1P3LA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lA00
4Z66B 3REJB 3AYWD 1KX4A 3MGQD 3WTPA 1P3AA 4J8XA 5C3IB 3A6NB 1M1AC 2NQBC 1BH9A 3WKJC 5B2IC 5GT0C 3NQJB 4R8PC 1ID3A 2HIOB 3W97A 4QLCC 5BT1D 4YM6C 3UTAD 3MGRA 4UUZB 3AFAD 4WZSB 1P3FA 2F8NK 1P3GA 3LJAA 4Z5TB 5BNXA 4CAYA 1S32A 5G49B 2HUEC 4WNNB 3LZ1D 5CHLB 3X1VB 3MGSD 1F66D 5AY8C 3LZ0C 4J8VC 5E5AD 3R45A 5GT3C 1JFIA 4KUDB 3TU4A 4JJNC 3REIB 4H9PA 1KX5B 1AOID 3AN2D 1P3KC 3AZIC 4DRAA 2FJ7D 4EO5B 5AV8D 3UTBB 3W96B 5CPIB 5B1MC 3AV1D 3B6FA 5B31B 3MGPB 3O62B 3REKD 5KDMA 2PYOB 1JFIB 1HQ3B 3REHC 3UTAC 1BFMA 3NQUA 5GT0A 4WU8D 1P3IB 4R8PA 3KXBA 5B40C 2F8NA 2NZDB 1TZYA 4QLCA 3RELC 1WWSA 4YM6A 5B0YA 4H9RB 5B24D 5AV6C 4AWLC 2AROA 1M1AB 2NQBB 2YFWB 3WKJB 4LD9A 5DNMA 4YS3A 5B2IB 3NQUB 3X1TC 5GT0B 3WA9D 4CSRA 1ZLAD 3MNND 5B0ZC 4J8WA 4Z5TD 4HGAB 3LELD 3X1SA 1M19D 5CPJA 3AV2D 4J8UC 4XZQD 5AVCB 1KX4C 3AZFD 3AYWA 3WTPC 3AZMD 1P3MD 4J8XC 3MGQA 5BO0B 1N1JB 3REKC 1M18D 3KWQD 2L5AA 5AY8B 3LZ0B 3W99D 3AZND 3W97C 4J8VB 3W96D 5CPID 1TAFB 5DNND 5GT3B 5BS7A 3MGRC 3REHA 3UTAA 4ZUXD 4JJNB 1P3PD 5B40A 1P3KB 3AFAA 1HQ3D 5B32D 2RVQD 3AZIB 1P3FC 5B32G 5B1MB 1S32C 4KHAA 5B33B 3KUYB 4E44A 5AV9D 1P34D 1F66A 5AV5D 3MGSA 1M19C 4H9NB 5JRGD 2CV5D 5E5AA 3RELB 3AZEB 4WU9D 4DRBA 5GXQC 3AZKD 3TU4C 1KX3D 4NFTA 5AV6B 1AOIA 3AN2A 5AVBD 4AWLB 3UT9D 3AZGD 1P3LD 2FJ7A 1H3OA 4G91C 3X1TB 3C1BB 3B6FC 5GSUD 3X1UD 5B0ZB 3REKA 3AZHC 1EQZD 5CPKD 4KGCD 3AZJD 2F8NH 4J8UB 3KXBC 2BYMB 1WWIA 4WU8A 1TZYC 3MVDD 5CP6D 5B32C 1BH8A 3B6GD 1KX4B 1P3IC 5B0YC 1ULYA 4XUJD 3WTPB 4X23D 3B0BA 1P3AB 4J8XB 5JA4A 5B2JD 5B24A 2AROC 1BH9B 3V9RA 4LD9C 5DNMC 3AZLD 1U35D 4YS3C 1ID3B 5B1LD 3W97B 3WA9A 1ZLAA 4J8WC 3MNNA 5B33D 3MGRB 3X1SC 5F99D 5CPJC 3KUYD 3B0CW 1M19A 3B0CT 3AV2A 3WAAD 1P3BD 1P3FB 1P3GB 3LJAB 5GXQA 3AYWC 5BNXB 4CAYB 3MGQC 3AZFA 1S32B 3AZMA 3W98D 3AZED 3C1CD 1P3OD 1M18A 3KWQA 4KGCC 4Z66D 3REJD 3W99A 3R45B 1F1EA 3AZNA 3AZHA 5BS7C 5BT1C 2BYKA 5DNNA 3TU4B 3B6GC 3A6ND 4H9PB 4ZUXA 3AFAC 1P3PA 5B32A 2HIOD 5BNVA 1U35C 4G91B 3B6FB 4ZBJC 5KDMB 4H9OA 1P3AD 3B0DC 1P34A 3LZ1C 1F66C 3MGSC 4R8PB 3KXBB 2F8NB 5AV5A 3WAAC 1TZYB 5E5AC 4QLCB 5JRGA 2CV5A 4YM6B 1ID3D 5B0YB 4WU9A 3AZKA 1KX3A 1AOIC 3X1VD 3AN2C 2AROB 2FJ7C 3UT9A 5AV8C 3AZGA 5FUGA 5DNMB 1P3LA 4LD9B 3VH5A 4YS3B 4CSRB 3AV1C 4KUDD 4Z66C 2HUEB 3LJAD 4J8WB 5GSUA 3REID 3X1UA 1KX5D 1EQZA 5CPKA 3X1SB 4KGCA 5CPJB 2YFVA 3AZJA 3UTBD 4WU8C 3MVDA 5CP6A 5B31D 3MGPD 3O62D 3B6GA 3AYWB 1KU5A 3MGQB 2PYOD 4X23A 4XUJA 5B24C 4H9QA 4Z2MG 1Q9CA 5B2JA 1P3ID 2NZDD 3AZLA 1U35A 3VH6A 3WA9C 1ZLAC 5B1LA 3MNNC 4Z5TC 3REHB 3UTAB 3KSYA 3LELC 3LZ1A 5F99A 1M1AD 2NQBD 3AV2C 5B40B 3WKJD 3AFAB 4XZQC 3WAAA 4NE6A 5B2ID 5GT0D 1P3BA 4R8PD 3AZFC 4KHAB 3AZMC 1P3MC 4ZBJB 3W98A 4M6BA 3C1CA 3KWQC 1M18C 5AV8A 3LZ1B 1F66B 3MGSB 5AVCD 3W99C 3AV1A 4NE5A 3AZNC 4Z66A 3REJA 3W96C 5E5AB 5CPIC 2IO5C 5DNNC 4E45A 4ZUXC 3A6NA 1AOIB 1P3PC 3AN2B 1HQ3C 5AY8D 3VH5W 2RVQC 3VH5T 3WTPE 3LZ0D 2FJ7B 4J8VD 1H3OB 3NQJA 2HIOA 3AV1B 1R4VA 5GT3D 1B67A 3REKB 1HTAA 4JJND 4H9SC 4UUZA 5AV9C 1P34C 1P3KD 3AZID 5AV5C 4WU8B 5B1MD 5JRGC 2CV5C 1BH8B 4Z5TA 1A7WA 4NE3A 4WU9C 3AZKC 3LELA 5G49A 5JA4B 1KX3C 5B24B 4WNNA 4XZQA 3REHD 4HGAC 3X1VA 3V9RB 5AVBC 3UT9C 3AZGC 1P3LC 3VH6W 5B40D 3VH6T 3RELD 1P3MA 2JSSA 3WA9B 5AVCC 1ZLAB 5GSUC 4KUDA 3X1UC 3MNNB 1EQZC 5CPKC 5AV6D 3REIA 1KX5A 3LELB 3AZJC 1M19B 3AV2B 4XZQB 3UTBA 3W96A 3MVDC 5CPIA 5CP6C 3X1TD 3C1BD 5GXQB 3AZFB 5B31A 3MGPA 3O62A 5B0ZD 4XUJC 4X23C 3AZMB 1P3MB 2PYOA 5B2JC 1HQ3A 4J8UD 1M18B 3KWQB 4G92C 3AZLC 1P3IA 2NZDA 3W99B 1KX4D 3AZNB 5B1LC 3WTPD 3AZHB 4J8XD 4H9SA 2IO5B 4H9RA 5DNNB 2BYKB 5AV9A 5B33C 5F99C 4ZUXB 3KUYC 1M1AA 1P3PB 2YFWA 2NQBA 3WKJA 1P3BC 5B32B 5B2IA 3W97D 5BNVB 3W98C 3MGRD 3AZEC 4H9OB 3C1CC 5AVBA 1P34B 5AV9B 1P3OC 1P3FD 5AV5B 1P3GD 3REJC 5AVCA 5JRGB 2CV5B 1S32D 3C1BC 5C3IC 4WU9B 3AZKB 5BO0A 3A6NC 1KX3B 1N1JA 5AVBB 3UT9B 5AY8A 5FUGB 3LZ0A 3AZGB 1P3LB 2HIOC 4J8VA 5B31G 1TAFA 5GXQD 5GT3A 3TU4D 5GSUB 3X1UB 1P3AC 1EQZB 4JJNA 5CPKB 4KGCB 2YFVB 3AZJB 1P3KA 3AZIA 4WV4B 3MVDB 5CP6B 3B6FD 5B1MA 3B6GB 1ID3C 5B33A 4X23B 4XUJB 3AZHD 3KUYA 4H9QB 5B2JB 3X1VC 3KXBD 4G92B 2F8ND 3AZLB 1TZYD 4QLCD 1U35B 4H9NA 2F8NG 4YM6D 5B0YD 3RELA 5B1LB 3AZEA 1P3GC 4KUDC 3LJAC 3B0DB 1B6WA 3REIC 1KX5C 1P3OA 5AV6A 2AROD 5F99B 4EO5C 4LD9D 5DNMD 3UTBC 3WAAB 4YS3D 1P3BB 4Z2MH 3C1BA 3X1TA 5B31C 3MGPC 3O62C 2CWEA 4J8WD 2PYOC 5B0ZA 3W98B 3X1SD 5CPJD 3C1CB 5AV8B 2LY8A 1P3OB 4J8UA 2BYMA 2NZDC
