1P3LA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lA00
5KDMB 3AZEC 4LD9C 1B67A 4Z2MH 3X1UB 1P3KA 3MVDC 4G91C 4WU9B 3RELC 3VH6W 3VH5W 4J8XA 3UTAC 1EQZC 5CP6A 4JJNB 4XZQC 3AZED 4LD9D 1F66A 3O62B 3AZHC 3MGRC 3B0BA 5B0ZA 5B1LD 2PYOC 3NQJB 1P3MA 1EQZD 1P3OD 5B33B 5FUGA 5B2JB 3AZFC 1P3IB 5B2IA 3AN2D 5BT1C 5CPJC 5GXQB 3REJD 3AZIC 3B6FD 1P3BA 5G49A 3NQUA 4M6BA 5AV8A 5CPKA 2YFWA 5GT0C 1P3LB 3AYWA 2F8ND 4J8UA 3LELC 2AROD 1JFIA 4YS3C 5BT1D 1WWIA 3WTPA 1P3MB 1P3OB 2NZDC 5CPJD 1BH9A 3REHD 3X1TB 3AZKD 1P3AC 4H9OB 3AZGB 4WNNA 4R8PC 3A6ND 3AZNA 1KX4D 3W99D 3W96C 3TU4A 4CAYB 3REJB 3B6FB 3LZ1A 1ID3B 5JA4B 4YS3D 2F8NK 2BYMA 4YM6D 5AV6A 3AZFA 5CPIA 3MGSD 1P3FD 5DNNC 3AV1D 3W97A 5GSUA 5CPKB 5E5AB 4CSRB 1P3GA 2IO5C 5AV9A 4E44A 3AV2D 2AROB 4H9RA 3LZ0C 4G92B 3AZLC 3X1VA 5DNMC 4H9SC 4X23A 1KX3B 5BNXA 5JRGD 3REHB 4HGAC 5B40B 5AVCC 3AZKB 1AOID 5B32B 1TAFB 3REKC 5AV5D 5B24A 4KGCC 4WNNB 3KWQC 1KX4B 4UUZA 4Z5TA 2CV5C 1TZYD 3B0CT 5GT3D 5B31C 3LZ0D 5DNMD 5AY8A 4YM6B 3MNND 5BO0A 3MGSB 3AV1B 3AFAA 3C1BD 5AVBC 4KUDA 3LJAA 4Z66D 4J8WA 4KHAA 3C1CA 4QLCA 3X1UC 4H9QB 3WA9B 4ZBJB 3B6GB 4AWLB 1P3PA 3WTPE 2CV5D 5B0YA 1M18D 3UTBB 3AZJA 2NQBC 2FJ7C 5AV5B 3MGPD 5BNVA 2HUEC 5F99A 4JJNC 3UT9A 5GT3B 3W98D 4XUJA 3X1UD 3REIA 1ZLAA 4WU9D 3MNNB 4ZUXB 5AY8B 3C1BB 1WWSA 4Z66B 4KUDB 3KWQA 4J8WB 4H9PB 3C1CB 4NE5A 5B33C 1S32D 5B2JC 3MGQB 1P3IC 4WU8B 3O62D 1M18B 1M1AA 4WV4B 3MGPB 2HIOD 3X1SA 3UT9B 1U35B 3KSYA 5B1MA 3R45A 3W98B 4J8VA 3KUYA 3KXBA 5B33D 5B2JD 1P3ID 4DRBA 1P3LC 5B1LC 1P34A 1H3OA 1M19A 1KX5B 1P3OC 1S32B 5GXQD 3X1TC 4EO5B 3AZGC 2YFVA 3AN2C 1HQ3B 1F66D 3AZMB 1R4VA 2BYKA 2HIOB 1P3LD 3REJC 5B0ZD 3WKJA 3B6FC 3WAAA 1P3MD 1P3KB 