1P3LA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lA00
4M6BA 3UT9A 4XUJD 4R8PA 4J8UC 3AV2A 1TZYB 1F66D 1BFMA 5AY8C 5CPKD 4J8VD 3AZFC 4HGAB 4X23D 2NZDD 2BYMB 1M1AD 5B1MC 3KUYD 3MGSC 4H9QB 3REHD 3UTAD 4YS3A 5AVBC 4YS3B 3WTPE 4ZUXC 1P3AB 3MGPC 1S32D 1M19D 1KX5B 3W97C 4G92B 1P3BC 1H3OA 1P3OD 3AN2B 5GT0D 3WKJA 3MNNB 5B0ZA 3MGRA 1EQZC 2NQBD 2IO5C 5JA4B 5AVCC 3LELC 3AZEC 3AZGB 1P34A 2F8NH 3RELC 1U35C 5G49A 5BNXA 3AZHB 3AZKA 4JJND 3X1UB 1BH8A 4Z5TD 4KHAA 1HQ3C 4AWLC 3LZ0B 3TU4B 3B0CW 5CPKC 5KDMB 5JRGC 4H9PB 5DNNA 1P3MB 3LZ1A 3B0DB 5AV6B 1P3KD 4LD9C 5B32C 5CPIA 1KX4B 2F8NA 3AZND 3VH5W 4J8XD 3W98A 4J8UB 1R4VA 4QLCA 5B24A 3AZEB 1P3BB 4QLCB 5FUGB 4YM6B 3MGQA 1AOIA 1ULYA 4Z2MH 4Z66C 1ZLAB 4DRAA 3W97D 5BT1D 3KXBA 4G91C 1P3OC 5GT0C 5KDMA 4X23C 5BNXB 1HQ3D 3TU4A 3LZ0A 5GSUB 4H9NB 5AV9B 5AY8D 1P3PB 3AZJB 3X1UC 4WU9A 4J8VC 2AROC 1M1AA 5CPIB 2NZDC 1U35B 3AYWD 3REJA 3WA9D 3C1BB 3WAAD 3KSYA 5JA4A 1EQZB 3W98B 2NQBC 2F8ND 3AN2A 5AVCB 3AZMB 1P3FB 1H3OB 5F99D 3MGPB 4CSRB 3AN2C 5BS7A 1BH8B 3R45B 4XUJB 5BNVA 4KGCB 3NQUA 4CAYA 5DNMD 5AV5D 1TZYD 1F66B 1KX4C 3REJC 5CPKB 2NZDA 4J8VB 1TAFB 4ZBJC 3VH6T 4J8VA 3X1UA 4X23B 2NZDB 5B31B 1ID3B 2PYOD 2F8NG 3TU4C 4X23A 4YS3D 4YM6C 3B6GA 3A6NA 5CPJB 5GT0A 3KUYA 1KX5D 3KXBC 4NE6A 4Z66B 5GT0B 4KGCC 1AOIC 3B6GB 1P3ID 4J8XC 3AZGD 4CSRA 1TZYA 5E5AA 5B2IA 1N1JA 5B32B 4XZQD 4Z5TB 3AV1C 5B31C 3C1BC 4WU8A 5CPIC 3LZ0D 4LD9A 3NQUB 4WU9B 2HUEC 3LZ1C 5JRGA 2JSSA 1P3LA 5CPKA 1P3KB 1ID3C 3X1VD 1BH9B 4H9RB 2CV5A 1KX4D 4WNNA 2HIOD 3AZNA 2FJ7A 4WZSB 3AZMC 1P3FC 5F99C 1U35A 3RELA 5GXQA 5B24B 3LELA 4J8WD 3AZEA 5AVCA 4QLCD 5B33C 5GT3D 1P34C 5B0ZC 1WWIA 4YM6D 3VH6A 1EQZA 5CP6A 3WKJC 3VH6W 5GXQB 1KX3C 1KX5C 3W97B 1P3BA 3KWQB 3W97A 5B1MB 4ZUXA 1P3GC 3REHC 5B2JD 4JJNA 3UTAC 1AOID 4UUZA 5CPJC 5AVBA 4HGAC 3AZFB 3AZID 5AY8B 2L5AA 3X1SC 4KUDC 3MGSB 5C3IB 5BO0B 4H9PA 3AYWB 3WA9B 3C1BD 5AY8A 3RELD 3W96C 2YFWA 3B6FC 4J8UA 3AV2C 3W99C 3W98D 2F8NB 4NFTA 3V9RA 3AZMD 1P3FD 3MGPD 5B2IB 1S32C 1S32A 1M19A 1M18A 1M19C 1Q9CA 5B1LD 4XZQC 5CP6B 4KGCD 3O62C 3W99A 3B6FA 5B0ZD 5DNMB 1B67A 3W96A 5AV5B 3REID 3C1CD 5AV8D 5E5AB 1JFIB 3AFAC 5DNNB 1P3MA 4H9SA 3X1SA 4KUDA 4WNNB 4H9QA 5B31D 1ID3D 2PYOB 4WU8B 3X1VA 4KHAB 3VH5T 1P3LB 5JRGD 1F1EA 5CPJA 3AZLD 1TAFA 4JJNC 3REHA 5CPJD 3LZ1D 3UTAA 1P3GA 3MVDC 2HIOA 1KX5A 4Z66D 1KX3A 3AZIC 1KX3B 5CP6C 3B6GD 1P3IB 5B32G 1P3GB 5B33A 3MNNA 3WKJD 5GXQC 5F99A 3AZMA 1P3FA 5B32D 1F66A 4XZQB 1P34D 5B33B 2FJ7C 3AV2D 3AZNC 3W99B 3AZJC 1JFIA 2CV5C 1ID3A 4EO5C 3UTBC 1P3LC 1HTAA 5GSUC 3C1CA 2BYMA 3LJAB 4R8PB 5AV5A 4WU9D 3W96B 3X1TB 1P3PA 3REKC 3X1VB 4H9NA 4E45A 4WU8C 2PYOA 3C1BA 1ZLAC 5AV8C 5B31A 2HIOB 5BT1C 3AV1A 3X1SB 4KUDB 3V9RB 5BO0A 3AZLA 2YFWB 5DNMC 5B2IC 5B40B 5E5AC 1TZYC 5B0YD 5B24D 4J8WB 1M18D 5GT3B 4J8XA 3O62D 3B6FB 5BNVB 4KGCA 3R45A 4XUJA 5GXQD 3MVDD 3KWQD 3AYWC 5B1MD 3KUYC 5B1LC 5B2JB 3A6NC 5FUGA 4YM6A 3REIA 1AOIB 3B6GC 5B31G 5AVBD 3AZFD 2YFVA 4ZUXD 2AROB 3AZIB 3NQJA 3KXBD 3MGSD 4ZBJB 3REKD 3WTPB 3AFAD 1KX4A 5AV9A 2CV5B 3RELB 4Z2MG 5AV6A 3UTBD 3REJD 3WA9A 5BS7C 5B2ID 5GT3A 5B1LB 1P3AC 5B0YA 5CP6D 3MGQB 2NQBA 4NE5A 1P3IC 5B0ZB 4Z5TA 3REIB 3C1CB 3AZKB 3AZHA 1N1JB 5AV8B 5E5AD 4J8WC 2AROA 1M1AC 4WU9C 5DNND 5CHLB 5B2JA 4WU8D 3LZ0C 1KU5A 3B0BA 1P3KA 1P3KC 4LD9D 1P3LD 5JRGB 3AZLB 5B2JC 3A6NB 3LZ1B 2FJ7B 1P3OA 3AV1B 4Z66A 3LELD 4J8WA 1KX3D 2BYKB 3MGQC 4EO5B 4NE3A 3AZHC 1P3GD 3VH5A 3MGRB 3WKJB 4Z5TC 1B6WA 1P3IA 2BYKA 2IO5B 5G49B 5B0YC 1P3AA 5B24C 4H9OB 1P34B 4QLCC 5B33D 5GT3C 3AV2B 3W99D 3W98C 3UT9B 2LY8A 5B32A 3WA9C 3B0DC 5AV6C 3LJAD 4R8PD 3W96D 5C3IC 5AV9C 3X1TD 4CAYB 5DNNC 1WWSA 1HQ3A 3X1SD 4KUDD 1M1AB 3KUYB 3REHB 3UTAB 3AZKC 2RVQC 5B40D 5B0YB 3REIC 2F8NK 5B1LA 1M18B 1P3AD 1S32B 1M19B 3AYWA 3O62B 4G91B 1P3OB 3MGRC 3B6FD 3AN2D 4XUJC 3MNND 3MVDB 2NQBB 3MGPA 3WAAC 5DNMA 3AZHD 5AVBB 4YS3C 3AZLC 4JJNB 3X1UD 3MGSA 5B1MA 2AROD 4ZUXB 3KXBB 5AV8A 1ZLAA 2PYOC 3AZFA 3TU4D 3REKB 3WTPD 3AFAB 3REKA 1P3MD 1P3PC 4DRBA 4E44A 5AV5C 2CV5D 3C1CC 3UTBB 5GSUA 5AV6D 3REJB 3UTBA 4R8PC 3UT9C 3AZNB 3AZJA 4J8XB 4J8UD 3AZED 1F66C 5B40A 3MGQD 1P3BD 3MNNC 3AZKD 3KWQA 3AZGA 2YFVB 3AZIA 1ZLAD 2HIOC 3MVDA 3X1TA 3WTPA 4UUZB 3LJAA 1HQ3B 4LD9B 3X1VC 5GSUD 3NQJB 1A7WA 3A6ND 3LJAC 4AWLB 5AV9D 3WTPC 3X1TC 2FJ7D 4H9SC 1P3MC 3AFAA 3AV1D 1P3PD 3AZJD 2HUEB 3LELB 2CWEA 4H9RA 3AZGC 1BH9A 5CPID 3KWQC 3B0CT 1U35D 3WAAB 3WAAA 3MGRD 1EQZD 3O62A 4H9OA 2RVQD 4XZQA 5B40C 4WV4B 5AVCD 1M18C 5F99B 4G92C 3UT9D
