  3AFA B;  1R4V A;  1F66 A;  4JJN D;  5B0Y A;  3VH5 A;  5B40 C;  1P3O A;  3AZN C;  4J8W D;  5B2J A;  3AZE D;  1P3I C;  3MGS D;  4G91 C;  2BYK A;  4XZQ A;  2CV5 A;  3B6G A;  1JFI B;  1P3L B;  5E5A B;  4YM6 B;  1TZY D;  3W96 C;  5BS7 A;  5CPK D;  5AV6 D;  5F99 A;  1F66 C;  3AYW A;  3B6F B;  3X1T D;  1HTA A;  4Z66 D;  5AVC D;  3UTB D;  5B33 A;  3AZL D;  3WA9 A;  4WU9 B;  1P3G D;  4XZQ C;  3NQU A;  3MNN A;  3KWQ D;  3C1C B;  3AZK B;  3AZF B;  2CV5 C;  3UT9 C;  1AOI B;  3B6G C;  4J8X C;  3REH A;  2FJ7 D;  3MGP B;  3AFA A;  1M18 B;  5B1L D;  5BS7 C;  1ID3 D;  3LZ1 C;  3KXB B;  1P3A C;  5AV8 D;  1KX3 D;  3MGR D;  3UTA D;  1P3F A;  4H9P B;  3AN2 C;  3X1S C;  3WTP E;  3WKJ C;  1JFI A;  1P3L A;  5E5A A;  1P3M B;  3C1B B;  4YM6 A;  3AFA C;  1ZLA C;  4JJN B;  1U35 D;  4KHA A;  1A7W A;  3B6F A;  4J8W B;  5CPI D;  4KGC C;  3MGS B;  1HQ3 D;  3AZH C;  4WU9 A;  4CAY B;  3VH6 W;  5GT0 D;  5CHL B;  1P3F C;  4ZUX D;  5DNM C;  3WAA D;  3REL C;  3C1C A;  3AZK A;  3AZF A;  1AOI A;  1TZY B;  2NZD D;  5AVB B;  5CPK B;  5AV6 B;  3MGP A;  1M18 A;  3KSY A;  3X1T B;  4H9S C;  1BFM A;  3LJA D;  5AVC B;  3B6F C;  3KXB A;  3B0B A;  3KUY D;  2YFW B;  3AZL B;  2F8N H;  4H9P A;  5AV9 D;  3KWQ B;  3B0D C;  4NE3 A;  2F8N K;  1P3M A;  3C1B A;  2FJ7 B;  5B1L B;  5GT3 C;  2HIO C;  1ID3 B;  1P3K D;  1M1A C;  1M18 C;  4JJN A;  5C3I C;  3X1U D;  4J8W A;  5AV8 B;  4J8V D;  1KU5 A;  3AZM B;  1KX3 B;  3UTA B;  5BNV B;  3REJ D;  3MGS A;  2NQB B;  5DNN C;  3AZJ B;  4Z5T D;  5FUG B;  4CAY A;  3X1V D;  3W98 C;  4QLC D;  3REI C;  2PYO D;  3WTP D;  1TZY A;  5AVB A;  5CPK A;  3VH5 W;  5AV6 A;  3MGQ C;  3MVD C;  4KUD D;  1U35 B;  3X1T A;  5AVC A;  3W97 C;  3AV2 D;  4EO5 B;  2YFW A;  1HQ3 B;  3AV1 C;  3AZG C;  3AZL A;  1WWS A;  5CPJ D;  5B2I D;  5GT0 B;  4J8U D;  3LEL B;  1WWI A;  3WAA B;  5B24 D;  3KWQ A;  5JRG C;  4NE5 A;  2RVQ D;  5CP6 D;  2NZD B;  2FJ7 A;  5AVB C;  5B0Z C;  1ID3 A;  4AWL C;  3W99 D;  3VH6 T;  3LJA B;  1KX4 D;  2ARO B;  3KUY B;  5KDM B;  1M19 C;  1P3B D;  5AV8 A;  3AZM A;  1KX3 A;  3UTA A;  5BNV A;  4NE6 A;  5AY8 B;  2NQB A;  3TU4 C;  2YFV B;  3AZJ A;  3LZ0 B;  5FUG A;  4H9Q B;  4XUJ C;  4LD9 C;  5B31 B;  1B67 A;  5GSU D;  1P3K B;  1P34 D;  3O62 D;  3X1U B;  1U35 A;  3A6N C;  4H9O