3X1TD 1F1EA 4NE3A 3AZGD 5B2ID 1N1JA 2AROC 3AZEA 4LD9A 4H9NA 4J8XB 5CP6B 3REHC 3AZKC 3MVDA 5B40C 1ID3D 3RELA 1F66B 5B32C 1P3BD 3A6NC 1KX4C 3W99C 5CPKD 5E5AD 3UTAA 1EQZA 5B0ZB 3AYWD 4J8UD 4XZQA 4YM6C 3WTPD 3MGSC 3AZHA 1P3FC 3AV1C 3AN2A 3MGRA 1KX3D 5FUGB 5B40D 4NFTA 5B32D 5B2IB 3AV2C 3WA9C 2PYOA 4ZBJC 3B6GC 4AWLC 4H9NB 5JRGC 1AOIC 3MVDB 1P3BB 5AV5C 2F8NA 5AV6D 5G49B 5CHLB 3NQUB 5AV8B 2YFWB 3W97D 1TZYC 5GT3C 3AYWB 5CPJA 4J8UB 3VH6T 3AZIA 1JFIB 3WA9D 3WTPB 3MNNC 3B6GD 3X1VD 3VH5A 4XZQB 4ZUXC 3VH5T 3C1BC 4WZSB 3MGRB 4Z66C 3UTBD 1BH9B 3A6NA 4DRAA 5GT0A 2PYOB 3LELA 3AZNB 4YS3A 4Z5TD 3V9RA 4WU8C 1M18C 3TU4B 2JSSA 2NZDA 1P3FA 3LZ1B 5BS7C 3MGPC 1P3AA 2BYMB 4ZUXD 3AZFB 5AY8D 5AV6B 5CPIB 2RVQD 3AV2A 4R8PA 4KUDD 3W97B 1U35C 4J8WD 5GSUB 3W98C 1P3GB 3W96A 3C1CD 5AV9B 4QLCD 4H9RB 4WU9C 3X1VB 3MGQD 4X23B 5BNXB 4WU8D 5DNNA 5B0YD 3AZJD 1KX5C 1S32C 5GT0B 5B24B 3LZ0A 4UUZB 4Z5TB 5DNMA 3LELB 4H9SA 3O62C 4EO5C 3UT9D 3AZLA 1U35D 1HQ3C 4XUJD 3AZMC 3REID 1ZLAD 5AVCA 2HIOC 5BO0B 3REKA 3AFAB 4KGCA 3LJAB 3B0DB 4KHAB 1KX5D 4Z2MG 5B31G 4QLCB 4E45A 2CV5A 5B31A 2CWEA 1P3KC 1P3PB 1HQ3D 5B0YB 3AZJB 5KDMA 3AZMD 5AVBA 4J8XC 5BNVB 5F99B 2IO5B 5GXQC 3X1UA 4WU9A 1F66C 4XUJB 4J8VD 3KUYD 3KXBD 3REIB 1ZLAB 2NQBA 1P3KD 2FJ7A 5B0ZC 3REKB 4JJNA 4KGCB 3KWQB 1P34D 1P3MC 4J8XD 5CP6D 5B31B 5B2IC 1M1AB 1HTAA 5AVBB 3NQJA 3X1SB 5B33A 5B2JA 1ID3C 3WAAD 5B1MB 3WKJD 3R45B 1P3BC 4J8VB 1P3IA 3KUYB 1ULYA 3KXBB 1B6WA 2NQBB 5AV8C 5CPKC 5E5AC 2FJ7B 3AYWC 2HUEB 1P34B 4G92C 5GXQA 4J8UC 1H3OB 1M19B 3WTPC 1KX3C 3B0CW 3MVDD 2YFVB 3RELD 1P3LA 5B1LA 2BYKB 3AZNC 5AV8D 1P3OA 3TU4C 3UTAD 3WKJB 3WAAB 3LZ1C 3X1TA 4XZQD 4H9OA 5CPIC 5AV6C 3AZGA 3AZHD 3MGRD 