chains in the Genus database with same CATH superfamily
4M6BA 3UT9A 4XUJD 4R8PA 4J8UC 3AV2A 1TZYB 1F66D 1BFMA 5AY8C 3EPHA 5CPKD 4J8VD 2ZY3A 3AZFC 4HGAB 4X23D 2NZDD 2BYMB 1M1AD 5B1MC 3KUYD 3MGSC 4H9QB 3REHD 3UTAD 4YS3A 5AVBC 4YS3B 3WTPE 4ZUXC 1P3AB 3MGPC 1S32D 1M19D 1KX5B 3W97C 4G92B 1P3BC 1H3OA 1P3OD 3AN2B 5GT0D 3IP4C 3WKJA 3MNNB 5B0ZA 3MGRA 1EQZC 2NQBD 2IO5C 5JA4B 5AVCC 3LELC 3AZEC 3AZGB 1P34A 2F8NH 2Y2HA 3RELC 1U35C 5G49A 2XD1A 5BNXA 3AZHB 3AZKA 4JJND 3X1UB 1BH8A 2Y2QA 4Z5TD 1HQ3C 2Y2GA 4KHAA 3FDDA 4AWLC 3LZ0B 3TU4B 3B0CW 5CPKC 3EPLA 5KDMB 5JRGC 4H9PB 5DNNA 1P3MB 4DQYB 3LZ1A 2Y2IA 2Y2NA 3B0DB 5AV6B 1P3KD 4LD9C 5B32C 2XD5A 5CPIA 1KX4B 2F8NA 3AZND 1Z2CB 3VH5W 4J8XD 3W98A 4J8UB 1R4VA 4QLCA 5B24A 3AZEB 2Y2MA 1P3BB 4QLCB 5FUGB 1T3UA 4YM6B 3MGQA 1ULYA 4Z2MH 4Z66C 1AOIA 1ZLAB 4DRAA 3W97D 5BT1D 3KXBA 4G91C 1P3OC 5GT0C 5KDMA 4X23C 5BNXB 1HQ3D 3TU4A 3LZ0A 5GSUB 4H9NB 5AV9B 5AY8D 1P3PB 3AZJB 3X1UC 2DF4C 4WU9A 4J8VC 2AROC 1M1AA 5CPIB 2NZDC 1U35B 3AYWD 3REJA 3WA9D 3C1BB 3WAAD 3KSYA 5JA4A 1EQZB 3W98B 2NQBC 2F8ND 3AN2A 5AVCB 2ZY2A 3AZMB 1H3OB 1P3FB 5F99D 3MGPB 2F2AC 4CSRB 3AN2C 5BS7A 1BH8B 3R45B 4XUJB 5BNVA 4KGCB 3NQUA 4CAYA 5DNMD 5AV5D 1TZYD 1F66B 3KFUG 1KX4C 3REJC 3A1KA 5CPKB 2NZDA 3A1IA 4J8VB 1TAFB 4ZBJC 3VH6T 4J8VA 3X1UA 4X23B 2NZDB 5B31B 1ID3B 2PYOD 2F8NG 3TU4C 4X23A 3H0LC 4YS3D 4YM6C 3B6GA 3A6NA 5CPJB 5GT0A 3KUYA 1KX5D 3KXBC 4NE6A 4Z66B 5GT0B 4KGCC 1AOIC 3B6GB 1P3ID 4J8XC 3AZGD 4CSRA 1TZYA 5E5AA 5B2IA 1N1JA 5B32B 4XZQD 4Z5TB 3H0MC 3AV1C 5B31C 3C1BC 4WU8A 5CPIC 3LZ0D 4LD9A 3NQUB 4WU9B 2HUEC 3LZ1C 2Y2LA 5JRGA 2JSSA 1P3LA 5CPKA 1P3KB 1ID3C 3X1VD 1BH9B 4H9RB 2CV5A 1KX4D 4WNNA 2HIOD 3AZNA 2Y2PA 2FJ7A 4WZSB 3AZMC 1P3FC 5F99C 1U35A 3RELA 5GXQA 5B24B 3LELA 4J8WD 3AZEA 5AVCA 4QLCD 5B33C 5GT3D 1P34C 5B0ZC 1WWIA 4YM6D 3VH6A 1EQZA 5CP6A 3WKJC 3VH6W 5GXQB 1KX3C 1KX5C 3W97B 1P3BA 3KWQB 3W97A 5B1MB 4ZUXA 1P3GC 3REHC 5B2JD 4JJNA 3UTAC 1AOID 4UUZA 5CPJC 5AVBA 4HGAC 3AZFB 3AZID 5AY8B 2G5IC 2L5AA 3X1SC 4KUDC 2BG1A 3MGSB 5C3IB 5BO0B 4H9PA 3AYWB 3WA9B 3C1BD 5AY8A 3RELD 3W96C 2YFWA 3B6FC 4J8UA 3AV2C 3W99C 3W98D 2F8NB 4NFTA 3V9RA 3AZMD 1P3FD 3MGPD 5B2IB 1S32C 1S32A 1M19A 1M18A 1M19C 1Q9CA 5B1LD 4XZQC 5CP6B 4KGCD 3O62C 3W99A 3B6FA 5B0ZD 5DNMB 1B67A 3W96A 5AV5B 3REID 3C1CD 5AV8D 5E5AB 1JFIB 3AFAC 5DNNB 1P3MA 4H9SA 3X1SA 4KUDA 4WNNB 4H9QA 5B31D 1ID3D 2PYOB 4WU8B 3F6TA 3X1VA 4KHAB 3VH5T 1P3LB 5JRGD 1F1EA 5CPJA 3AZLD 3AL0C 1TAFA 2ZY4A 4JJNC 3REHA 5CPJD 3LZ1D 2JE5A 3UTAA 1P3GA 3MVDC 2HIOA 1KX5A 4Z66D 1KX3A 3AZIC 1KX3B 5CP6C 3B6GD 1P3IB 5B32G 1P3GB 2ZM5A 5B33A 3MNNA 3WKJD 5GXQC 5F99A 3AZMA 1P3FA 5B32D 1F66A 4XZQB 1P34D 5B33B 2FJ7C 3AV2D 3AZNC 3W99B 3AZJC 1JFIA 2CV5C 4WJ3C 1ID3A 4EO5C 3UTBC 1P3LC 1HTAA 5GSUC 3C1CA 2BYMA 3LJAB 4R8PB 5AV5A 4WU9D 3W96B 3X1TB 1P3PA 3REKC 3X1VB 4H9NA 3P5JB 4E45A 4WU8C 2PYOA 3C1BA 1ZLAC 5AV8C 5B31A 2HIOB 5BT1C 3AV1A 3X1SB 4KUDB 3V9RB 5BO0A 3AZLA 2YFWB 5DNMC 5B2IC 5B40B 5E5AC 1TZYC 5B0YD 5B24D 4J8WB 1M18D 5GT3B 4J8XA 3O62D 3B6FB 5BNVB 4KGCA 3R45A 4XUJA 5GXQD 3MVDD 3KWQD 3AYWC 5B1MD 3KUYC 5B1LC 5B2JB 3A6NC 5FUGA 4YM6A 3REIA 1AOIB 3B6GC 5B31G 5AVBD 3AZFD 2YFVA 4ZUXD 2AROB 3AZIB 3NQJA 3KXBD 3MGSD 4ZBJB 3REKD 3WTPB 3AFAD 1KX4A 5AV9A 2CV5B 2RIQA 3RELB 4Z2MG 5AV6A 2W8SA 3UTBD 3REJD 3WA9A 5BS7C 5B2ID 5GT3A 5B1LB 1P3AC 5B0YA 5CP6D 3MGQB 2NQBA 4NE5A 1P3IC 5B0ZB 4Z5TA 3REIB 3C1CB 3AZKB 3AZHA 1N1JB 5AV8B 1PZRA 5E5AD 3H0RC 4J8WC 2AROA 1M1AC 4WU9C 5DNND 5CHLB 2ZY5A 5B2JA 4WU8D 3LZ0C 1KU5A 3B0BA 1P3KA 1P3KC 4LD9D 1P3LD 5JRGB 3AZLB 5B2JC 3A6NB 2DQNC 3LZ1B 2FJ7B 1P3OA 3AV1B 4Z66A 3LELD 4J8WA 1KX3D 2BYKB 3MGQC 4EO5B 4NE3A 3AZHC 1W2EA 3VH5A 3MGRB 1P3GD 2Y2OA 3WKJB 4Z5TC 1B6WA 1P3IA 2BYKA 2IO5B 5G49B 5B0YC 1P3AA 2Y2JA 5B24C 4H9OB 1P34B 4QLCC 5B33D 5GT3C 3AV2B 3W99D 3W98C 3UT9B 2LY8A 5B32A 2JCHA 3WA9C 3B0DC 5AV6C 3LJAD 4R8PD 3W96D 5C3IC 5AV9C 3X1TD 4CAYB 5DNNC 1WWSA 1HQ3A 3X1SD 4KUDD 1M1AB 3KUYB 3REHB 3UTAB 2Y2KA 3AZKC 2RVQC 5B40D 5B0YB 3REIC 2F8NK 5B1LA 1M18B 1P3AD 1S32B 1M19B 3AYWA 3O62B 4G91B 1P3OB 3MGRC 3B6FD 3AN2D 4XUJC 3MNND 3MVDB 2NQBB 3MGPA 3WAAC 5DNMA 3AZHD 5AVBB 4YS3C 3AZLC 4JJNB 3X1UD 3MGSA 5B1MA 2AROD 4ZUXB 3KXBB 5AV8A 1ZLAA 2PYOC 3AZFA 3TU4D 3REKB 3WTPD 3AFAB 3REKA 1P3MD 1P3PC 4DRBA 4E44A 5AV5C 2CV5D 3C1CC 3UTBB 5GSUA 5AV6D 3REJB 3UTBA 2J8PA 4R8PC 3UT9C 3AZNB 3AZJA 2UWXA 4J8XB 4J8UD 3AZED 1F66C 5B40A 3MGQD 1P3BD 3MNNC 3AZKD 3KWQA 3AZGA 2YFVB 3AZIA 1ZLAD 2HIOC 3MVDA 3X1TA 3WTPA 4UUZB 3EPKA 3LJAA 2VQRA 1HQ3B 4LD9B 3X1VC 5GSUD 3NQJB 1A7WA 3A6ND 3LJAC 4AWLB 5AV9D 3WTPC 3X1TC 2FJ7D 4H9SC 1P3MC 3AFAA 3EPJA 3AV1D 3AZJD 1P3PD 3EG5B 2HUEB 4UPKA 3LELB 2CWEA 4H9RA 3AZGC 1BH9A 5CPID 3KWQC 3B0CT 1U35D 3WAAB 3WAAA 3MGRD 1EQZD 2FFFB 3O62A 2G5HC 2RVQD 4H9OA 4XZQA 5B40C 4WV4B 5AVCD 1M18C 5F99B 4G92C 3UT9D