B;  3REK D;  4J8V B;  3REJ B;  3AZM C;  4R8P C;  1HQ3 A;  1S32 B;  4G92 C;  3X1V B;  5GT0 A;  2NQB C;  4QLC B;  3AZJ C;  3LEL A;  5B32 G;  1KX5 D;  2F8N G;  4ZBJ C;  2HUE B;  5B0Y C;  2BYM B;  1P3O C;  3WAA A;  3WTP B;  4WNN B;  5BNX B;  5GXQ D;  2NZD A;  5B2J C;  4NFT A;  4KUD B;  4DRA A;  4YS3 D;  2ARO A;  3KUY A;  3AV2 B;  5KDM A;  5AV5 D;  4X23 D;  4WU8 D;  5CPJ B;  3AZI B;  1EQZ D;  5AY8 A;  5BT1 D;  4J8U B;  3VH5 T;  2YFV A;  5B1M B;  5B24 B;  5F99 C;  3LZ0 A;  3LEL C;  4H9Q A;  3AYW C;  5B31 A;  1P3P D;  2F8N D;  5B32 D;  1M19 D;  5B33 C;  3WA9 C;  1P3K A;  3X1U A;  1KX4 B;  3MNN C;  1P3B B;  5B40 D;  4M6B A;  2ARO C;  4HGA B;  4J8V A;  3AZN D;  3REJ A;  3REH C;  1S32 A;  3X1V A;  1P3I D;  5AY8 C;  4QLC A;  3LZ0 C;  2BYM A;  3WTP A;  4WNN A;  5B31 C;  5BNX A;  3A6N D;  3AZE B;  5GSU B;  1P34 B;  3O62 B;  3W96 D;  4KUD A;  4R8P D;  1F66 D;  1P3L C;  3AV2 A;  5E5A C;  4YM6 C;  4DRB A;  5CPJ A;  3AZI A;  1KX5 B;  4J8U A;  1S32 C;  5B1M A;  5B24 A;  4Z66 B;  4XZQ D;  5GXQ B;  3UTB B;  2CV5 D;  3B6G D;  3UT9 D;  1P3G B;  4J8X D;  4WU9 C;  1KX4 A;  3LZ1 D;  1BH8 B;  4YS3 B;  3C1C C;  3AZK C;  3AZF C;  1P3B A;  1AOI C;  4X23 B;  2IO5 B;  1P3A D;  1EQZ B;  3MGP C;  3AZI C;  5B1M C;  3X1S D;  3AN2 D;  1P3P B;  3KXB C;  3MGR B;  2F8N B;  5B32 B;  3AZE A;  3WKJ D;  5GSU A;  1P34 A;  5BO0 B;  3O62 A;  2CWE A;  3AFA D;  1ZLA D;  3B0C T;  5B40 B;  1P3M C;  4HGA C;  3C1B C;  4KGC D;  1KX5 A;  3AZH D;  4G91 B;  4JJN C;  5CPI B;  4Z66 A;  1P3F D;  5DNM D;  3REL D;  4J8W C;  3UTB A;  3AZE C;  3MGS C;  4ZUX B;  1P3G A;  4E45 A;  1BH8 A;  4YS3 A;  1B6W A;  3B6F D;  1TZY C;  4X23 A;  5B1L A;  1EQZ A;  5CPK C;  3NQJ B;  5AV6 C; 
#chains in the Genus database with same CATH topology
 2FFF B;  3X1T C;  3R45 B;  3KFU G;  4Z66 C;  5AVC C;  1P3P A;  3UT9 B;  3MGR A;  2F8N A;  5B32 A;  3C1C D;  3UTB C;  2Y2P A;  3AZL C;  4J8X B;  5AV9 B;  5BO0 A;  1P3G C;  5GT3 D;  2HIO D;  3LZ1 B;  3KWQ C;  1M1A D;  1M18 D;  5B40 A;  1P3A B;  3EG5 B;  2FJ7 C;  2Y2M A;  5B1L C;  3F6T A;  1ID3 C;  5DNN D;  2JCH A;  3X1S B;  3AN2 B;  3W98 D;  5CPI A;  3REI D;  1H3O B;  1W2E A;  3WKJ B;  5AV8 C;  1KX3 C;  3MGR C;  3UTA C;  4Z5T B;  4ZUX A;  3H0L C;  3WAA A;  1ZLA B;  3MGQ D;  3MVD D;  3P5J