chains in the Genus database with same CATH superfamily
4Z66B 3REJB 3AYWD 1KX4A 3MGQD 3WTPA 1P3AA 4J8XA 5C3IB 3A6NB 1M1AC 2NQBC 1BH9A 3WKJC 3EPKA 5B2IC 5GT0C 3NQJB 4R8PC 1ID3A 2HIOB 3W97A 3EPHA 4QLCC 5BT1D 4YM6C 3UTAD 3MGRA 4UUZB 2Y2LA 3AFAD 4WZSB 1P3FA 2F8NK 1P3GA 3LJAA 4Z5TB 5BNXA 4CAYA 1S32A 5G49B 2HUEC 2VQRA 4WNNB 3LZ1D 5CHLB 3X1VB 3MGSD 1F66D 5AY8C 3LZ0C 4J8VC 5E5AD 3R45A 5GT3C 1JFIA 4KUDB 3TU4A 4JJNC 3REIB 4H9PA 1KX5B 1AOID 3AN2D 1P3KC 3AZIC 4DRAA 2FJ7D 4EO5B 5AV8D 3UTBB 3W96B 5CPIB 5B1MC 3AV1D 3B6FA 5B31B 3MGPB 3O62B 3H0MC 3REKD 2Y2KA 2ZY5A 5KDMA 2Y2NA 2PYOB 1JFIB 1HQ3B 3REHC 3UTAC 1BFMA 3NQUA 5GT0A 4WU8D 1P3IB 4R8PA 3KXBA 5B40C 2F8NA 2NZDB 1TZYA 4QLCA 3RELC 1WWSA 3F6TA 4YM6A 5B0YA 4H9RB 5B24D 5AV6C 4AWLC 2AROA 1M1AB 1W2EA 2YFWB 2NQBB 3WKJB 4LD9A 5DNMA 4YS3A 5B2IB 3NQUB 3X1TC 5GT0B 3WA9D 2G5IC 4CSRA 1ZLAD 3MNND 5B0ZC 4J8WA 4Z5TD 4HGAB 1T3UA 3LELD 2JCHA 3X1SA 1M19D 5CPJA 3AV2D 4J8UC 4XZQD 4UPKA 5AVCB 1KX4C 3AZFD 3AYWA 3WTPC 3AZMD 1P3MD 2UWXA 3MGQA 4J8XC 5BO0B 1N1JB 3REKC 1M18D 3KWQD 2L5AA 5AY8B 3LZ0B 3W99D 2JE5A 3AZND 3W97C 4J8VB 3W96D 5CPID 1TAFB 5DNND 5GT3B 5BS7A 3MGRC 3REHA 3UTAA 4ZUXD 4JJNB 1P3PD 5B40A 1P3KB 3AFAA 1HQ3D 5B32D 2RVQD 3AZIB 1P3FC 3A1IA 5B32G 5B1MB 1S32C 4KHAA 5B33B 2BG1A 3KUYB 4E44A 5AV9D 1P34D 2Y2HA 1F66A 5AV5D 3MGSA 1M19C 4DQYB 4H9NB 5JRGD 2CV5D 5E5AA 3RELB 3AZEB 4WU9D 4DRBA 5GXQC 3AZKD 3TU4C 2F2AC 1KX3D 4NFTA 5AV6B 1AOIA 3AN2A 5AVBD 4AWLB 3UT9D 3AZGD 1P3LD 3IP4C 2FJ7A 1H3OA 4G91C 3X1TB 3C1BB 3B6FC 5GSUD 2J8PA 3X1UD 5B0ZB 3REKA 3AZHC 1EQZD 5CPKD 4KGCD 3AZJD 2F8NH 4J8UB 3KXBC 2BYMB 3H0LC 1WWIA 4WU8A 1TZYC 2DF4C 5CP6D 3MVDD 5B32C 1BH8A 3B6GD 1KX4B 1P3IC 5B0YC 1ULYA 4XUJD 3WTPB 4X23D 3B0BA 1P3AB 4J8XB 2G5HC 5JA4A 5B2JD 5B24A 3EPLA 2AROC 3AL0C 1BH9B 3V9RA 4LD9C 5DNMC 3AZLD 1U35D 4YS3C 1ID3B 5B1LD 3W97B 3WA9A 1ZLAA 4J8WC 3MNNA 5B33D 3MGRB 3X1SC 5F99D 5CPJC 3KUYD 1PZRA 3B0CW 1M19A 3B0CT 3AV2A 3WAAD 1P3BD 1P3FB 1P3GB 3LJAB 5GXQA 3AYWC 2ZY4A 5BNXB 4CAYB 3MGQC 3AZFA 1S32B 3AZMA 3W98D 3AZED 3C1CD 1P3OD 1M18A 3KWQA 4KGCC 4Z66D 3REJD 3W99A 3R45B 1F1EA 3AZNA 3KFUG 3AZHA 5BS7C 5BT1C 2BYKA 5DNNA 3TU4B 3B6GC 4WJ3C 3A6ND 4H9PB 4ZUXA 3AFAC 1P3PA 5B32A 2HIOD 5BNVA 1U35C 4G91B 3B6FB 2XD5A 4ZBJC 5KDMB 4H9OA 1P3AD 3B0DC 1P34A 3LZ1C 2Y2OA 1F66C 3MGSC 4R8PB 3KXBB 3EPJA 5AV5A 2F8NB 3WAAC 1TZYB 5E5AC 4QLCB 5JRGA 2CV5A 4YM6B 1ID3D 5B0YB 4WU9A 3AZKA 1KX3A 1AOIC 3X1VD 3AN2C 2AROB 2FJ7C 3UT9A 5AV8C 3AZGA 5FUGA 5DNMB 1P3LA 4LD9B 3VH5A 4YS3B 4CSRB 3AV1C 4KUDD 4Z66C 2HUEB 3LJAD 4J8WB 5GSUA 3REID 3X1UA 1KX5D 1EQZA 5CPKA 3X1SB 4KGCA 5CPJB 2YFVA 3AZJA 3UTBD 4WU8C 3MVDA 5CP6A 5B31D 3MGPD 3O62D 3B6GA 3AYWB 1KU5A 3MGQB 2PYOD 4X23A 4XUJA 5B24C 4H9QA 4Z2MG 1Q9CA 5B2JA 1P3ID 2NZDD 3AZLA 1U35A 3VH6A 3WA9C 1ZLAC 5B1LA 3MNNC 4Z5TC 3REHB 3UTAB 3KSYA 3LELC 3LZ1A 3A1KA 5F99A 1M1AD 2NQBD 3AV2C 5B40B 2W8SA 3WKJD 3AFAB 4XZQC 3WAAA 4NE6A 5B2ID 5GT0D 1P3BA 4R8PD 3AZFC 4KHAB 3AZMC 1P3MC 4ZBJB 3W98A 4M6BA 2Y2JA 3C1CA 3KWQC 1M18C 5AV8A 3LZ1B 1F66B 3MGSB 5AVCD 3W99C 3AV1A 4NE5A 3AZNC 4Z66A 3REJA 2FFFB 3W96C 5E5AB 5CPIC 2IO5C 5DNNC 4E45A 4ZUXC 3A6NA 1AOIB 1P3PC 3AN2B 1HQ3C 2ZY2A 5AY8D 2RVQC 3VH5T 3VH5W 3WTPE 3LZ0D 2FJ7B 4J8VD 1H3OB 3NQJA 2HIOA 3AV1B 1R4VA 5GT3D 1B67A 3REKB 1HTAA 4JJND 4H9SC 4UUZA 5AV9C 1P34C 1P3KD 3AZID 5AV5C 4WU8B 5B1MD 5JRGC 2CV5C 1BH8B 2Y2PA 4Z5TA 1A7WA 4NE3A 4WU9C 3AZKC 3LELA 5G49A 5JA4B 1KX3C 5B24B 4WNNA 4XZQA 3REHD 4HGAC 3X1VA 3V9RB 5AVBC 3UT9C 3AZGC 1P3LC 3VH6W 5B40D 3VH6T 3RELD 1P3MA 2JSSA 3WA9B 5AVCC 1ZLAB 5GSUC 4KUDA 3X1UC 3MNNB 1EQZC 5CPKC 5AV6D 3REIA 1KX5A 3LELB 3AZJC 1M19B 3AV2B 4XZQB 3UTBA 3W96A 3MVDC 5CPIA 5CP6C 3X1TD 3C1BD 5GXQB 3AZFB 5B31A 3MGPA 3O62A 5B0ZD 4XUJC 4X23C 3AZMB 1P3MB 2PYOA 2Y2IA 5B2JC 1HQ3A 2Y2MA 4J8UD 1M18B 3KWQB 4G92C 3AZLC 1P3IA 2NZDA 3W99B 2ZY3A 3EG5B 1KX4D 3AZNB 2Y2QA 5B1LC 2Y2GA 3WTPD 3AZHB 4J8XD 4H9SA 2IO5B 4H9RA 5DNNB 2BYKB 5AV9A 5B33C 5F99C 3P5JB 4ZUXB 3KUYC 1M1AA 1P3PB 2YFWA 2NQBA 3WKJA 1P3BC 5B32B 5B2IA 3W97D 5BNVB 3H0RC 3MGRD 3AZEC 3W98C 4H9OB 3C1CC 5AVBA 1P34B 5AV9B 1P3OC 1P3FD 5AV5B 1P3GD 3REJC 5AVCA 5JRGB 2CV5B 1S32D 3C1BC 5C3IC 4WU9B 3AZKB 5BO0A 3A6NC 1KX3B 1N1JA 2DQNC 2RIQA 5AVBB 3UT9B 5AY8A 5FUGB 3LZ0A 3AZGB 1P3LB 2HIOC 4J8VA 5B31G 1TAFA 5GXQD 5GT3A 3TU4D 5GSUB 3X1UB 1P3AC 1EQZB 4JJNA 5CPKB 4KGCB 2YFVB 3AZJB 1P3KA 3AZIA 4WV4B 3MVDB 5CP6B 3B6FD 5B1MA 3B6GB 1ID3C 5B33A 4X23B 4XUJB 3AZHD 3KUYA 4H9QB 5B2JB 3X1VC 3KXBD 4G92B 2F8ND 3AZLB 4QLCD 1TZYD 1U35B 4H9NA 2F8NG 4YM6D 5B0YD 3RELA 5B1LB 3AZEA 1P3GC 4KUDC 3LJAC 3B0DB 1B6WA 3REIC 1KX5C 1P3OA 5AV6A 3FDDA 2AROD 5F99B 4EO5C 4LD9D 5DNMD 3UTBC 3WAAB 4YS3D 1P3BB 4Z2MH 3C1BA 3X1TA 5B31C 3MGPC 2ZM5A 3O62C 2CWEA 4J8WD 1Z2CB 5B0ZA 2PYOC 3W98B 3X1SD 5CPJD 2XD1A 3C1CB 5AV8B 2LY8A 1P3OB 4J8UA 2BYMA 2NZDC