chains in the Genus database with same CATH topology
4M6BA 3UT9A 4XUJD 4R8PA 4J8UC 3AV2A 1TZYB 1F66D 1BFMA 5AY8C 3EPHA 5CPKD 4J8VD 2ZY3A 3AZFC 4HGAB 4X23D 2NZDD 2BYMB 1M1AD 5B1MC 3KUYD 3MGSC 4H9QB 3REHD 3UTAD 4YS3A 5AVBC 4YS3B 3WTPE 4ZUXC 1P3AB 3MGPC 1S32D 1M19D 1KX5B 3W97C 4G92B 1P3BC 1H3OA 1P3OD 3AN2B 5GT0D 3IP4C 3WKJA 3MNNB 5B0ZA 3MGRA 1EQZC 2NQBD 2IO5C 5JA4B 5AVCC 3LELC 3AZEC 3AZGB 1P34A 2F8NH 2Y2HA 3RELC 1U35C 5G49A 2XD1A 5BNXA 3AZHB 3AZKA 4JJND 3X1UB 1BH8A 2Y2QA 4Z5TD 1HQ3C 2Y2GA 4KHAA 3FDDA 4AWLC 3LZ0B 3TU4B 3B0CW 5CPKC 3EPLA 5KDMB 5JRGC 4H9PB 5DNNA 1P3MB 4DQYB 3LZ1A 2Y2IA 2Y2NA 3B0DB 5AV6B 1P3KD 4LD9C 5B32C 2XD5A 5CPIA 1KX4B 2F8NA 3AZND 1Z2CB 3VH5W 4J8XD 3W98A 4J8UB 1R4VA 4QLCA 5B24A 3AZEB 2Y2MA 1P3BB 4QLCB 5FUGB 1T3UA 4YM6B 3MGQA 1ULYA 4Z2MH 4Z66C 1AOIA 1ZLAB 4DRAA 3W97D 5BT1D 3KXBA 4G91C 1P3OC 5GT0C 5KDMA 4X23C 5BNXB 1HQ3D 3TU4A 3LZ0A 5GSUB 4H9NB 5AV9B 5AY8D 1P3PB 3AZJB 3X1UC 2DF4C 4WU9A 4J8VC 2AROC 1M1AA 5CPIB 2NZDC 1U35B 3AYWD 3REJA 3WA9D 3C1BB 3WAAD 3KSYA 5JA4A 1EQZB 3W98B 2NQBC 2F8ND 3AN2A 5AVCB 2ZY2A 3AZMB 1H3OB 1P3FB 5F99D 3MGPB 2F2AC 4CSRB 3AN2C 5BS7A 1BH8B 3R45B 4XUJB 5BNVA 4KGCB 3NQUA 4CAYA 5DNMD 5AV5D 1TZYD 1F66B 3KFUG 1KX4C 3REJC 3A1KA 5CPKB 2NZDA 3A1IA 4J8VB 1TAFB 4ZBJC 3VH6T 4J8VA 3X1UA 4X23B 2NZDB 5B31B 1ID3B 2PYOD 2F8NG 3TU4C 4X23A 3H0LC 4YS3D 4YM6C 3B6GA 3A6NA 5CPJB 5GT0A 3KUYA 1KX5D 3KXBC 4NE6A 4Z66B 5GT0B 4KGCC 1AOIC 3B6GB 1P3ID 4J8XC 3AZGD 4CSRA 1TZYA 5E5AA 5B2IA 1N1JA 5B32B 4XZQD 4Z5TB 3H0MC 3AV1C 5B31C 3C1BC 4WU8A 5CPIC 3LZ0D 4LD9A 3NQUB 4WU9B 2HUEC 3LZ1C 2Y2LA 5JRGA 2JSSA 1P3LA 5CPKA 1P3KB 1ID3C 3X1VD 1BH9B 4H9RB 2CV5A 1KX4D 4WNNA 2HIOD 3AZNA 2Y2PA 2FJ7A 4WZSB 3AZMC 1P3FC 5F99C 1U35A 3RELA 5GXQA 5B24B 3LELA 4J8WD 3AZEA 5AVCA 4QLCD 5B33C 5GT3D 1P34C 5B0ZC 1WWIA 4YM6D 3VH6A 1EQZA 5CP6A 3WKJC 3VH6W 5GXQB 1KX3C 1KX5C 3W97B 1P3BA 3KWQB 3W97A 5B1MB 4ZUXA 1P3GC 3REHC 5B2JD 4JJNA 3UTAC 1AOID 4UUZA 5CPJC 5AVBA 4HGAC 3AZFB 3AZID 5AY8B 2G5IC 2L5AA 3X1SC 4KUDC 2BG1A 3MGSB 5C3IB 5BO0B 4H9PA 3AYWB 3WA9B 3C1BD 5AY8A 3RELD 3W96C 2YFWA 3B6FC 4J8UA 3AV2C 3W99C 3W98D 2F8NB 4NFTA 3V9RA 3AZMD 1P3FD 3MGPD 5B2IB 1S32C 1S32A 1M19A 1M18A 1M19C 1Q9CA 5B1LD 4XZQC 5CP6B 4KGCD 3O62C 3W99A 3B6FA 5B0ZD 5DNMB 1B67A 3W96A 5AV5B 3REID 3C1CD 5AV8D 5E5AB 1JFIB 3AFAC 5DNNB 1P3MA 4H9SA 3X1SA 4KUDA 4WNNB 4H9QA 5B31D 1ID3D 2PYOB 4WU8B 3F6TA 3X1VA 4KHAB 3VH5T 1P3LB 5JRGD 1F1EA 5CPJA 3AZLD 3AL0C 1TAFA 2ZY4A 4JJNC 3REHA 5CPJD 3LZ1D 2JE5A 3UTAA 1P3GA 3MVDC 2HIOA 1KX5A 4Z66D 1KX3A 3AZIC 1KX3B 5CP6C 3B6GD 1P3IB 5B32G 1P3GB 2ZM5A 5B33A 3MNNA 3WKJD 5GXQC 5F99A 3AZMA 1P3FA 5B32D 1F66A 4XZQB 1P34D 5B33B 2FJ7C 3AV2D 3AZNC 3W99B 3AZJC 1JFIA 2CV5C 4WJ3C 1ID3A 4EO5C 3UTBC 1P3LC 1HTAA 5GSUC 3C1CA 2BYMA 3LJAB 4R8PB 5AV5A 4WU9D 3W96B 3X1TB 1P3PA 3REKC 3X1VB 4H9NA 3P5JB 4E45A 4WU8C 2PYOA 3C1BA 1ZLAC 5AV8C 5B31A 2HIOB 5BT1C 3AV1A 3X1SB 4KUDB 3V9RB 5BO0A 3AZLA 2YFWB 5DNMC 5B2IC 5B40B 5E5AC 1TZYC 5B0YD 5B24D 4J8WB 1M18D 5GT3B 4J8XA 3O62D 3B6FB 5BNVB 4KGCA 3R45A 4XUJA 5GXQD 3MVDD 3KWQD 3AYWC 5B1MD 3KUYC 5B1LC 5B2JB 3A6NC 5FUGA 4YM6A 3REIA 1AOIB 3B6GC 5B31G 5AVBD 3AZFD 2YFVA 4ZUXD 2AROB 3AZIB 3NQJA 3KXBD 3MGSD 4ZBJB 3REKD 3WTPB 3AFAD 1KX4A 5AV9A 2CV5B 2RIQA 3RELB 4Z2MG 5AV6A 2W8SA 3UTBD 3REJD 3WA9A 5BS7C 5B2ID 5GT3A 5B1LB 1P3AC 5B0YA 5CP6D 3MGQB 2NQBA 4NE5A 1P3IC 5B0ZB 4Z5TA 3REIB 3C1CB 3AZKB 3AZHA 1N1JB 5AV8B 1PZRA 5E5AD 3H0RC 4J8WC 2AROA 1M1AC 4WU9C 5DNND 5CHLB 2ZY5A 5B2JA 4WU8D 3LZ0C 1KU5A 3B0BA 1P3KA 1P3KC 4LD9D 1P3LD 5JRGB 3AZLB 5B2JC 3A6NB 2DQNC 3LZ1B 2FJ7B 1P3OA 3AV1B 4Z66A 3LELD 4J8WA 1KX3D 2BYKB 3MGQC 4EO5B 4NE3A 3AZHC 1W2EA 3VH5A 3MGRB 1P3GD 2Y2OA 3WKJB 4Z5TC 1B6WA 1P3IA 2BYKA 2IO5B 5G49B 5B0YC 1P3AA 2Y2JA 5B24C 4H9OB 1P34B 4QLCC 5B33D 5GT3C 3AV2B 3W99D 3W98C 3UT9B 2LY8A 5B32A 2JCHA 3WA9C 3B0DC 5AV6C 3LJAD 4R8PD 3W96D 5C3IC 5AV9C 3X1TD 4CAYB 5DNNC 1WWSA 