B;  2PYO B;  3W97 D;  4KGC B;  3AV1 D;  3NQJ A;  3AZH B;  3AZG D;  4CSR B;  3LJA A;  1U35 C;  1P3F B;  5DNM B;  3R45 A;  3REL B;  5CPI C;  3UT9 A;  5JRG D;  2RIQ A;  5B2I B;  4EO5 C;  1HQ3 C;  4J8X A;  5AV9 A;  5GT0 C;  4ZUX C;  2ZY4 A;  3B0C W;  3WAA C;  4UUZ B;  5AVB D;  5B0Z D;  3LZ1 A;  5CP6 B;  4KHA B;  2NZD C;  1P3A A;  3W99 B;  4E44 A;  3TU4 D;  3X1S A;  3B0D B;  4H9O A;  3LJA C;  3AN2 A;  4XUJ D;  3KUY C;  1H3O A;  3WKJ A;  4LD9 D;  5JA4 B;  4Z5T A;  5GT3 B;  2HIO B;  5AV9 C;  2L5A A;  1M1A B;  1ZLA A;  5C3I B;  2PYO A;  1T3U A;  4KGC A;  1N1J B;  3AZM D;  1P3K C;  3AZH A;  5DNN B;  1ULY A;  2J8P A;  4CSR A;  3W98 B;  3X1U C;  3REK B;  2NQB D;  3REI B;  3AZJ D;  5DNM A;  3REL A;  3FDD A;  4H9N B;  2Y2G A;  5B0Y D;  4J8V C;  1P3O D;  3REJ C;  5B2I A;  5B2J D;  4Z2M H;  4Z5T C;  3X1V C;  3MGQ B;  3MVD B;  4QLC C;  4UUZ A;  2HUE C;  5G49 B;  4H9S A;  3V9R B;  5CP6 A;  2PYO C;  3WTP C;  3W97 B;  3AV1 B;  4H9R B;  3AZG B;  3W99 A;  4KUD C;  5B31 G;  5F99 D;  3LEL D;  5AV5 B;  3AYW D;  5JRG B;  4WU8 B;  2XD5 A;  3AV2 C;  5CPJ C;  5JA4 A;  5B2I C;  5B33 D;  4J8U C;  5GT3 A;  2HIO A;  5B0Z B;  1TAF B;  5B24 C;  4AWL B;  3WA9 D;  1M1A A;  2JSS A;  3MNN D;  2RVQ C;  5CP6 C;  1M19 B;  2ARO D;  1N1J A;  1BH9 B;  3REH D;  3W99 C;  5DNN A;  3TU4 B;  4WZS B;  3W98 A;  5AY8 D;  3REK A;  1KX4 C;  4XUJ B;  3REI A;  4LD9 B;  3LZ0 D;  3AZN B;  4H9N A;  1Q9C A;  1P3B C;  5B31 D;  1P3I B;  4WV4 B;  3MGQ A;  3MVD A;  2Y2H A;  5G49 A;  3A6N B;  3V9R A;  5GXQ A;  3VH6 A;  3W97 A;  1P3L D;  2Y2K A;  5E5A D;  5GSU C;  3W96 B;  4R8P B;  3AV1 A;  4H9R A;  4YM6 D;  3AZG A;  4G92 B;  1P34 C;  3O62 C;  1F66 B;  1S32 D;  4ZBJ B;  1P3O B;  5B0Y B;  3REK C;  5AV5 A;  5JRG A;  4WU8 A;  3IP4 C;  2LY8 A;  5B2J B;  1KX5 C;  5B0Z A;  1TAF A;  2BYK B;  4XZQ B;  4WU9 D;  1F1E A;  2CV5 B;  3B6G B;  3AL0 C;  5GXQ C;  3AZK D;  1M19 A;  3AZF D;  1AOI D;  1BH9 A;  3EPK A;  3TU4 A;  3MGP D;  5F99 B;  3A1I A;  3AZI D;  2ZM5 A;  4YS3 C;  4XUJ A;  3AYW B;  5B1M D;  4LD9 A;  3AZN A;  5AV5 C;  3KXB D;  4X23 C;  4WU8 C;  2IO5 C;  1P3I A;  1EQZ C;  5BT1 C;  5B33 B;  3WA9 B;  4Z2M G;  4UPK A;  3NQU B;  3MNN B;  3A6N A;  1P3P C;  5B32 C;  3W96 A;  1P3M D;  3REH B;  4R8P A;  3C1B D;  3AFA B;  1R4V