chains in the Genus database with same CATH topology
4Z66B 3REJB 3AYWD 1KX4A 3MGQD 3WTPA 1P3AA 4J8XA 5C3IB 3A6NB 1M1AC 2NQBC 1BH9A 3WKJC 3EPKA 5B2IC 5GT0C 3NQJB 4R8PC 1ID3A 2HIOB 3W97A 3EPHA 4QLCC 5BT1D 4YM6C 3UTAD 3MGRA 4UUZB 2Y2LA 3AFAD 4WZSB 1P3FA 2F8NK 1P3GA 3LJAA 4Z5TB 5BNXA 4CAYA 1S32A 5G49B 2HUEC 2VQRA 4WNNB 3LZ1D 5CHLB 3X1VB 3MGSD 1F66D 5AY8C 3LZ0C 4J8VC 5E5AD 3R45A 5GT3C 1JFIA 4KUDB 3TU4A 4JJNC 3REIB 4H9PA 1KX5B 1AOID 3AN2D 1P3KC 3AZIC 4DRAA 2FJ7D 4EO5B 5AV8D 3UTBB 3W96B 5CPIB 5B1MC 3AV1D 3B6FA 5B31B 3MGPB 3O62B 3H0MC 3REKD 2Y2KA 2ZY5A 5KDMA 2Y2NA 2PYOB 1JFIB 1HQ3B 3REHC 3UTAC 1BFMA 3NQUA 5GT0A 4WU8D 1P3IB 4R8PA 3KXBA 5B40C 2F8NA 2NZDB 1TZYA 4QLCA 3RELC 1WWSA 3F6TA 4YM6A 5B0YA 4H9RB 5B24D 5AV6C 4AWLC 2AROA 1M1AB 1W2EA 2YFWB 2NQBB 3WKJB 4LD9A 5DNMA 4YS3A 5B2IB 3NQUB 3X1TC 5GT0B 3WA9D 2G5IC 4CSRA 1ZLAD 3MNND 5B0ZC 4J8WA 4Z5TD 4HGAB 1T3UA 3LELD 2JCHA 3X1SA 1M19D 5CPJA 3AV2D 4J8UC 4XZQD 4UPKA 5AVCB 1KX4C 3AZFD 3AYWA 3WTPC 3AZMD 1P3MD 2UWXA 3MGQA 4J8XC 5BO0B 1N1JB 3REKC 1M18D 3KWQD 2L5AA 5AY8B 3LZ0B 3W99D 2JE5A 3AZND 3W97C 4J8VB 3W96D 5CPID 1TAFB 5DNND 5GT3B 5BS7A 3MGRC 3REHA 3UTAA 4ZUXD 4JJNB 1P3PD 5B40A 1P3KB 3AFAA 1HQ3D 5B32D 2RVQD 3AZIB 1P3FC 3A1IA 5B32G 5B1MB 1S32C 4KHAA 5B33B 2BG1A 3KUYB 4E44A 5AV9D 1P34D 2Y2HA 1F66A 5AV5D 3MGSA 1M19C 4DQYB 4H9NB 5JRGD 2CV5D 5E5AA 3RELB 3AZEB 4WU9D 4DRBA 5GXQC 3AZKD 3TU4C 2F2AC 1KX3D 4NFTA 5AV6B 1AOIA 3AN2A 5AVBD 4AWLB 3UT9D 3AZGD 1P3LD 3IP4C 2FJ7A 1H3OA 4G91C 3X1TB 3C1BB 3B6FC 5GSUD 2J8PA 3X1UD 5B0ZB 3REKA 3AZHC 1EQZD 5CPKD 4KGCD 3AZJD 2F8NH 4J8UB 3KXBC 2BYMB 3H0LC 1WWIA 4WU8A 1TZYC 2DF4C 5CP6D 3MVDD 5B32C 1BH8A 3B6GD 1KX4B 1P3IC 5B0YC 1ULYA 4XUJD 3WTPB 4X23D 3B0BA 1P3AB 4J8XB 2G5HC 5JA4A 5B2JD 5B24A 3EPLA 2AROC 3AL0C 1BH9B 3V9RA 4LD9C 5DNMC 3AZLD 1U35D 4YS3C 1ID3B 5B1LD 3W97B 3WA9A 1ZLAA 4J8WC 3MNNA 5B33D 3MGRB 3X1SC 5F99D 5CPJC 3KUYD 1PZRA 3B0CW 1M19A 3B0CT 3AV2A 3WAAD 1P3BD 1P3FB 1P3GB 3LJAB 5GXQA 3AYWC 2ZY4A 5BNXB 4CAYB 3MGQC 3AZFA 1S32B 3AZMA 3W98D 3AZED 3C1CD 1P3OD 1M18A 3KWQA 4KGCC 4Z66D 3REJD 3W99A 3R45B 1F1EA 3AZNA 3KFUG 3AZHA 5BS7C 5BT1C 2BYKA 5DNNA 3TU4B 3B6GC 4WJ3C 3A6ND 4H9PB 4ZUXA 3AFAC 1P3PA 5B32A 2HIOD 5BNVA 1U35C 4G91B 3B6FB 2XD5A 4ZBJC 5KDMB 4H9OA 1P3AD 3B0DC 1P34A 3LZ1C 2Y2OA 1F66C 3MGSC 4R8PB 3KXBB 3EPJA 5AV5A 2F8NB 3WAAC 1TZYB 5E5AC 4QLCB 5JRGA 2CV5A 4YM6B 1ID3D 5B0YB 4WU9A 3AZKA 1KX3A 1AOIC 3X1VD 3AN2C 2AROB 2FJ7C 3UT9A 5AV8C 3AZGA 5FUGA 5DNMB 1P3LA 4LD9B 3VH5A 4YS3B 4CSRB 3AV1C 4KUDD 4Z66C 2HUEB 3LJAD 4J8WB 5GSUA 3REID 3X1UA 1KX5D 1EQZA 5CPKA 3X1SB 4KGCA 5CPJB 2YFVA 3AZJA 3UTBD 4WU8C 3MVDA 5CP6A 5B31D 3MGPD 3O62D 3B6GA 3AYWB 1KU5A 3MGQB 2PYOD 4X23A 4XUJA 5B24C 4H9QA 4Z2MG 1Q9CA 5B2JA 1P3ID 2NZDD 3AZLA 1U35A 3VH6A 3WA9C 1ZLAC 5B1LA 3MNNC 4Z5TC 3REHB 3UTAB 3KSYA 3LELC 3LZ1A 3A1KA 5F99A 1M1AD 2NQBD 3AV2C 5B40B 2W8SA 3WKJD 3AFAB 4XZQC 3WAAA 4NE6A 5B2ID 5GT0D 1P3BA 4R8PD 3AZFC 4KHAB 3AZMC 1P3MC 4ZBJB 3W98A 4M6BA 2Y2JA 3C1CA 3KWQC 1M18C 5AV8A 3LZ1B 1F66B 3MGSB 5AVCD 3W99C 3AV1A 4NE5A 3AZNC 4Z66A 3REJA 2FFFB 3W96C 5E5AB 5CPIC 2IO5C 5DNNC 4E45A 4ZUXC 3A6NA 1AOIB 1P3PC 3AN2B 1HQ3C 2ZY2A 5AY8D 2RVQC 3VH5T 3VH5W 3WTPE 3LZ0D 2FJ7B 4J8VD 1H3OB 3NQJA 2HIOA 3AV1B 1R4VA 5GT3D 1B67A 3REKB 1HTAA 4JJND 4H9SC 4UUZA 5AV9C 1P34C 1P3KD 3AZID 5AV5C 4WU8B 5B1MD 5JRGC 2CV5C 1BH8B 2Y2PA 4Z5TA 1A7WA 4NE3A 4WU9C 3AZKC 3LELA 5G49A 5JA4B 1KX3C 5B24B 4WNNA 4XZQA 3REHD 4HGAC 3X1VA 3V9RB 5AVBC 3UT9C 3AZGC 1P3LC 3VH6W 5B40D 3VH6T 3RELD 1P3MA 2JSSA 3WA9B 5AVCC 1ZLAB 5GSUC 4KUDA 3X1UC 3MNNB 1EQZC 5CPKC 5AV6D 3REIA 1KX5A 3LELB 3AZJC 1M19B 3AV2B 4XZQB 3UTBA 3W96A 3MVDC 5CPIA 5CP6C 3X1TD 3C1BD 5GXQB 3AZFB 5B31A 3MGPA 3O62A 5B0ZD 4XUJC 4X23C 3AZMB 1P3MB 2PYOA 2Y2IA 5B2JC 1HQ3A 2Y2MA 4J8UD 1M18B 3KWQB 4G92C 3AZLC 1P3IA 2NZDA 3W99B 2ZY3A 3EG5B 1KX4D 3AZNB 2Y2QA 5B1LC 2Y2GA 3WTPD 3AZHB 4J8XD 4H9SA 2IO5B 4H9RA 