1HQ3A 3X1SD 4KUDD 1M1AB 3KUYB 3REHB 3UTAB 2Y2KA 3AZKC 2RVQC 5B40D 5B0YB 3REIC 2F8NK 5B1LA 1M18B 1P3AD 1S32B 1M19B 3AYWA 3O62B 4G91B 1P3OB 3MGRC 3B6FD 3AN2D 4XUJC 3MNND 3MVDB 2NQBB 3MGPA 3WAAC 5DNMA 3AZHD 5AVBB 4YS3C 3AZLC 4JJNB 3X1UD 3MGSA 5B1MA 2AROD 4ZUXB 3KXBB 5AV8A 1ZLAA 2PYOC 3AZFA 3TU4D 3REKB 3WTPD 3AFAB 3REKA 1P3MD 1P3PC 4DRBA 4E44A 5AV5C 2CV5D 3C1CC 3UTBB 5GSUA 5AV6D 3REJB 3UTBA 2J8PA 4R8PC 3UT9C 3AZNB 3AZJA 2UWXA 4J8XB 4J8UD 3AZED 1F66C 5B40A 3MGQD 1P3BD 3MNNC 3AZKD 3KWQA 3AZGA 2YFVB 3AZIA 1ZLAD 2HIOC 3MVDA 3X1TA 3WTPA 4UUZB 3EPKA 3LJAA 2VQRA 1HQ3B 4LD9B 3X1VC 5GSUD 3NQJB 1A7WA 3A6ND 3LJAC 4AWLB 5AV9D 3WTPC 3X1TC 2FJ7D 4H9SC 1P3MC 3AFAA 3EPJA 3AV1D 3AZJD 1P3PD 3EG5B 2HUEB 4UPKA 3LELB 2CWEA 4H9RA 3AZGC 1BH9A 5CPID 3KWQC 3B0CT 1U35D 3WAAB 3WAAA 3MGRD 1EQZD 2FFFB 3O62A 2G5HC 2RVQD 4H9OA 4XZQA 5B40C 4WV4B 5AVCD 1M18C 5F99B 4G92C 3UT9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6B A;  3UT9 A;  4XUJ D;  4R8P A;  4J8U C;  3AV2 A;  1TZY B;  1F66 D;  1BFM A;  5AY8 C;  5CPK D;  4J8V D;  3AZF C;  4HGA B;  4X23 D;  2NZD D;  2BYM B;  1M1A D;  5B1M C;  3KUY D;  3MGS C;  4H9Q B;  3REH D;  3UTA D;  4YS3 A;  5AVB C;  4YS3 B;  3WTP E;  4ZUX C;  1P3A B;  3MGP C;  1S32 D;  1M19 D;  1KX5 B;  3W97 C;  4G92 B;  1P3B C;  1H3O A;  1P3O D;  3AN2 B;  5GT0 D;  3WKJ A;  3MNN B;  5B0Z A;  3MGR A;  1EQZ C;  2NQB D;  2IO5 C;  5JA4 B;  5AVC C;  3LEL C;  3AZE C;  3AZG B;  1P34 A;  2F8N H;  3REL C;  1U35 C;  5G49 A;  5BNX A;  3AZH B;  3AZK A;  4JJN D;  3X1U B;  1BH8 A;  4Z5T D;  4KHA A;  1HQ3 C;  4AWL C;  3LZ0 B;  3TU4 B;  3B0C W;  5CPK C;  5KDM B;  5JRG C;  4H9P B;  5DNN A;  1P3M B;  3LZ1 A;  3B0D B;  5AV6 B;  1P3K D;  4LD9 C;  5B32 C;  5CPI A;  1KX4 B;  2F8N A;  3AZN D;  3VH5 W;  4J8X D;  3W98 A;  4J8U B;  1R4V A;  4QLC A;  5B24 A;  3AZE B;  1P3B B;  4QLC B;  5FUG B;  4YM6 B;  3MGQ A;  1AOI A;  1ULY A;  4Z2M H;  4Z66 C;  1ZLA B;  4DRA A;  3W97 D;  5BT1 D;  3KXB A;  4G91 C;  1P3O C;  5GT0 C;  5KDM A;  4X23 C;  5BNX B;  1HQ3 D;  3TU4 A;  3LZ0 A;  5GSU B;  4H9N B;  5AV9 B;  5AY8 D;  1P3P B;  3AZJ B;  3X1U C;  4WU9 A;  4J8V C;  2ARO C;  1M1A A;  5CPI B;  2NZD C;  1U35 B;  3AYW D;  3REJ A;  3WA9 D;  3C1B B;  3WAA D;  3KSY A;  5JA4 A;  1EQZ B;  3W98 B;  2NQB C;  2F8N D;  3AN2 A;  5AVC B;  3AZM B;  1P3F B;  1H3O B;  5F99 D;  3MGP B;  4CSR B;  3AN2 C;  5BS7 A;  1BH8 B;  3R45 B;  4XUJ B;  5BNV A;  4KGC B;  3NQU A;  4CAY A;  5DNM D;  5AV5 D;  1TZY D;  1F66 B;  1KX4 C;  3REJ C;  5CPK B;  2NZD A;  4J8V B;  1TAF B;  4ZBJ C;  3VH6 T;  4J8V A;  3X1U A;  4X23 B;  2NZD B;  5B31 B;  1ID3 B;  2PYO D;  2F8N G;  3TU4 C;  4X23 A;  4YS3 D;  4YM6 C;  3B6G A;  3A6N A;  5CPJ B;  5GT0 A;  3KUY A;  1KX5 D;  3KXB C;  4NE6 A;  4Z66 B;  5GT0 B;  4KGC C;  1AOI C;  3B6G B;  1P3I D;  4J8X C;  3AZG D;  4CSR A;  1TZY A;  5E5A A;  5B2I A;  1N1J A;  5B32 B;  4XZQ D;  4Z5T B;  3AV1 C;  5B31 C;  3C1B C;  4WU8 A;  5CPI C;  3LZ0 D;  4LD9 A;  3NQU B;  4WU9 B;  2HUE C;  3LZ1 C;  5JRG A;  2JSS A;  1P3L A;  5CPK A;  1P3K B;  1ID3 C;  3X1V D;  1BH9 B;  4H9R B;  2CV5 A;  1KX4 D;  4WNN A;  2HIO D;  3AZN A;  2FJ7 A;  4WZS B;  3AZM C;  1P3F C;  5F99 C;  1U35 A;  3REL A;  5GXQ A;  5B24 B;  3LEL A;  4J8W D;  3AZE A;  5AVC A;  4QLC D;  5B33 C;  5GT3 D;  1P34 C;  5B0Z C;  1WWI A;  4YM6 D;  3VH6 A;  1EQZ A;  5CP6 A;  3WKJ C;  3VH6 W;  5GXQ B;  1KX3 C;  1KX5 C;  3W97 B;  1P3B A;  3KWQ B;  3W97 A;  5B1M B;  4ZUX A;  1P3G C;  3REH C;  5B2J D;  4JJN A;  3UTA C;  1AOI D;  4UUZ A;  5CPJ C;  5AVB A;  4HGA C;  3AZF B;  3AZI D;  5AY8 B;  2L5A A;  3X1S C;  4KUD C;  3MGS B;  5C3I B;  5BO0 B;  4H9P A;  3AYW B;  3WA9 B;  3C1B D;  5AY8 A;  3REL D;  3W96 C;  2YFW A;  3B6F C;  4J8U A;  3AV2 C;  3W99 C;  3W98 D;  2F8N B;  4NFT A;  3V9R A;  3AZM D;  1P3F D;  3MGP D;  5B2I B;  1S32 C;  1S32 A;  1M19 A;  1M18 A;  1M19 C;  1Q9C A;  5B1L D;  4XZQ C;  5CP6 B;  4KGC D;  3O62 C;  3W99 A;  3B6F A;  5B0Z D;  5DNM B;  1B67 A;  3W96 A;  5AV5 B;  3REI D;  3C1C D;  5AV8 D;  5E5A B;  1JFI B;  3AFA C;  5DNN B;  1P3M A;  4H9S A;  3X1S A;  4KUD A;  4WNN B;  4H9Q A;  5B31 D;  1ID3 D;  2PYO B;  4WU8 B;  3X1V A;  4KHA B;  3VH5 T;  1P3L B;  5JRG D;  1F1E A;  5CPJ A;  3AZL D;  1TAF A;  4JJN C;  3REH A;  5CPJ D;  3LZ1 D;  3UTA A;  1P3G A;  3MVD C;  2HIO A;  1KX5 A;  4Z66 D;  1KX3 A;  3AZI C;  1KX3 