A;  1F66 A;  4JJN D;  5B0Y A;  3VH5 A;  5B40 C;  1P3O A;  3AZN C;  4J8W D;  5B2J A;  3AZE D;  1P3I C;  3MGS D;  4G91 C;  2BYK A;  4XZQ A;  2CV5 A;  3B6G A;  1JFI B;  1P3L B;  5E5A B;  4YM6 B;  1TZY D;  3W96 C;  5BS7 A;  3H0R C;  5CPK D;  5AV6 D;  5F99 A;  1F66 C;  3AYW A;  3B6F B;  3X1T D;  1HTA A;  4Z66 D;  5AVC D;  2ZY2 A;  3UTB D;  5B33 A;  3AZL D;  3WA9 A;  4WU9 B;  1P3G D;  4XZQ C;  3NQU A;  3MNN A;  3KWQ D;  3C1C B;  3AZK B;  3AZF B;  2CV5 C;  3UT9 C;  1AOI B;  3B6G C;  4J8X C;  3REH A;  2FJ7 D;  3MGP B;  3AFA A;  1M18 B;  5B1L D;  5BS7 C;  1ID3 D;  3LZ1 C;  2DF4 C;  3KXB B;  1P3A C;  5AV8 D;  1KX3 D;  3MGR D;  3UTA D;  2Y2J A;  1P3F A;  4H9P B;  3AN2 C;  3X1S C;  3WTP E;  3WKJ C;  1JFI A;  1P3L A;  5E5A A;  1P3M B;  3C1B B;  4YM6 A;  3EPH A;  3AFA C;  1ZLA C;  4JJN B;  1U35 D;  4KHA A;  1A7W A;  3B6F A;  4J8W B;  5CPI D;  4KGC C;  3MGS B;  1HQ3 D;  3AZH C;  4WU9 A;  4CAY B;  3VH6 W;  5GT0 D;  5CHL B;  1P3F C;  4ZUX D;  5DNM C;  3WAA D;  3REL C;  3C1C A;  3AZK A;  3AZF A;  1AOI A;  2Y2L A;  1TZY B;  2NZD D;  3H0M C;  5AVB B;  5CPK B;  5AV6 B;  3MGP A;  1M18 A;  2G5I C;  3KSY A;  3X1T B;  4H9S C;  1BFM A;  3LJA D;  2XD1 A;  5AVC B;  3B6F C;  3KXB A;  3B0B A;  3KUY D;  2YFW B;  2JE5 A;  3AZL B;  2F8N H;  4H9P A;  5AV9 D;  3KWQ B;  3B0D C;  4NE3 A;  2F8N K;  1P3M A;  3C1B A;  2FJ7 B;  5B1L B;  5GT3 C;  2HIO C;  1ID3 B;  1P3K D;  1M1A C;  1M18 C;  4JJN A;  5C3I C;  3X1U D;  4J8W A;  5AV8 B;  4J8V D;  1KU5 A;  3AZM B;  1KX3 B;  3UTA B;  5BNV B;  3REJ D;  1Z2C B;  3MGS A;  2NQB B;  5DNN C;  3AZJ B;  4Z5T D;  5FUG B;  4CAY A;  3X1V D;  3W98 C;  4QLC D;  3REI C;  2F2A C;  2VQR A;  2PYO D;  3WTP D;  1TZY A;  5AVB A;  5CPK A;  3VH5 W;  5AV6 A;  3MGQ C;  3MVD C;  4KUD D;  1U35 B;  3X1T A;  5AVC A;  3W97 C;  2ZY5 A;  3AV2 D;  4EO5 B;  2YFW A;  1HQ3 B;  3AV1 C;  4WJ3 C;  3AZG C;  3AZL A;  1WWS A;  5CPJ D;  5B2I D;  5GT0 B;  4J8U D;  3LEL B;  1WWI A;  3WAA B;  5B24 D;  3KWQ A;  5JRG C;  4NE5 A;  2RVQ D;  2Y2I A;  5CP6 D;  2NZD B;  2FJ7 A;  2DQN C;  5AVB C;  5B0Z C;  1ID3 A;  4AWL C;  3W99 D;  3VH6 T;  3LJA B;  1PZR A;  1KX4 D;  2ARO B;  3KUY B;  5KDM B;  1M19 C;  1P3B D;  5AV8 A;  3AZM A;  1KX3 A;  3UTA A;  5BNV A;  4NE6 A;  5AY8 B;  2NQB A;  3TU4 C;  