5DNNB 2BYKB 5AV9A 5B33C 5F99C 3P5JB 4ZUXB 3KUYC 1M1AA 1P3PB 2YFWA 2NQBA 3WKJA 1P3BC 5B32B 5B2IA 3W97D 5BNVB 3H0RC 3MGRD 3AZEC 3W98C 4H9OB 3C1CC 5AVBA 1P34B 5AV9B 1P3OC 1P3FD 5AV5B 1P3GD 3REJC 5AVCA 5JRGB 2CV5B 1S32D 3C1BC 5C3IC 4WU9B 3AZKB 5BO0A 3A6NC 1KX3B 1N1JA 2DQNC 2RIQA 5AVBB 3UT9B 5AY8A 5FUGB 3LZ0A 3AZGB 1P3LB 2HIOC 4J8VA 5B31G 1TAFA 5GXQD 5GT3A 3TU4D 5GSUB 3X1UB 1P3AC 1EQZB 4JJNA 5CPKB 4KGCB 2YFVB 3AZJB 1P3KA 3AZIA 4WV4B 3MVDB 5CP6B 3B6FD 5B1MA 3B6GB 1ID3C 5B33A 4X23B 4XUJB 3AZHD 3KUYA 4H9QB 5B2JB 3X1VC 3KXBD 4G92B 2F8ND 3AZLB 4QLCD 1TZYD 1U35B 4H9NA 2F8NG 4YM6D 5B0YD 3RELA 5B1LB 3AZEA 1P3GC 4KUDC 3LJAC 3B0DB 1B6WA 3REIC 1KX5C 1P3OA 5AV6A 3FDDA 2AROD 5F99B 4EO5C 4LD9D 5DNMD 3UTBC 3WAAB 4YS3D 1P3BB 4Z2MH 3C1BA 3X1TA 5B31C 3MGPC 2ZM5A 3O62C 2CWEA 4J8WD 1Z2CB 5B0ZA 2PYOC 3W98B 3X1SD 5CPJD 2XD1A 3C1CB 5AV8B 2LY8A 1P3OB 4J8UA 2BYMA 2NZDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 B;  3REJ B;  3AYW D;  1KX4 A;  3MGQ D;  3WTP A;  1P3A A;  4J8X A;  5C3I B;  3A6N B;  1M1A C;  2NQB C;  1BH9 A;  3WKJ C;  5B2I C;  5GT0 C;  3NQJ B;  4R8P C;  1ID3 A;  2HIO B;  3W97 A;  4QLC C;  5BT1 D;  4YM6 C;  3UTA D;  3MGR A;  4UUZ B;  3AFA D;  4WZS B;  1P3F A;  2F8N K;  1P3G A;  3LJA A;  4Z5T B;  5BNX A;  4CAY A;  1S32 A;  5G49 B;  2HUE C;  4WNN B;  3LZ1 D;  5CHL B;  3X1V B;  3MGS D;  1F66 D;  5AY8 C;  3LZ0 C;  4J8V C;  5E5A D;  3R45 A;  5GT3 C;  1JFI A;  4KUD B;  3TU4 A;  4JJN C;  3REI B;  4H9P A;  1KX5 B;  1AOI D;  3AN2 D;  1P3K C;  3AZI C;  4DRA A;  2FJ7 D;  4EO5 B;  5AV8 D;  3UTB B;  3W96 B;  5CPI B;  5B1M C;  3AV1 D;  3B6F A;  5B31 B;  3MGP B;  3O62 B;  3REK D;  5KDM A;  2PYO B;  1JFI B;  1HQ3 B;  3REH C;  3UTA C;  1BFM A;  3NQU A;  5GT0 A;  4WU8 D;  1P3I B;  4R8P A;  3KXB A;  5B40 C;  2F8N A;  2NZD B;  1TZY A;  4QLC A;  3REL C;  1WWS A;  4YM6 A;  5B0Y A;  4H9R B;  5B24 D;  5AV6 C;  4AWL C;  2ARO A;  1M1A B;  2NQB B;  2YFW B;  3WKJ B;  4LD9 A;  5DNM A;  4YS3 A;  5B2I B;  3NQU B;  3X1T C;  5GT0 B;  3WA9 D;  4CSR A;  1ZLA D;  3MNN D;  5B0Z C;  4J8W A;  4Z5T D;  4HGA B;  3LEL D;  3X1S A;  1M19 D;  5CPJ A;  3AV2 D;  4J8U C;  4XZQ D;  5AVC B;  1KX4 C;  3AZF D;  3AYW A;  3WTP C;  3AZM D;  1P3M D;  4J8X C;  3MGQ A;  5BO0 B;  1N1J B;  3REK C;  1M18 D;  3KWQ D;  2L5A A;  5AY8 B;  3LZ0 B;  3W99 D;  3AZN D;  3W97 C;  4J8V B;  3W96 D;  5CPI D;  1TAF B;  5DNN D;  5GT3 B;  5BS7 A;  3MGR C;  3REH A;  3UTA A;  4ZUX D;  4JJN B;  1P3P D;  5B40 A;  1P3K B;  3AFA A;  1HQ3 D;  5B32 D;  2RVQ D;  3AZI B;  1P3F C;  5B32 G;  5B1M B;  1S32 C;  4KHA A;  5B33 B;  3KUY B;  4E44 A;  5AV9 D;  1P34 D;  1F66 A;  5AV5 D;  3MGS A;  1M19 C;  4H9N B;  5JRG D;  2CV5 D;  5E5A A;  3REL B;  3AZE B;  4WU9 D;  4DRB A;  5GXQ C;  3AZK D;  3TU4 C;  1KX3 D;  4NFT A;  5AV6 B;  1AOI A;  3AN2 A;  5AVB D;  4AWL B;  3UT9 D;  3AZG D;  1P3L D;  2FJ7 A;  1H3O A;  4G91 C;  3X1T B;  3C1B B;  3B6F C;  5GSU D;  3X1U D;  5B0Z B;  3REK A;  3AZH C;  1EQZ D;  5CPK D;  4KGC D;  3AZJ D;  2F8N H;  4J8U B;  3KXB C;  2BYM B;  1WWI A;  4WU8 A;  1TZY C;  3MVD D;  5CP6 D;  5B32 C;  1BH8 A;  3B6G D;  1KX4 B;  1P3I C;  5B0Y C;  1ULY A;  4XUJ D;  3WTP B;  4X23 D;  3B0B A;  1P3A B;  4J8X B;  5JA4 A;  5B2J D;  5B24 A;  2ARO C;  1BH9 B;  3V9R A;  4LD9 C;  5DNM C;  3AZL D;  1U35 D;  4YS3 C;  1ID3 B;  5B1L D;  3W97 B;  3WA9 A;  1ZLA A;  4J8W C;  3MNN A;  5B33 D;  3MGR B;  3X1S C;  5F99 D;  5CPJ C;  3KUY D;  3B0C W;  1M19 A;  3B0C T;  3AV2 A;  3WAA D;  1P3B D;  1P3F B;  1P3G B;  3LJA B;  5GXQ A;  3AYW C;  5BNX B;  4CAY B;  3MGQ C;  3AZF A;  1S32 B;  3AZM A;  3W98 D;  3AZE D;  3C1C D;  1P3O D;  1M18 A;  3KWQ A;  4KGC C;  4Z66 D;  3REJ D;  3W99 A;  3R45 B;  1F1E A;  3AZN A;  3AZH A;  5BS7 C;  5BT1 C;  2BYK A;  5DNN A;  3TU4 B;  3B6G C;  3A6N D;  4H9P B;  4ZUX A;  3AFA C;  1P3P A;  5B32 A;  2HIO D;  5BNV A;  1U35 C;  4G91 B;  3B6F B;  4ZBJ C;  5KDM B;  4H9O A;  1P3A D;  3B0D C;  1P34 A;  3LZ1 C;  1F66 C;  3MGS C;  4R8P B;  3KXB B;  2F8N B;  5AV5 A;  3WAA C;  1TZY B;  5E5A C;  4QLC B;  5JRG A;  2CV5 A;  4YM6 B;  1ID3 D;  5B0Y B;  4WU9 A;  3AZK A;  1KX3 A;  1AOI C;  3X1V D;  3AN2 C;  2ARO B;  2FJ7 C;  3UT9 A;  5AV8 C;  3AZG A;  5FUG A;  5DNM B;  1P3L A;  4LD9 B;  3VH5 A;  4YS3 B;  4CSR B;  3AV1 C;  4KUD D;  4Z66 C;  2HUE B;  3LJA D;  4J8W B;  5GSU A;  3REI D;  3X1U A;  1KX5 