B;  5CP6 C;  3B6G D;  1P3I B;  5B32 G;  1P3G B;  5B33 A;  3MNN A;  3WKJ D;  5GXQ C;  5F99 A;  3AZM A;  1P3F A;  5B32 D;  1F66 A;  4XZQ B;  1P34 D;  5B33 B;  2FJ7 C;  3AV2 D;  3AZN C;  3W99 B;  3AZJ C;  1JFI A;  2CV5 C;  1ID3 A;  4EO5 C;  3UTB C;  1P3L C;  1HTA A;  5GSU C;  3C1C A;  2BYM A;  3LJA B;  4R8P B;  5AV5 A;  4WU9 D;  3W96 B;  3X1T B;  1P3P A;  3REK C;  3X1V B;  4H9N A;  4E45 A;  4WU8 C;  2PYO A;  3C1B A;  1ZLA C;  5AV8 C;  5B31 A;  2HIO B;  5BT1 C;  3AV1 A;  3X1S B;  4KUD B;  3V9R B;  5BO0 A;  3AZL A;  2YFW B;  5DNM C;  5B2I C;  5B40 B;  5E5A C;  1TZY C;  5B0Y D;  5B24 D;  4J8W B;  1M18 D;  5GT3 B;  4J8X A;  3O62 D;  3B6F B;  5BNV B;  4KGC A;  3R45 A;  4XUJ A;  5GXQ D;  3MVD D;  3KWQ D;  3AYW C;  5B1M D;  3KUY C;  5B1L C;  5B2J B;  3A6N C;  5FUG A;  4YM6 A;  3REI A;  1AOI B;  3B6G C;  5B31 G;  5AVB D;  3AZF D;  2YFV A;  4ZUX D;  2ARO B;  3AZI B;  3NQJ A;  3KXB D;  3MGS D;  4ZBJ B;  3REK D;  3WTP B;  3AFA D;  1KX4 A;  5AV9 A;  2CV5 B;  3REL B;  4Z2M G;  5AV6 A;  3UTB D;  3REJ D;  3WA9 A;  5BS7 C;  5B2I D;  5GT3 A;  5B1L B;  1P3A C;  5B0Y A;  5CP6 D;  3MGQ B;  2NQB A;  4NE5 A;  1P3I C;  5B0Z B;  4Z5T A;  3REI B;  3C1C B;  3AZK B;  3AZH A;  1N1J B;  5AV8 B;  5E5A D;  4J8W C;  2ARO A;  1M1A C;  4WU9 C;  5DNN D;  5CHL B;  5B2J A;  4WU8 D;  3LZ0 C;  1KU5 A;  3B0B A;  1P3K A;  1P3K C;  4LD9 D;  1P3L D;  5JRG B;  3AZL B;  5B2J C;  3A6N B;  3LZ1 B;  2FJ7 B;  1P3O A;  3AV1 B;  4Z66 A;  3LEL D;  4J8W A;  1KX3 D;  2BYK B;  3MGQ C;  4EO5 B;  4NE3 A;  3AZH C;  1P3G D;  3VH5 A;  3MGR B;  3WKJ B;  4Z5T C;  1B6W A;  1P3I A;  2BYK A;  2IO5 B;  5G49 B;  5B0Y C;  1P3A A;  5B24 C;  4H9O B;  1P34 B;  4QLC C;  5B33 D;  5GT3 C;  3AV2 B;  3W99 D;  3W98 C;  3UT9 B;  2LY8 A;  5B32 A;  3WA9 C;  3B0D C;  5AV6 C;  3LJA D;  4R8P D;  3W96 D;  5C3I C;  5AV9 C;  3X1T D;  4CAY B;  5DNN C;  1WWS A;  1HQ3 A;  3X1S D;  4KUD D;  1M1A B;  3KUY B;  3REH B;  3UTA B;  3AZK C;  2RVQ C;  5B40 D;  5B0Y B;  3REI C;  2F8N K;  5B1L A;  1M18 B;  1P3A D;  1S32 B;  1M19 B;  3AYW A;  3O62 B;  4G91 B;  1P3O B;  3MGR C;  3B6F D;  3AN2 D;  4XUJ C;  3MNN D;  3MVD B;  2NQB B;  3MGP A;  3WAA C;  5DNM A;  3AZH D;  5AVB B;  4YS3 C;  3AZL C;  4JJN B;  3X1U D;  3MGS A;  5B1M A;  2ARO D;  4ZUX B;  3KXB B;  5AV8 A;  1ZLA A;  2PYO C;  3AZF A;  3TU4 D;  3REK B;  3WTP D;  3AFA B;  3REK A;  1P3M D;  1P3P C;  4DRB A;  4E44 A;  5AV5 C;  2CV5 D;  3C1C C;  3UTB B;  5GSU A;  5AV6 D;  3REJ B;  3UTB A;  4R8P C;  3UT9 C;  3AZN B;  3AZJ A;  4J8X B;  4J8U D;  3AZE D;  1F66 C;  5B40 A;  3MGQ D;  1P3B D;  3MNN C;  3AZK D;  3KWQ A;  3AZG A;  2YFV B;  3AZI A;  1ZLA D;  2HIO C;  3MVD A;  3X1T A;  3WTP A;  4UUZ B;  3LJA A;  1HQ3 B;  4LD9 B;  3X1V C;  5GSU D;  3NQJ B;  1A7W A;  3A6N D;  3LJA C;  4AWL B;  5AV9 D;  3WTP C;  3X1T C;  2FJ7 D;  4H9S C;  1P3M C;  3AFA A;  3AV1 D;  1P3P D;  3AZJ D;  2HUE B;  3LEL B;  2CWE A;  4H9R A;  3AZG C;  1BH9 A;  5CPI D;  3KWQ C;  3B0C T;  1U35 D;  3WAA B;  3WAA A;  3MGR D;  1EQZ D;  3O62 A;  4H9O A;  2RVQ D;  4XZQ A;  5B40 C;  4WV4 B;  5AVC D;  1M18 C;  5F99 B;  4G92 C;  3UT9 D; 
#chains in the Genus database with same CATH topology
 4M6B A;  3UT9 A;  4XUJ D;  4R8P A;  4J8U C;  3AV2 A;  1TZY B;  1F66 D;  1BFM A;  5AY8 C;  3EPH A;  5CPK D;  4J8V D;  2ZY3 A;  3AZF C;  4HGA B;  4X23 D;  2NZD D;  2BYM B;  1M1A D;  5B1M C;  3KUY D;  3MGS C;  4H9Q B;  3REH D;  3UTA D;  4YS3 A;  5AVB C;  4YS3 B;  3WTP E;  4ZUX C;  1P3A B;  3MGP C;  1S32 D;  1M19 D;  1KX5 B;  3W97 C;  4G92 B;  1P3B C;  1H3O A;  1P3O D;  3AN2 B;  5GT0 D;  3IP4 C;  3WKJ A;  3MNN B;  5B0Z A;  3MGR A;  1EQZ C;  2NQB D;  2IO5 C;  5JA4 B;  5AVC C;  3LEL C;  3AZE C;  3AZG B;  1P34 A;  2F8N H;  2Y2H A;  3REL C;  1U35 C;  5G49 A;  2XD1 A;  5BNX A;  3AZH B;  3AZK A;  4JJN D;  3X1U B;  1BH8 A;  2Y2Q A;  4Z5T D;  1HQ3 C;  2Y2G A;  4KHA A;  3FDD A;  4AWL C;  3LZ0 B;  3TU4 B;  3B0C W;  5CPK C;  3EPL A;  5KDM B;  5JRG C;  4H9P B;  5DNN A;  1P3M B;  4DQY B;  3LZ1 A;  2Y2I A;  2Y2N A;  3B0D B;  5AV6 B;  1P3K D;  4LD9 C;  5B32 C;  2XD5 A;  5CPI A;  1KX4 B;  2F8N A;  3AZN D;  1Z2C B;  3VH5 W;  4J8X D;  3W98 A;  4J8U B;  1R4V A;  4QLC A;  5B24 A;  3AZE B;  2Y2M A;  1P3B B;  4QLC B;  5FUG B;  1T3U A;  4YM6 B;  3MGQ A;  1ULY A;  4Z2M H;  4Z66 C;  1AOI A;  1ZLA B;  4DRA A;  3W97 D;  5BT1 D;  