2YFV B;  3AZJ A;  3LZ0 B;  5FUG A;  4H9Q B;  4XUJ C;  3EPL A;  4LD9 C;  2Y2O A;  5B31 B;  1B67 A;  5GSU D;  1P3K B;  1P34 D;  3O62 D;  3X1U B;  1U35 A;  3A6N C;  4H9O B;  3REK D;  4J8V B;  3REJ B;  2UWX A;  3AZM C;  4R8P C;  1HQ3 A;  1S32 B;  4G92 C;  3X1V B;  5GT0 A;  2NQB C;  4QLC B;  3AZJ C;  3LEL A;  5B32 G;  1KX5 D;  2F8N G;  4ZBJ C;  2HUE B;  2BYM B;  5B0Y C;  2G5H C;  1P3O C;  3WTP B;  4WNN B;  5BNX B;  5GXQ D;  2NZD A;  5B2J C;  4NFT A;  4KUD B;  4DRA A;  3A1K A;  4YS3 D;  2ARO A;  3KUY A;  3AV2 B;  5KDM A;  5AV5 D;  4X23 D;  4WU8 D;  5CPJ B;  3AZI B;  1EQZ D;  5AY8 A;  5BT1 D;  4J8U B;  3VH5 T;  2YFV A;  5B1M B;  5B24 B;  5F99 C;  3LZ0 A;  3LEL C;  4H9Q A;  3AYW C;  5B31 A;  1P3P D;  2F8N D;  5B32 D;  1M19 D;  5B33 C;  3WA9 C;  1P3K A;  3X1U A;  1KX4 B;  3MNN C;  1P3B B;  5B40 D;  4M6B A;  2ARO C;  4HGA B;  4J8V A;  3AZN D;  3REJ A;  3REH C;  1S32 A;  3X1V A;  1P3I D;  5AY8 C;  4QLC A;  3LZ0 C;  2BYM A;  2W8S A;  5B31 C;  2Y2Q A;  4WNN A;  5BNX A;  3WTP A;  3A6N D;  5GSU B;  3AZE B;  1P34 B;  3O62 B;  3W96 D;  4KUD A;  4R8P D;  3EPJ A;  1F66 D;  1P3L C;  3AV2 A;  5E5A C;  4YM6 C;  4DRB A;  5CPJ A;  3AZI A;  1KX5 B;  4J8U A;  1S32 C;  5B1M A;  5B24 A;  4Z66 B;  4XZQ D;  5GXQ B;  3UTB B;  2CV5 D;  3B6G D;  3UT9 D;  1P3G B;  4J8X D;  4WU9 C;  1KX4 A;  3LZ1 D;  1BH8 B;  4YS3 B;  3C1C C;  3AZK C;  3AZF C;  1P3B A;  1AOI C;  4X23 B;  2IO5 B;  1P3A D;  1EQZ B;  3MGP C;  3AZI C;  5B1M C;  3X1S D;  3AN2 D;  2Y2N A;  1P3P B;  3KXB C;  3MGR B;  2F8N B;  5B32 B;  3AZE A;  3WKJ D;  5GSU A;  1P34 A;  5BO0 B;  3O62 A;  2CWE A;  3AFA D;  1ZLA D;  3B0C T;  5B40 B;  1P3M C;  4HGA C;  3C1B C;  4KGC D;  1KX5 A;  3AZH D;  4G91 B;  4JJN C;  5CPI B;  4Z66 A;  1P3F D;  5DNM D;  3REL D;  4J8W C;  2ZY3 A;  3UTB A;  3AZE C;  3MGS C;  4ZUX B;  1P3G A;  2BG1 A;  4E45 A;  1BH8 A;  4DQY B;  4YS3 A;  1B6W A;  3B6F D;  1TZY C;  4X23 A;  5B1L A;  1EQZ A;  5CPK C;  3NQJ B;  5AV6 C; 
#chains in the Genus database with same CATH homology