D;  1EQZ A;  5CPK A;  3X1S B;  4KGC A;  5CPJ B;  2YFV A;  3AZJ A;  3UTB D;  4WU8 C;  3MVD A;  5CP6 A;  5B31 D;  3MGP D;  3O62 D;  3B6G A;  3AYW B;  1KU5 A;  3MGQ B;  2PYO D;  4X23 A;  4XUJ A;  5B24 C;  4H9Q A;  4Z2M G;  1Q9C A;  5B2J A;  1P3I D;  2NZD D;  3AZL A;  1U35 A;  3VH6 A;  3WA9 C;  1ZLA C;  5B1L A;  3MNN C;  4Z5T C;  3REH B;  3UTA B;  3KSY A;  3LEL C;  3LZ1 A;  5F99 A;  1M1A D;  2NQB D;  3AV2 C;  5B40 B;  3WKJ D;  3AFA B;  4XZQ C;  3WAA A;  4NE6 A;  5B2I D;  5GT0 D;  1P3B A;  4R8P D;  3AZF C;  4KHA B;  3AZM C;  1P3M C;  4ZBJ B;  3W98 A;  4M6B A;  3C1C A;  3KWQ C;  1M18 C;  5AV8 A;  3LZ1 B;  1F66 B;  3MGS B;  5AVC D;  3W99 C;  3AV1 A;  4NE5 A;  3AZN C;  4Z66 A;  3REJ A;  3W96 C;  5E5A B;  5CPI C;  2IO5 C;  5DNN C;  4E45 A;  4ZUX C;  3A6N A;  1AOI B;  1P3P C;  3AN2 B;  1HQ3 C;  5AY8 D;  3VH5 W;  2RVQ C;  3VH5 T;  3WTP E;  3LZ0 D;  2FJ7 B;  4J8V D;  1H3O B;  3NQJ A;  2HIO A;  3AV1 B;  1R4V A;  5GT3 D;  1B67 A;  3REK B;  1HTA A;  4JJN D;  4H9S C;  4UUZ A;  5AV9 C;  1P34 C;  1P3K D;  3AZI D;  5AV5 C;  4WU8 B;  5B1M D;  5JRG C;  2CV5 C;  1BH8 B;  4Z5T A;  1A7W A;  4NE3 A;  4WU9 C;  3AZK C;  3LEL A;  5G49 A;  5JA4 B;  1KX3 C;  5B24 B;  4WNN A;  4XZQ A;  3REH D;  4HGA C;  3X1V A;  3V9R B;  5AVB C;  3UT9 C;  3AZG C;  1P3L C;  3VH6 W;  5B40 D;  3VH6 T;  3REL D;  1P3M A;  2JSS A;  3WA9 B;  5AVC C;  1ZLA B;  5GSU C;  4KUD A;  3X1U C;  3MNN B;  1EQZ C;  5CPK C;  5AV6 D;  3REI A;  1KX5 A;  3LEL B;  3AZJ C;  1M19 B;  3AV2 B;  4XZQ B;  3UTB A;  3W96 A;  3MVD C;  5CPI A;  5CP6 C;  3X1T D;  3C1B D;  5GXQ B;  3AZF B;  5B31 A;  3MGP A;  3O62 A;  5B0Z D;  4XUJ C;  4X23 C;  3AZM B;  1P3M B;  2PYO A;  5B2J C;  1HQ3 A;  4J8U D;  1M18 B;  3KWQ B;  4G92 C;  3AZL C;  1P3I A;  2NZD A;  3W99 B;  1KX4 D;  3AZN B;  5B1L C;  3WTP D;  3AZH B;  4J8X D;  4H9S A;  2IO5 B;  4H9R A;  5DNN B;  2BYK B;  5AV9 A;  5B33 C;  5F99 C;  4ZUX B;  3KUY C;  1M1A A;  1P3P B;  2YFW A;  2NQB A;  3WKJ A;  1P3B C;  5B32 B;  5B2I A;  3W97 D;  5BNV B;  3W98 C;  3MGR D;  3AZE C;  4H9O B;  3C1C C;  5AVB A;  1P34 B;  5AV9 B;  1P3O C;  1P3F D;  5AV5 B;  1P3G D;  3REJ C;  5AVC A;  5JRG B;  2CV5 B;  1S32 D;  3C1B C;  5C3I C;  4WU9 B;  3AZK B;  5BO0 A;  3A6N C;  1KX3 B;  1N1J A;  5AVB B;  3UT9 B;  5AY8 A;  5FUG B;  3LZ0 A;  3AZG B;  1P3L B;  2HIO C;  4J8V A;  5B31 G;  1TAF A;  5GXQ D;  5GT3 A;  3TU4 D;  5GSU B;  3X1U B;  1P3A C;  1EQZ B;  4JJN A;  5CPK B;  4KGC B;  2YFV B;  3AZJ B;  1P3K A;  3AZI A;  4WV4 B;  3MVD B;  5CP6 B;  3B6F D;  5B1M A;  3B6G B;  1ID3 C;  5B33 A;  4X23 B;  4XUJ B;  3AZH D;  3KUY A;  4H9Q B;  5B2J B;  3X1V C;  3KXB D;  4G92 B;  2F8N D;  3AZL B;  1TZY D;  4QLC D;  1U35 B;  4H9N A;  2F8N G;  4YM6 D;  5B0Y D;  3REL A;  5B1L B;  3AZE A;  1P3G C;  4KUD C;  3LJA C;  3B0D B;  1B6W A;  3REI C;  1KX5 C;  1P3O A;  5AV6 A;  2ARO D;  5F99 B;  4EO5 C;  4LD9 D;  5DNM D;  3UTB C;  3WAA B;  4YS3 D;  1P3B B;  4Z2M H;  3C1B A;  3X1T A;  5B31 C;  3MGP C;  3O62 C;  2CWE A;  4J8W D;  2PYO C;  5B0Z A;  3W98 B;  3X1S D;  5CPJ D;  3C1C B;  5AV8 B;  2LY8 A;  1P3O B;  4J8U A;  2BYM A;  2NZD C; 
#chains in the Genus database with same CATH topology
 4Z66 B;  3REJ B;  3AYW D;  1KX4 A;  3MGQ D;  3WTP A;  1P3A A;  4J8X A;  5C3I B;  3A6N B;  1M1A C;  2NQB C;  1BH9 A;  3WKJ C;  3EPK A;  5B2I C;  5GT0 C;  3NQJ B;  4R8P C;  1ID3 A;  2HIO B;  3W97 A;  3EPH A;  4QLC C;  5BT1 D;  4YM6 C;  3UTA D;  3MGR A;  4UUZ B;  2Y2L A;  3AFA D;  4WZS B;  1P3F A;  2F8N K;  1P3G A;  3LJA A;  4Z5T B;  5BNX A;  4CAY A;  1S32 A;  5G49 B;  2HUE C;  2VQR A;  4WNN B;  3LZ1 D;  5CHL B;  3X1V B;  3MGS D;  1F66 D;  5AY8 C;  3LZ0 C;  4J8V C;  5E5A D;  3R45 A;  5GT3 C;  1JFI A;  4KUD B;  3TU4 A;  4JJN C;  3REI B;  4H9P A;  1KX5 B;  1AOI D;  3AN2 D;  1P3K C;  3AZI C;  4DRA A;  2FJ7 D;  4EO5 B;  5AV8 D;  3UTB B;  3W96 B;  5CPI B;  5B1M C;  3AV1 D;  3B6F A;  5B31 B;  3MGP B;  3O62 B;  3H0M C;  3REK D;  2Y2K A;  2ZY5 A;  5KDM A;  2Y2N A;  2PYO B;  1JFI B;  1HQ3 B;  3REH C;  3UTA C;  1BFM A;  3NQU A;  5GT0 A;  4WU8 D;  1P3I B;  4R8P A;  3KXB A;  5B40 C;  2F8N A;  2NZD B;  1TZY A;  4QLC A;  3REL C;  1WWS A;  3F6T A;  4YM6 A;  5B0Y A;  4H9R B;  5B24 D;  5AV6 C;  4AWL C;  2ARO A;  1M1A B;  1W2E A;  2YFW B;  2NQB B;  3WKJ B;  4LD9 A;  5DNM A;  4YS3 A;  5B2I B;  3NQU B;  3X1T C;  5GT0 B;  