3KXB A;  4G91 C;  1P3O C;  5GT0 C;  5KDM A;  4X23 C;  5BNX B;  1HQ3 D;  3TU4 A;  3LZ0 A;  5GSU B;  4H9N B;  5AV9 B;  5AY8 D;  1P3P B;  3AZJ B;  3X1U C;  2DF4 C;  4WU9 A;  4J8V C;  2ARO C;  1M1A A;  5CPI B;  2NZD C;  1U35 B;  3AYW D;  3REJ A;  3WA9 D;  3C1B B;  3WAA D;  3KSY A;  5JA4 A;  1EQZ B;  3W98 B;  2NQB C;  2F8N D;  3AN2 A;  5AVC B;  2ZY2 A;  3AZM B;  1H3O B;  1P3F B;  5F99 D;  3MGP B;  2F2A C;  4CSR B;  3AN2 C;  5BS7 A;  1BH8 B;  3R45 B;  4XUJ B;  5BNV A;  4KGC B;  3NQU A;  4CAY A;  5DNM D;  5AV5 D;  1TZY D;  1F66 B;  3KFU G;  1KX4 C;  3REJ C;  3A1K A;  5CPK B;  2NZD A;  3A1I A;  4J8V B;  1TAF B;  4ZBJ C;  3VH6 T;  4J8V A;  3X1U A;  4X23 B;  2NZD B;  5B31 B;  1ID3 B;  2PYO D;  2F8N G;  3TU4 C;  4X23 A;  3H0L C;  4YS3 D;  4YM6 C;  3B6G A;  3A6N A;  5CPJ B;  5GT0 A;  3KUY A;  1KX5 D;  3KXB C;  4NE6 A;  4Z66 B;  5GT0 B;  4KGC C;  1AOI C;  3B6G B;  1P3I D;  4J8X C;  3AZG D;  4CSR A;  1TZY A;  5E5A A;  5B2I A;  1N1J A;  5B32 B;  4XZQ D;  4Z5T B;  3H0M C;  3AV1 C;  5B31 C;  3C1B C;  4WU8 A;  5CPI C;  3LZ0 D;  4LD9 A;  3NQU B;  4WU9 B;  2HUE C;  3LZ1 C;  2Y2L A;  5JRG A;  2JSS A;  1P3L A;  5CPK A;  1P3K B;  1ID3 C;  3X1V D;  1BH9 B;  4H9R B;  2CV5 A;  1KX4 D;  4WNN A;  2HIO D;  3AZN A;  2Y2P A;  2FJ7 A;  4WZS B;  3AZM C;  1P3F C;  5F99 C;  1U35 A;  3REL A;  5GXQ A;  5B24 B;  3LEL A;  4J8W D;  3AZE A;  5AVC A;  4QLC D;  5B33 C;  5GT3 D;  1P34 C;  5B0Z C;  1WWI A;  4YM6 D;  3VH6 A;  1EQZ A;  5CP6 A;  3WKJ C;  3VH6 W;  5GXQ B;  1KX3 C;  1KX5 C;  3W97 B;  1P3B A;  3KWQ B;  3W97 A;  5B1M B;  4ZUX A;  1P3G C;  3REH C;  5B2J D;  4JJN A;  3UTA C;  1AOI D;  4UUZ A;  5CPJ C;  5AVB A;  4HGA C;  3AZF B;  3AZI D;  5AY8 B;  2G5I C;  2L5A A;  3X1S C;  4KUD C;  2BG1 A;  3MGS B;  5C3I B;  5BO0 B;  4H9P A;  3AYW B;  3WA9 B;  3C1B D;  5AY8 A;  3REL D;  3W96 C;  2YFW A;  3B6F C;  4J8U A;  3AV2 C;  3W99 C;  3W98 D;  2F8N B;  4NFT A;  3V9R A;  3AZM D;  1P3F D;  3MGP D;  5B2I B;  1S32 C;  1S32 A;  1M19 A;  1M18 A;  1M19 C;  1Q9C A;  5B1L D;  4XZQ C;  5CP6 B;  4KGC D;  3O62 C;  3W99 A;  3B6F A;  5B0Z D;  5DNM B;  1B67 A;  3W96 A;  5AV5 B;  3REI D;  3C1C D;  5AV8 D;  5E5A B;  1JFI B;  3AFA C;  5DNN B;  1P3M A;  4H9S A;  3X1S A;  4KUD A;  4WNN B;  4H9Q A;  5B31 D;  1ID3 D;  2PYO B;  4WU8 B;  3F6T A;  3X1V A;  4KHA B;  3VH5 T;  1P3L B;  5JRG D;  1F1E A;  5CPJ A;  3AZL D;  3AL0 C;  1TAF A;  2ZY4 A;  4JJN C;  3REH A;  5CPJ D;  3LZ1 D;  2JE5 A;  3UTA A;  1P3G A;  3MVD C;  2HIO A;  1KX5 A;  4Z66 D;  1KX3 A;  3AZI C;  1KX3 B;  5CP6 C;  3B6G D;  1P3I B;  5B32 G;  1P3G B;  2ZM5 A;  5B33 A;  3MNN A;  3WKJ D;  5GXQ C;  5F99 A;  3AZM A;  1P3F A;  5B32 D;  1F66 A;  4XZQ B;  1P34 D;  5B33 B;  2FJ7 C;  3AV2 D;  3AZN C;  3W99 B;  3AZJ C;  1JFI A;  2CV5 C;  4WJ3 C;  1ID3 A;  4EO5 C;  3UTB C;  1P3L C;  1HTA A;  5GSU C;  3C1C A;  2BYM A;  3LJA B;  4R8P B;  5AV5 A;  4WU9 D;  3W96 B;  3X1T B;  1P3P A;  3REK C;  3X1V B;  4H9N A;  3P5J B;  4E45 A;  4WU8 C;  2PYO A;  3C1B A;  1ZLA C;  5AV8 C;  5B31 A;  2HIO B;  5BT1 C;  3AV1 A;  3X1S B;  4KUD B;  3V9R B;  5BO0 A;  3AZL A;  2YFW B;  5DNM C;  5B2I C;  5B40 B;  5E5A C;  1TZY C;  5B0Y D;  5B24 D;  4J8W B;  1M18 D;  5GT3 B;  4J8X A;  3O62 D;  3B6F B;  5BNV B;  4KGC A;  3R45 A;  4XUJ A;  5GXQ D;  3MVD D;  3KWQ D;  3AYW C;  5B1M D;  3KUY C;  5B1L C;  5B2J B;  3A6N C;  5FUG A;  4YM6 A;  3REI A;  1AOI B;  3B6G C;  5B31 G;  5AVB D;  3AZF D;  2YFV A;  4ZUX D;  2ARO B;  3AZI B;  3NQJ A;  3KXB D;  3MGS D;  4ZBJ B;  3REK D;  3WTP B;  3AFA D;  1KX4 A;  5AV9 A;  2CV5 B;  2RIQ A;  3REL B;  4Z2M G;  5AV6 A;  2W8S A;  3UTB D;  3REJ D;  3WA9 A;  5BS7 C;  5B2I D;  5GT3 A;  5B1L B;  1P3A C;  5B0Y A;  5CP6 D;  3MGQ B;  2NQB A;  4NE5 A;  1P3I C;  5B0Z B;  4Z5T A;  3REI B;  3C1C B;  3AZK B;  3AZH A;  1N1J B;  5AV8 B;  1PZR A;  5E5A D;  3H0R C;  4J8W C;  2ARO A;  1M1A C;  4WU9 C;  5DNN D;  5CHL B;  2ZY5 A;  5B2J A;  4WU8 D;  3LZ0 C;  1KU5 A;  3B0B A;  1P3K A;  1P3K C;  4LD9 D;  1P3L D;  5JRG B;  3AZL B;  5B2J C;  3A6N B;  2DQN C;  3LZ1 B;  2FJ7 B;  1P3O A;  3AV1 B;  4Z66 A;  3LEL D;  4J8W A;  1KX3 D;  2BYK B;  3MGQ C;  4EO5 B;  4NE3 A;  3AZH C;  1W2E A;  3VH5 A;  3MGR B;  1P3G D;  2Y2O A;  3WKJ B;  4Z5T C;  1B6W A;  1P3I A;  2BYK A;  2IO5 B;  5G49 B;  5B0Y C;  1P3A A;  2Y2J A;  5B24 C;  4H9O B;  1P34 B;  4QLC