 2FFF B;  3X1T C;  3R45 B;  3KFU G;  4Z66 C;  5AVC C;  1P3P A;  3UT9 B;  3MGR A;  2F8N A;  5B32 A;  3C1C D;  3UTB C;  2Y2P A;  3AZL C;  4J8X B;  5AV9 B;  5BO0 A;  1P3G C;  5GT3 D;  2HIO D;  3LZ1 B;  3KWQ C;  1M1A D;  1M18 D;  5B40 A;  1P3A B;  3EG5 B;  2FJ7 C;  2Y2M A;  5B1L C;  3F6T A;  1ID3 C;  5DNN D;  2JCH A;  3X1S B;  3AN2 B;  3W98 D;  5CPI A;  3REI D;  1H3O B;  1W2E A;  3WKJ B;  5AV8 C;  1KX3 C;  3MGR C;  3UTA C;  4Z5T B;  4ZUX A;  3H0L C;  3WAA A;  1ZLA B;  3MGQ D;  3MVD D;  3P5J B;  2PYO B;  3W97 D;  4KGC B;  3AV1 D;  3NQJ A;  3AZH B;  3AZG D;  4CSR B;  3LJA A;  1U35 C;  1P3F B;  5DNM B;  3R45 A;  3REL B;  5CPI C;  3UT9 A;  5JRG D;  2RIQ A;  5B2I B;  4EO5 C;  1HQ3 C;  4J8X A;  5AV9 A;  5GT0 C;  4ZUX C;  2ZY4 A;  3B0C W;  3WAA C;  4UUZ B;  5AVB D;  5B0Z D;  3LZ1 A;  5CP6 B;  4KHA B;  2NZD C;  1P3A A;  3W99 B;  4E44 A;  3TU4 D;  3X1S A;  3B0D B;  4H9O A;  3LJA C;  3AN2 A;  4XUJ D;  3KUY C;  1H3O A;  3WKJ A;  4LD9 D;  5JA4 B;  4Z5T A;  5GT3 B;  2HIO B;  5AV9 C;  2L5A A;  1M1A B;  1ZLA A;  5C3I B;  2PYO A;  1T3U A;  4KGC A;  1N1J B;  3AZM D;  1P3K C;  3AZH A;  5DNN B;  1ULY A;  2J8P A;  4CSR A;  3W98 B;  3X1U C;  3REK B;  2NQB D;  3REI B;  3AZJ D;  5DNM A;  3REL A;  3FDD A;  4H9N B;  2Y2G A;  5B0Y D;  4J8V C;  1P3O D;  3REJ C;  5B2I A;  5B2J D;  4Z2M H;  4Z5T C;  3X1V C;  3MGQ B;  3MVD B;  4QLC C;  4UUZ A;  2HUE C;  5G49 B;  4H9S A;  3V9R B;  5CP6 A;  2PYO C;  3WTP C;  3W97 B;  3AV1 B;  4H9R B;  3AZG B;  3W99 A;  4KUD C;  5B31 G;  5F99 D;  3LEL D;  5AV5 B;  3AYW D;  5JRG B;  4WU8 B;  2XD5 A;  3AV2 C;  5CPJ C;  5JA4 A;  5B2I C;  5B33 D;  4J8U C;  5GT3 A;  2HIO A;  5B0Z B;  1TAF B;  5B24 C;  4AWL B;  3WA9 D;  1M1A A;  2JSS A;  3MNN D;  2RVQ C;  5CP6 C;  1M19 B;  2ARO D;  1N1J A;  1BH9 B;  3REH D;  3W99 C;  5DNN A;  3TU4 B;  4WZS B;  3W98 A;  5AY8 D;  3REK A;  1KX4 C;  4XUJ B;  3REI A;  4LD9 B;  3LZ0 D;  3AZN B;  4H9N A;  1Q9C A;  1P3B C;  5B31 D;  1P3I B;  4WV4 B;  3MGQ A;  3MVD A;  2Y2H A;  5G49 A;  3A6N B;  3V9R A;  5GXQ A;  3VH6 A;  3W97 A;  1P3L D;  2Y2K A;  5E5A D;  5GSU C;  3W96 B;  4R8P B;  3AV1 A;  4H9R A;  4YM6 D;  3AZG A;  4G92 B;  1P34 C;  3O62 C;  1F66 B;  1S32 D;  4ZBJ B;  1P3O B;  5B0Y B;  3REK C;  5AV5 A;  5JRG A;  4WU8 A;  3IP4 C;  2LY8 A;  5B2J B;  1KX5 C;  5B0Z A;  1TAF A;  2BYK B;  4XZQ B;  4WU9 D;  1F1E A;  2CV5 B;  3B6G B;  3AL0 C;  5GXQ C;  3AZK D;  1M19 A;  3AZF D;  1AOI D;  1BH9 A;  3EPK A;  3TU4 A;  3MGP D;  5F99 B;  3A1I A;  3AZI D;  2ZM5 A;  4YS3 C;  4XUJ A;  