3WA9 D;  2G5I C;  4CSR A;  1ZLA D;  3MNN D;  5B0Z C;  4J8W A;  4Z5T D;  4HGA B;  1T3U A;  3LEL D;  2JCH A;  3X1S A;  1M19 D;  5CPJ A;  3AV2 D;  4J8U C;  4XZQ D;  4UPK A;  5AVC B;  1KX4 C;  3AZF D;  3AYW A;  3WTP C;  3AZM D;  1P3M D;  2UWX A;  3MGQ A;  4J8X C;  5BO0 B;  1N1J B;  3REK C;  1M18 D;  3KWQ D;  2L5A A;  5AY8 B;  3LZ0 B;  3W99 D;  2JE5 A;  3AZN D;  3W97 C;  4J8V B;  3W96 D;  5CPI D;  1TAF B;  5DNN D;  5GT3 B;  5BS7 A;  3MGR C;  3REH A;  3UTA A;  4ZUX D;  4JJN B;  1P3P D;  5B40 A;  1P3K B;  3AFA A;  1HQ3 D;  5B32 D;  2RVQ D;  3AZI B;  1P3F C;  3A1I A;  5B32 G;  5B1M B;  1S32 C;  4KHA A;  5B33 B;  2BG1 A;  3KUY B;  4E44 A;  5AV9 D;  1P34 D;  2Y2H A;  1F66 A;  5AV5 D;  3MGS A;  1M19 C;  4DQY B;  4H9N B;  5JRG D;  2CV5 D;  5E5A A;  3REL B;  3AZE B;  4WU9 D;  4DRB A;  5GXQ C;  3AZK D;  3TU4 C;  2F2A C;  1KX3 D;  4NFT A;  5AV6 B;  1AOI A;  3AN2 A;  5AVB D;  4AWL B;  3UT9 D;  3AZG D;  1P3L D;  3IP4 C;  2FJ7 A;  1H3O A;  4G91 C;  3X1T B;  3C1B B;  3B6F C;  5GSU D;  2J8P A;  3X1U D;  5B0Z B;  3REK A;  3AZH C;  1EQZ D;  5CPK D;  4KGC D;  3AZJ D;  2F8N H;  4J8U B;  3KXB C;  2BYM B;  3H0L C;  1WWI A;  4WU8 A;  1TZY C;  2DF4 C;  5CP6 D;  3MVD D;  5B32 C;  1BH8 A;  3B6G D;  1KX4 B;  1P3I C;  5B0Y C;  1ULY A;  4XUJ D;  3WTP B;  4X23 D;  3B0B A;  1P3A B;  4J8X B;  2G5H C;  5JA4 A;  5B2J D;  5B24 A;  3EPL A;  2ARO C;  3AL0 C;  1BH9 B;  3V9R A;  4LD9 C;  5DNM C;  3AZL D;  1U35 D;  4YS3 C;  1ID3 B;  5B1L D;  3W97 B;  3WA9 A;  1ZLA A;  4J8W C;  3MNN A;  5B33 D;  3MGR B;  3X1S C;  5F99 D;  5CPJ C;  3KUY D;  1PZR A;  3B0C W;  1M19 A;  3B0C T;  3AV2 A;  3WAA D;  1P3B D;  1P3F B;  1P3G B;  3LJA B;  5GXQ A;  3AYW C;  2ZY4 A;  5BNX B;  4CAY B;  3MGQ C;  3AZF A;  1S32 B;  3AZM A;  3W98 D;  3AZE D;  3C1C D;  1P3O D;  1M18 A;  3KWQ A;  4KGC C;  4Z66 D;  3REJ D;  3W99 A;  3R45 B;  1F1E A;  3AZN A;  3KFU G;  3AZH A;  5BS7 C;  5BT1 C;  2BYK A;  5DNN A;  3TU4 B;  3B6G C;  4WJ3 C;  3A6N D;  4H9P B;  4ZUX A;  3AFA C;  1P3P A;  5B32 A;  2HIO D;  5BNV A;  1U35 C;  4G91 B;  3B6F B;  2XD5 A;  4ZBJ C;  5KDM B;  4H9O A;  1P3A D;  3B0D C;  1P34 A;  3LZ1 C;  2Y2O A;  1F66 C;  3MGS C;  4R8P B;  3KXB B;  3EPJ A;  5AV5 A;  2F8N B;  3WAA C;  1TZY B;  5E5A C;  4QLC B;  5JRG A;  2CV5 A;  4YM6 B;  1ID3 D;  5B0Y B;  4WU9 A;  3AZK A;  1KX3 A;  1AOI C;  3X1V D;  3AN2 C;  2ARO B;  2FJ7 C;  3UT9 A;  5AV8 C;  3AZG A;  5FUG A;  5DNM B;  1P3L A;  4LD9 B;  3VH5 A;  4YS3 B;  4CSR B;  3AV1 C;  4KUD D;  4Z66 C;  2HUE B;  3LJA D;  4J8W B;  5GSU A;  3REI D;  3X1U A;  1KX5 D;  1EQZ A;  5CPK A;  3X1S B;  4KGC A;  5CPJ B;  2YFV A;  3AZJ A;  3UTB D;  4WU8 C;  3MVD A;  5CP6 A;  5B31 D;  3MGP D;  3O62 D;  3B6G A;  3AYW B;  1KU5 A;  3MGQ B;  2PYO D;  4X23 A;  4XUJ A;  5B24 C;  4H9Q A;  4Z2M G;  1Q9C A;  5B2J A;  1P3I D;  2NZD D;  3AZL A;  1U35 A;  3VH6 A;  3WA9 C;  1ZLA C;  5B1L A;  3MNN C;  4Z5T C;  3REH B;  3UTA B;  3KSY A;  3LEL C;  3LZ1 A;  3A1K A;  5F99 A;  1M1A D;  2NQB D;  3AV2 C;  5B40 B;  2W8S A;  3WKJ D;  3AFA B;  4XZQ C;  3WAA A;  4NE6 A;  5B2I D;  5GT0 D;  1P3B A;  4R8P D;  3AZF C;  4KHA B;  3AZM C;  1P3M C;  4ZBJ B;  3W98 A;  4M6B A;  2Y2J A;  3C1C A;  3KWQ C;  1M18 C;  5AV8 A;  3LZ1 B;  1F66 B;  3MGS B;  5AVC D;  3W99 C;  3AV1 A;  4NE5 A;  3AZN C;  4Z66 A;  3REJ A;  2FFF B;  3W96 C;  5E5A B;  5CPI C;  2IO5 C;  5DNN C;  4E45 A;  4ZUX C;  3A6N A;  1AOI B;  1P3P C;  3AN2 B;  1HQ3 C;  2ZY2 A;  5AY8 D;  2RVQ C;  3VH5 T;  3VH5 W;  3WTP E;  3LZ0 D;  2FJ7 B;  4J8V D;  1H3O B;  3NQJ A;  2HIO A;  3AV1 B;  1R4V A;  5GT3 D;  1B67 A;  3REK B;  1HTA A;  4JJN D;  4H9S C;  4UUZ A;  5AV9 C;  1P34 C;  1P3K D;  3AZI D;  5AV5 C;  4WU8 B;  5B1M D;  5JRG C;  2CV5 C;  1BH8 B;  2Y2P A;  4Z5T A;  1A7W A;  4NE3 A;  4WU9 C;  3AZK C;  3LEL A;  5G49 A;  5JA4 B;  1KX3 C;  5B24 B;  4WNN A;  4XZQ A;  3REH D;  4HGA C;  3X1V A;  3V9R B;  5AVB C;  3UT9 C;  3AZG C;  1P3L C;  3VH6 W;  5B40 D;  3VH6 T;  3REL D;  1P3M A;  2JSS A;  3WA9 B;  5AVC C;  1ZLA B;  5GSU C;  4KUD A;  3X1U C;  3MNN B;  1EQZ C;  5CPK C;  5AV6 D;  3REI A;  1KX5 A;  3LEL B;  3AZJ C;  1M19 B;  3AV2 B;  4XZQ B;  3UTB A;  3W96 A;  3MVD C;  5CPI A;  5CP6 C;  3X1T D;  3C1B D;  5GXQ B;  3AZF B;  5B31 A;  3MGP A;  3O62 A;  5B0Z D;  4XUJ C;  4X23 C;  3AZM B;  1P3M B;  2PYO A;  2Y2I A;  5B2J C;  1HQ3 A;  2Y2M