C;  5B33 D;  5GT3 C;  3AV2 B;  3W99 D;  3W98 C;  3UT9 B;  2LY8 A;  5B32 A;  2JCH A;  3WA9 C;  3B0D C;  5AV6 C;  3LJA D;  4R8P D;  3W96 D;  5C3I C;  5AV9 C;  3X1T D;  4CAY B;  5DNN C;  1WWS A;  1HQ3 A;  3X1S D;  4KUD D;  1M1A B;  3KUY B;  3REH B;  3UTA B;  2Y2K A;  3AZK C;  2RVQ C;  5B40 D;  5B0Y B;  3REI C;  2F8N K;  5B1L A;  1M18 B;  1P3A D;  1S32 B;  1M19 B;  3AYW A;  3O62 B;  4G91 B;  1P3O B;  3MGR C;  3B6F D;  3AN2 D;  4XUJ C;  3MNN D;  3MVD B;  2NQB B;  3MGP A;  3WAA C;  5DNM A;  3AZH D;  5AVB B;  4YS3 C;  3AZL C;  4JJN B;  3X1U D;  3MGS A;  5B1M A;  2ARO D;  4ZUX B;  3KXB B;  5AV8 A;  1ZLA A;  2PYO C;  3AZF A;  3TU4 D;  3REK B;  3WTP D;  3AFA B;  3REK A;  1P3M D;  1P3P C;  4DRB A;  4E44 A;  5AV5 C;  2CV5 D;  3C1C C;  3UTB B;  5GSU A;  5AV6 D;  3REJ B;  3UTB A;  2J8P A;  4R8P C;  3UT9 C;  3AZN B;  3AZJ A;  2UWX A;  4J8X B;  4J8U D;  3AZE D;  1F66 C;  5B40 A;  3MGQ D;  1P3B D;  3MNN C;  3AZK D;  3KWQ A;  3AZG A;  2YFV B;  3AZI A;  1ZLA D;  2HIO C;  3MVD A;  3X1T A;  3WTP A;  4UUZ B;  3EPK A;  3LJA A;  2VQR A;  1HQ3 B;  4LD9 B;  3X1V C;  5GSU D;  3NQJ B;  1A7W A;  3A6N D;  3LJA C;  4AWL B;  5AV9 D;  3WTP C;  3X1T C;  2FJ7 D;  4H9S C;  1P3M C;  3AFA A;  3EPJ A;  3AV1 D;  3AZJ D;  1P3P D;  3EG5 B;  2HUE B;  4UPK A;  3LEL B;  2CWE A;  4H9R A;  3AZG C;  1BH9 A;  5CPI D;  3KWQ C;  3B0C T;  1U35 D;  3WAA B;  3WAA A;  3MGR D;  1EQZ D;  2FFF B;  3O62 A;  2G5H C;  2RVQ D;  4H9O A;  4XZQ A;  5B40 C;  4WV4 B;  5AVC D;  1M18 C;  5F99 B;  4G92 C;  3UT9 D; 
#chains in the Genus database with same CATH homology
 4M6B A;  3UT9 A;  4XUJ D;  4R8P A;  4J8U C;  3AV2 A;  1TZY B;  1F66 D;  1BFM A;  5AY8 C;  3EPH A;  5CPK D;  4J8V D;  2ZY3 A;  3AZF C;  4HGA B;  4X23 D;  2NZD D;  2BYM B;  1M1A D;  5B1M C;  3KUY D;  3MGS C;  4H9Q B;  3REH D;  3UTA D;  4YS3 A;  5AVB C;  4YS3 B;  3WTP E;  4ZUX C;  1P3A B;  3MGP C;  1S32 D;  1M19 D;  1KX5 B;  3W97 C;  4G92 B;  1P3B C;  1H3O A;  1P3O D;  3AN2 B;  5GT0 D;  3IP4 C;  3WKJ A;  3MNN B;  5B0Z A;  3MGR A;  1EQZ C;  2NQB D;  2IO5 C;  5JA4 B;  5AVC C;  3LEL C;  3AZE C;  3AZG B;  1P34 A;  2F8N H;  2Y2H A;  3REL C;  1U35 C;  5G49 A;  2XD1 A;  5BNX A;  3AZH B;  3AZK A;  4JJN D;  3X1U B;  1BH8 A;  2Y2Q A;  4Z5T D;  1HQ3 C;  2Y2G A;  4KHA A;  3FDD A;  4AWL C;  3LZ0 B;  3TU4 B;  3B0C W;  5CPK C;  3EPL A;  5KDM B;  5JRG C;  4H9P B;  5DNN A;  1P3M B;  4DQY B;  3LZ1 A;  2Y2I A;  2Y2N A;  3B0D B;  5AV6 B;  1P3K D;  4LD9 C;  5B32 C;  2XD5 A;  5CPI A;  1KX4 B;  2F8N A;  3AZN D;  1Z2C B;  3VH5 W;  4J8X D;  3W98 A;  4J8U B;  1R4V A;  4QLC A;  5B24 A;  3AZE B;  2Y2M A;  1P3B B;  4QLC B;  5FUG B;  1T3U A;  4YM6 B;  3MGQ A;  1ULY A;  4Z2M H;  4Z66 C;  1AOI A;  1ZLA B;  4DRA A;  3W97 D;  5BT1 D;  3KXB A;  4G91 C;  1P3O C;  5GT0 C;  5KDM A;  4X23 C;  5BNX B;  1HQ3 D;  3TU4 A;  3LZ0 A;  5GSU B;  4H9N B;  5AV9 B;  5AY8 D;  1P3P B;  3AZJ B;  3X1U C;  2DF4 C;  4WU9 A;  4J8V C;  2ARO C;  1M1A A;  5CPI B;  2NZD C;  1U35 B;  3AYW D;  3REJ A;  3WA9 D;  3C1B B;  3WAA D;  3KSY A;  5JA4 A;  1EQZ B;  3W98 B;  2NQB C;  2F8N D;  3AN2 A;  5AVC B;  2ZY2 A;  3AZM B;  1H3O B;  1P3F B;  5F99 D;  3MGP B;  2F2A C;  4CSR B;  3AN2 C;  5BS7 A;  1BH8 B;  3R45 B;  4XUJ B;  5BNV A;  4KGC B;  3NQU A;  4CAY A;  5DNM D;  5AV5 D;  1TZY D;  1F66 B;  3KFU G;  1KX4 C;  3REJ C;  3A1K A;  5CPK B;  2NZD A;  3A1I A;  4J8V B;  1TAF B;  4ZBJ C;  3VH6 T;  4J8V A;  3X1U A;  4X23 B;  2NZD B;  5B31 B;  1ID3 B;  2PYO D;  2F8N G;  3TU4 C;  4X23 A;  3H0L C;  4YS3 D;  4YM6 C;  3B6G A;  3A6N A;  5CPJ B;  5GT0 A;  3KUY A;  1KX5 D;  3KXB C;  4NE6 A;  4Z66 B;  5GT0 B;  4KGC C;  1AOI C;  3B6G B;  1P3I D;  4J8X C;  3AZG D;  4CSR A;  1TZY A;  5E5A A;  5B2I A;  1N1J A;  5B32 B;  4XZQ D;  4Z5T B;  3H0M C;  3AV1 C;  5B31 C;  3C1B C;  4WU8 A;  5CPI C;  3LZ0 D;  4LD9 A;  3NQU B;  4WU9 B;  2HUE C;  3LZ1 C;  2Y2L A;  5JRG A;  2JSS A;  1P3L A;  5CPK A;  1P3K B;  1ID3 C;  3X1V D;  1BH9 B;  4H9R B;  2CV5 A;  1KX4 D;  4WNN A;  2HIO D;  3AZN A;  2Y2P A;  2FJ7 A;  4WZS B;  3AZM C;  1P3F C;  5F99 C;  1U35 A;  3REL A;  5GXQ A;  5B24 B;  3LEL A;  4J8W D;  3AZE A;  5AVC A;  4QLC D;  5B33 C;  5GT3 D;  1P34 C;  5B0Z C;  1WWI A;  4YM6 D;  3VH6 A;  1EQZ A;  5CP6 A;  3WKJ C;  3VH6 W;  5GXQ B;  1KX3 C;  1KX5 C;  3W97 B;  1P3B A;  3KWQ B;  3W97 A;  5B1M B;  4ZUX A;  