3AYW B;  5B1M D;  4LD9 A;  3AZN A;  5AV5 C;  3KXB D;  4X23 C;  4WU8 C;  2IO5 C;  1P3I A;  1EQZ C;  5BT1 C;  5B33 B;  3WA9 B;  4Z2M G;  4UPK A;  3NQU B;  3MNN B;  3A6N A;  1P3P C;  5B32 C;  3W96 A;  1P3M D;  3REH B;  4R8P A;  3C1B D;  3AFA B;  1R4V A;  1F66 A;  4JJN D;  5B0Y A;  3VH5 A;  5B40 C;  1P3O A;  3AZN C;  4J8W D;  5B2J A;  3AZE D;  1P3I C;  3MGS D;  4G91 C;  2BYK A;  4XZQ A;  2CV5 A;  3B6G A;  1JFI B;  1P3L B;  5E5A B;  4YM6 B;  1TZY D;  3W96 C;  5BS7 A;  3H0R C;  5CPK D;  5AV6 D;  5F99 A;  1F66 C;  3AYW A;  3B6F B;  3X1T D;  1HTA A;  4Z66 D;  5AVC D;  2ZY2 A;  3UTB D;  5B33 A;  3AZL D;  3WA9 A;  4WU9 B;  1P3G D;  4XZQ C;  3NQU A;  3MNN A;  3KWQ D;  3C1C B;  3AZK B;  3AZF B;  2CV5 C;  3UT9 C;  1AOI B;  3B6G C;  4J8X C;  3REH A;  2FJ7 D;  3MGP B;  3AFA A;  1M18 B;  5B1L D;  5BS7 C;  1ID3 D;  3LZ1 C;  2DF4 C;  3KXB B;  1P3A C;  5AV8 D;  1KX3 D;  3MGR D;  3UTA D;  2Y2J A;  1P3F A;  4H9P B;  3AN2 C;  3X1S C;  3WTP E;  3WKJ C;  1JFI A;  1P3L A;  5E5A A;  1P3M B;  3C1B B;  4YM6 A;  3EPH A;  3AFA C;  1ZLA C;  4JJN B;  1U35 D;  4KHA A;  1A7W A;  3B6F A;  4J8W B;  5CPI D;  4KGC C;  3MGS B;  1HQ3 D;  3AZH C;  4WU9 A;  4CAY B;  3VH6 W;  5GT0 D;  5CHL B;  1P3F C;  4ZUX D;  5DNM C;  3WAA D;  3REL C;  3C1C A;  3AZK A;  3AZF A;  1AOI A;  2Y2L A;  1TZY B;  2NZD D;  3H0M C;  5AVB B;  5CPK B;  5AV6 B;  3MGP A;  1M18 A;  2G5I C;  3KSY A;  3X1T B;  4H9S C;  1BFM A;  3LJA D;  2XD1 A;  5AVC B;  3B6F C;  3KXB A;  3B0B A;  3KUY D;  2YFW B;  2JE5 A;  3AZL B;  2F8N H;  4H9P A;  5AV9 D;  3KWQ B;  3B0D C;  4NE3 A;  2F8N K;  1P3M A;  3C1B A;  2FJ7 B;  5B1L B;  5GT3 C;  2HIO C;  1ID3 B;  1P3K D;  1M1A C;  1M18 C;  4JJN A;  5C3I C;  3X1U D;  4J8W A;  5AV8 B;  4J8V D;  1KU5 A;  3AZM B;  1KX3 B;  3UTA B;  5BNV B;  3REJ D;  1Z2C B;  3MGS A;  2NQB B;  5DNN C;  3AZJ B;  4Z5T D;  5FUG B;  4CAY A;  3X1V D;  3W98 C;  4QLC D;  3REI C;  2F2A C;  2VQR A;  2PYO D;  3WTP D;  1TZY A;  5AVB A;  5CPK A;  3VH5 W;  5AV6 A;  3MGQ C;  3MVD C;  4KUD D;  1U35 B;  3X1T A;  5AVC A;  3W97 C;  2ZY5 A;  3AV2 D;  4EO5 B;  2YFW A;  1HQ3 B;  3AV1 C;  4WJ3 C;  3AZG C;  3AZL A;  1WWS A;  5CPJ D;  5B2I D;  5GT0 B;  4J8U D;  3LEL B;  1WWI A;  3WAA B;  5B24 D;  3KWQ A;  5JRG C;  4NE5 A;  2RVQ D;  2Y2I