A;  4J8U D;  1M18 B;  3KWQ B;  4G92 C;  3AZL C;  1P3I A;  2NZD A;  3W99 B;  2ZY3 A;  3EG5 B;  1KX4 D;  3AZN B;  2Y2Q A;  5B1L C;  2Y2G A;  3WTP D;  3AZH B;  4J8X D;  4H9S A;  2IO5 B;  4H9R A;  5DNN B;  2BYK B;  5AV9 A;  5B33 C;  5F99 C;  3P5J B;  4ZUX B;  3KUY C;  1M1A A;  1P3P B;  2YFW A;  2NQB A;  3WKJ A;  1P3B C;  5B32 B;  5B2I A;  3W97 D;  5BNV B;  3H0R C;  3MGR D;  3AZE C;  3W98 C;  4H9O B;  3C1C C;  5AVB A;  1P34 B;  5AV9 B;  1P3O C;  1P3F D;  5AV5 B;  1P3G D;  3REJ C;  5AVC A;  5JRG B;  2CV5 B;  1S32 D;  3C1B C;  5C3I C;  4WU9 B;  3AZK B;  5BO0 A;  3A6N C;  1KX3 B;  1N1J A;  2DQN C;  2RIQ A;  5AVB B;  3UT9 B;  5AY8 A;  5FUG B;  3LZ0 A;  3AZG B;  1P3L B;  2HIO C;  4J8V A;  5B31 G;  1TAF A;  5GXQ D;  5GT3 A;  3TU4 D;  5GSU B;  3X1U B;  1P3A C;  1EQZ B;  4JJN A;  5CPK B;  4KGC B;  2YFV B;  3AZJ B;  1P3K A;  3AZI A;  4WV4 B;  3MVD B;  5CP6 B;  3B6F D;  5B1M A;  3B6G B;  1ID3 C;  5B33 A;  4X23 B;  4XUJ B;  3AZH D;  3KUY A;  4H9Q B;  5B2J B;  3X1V C;  3KXB D;  4G92 B;  2F8N D;  3AZL B;  4QLC D;  1TZY D;  1U35 B;  4H9N A;  2F8N G;  4YM6 D;  5B0Y D;  3REL A;  5B1L B;  3AZE A;  1P3G C;  4KUD C;  3LJA C;  3B0D B;  1B6W A;  3REI C;  1KX5 C;  1P3O A;  5AV6 A;  3FDD A;  2ARO D;  5F99 B;  4EO5 C;  4LD9 D;  5DNM D;  3UTB C;  3WAA B;  4YS3 D;  1P3B B;  4Z2M H;  3C1B A;  3X1T A;  5B31 C;  3MGP C;  2ZM5 A;  3O62 C;  2CWE A;  4J8W D;  1Z2C B;  5B0Z A;  2PYO C;  3W98 B;  3X1S D;  5CPJ D;  2XD1 A;  3C1C B;  5AV8 B;  2LY8 A;  1P3O B;  4J8U A;  2BYM A;  2NZD C; 
#chains in the Genus database with same CATH homology
 4Z66 B;  3REJ B;  3AYW D;  1KX4 A;  3MGQ D;  3WTP A;  1P3A A;  4J8X A;  5C3I B;  3A6N B;  1M1A C;  2NQB C;  1BH9 A;  3WKJ C;  3EPK A;  5B2I C;  5GT0 C;  3NQJ B;  4R8P C;  1ID3 A;  2HIO B;  3W97 A;  3EPH A;  4QLC C;  5BT1 D;  4YM6 C;  3UTA D;  3MGR A;  4UUZ B;  2Y2L A;  3AFA D;  4WZS B;  1P3F A;  2F8N K;  1P3G A;  3LJA A;  4Z5T B;  5BNX A;  4CAY A;  1S32 A;  5G49 B;  2HUE C;  2VQR A;  4WNN B;  3LZ1 D;  5CHL B;  3X1V B;  3MGS D;  1F66 D;  5AY8 C;  3LZ0 C;  4J8V C;  5E5A D;  3R45 A;  5GT3 C;  1JFI A;  4KUD B;  3TU4 A;  4JJN C;  3REI B;  4H9P A;  1KX5 B;  1AOI D;  3AN2 D;  1P3K C;  3AZI C;  4DRA A;  2FJ7 D;  4EO5 B;  5AV8 D;  3UTB B;  3W96 B;  5CPI B;  5B1M C;  3AV1 D;  3B6F A;  5B31 B;  3MGP B;  3O62 B;  3H0M C;  3REK D;  2Y2K A;  2ZY5 A;  5KDM A;  2Y2N A;  2PYO B;  1JFI B;  1HQ3 B;  3REH C;  3UTA C;  1BFM A;  3NQU A;  5GT0 A;  4WU8 D;  1P3I B;  4R8P A;  3KXB A;  5B40 C;  2F8N A;  2NZD B;  1TZY A;  4QLC A;  3REL C;  1WWS A;  3F6T A;  4YM6 A;  5B0Y A;  4H9R B;  5B24 D;  5AV6 C;  4AWL C;  2ARO A;  1M1A B;  1W2E A;  2YFW B;  2NQB B;  3WKJ B;  4LD9 A;  5DNM A;  4YS3 A;  5B2I B;  3NQU B;  3X1T C;  5GT0 B;  3WA9 D;  2G5I C;  4CSR A;  1ZLA D;  3MNN D;  5B0Z C;  4J8W A;  4Z5T D;  4HGA B;  1T3U A;  3LEL D;  2JCH A;  3X1S A;  1M19 D;  5CPJ A;  3AV2 D;  4J8U C;  4XZQ D;  4UPK A;  5AVC B;  1KX4 C;  3AZF D;  3AYW A;  3WTP C;  3AZM D;  1P3M D;  2UWX A;  3MGQ A;  4J8X C;  5BO0 B;  1N1J B;  3REK C;  1M18 D;  3KWQ D;  2L5A A;  5AY8 B;  3LZ0 B;  3W99 D;  2JE5 A;  3AZN D;  3W97 C;  4J8V B;  3W96 D;  5CPI D;  1TAF B;  5DNN D;  5GT3 B;  5BS7 A;  3MGR C;  3REH A;  3UTA A;  4ZUX D;  4JJN B;  1P3P D;  5B40 A;  1P3K B;  3AFA A;  1HQ3 D;  5B32 D;  2RVQ D;  3AZI B;  1P3F C;  3A1I A;  5B32 G;  5B1M B;  1S32 C;  4KHA A;  5B33 B;  2BG1 A;  3KUY B;  4E44 A;  5AV9 D;  1P34 D;  2Y2H A;  1F66 A;  5AV5 D;  3MGS A;  1M19 C;  4DQY B;  4H9N B;  5JRG D;  2CV5 D;  5E5A A;  3REL B;  3AZE B;  4WU9 D;  4DRB A;  5GXQ C;  3AZK D;  3TU4 C;  2F2A C;  1KX3 D;  4NFT A;  5AV6 B;  1AOI A;  3AN2 A;  5AVB D;  4AWL B;  3UT9 D;  3AZG D;  1P3L D;  3IP4 C;  2FJ7 A;  1H3O A;  4G91 C;  3X1T B;  3C1B B;  3B6F C;  5GSU D;  2J8P A;  3X1U D;  5B0Z B;  3REK A;  3AZH C;  1EQZ D;  5CPK D;  4KGC D;  3AZJ D;  2F8N H;  4J8U B;  3KXB C;  2BYM B;  3H0L C;  1WWI A;  4WU8 A;  1TZY C;  2DF4 C;  5CP6 D;  3MVD D;  5B32 C;  1BH8 A;  3B6G D;  1KX4 B;  1P3I C;  5B0Y C;  1ULY A;  4XUJ D;  3WTP B;  4X23 D;  3B0B A;  1P3A B;  4J8X B;  2G5H C;  5JA4 A;  5B2J D;  5B24 A;  3EPL A;  2ARO C;  3AL0 C;  1BH9 B;  3V9R A;  4LD9 C;  5DNM C;  3AZL D;  1U35 D;  4YS3 C;  1ID3 B;  5B1L D;  3W97 B;  3WA9 A;  1ZLA A;  4J8W C;  3MNN A;  5B33 D;  3MGR B;  3X1S C;  5F99 D;  5CPJ C;  3KUY D;  