1P3G C;  3REH C;  5B2J D;  4JJN A;  3UTA C;  1AOI D;  4UUZ A;  5CPJ C;  5AVB A;  4HGA C;  3AZF B;  3AZI D;  5AY8 B;  2G5I C;  2L5A A;  3X1S C;  4KUD C;  2BG1 A;  3MGS B;  5C3I B;  5BO0 B;  4H9P A;  3AYW B;  3WA9 B;  3C1B D;  5AY8 A;  3REL D;  3W96 C;  2YFW A;  3B6F C;  4J8U A;  3AV2 C;  3W99 C;  3W98 D;  2F8N B;  4NFT A;  3V9R A;  3AZM D;  1P3F D;  3MGP D;  5B2I B;  1S32 C;  1S32 A;  1M19 A;  1M18 A;  1M19 C;  1Q9C A;  5B1L D;  4XZQ C;  5CP6 B;  4KGC D;  3O62 C;  3W99 A;  3B6F A;  5B0Z D;  5DNM B;  1B67 A;  3W96 A;  5AV5 B;  3REI D;  3C1C D;  5AV8 D;  5E5A B;  1JFI B;  3AFA C;  5DNN B;  1P3M A;  4H9S A;  3X1S A;  4KUD A;  4WNN B;  4H9Q A;  5B31 D;  1ID3 D;  2PYO B;  4WU8 B;  3F6T A;  3X1V A;  4KHA B;  3VH5 T;  1P3L B;  5JRG D;  1F1E A;  5CPJ A;  3AZL D;  3AL0 C;  1TAF A;  2ZY4 A;  4JJN C;  3REH A;  5CPJ D;  3LZ1 D;  2JE5 A;  3UTA A;  1P3G A;  3MVD C;  2HIO A;  1KX5 A;  4Z66 D;  1KX3 A;  3AZI C;  1KX3 B;  5CP6 C;  3B6G D;  1P3I B;  5B32 G;  1P3G B;  2ZM5 A;  5B33 A;  3MNN A;  3WKJ D;  5GXQ C;  5F99 A;  3AZM A;  1P3F A;  5B32 D;  1F66 A;  4XZQ B;  1P34 D;  5B33 B;  2FJ7 C;  3AV2 D;  3AZN C;  3W99 B;  3AZJ C;  1JFI A;  2CV5 C;  4WJ3 C;  1ID3 A;  4EO5 C;  3UTB C;  1P3L C;  1HTA A;  5GSU C;  3C1C A;  2BYM A;  3LJA B;  4R8P B;  5AV5 A;  4WU9 D;  3W96 B;  3X1T B;  1P3P A;  3REK C;  3X1V B;  4H9N A;  3P5J B;  4E45 A;  4WU8 C;  2PYO A;  3C1B A;  1ZLA C;  5AV8 C;  5B31 A;  2HIO B;  5BT1 C;  3AV1 A;  3X1S B;  4KUD B;  3V9R B;  5BO0 A;  3AZL A;  2YFW B;  5DNM C;  5B2I C;  5B40 B;  5E5A C;  1TZY C;  5B0Y D;  5B24 D;  4J8W B;  1M18 D;  5GT3 B;  4J8X A;  3O62 D;  3B6F B;  5BNV B;  4KGC A;  3R45 A;  4XUJ A;  5GXQ D;  3MVD D;  3KWQ D;  3AYW C;  5B1M D;  3KUY C;  5B1L C;  5B2J B;  3A6N C;  5FUG A;  4YM6 A;  3REI A;  1AOI B;  3B6G C;  5B31 G;  5AVB D;  3AZF D;  2YFV A;  4ZUX D;  2ARO B;  3AZI B;  3NQJ A;  3KXB D;  3MGS D;  4ZBJ B;  3REK D;  3WTP B;  3AFA D;  1KX4 A;  5AV9 A;  2CV5 B;  2RIQ A;  3REL B;  4Z2M G;  5AV6 A;  2W8S A;  3UTB D;  3REJ D;  3WA9 A;  5BS7 C;  5B2I D;  5GT3 A;  5B1L B;  1P3A C;  5B0Y A;  5CP6 D;  3MGQ B;  2NQB A;  4NE5 A;  1P3I C;  5B0Z B;  4Z5T A;  3REI B;  3C1C B;  3AZK B;  3AZH A;  1N1J B;  5AV8 B;  1PZR A;  5E5A D;  3H0R C;  4J8W C;  2ARO A;  1M1A C;  4WU9 C;  5DNN D;  5CHL B;  2ZY5 A;  5B2J A;  4WU8 D;  3LZ0 C;  1KU5 A;  3B0B A;  1P3K A;  1P3K C;  4LD9 D;  1P3L D;  5JRG B;  3AZL B;  5B2J C;  3A6N B;  2DQN C;  3LZ1 B;  2FJ7 B;  1P3O A;  3AV1 B;  4Z66 A;  3LEL D;  4J8W A;  1KX3 D;  2BYK B;  3MGQ C;  4EO5 B;  4NE3 A;  3AZH C;  1W2E A;  3VH5 A;  3MGR B;  1P3G D;  2Y2O A;  3WKJ B;  4Z5T C;  1B6W A;  1P3I A;  2BYK A;  2IO5 B;  5G49 B;  5B0Y C;  1P3A A;  2Y2J A;  5B24 C;  4H9O B;  1P34 B;  4QLC C;  5B33 D;  5GT3 C;  3AV2 B;  3W99 D;  3W98 C;  3UT9 B;  2LY8 A;  5B32 A;  2JCH A;  3WA9 C;  3B0D C;  5AV6 C;  3LJA D;  4R8P D;  3W96 D;  5C3I C;  5AV9 C;  3X1T D;  4CAY B;  5DNN C;  1WWS A;  1HQ3 A;  3X1S D;  4KUD D;  1M1A B;  3KUY B;  3REH B;  3UTA B;  2Y2K A;  3AZK C;  2RVQ C;  5B40 D;  5B0Y B;  3REI C;  2F8N K;  5B1L A;  1M18 B;  1P3A D;  1S32 B;  1M19 B;  3AYW A;  3O62 B;  4G91 B;  1P3O B;  3MGR C;  3B6F D;  3AN2 D;  4XUJ C;  3MNN D;  3MVD B;  2NQB B;  3MGP A;  3WAA C;  5DNM A;  3AZH D;  5AVB B;  4YS3 C;  3AZL C;  4JJN B;  3X1U D;  3MGS A;  5B1M A;  2ARO D;  4ZUX B;  3KXB B;  5AV8 A;  1ZLA A;  2PYO C;  3AZF A;  3TU4 D;  3REK B;  3WTP D;  3AFA B;  3REK A;  1P3M D;  1P3P C;  4DRB A;  4E44 A;  5AV5 C;  2CV5 D;  3C1C C;  3UTB B;  5GSU A;  5AV6 D;  3REJ B;  3UTB A;  2J8P A;  4R8P C;  3UT9 C;  3AZN B;  3AZJ A;  2UWX A;  4J8X B;  4J8U D;  3AZE D;  1F66 C;  5B40 A;  3MGQ D;  1P3B D;  3MNN C;  3AZK D;  3KWQ A;  3AZG A;  2YFV B;  3AZI A;  1ZLA D;  2HIO C;  3MVD A;  3X1T A;  3WTP A;  4UUZ B;  3EPK A;  3LJA A;  2VQR A;  1HQ3 B;  4LD9 B;  3X1V C;  5GSU D;  3NQJ B;  1A7W A;  3A6N D;  3LJA C;  4AWL B;  5AV9 D;  3WTP C;  3X1T C;  2FJ7 D;  4H9S C;  1P3M C;  3AFA A;  3EPJ A;  3AV1 D;  3AZJ D;  1P3P D;  3EG5 B;  2HUE B;  4UPK A;  3LEL B;  2CWE A;  4H9R A;  3AZG C;  1BH9 A;  5CPI D;  3KWQ C;  3B0C T;  1U35 D;  3WAA B;  3WAA A;  3MGR D;  1EQZ D;  2FFF B;  3O62 A;  2G5H C;  2RVQ D;  4H9O A;  4XZQ A;  5B40 C;  4WV4 B;  5AVC D;  1M18 C;  5F99 B;  4G92 C;  3UT9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...