A;  5CP6 D;  2NZD B;  2FJ7 A;  2DQN C;  5AVB C;  5B0Z C;  1ID3 A;  4AWL C;  3W99 D;  3VH6 T;  3LJA B;  1PZR A;  1KX4 D;  2ARO B;  3KUY B;  5KDM B;  1M19 C;  1P3B D;  5AV8 A;  3AZM A;  1KX3 A;  3UTA A;  5BNV A;  4NE6 A;  5AY8 B;  2NQB A;  3TU4 C;  2YFV B;  3AZJ A;  3LZ0 B;  5FUG A;  4H9Q B;  4XUJ C;  3EPL A;  4LD9 C;  2Y2O A;  5B31 B;  1B67 A;  5GSU D;  1P3K B;  1P34 D;  3O62 D;  3X1U B;  1U35 A;  3A6N C;  4H9O B;  3REK D;  4J8V B;  3REJ B;  2UWX A;  3AZM C;  4R8P C;  1HQ3 A;  1S32 B;  4G92 C;  3X1V B;  5GT0 A;  2NQB C;  4QLC B;  3AZJ C;  3LEL A;  5B32 G;  1KX5 D;  2F8N G;  4ZBJ C;  2HUE B;  2BYM B;  5B0Y C;  2G5H C;  1P3O C;  3WTP B;  4WNN B;  5BNX B;  5GXQ D;  2NZD A;  5B2J C;  4NFT A;  4KUD B;  4DRA A;  3A1K A;  4YS3 D;  2ARO A;  3KUY A;  3AV2 B;  5KDM A;  5AV5 D;  4X23 D;  4WU8 D;  5CPJ B;  3AZI B;  1EQZ D;  5AY8 A;  5BT1 D;  4J8U B;  3VH5 T;  2YFV A;  5B1M B;  5B24 B;  5F99 C;  3LZ0 A;  3LEL C;  4H9Q A;  3AYW C;  5B31 A;  1P3P D;  2F8N D;  5B32 D;  1M19 D;  5B33 C;  3WA9 C;  1P3K A;  3X1U A;  1KX4 B;  3MNN C;  1P3B B;  5B40 D;  4M6B A;  2ARO C;  4HGA B;  4J8V A;  3AZN D;  3REJ A;  3REH C;  1S32 A;  3X1V A;  1P3I D;  5AY8 C;  4QLC A;  3LZ0 C;  2BYM A;  2W8S A;  5B31 C;  2Y2Q A;  4WNN A;  5BNX A;  3WTP A;  3A6N D;  5GSU B;  3AZE B;  1P34 B;  3O62 B;  3W96 D;  4KUD A;  4R8P D;  3EPJ A;  1F66 D;  1P3L C;  3AV2 A;  5E5A C;  4YM6 C;  4DRB A;  5CPJ A;  3AZI A;  1KX5 B;  4J8U A;  1S32 C;  5B1M A;  5B24 A;  4Z66 B;  4XZQ D;  5GXQ B;  3UTB B;  2CV5 D;  3B6G D;  3UT9 D;  1P3G B;  4J8X D;  4WU9 C;  1KX4 A;  3LZ1 D;  1BH8 B;  4YS3 B;  3C1C C;  3AZK C;  3AZF C;  1P3B A;  1AOI C;  4X23 B;  2IO5 B;  1P3A D;  1EQZ B;  3MGP C;  3AZI C;  5B1M C;  3X1S D;  3AN2 D;  2Y2N A;  1P3P B;  3KXB C;  3MGR B;  2F8N B;  5B32 B;  3AZE A;  3WKJ D;  5GSU A;  1P34 A;  5BO0 B;  3O62 A;  2CWE A;  3AFA D;  1ZLA D;  3B0C T;  5B40 B;  1P3M C;  4HGA C;  3C1B C;  4KGC D;  1KX5 A;  3AZH D;  4G91 B;  4JJN C;  5CPI B;  4Z66 A;  1P3F D;  5DNM D;  3REL D;  4J8W C;  2ZY3 A;  3UTB A;  3AZE C;  3MGS C;  4ZUX B;  1P3G A;  2BG1 A;  4E45 A;  1BH8 A;  4DQY B;  4YS3 A;  1B6W A;  3B6F D;  1TZY C;  4X23 A;  5B1L A;  1EQZ A;  5CPK C;  3NQJ B;  5AV6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...