1PZR A;  3B0C W;  1M19 A;  3B0C T;  3AV2 A;  3WAA D;  1P3B D;  1P3F B;  1P3G B;  3LJA B;  5GXQ A;  3AYW C;  2ZY4 A;  5BNX B;  4CAY B;  3MGQ C;  3AZF A;  1S32 B;  3AZM A;  3W98 D;  3AZE D;  3C1C D;  1P3O D;  1M18 A;  3KWQ A;  4KGC C;  4Z66 D;  3REJ D;  3W99 A;  3R45 B;  1F1E A;  3AZN A;  3KFU G;  3AZH A;  5BS7 C;  5BT1 C;  2BYK A;  5DNN A;  3TU4 B;  3B6G C;  4WJ3 C;  3A6N D;  4H9P B;  4ZUX A;  3AFA C;  1P3P A;  5B32 A;  2HIO D;  5BNV A;  1U35 C;  4G91 B;  3B6F B;  2XD5 A;  4ZBJ C;  5KDM B;  4H9O A;  1P3A D;  3B0D C;  1P34 A;  3LZ1 C;  2Y2O A;  1F66 C;  3MGS C;  4R8P B;  3KXB B;  3EPJ A;  5AV5 A;  2F8N B;  3WAA C;  1TZY B;  5E5A C;  4QLC B;  5JRG A;  2CV5 A;  4YM6 B;  1ID3 D;  5B0Y B;  4WU9 A;  3AZK A;  1KX3 A;  1AOI C;  3X1V D;  3AN2 C;  2ARO B;  2FJ7 C;  3UT9 A;  5AV8 C;  3AZG A;  5FUG A;  5DNM B;  1P3L A;  4LD9 B;  3VH5 A;  4YS3 B;  4CSR B;  3AV1 C;  4KUD D;  4Z66 C;  2HUE B;  3LJA D;  4J8W B;  5GSU A;  3REI D;  3X1U A;  1KX5 D;  1EQZ A;  5CPK A;  3X1S B;  4KGC A;  5CPJ B;  2YFV A;  3AZJ A;  3UTB D;  4WU8 C;  3MVD A;  5CP6 A;  5B31 D;  3MGP D;  3O62 D;  3B6G A;  3AYW B;  1KU5 A;  3MGQ B;  2PYO D;  4X23 A;  4XUJ A;  5B24 C;  4H9Q A;  4Z2M G;  1Q9C A;  5B2J A;  1P3I D;  2NZD D;  3AZL A;  1U35 A;  3VH6 A;  3WA9 C;  1ZLA C;  5B1L A;  3MNN C;  4Z5T C;  3REH B;  3UTA B;  3KSY A;  3LEL C;  3LZ1 A;  3A1K A;  5F99 A;  1M1A D;  2NQB D;  3AV2 C;  5B40 B;  2W8S A;  3WKJ D;  3AFA B;  4XZQ C;  3WAA A;  4NE6 A;  5B2I D;  5GT0 D;  1P3B A;  4R8P D;  3AZF C;  4KHA B;  3AZM C;  1P3M C;  4ZBJ B;  3W98 A;  4M6B A;  2Y2J A;  3C1C A;  3KWQ C;  1M18 C;  5AV8 A;  3LZ1 B;  1F66 B;  3MGS B;  5AVC D;  3W99 C;  3AV1 A;  4NE5 A;  3AZN C;  4Z66 A;  3REJ A;  2FFF B;  3W96 C;  5E5A B;  5CPI C;  2IO5 C;  5DNN C;  4E45 A;  4ZUX C;  3A6N A;  1AOI B;  1P3P C;  3AN2 B;  1HQ3 C;  2ZY2 A;  5AY8 D;  2RVQ C;  3VH5 T;  3VH5 W;  3WTP E;  3LZ0 D;  2FJ7 B;  4J8V D;  1H3O B;  3NQJ A;  2HIO A;  3AV1 B;  1R4V A;  5GT3 D;  1B67 A;  3REK B;  1HTA A;  4JJN D;  4H9S C;  4UUZ A;  5AV9 C;  1P34 C;  1P3K D;  3AZI D;  5AV5 C;  4WU8 B;  5B1M D;  5JRG C;  2CV5 C;  1BH8 B;  2Y2P A;  4Z5T A;  1A7W A;  4NE3 A;  4WU9 C;  3AZK C;  3LEL A;  5G49 A;  5JA4 B;  1KX3 C;  5B24 B;  4WNN A;  4XZQ A;  3REH D;  4HGA C;  3X1V A;  3V9R B;  5AVB C;  3UT9 C;  3AZG C;  1P3L C;  3VH6 W;  5B40 D;  3VH6 T;  3REL D;  1P3M A;  2JSS A;  3WA9 B;  5AVC C;  1ZLA B;  5GSU C;  4KUD A;  3X1U C;  3MNN B;  1EQZ C;  5CPK C;  5AV6 D;  3REI A;  1KX5 A;  3LEL B;  3AZJ C;  1M19 B;  3AV2 B;  4XZQ B;  3UTB A;  3W96 A;  3MVD C;  5CPI A;  5CP6 C;  3X1T D;  3C1B D;  5GXQ B;  3AZF B;  5B31 A;  3MGP A;  3O62 A;  5B0Z D;  4XUJ C;  4X23 C;  3AZM B;  1P3M B;  2PYO A;  2Y2I A;  5B2J C;  1HQ3 A;  2Y2M A;  4J8U D;  1M18 B;  3KWQ B;  4G92 C;  3AZL C;  1P3I A;  2NZD A;  3W99 B;  2ZY3 A;  3EG5 B;  1KX4 D;  3AZN B;  2Y2Q A;  5B1L C;  2Y2G A;  3WTP D;  3AZH B;  4J8X D;  4H9S A;  2IO5 B;  4H9R A;  5DNN B;  2BYK B;  5AV9 A;  5B33 C;  5F99 C;  3P5J B;  4ZUX B;  3KUY C;  1M1A A;  1P3P B;  2YFW A;  2NQB A;  3WKJ A;  1P3B C;  5B32 B;  5B2I A;  3W97 D;  5BNV B;  3H0R C;  3MGR D;  3AZE C;  3W98 C;  4H9O B;  3C1C C;  5AVB A;  1P34 B;  5AV9 B;  1P3O C;  1P3F D;  5AV5 B;  1P3G D;  3REJ C;  5AVC A;  5JRG B;  2CV5 B;  1S32 D;  3C1B C;  5C3I C;  4WU9 B;  3AZK B;  5BO0 A;  3A6N C;  1KX3 B;  1N1J A;  2DQN C;  2RIQ A;  5AVB B;  3UT9 B;  5AY8 A;  5FUG B;  3LZ0 A;  3AZG B;  1P3L B;  2HIO C;  4J8V A;  5B31 G;  1TAF A;  5GXQ D;  5GT3 A;  3TU4 D;  5GSU B;  3X1U B;  1P3A C;  1EQZ B;  4JJN A;  5CPK B;  4KGC B;  2YFV B;  3AZJ B;  1P3K A;  3AZI A;  4WV4 B;  3MVD B;  5CP6 B;  3B6F D;  5B1M A;  3B6G B;  1ID3 C;  5B33 A;  4X23 B;  4XUJ B;  3AZH D;  3KUY A;  4H9Q B;  5B2J B;  3X1V C;  3KXB D;  4G92 B;  2F8N D;  3AZL B;  4QLC D;  1TZY D;  1U35 B;  4H9N A;  2F8N G;  4YM6 D;  5B0Y D;  3REL A;  5B1L B;  3AZE A;  1P3G C;  4KUD C;  3LJA C;  3B0D B;  1B6W A;  3REI C;  1KX5 C;  1P3O A;  5AV6 A;  3FDD A;  2ARO D;  5F99 B;  4EO5 C;  4LD9 D;  5DNM D;  3UTB C;  3WAA B;  4YS3 D;  1P3B B;  4Z2M H;  3C1B A;  3X1T A;  5B31 C;  3MGP C;  2ZM5 A;  3O62 C;  2CWE A;  4J8W D;  1Z2C B;  5B0Z A;  2PYO C;  3W98 B;  3X1S D;  5CPJ D;  2XD1 A;  3C1C B;  5AV8 B;  2LY8 A;  1P3O B;  4J8U A;  2BYM A;  2NZD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...