5C3IB 3W97C 5GSUC 1P3GC 1BFMA 5AV9C 4CAYA 1N1JB 3REJA 3B6FA 3X1VC 2PYOD 3AZEB 3AZND 5JA4A 1ID3A 4LD9B 4X23C 3UTBC 3TU4D 3LZ1D 4G91B 2F8NG 3RELB 5E5AA 4CSRA 3AZFD 5CPID 5B24C 5B1LB 2AROA 4Z5TC 5GSUD 3UTAB 1P3GD 1KX3A 3VH6A 5AV9D 1EQZB 3REHA 5B32G 3AZKA 5B40A 3AZID 5AY8C 5B32A 4X23D 3AZHB 2RVQC 1TAFA 3AN2B 3AFAC 4KUDC 3LJAC 4J8WC 3B0DC 1KX4A 3W99A 3C1CC 4QLCC 5GT0D 5B24D 3MGQC 3LELD 4YM6A 3MGSA 1P3PC 3AV1A 5B0YC 3AZJC 2NZDD 1P3AD 2F8NB 5F99C 4NE6A 4H9QA 1Q9CA 2LY8A 3AFAD 3UT9C 3WA9A 3LJAD 1BH8A 4R8PD 3B6GA 4XUJC 3W96D 5JRGA 5CPJB 3REIC 3UTBA 1AOIA 3AZIB 1ZLAC 2L5AA 2F8NH 5AV5A 1P3PD 5DNND 3A6NB 3W99B 1TZYA 5GT3A 5F99D 4YS3B 3MNNA 4ZUXA 3AZLD 3V9RB 3C1BA 2NZDB 1P3FB 1M1AC 4Z66A 1P3AB 5AVCD 4H9PA 3X1SC 3REKD 1KU5A 3AV2B 4R8PB 4KGCD 3KWQD 5B1MC 1BH8B 3MGQA 4J8VC 3W96B 3KUYC 4WU8A 3KXBC 1M18A 5JRGB 5B31D 1AOIB 5BS7A 3MGPA 5DNNB 1P34C 1M1AD 5AVBD 1U35A 1M19C 5CP6C 3W98A 1TZYB 3X1SD 3LZ0B 3AZLB 5DNMB 5B1MD 4HGAB 5AVCB 2NQBD 1KX5A 2FJ7D 1S32A 1A7WA 3WAAC 3WKJC 4JJND 1M19D 3O62A 2CV5B 1HQ3A 3AZMA 5C3IC 2HIOA
chains in the Genus database with same CATH superfamily
5KDMB 3AZEC 4LD9C 1B67A 4Z2MH 2JCHA 3X1UB 2VQRA 3KFUG 1P3KA 3MVDC 4G91C 4WU9B 3RELC 3VH6W 4WJ3C 3VH5W 4J8XA 3UTAC 1EQZC 5CP6A 4JJNB 4XZQC 3AZED 4LD9D 1F66A 3O62B 3AZHC 3MGRC 3B0BA 5B0ZA 5B1LD 2PYOC 3NQJB 1P3MA 1EQZD 1P3OD 5B33B 5FUGA 5B2JB 2ZY4A 3AZFC 4DQYB 1P3IB 5B2IA 3AN2D 3EPJA 3H0RC 5BT1C 2ZY3A 5CPJC 5GXQB 3REJD 3AZIC 3B6FD 1P3BA 2XD5A 5G49A 3NQUA 4M6BA 5AV8A 5CPKA 2YFWA 5GT0C 1P3LB 3AYWA 2F8ND 4J8UA 3LELC 2AROD 2JE5A 4YS3C 5BT1D 1WWIA 3WTPA 1P3MB 1P3OB 1JFIA 2NZDC 5CPJD 1BH9A 3REHD 3X1TB 3AZKD 1P3AC 4H9OB 3AZGB 4WNNA 4R8PC 3A6ND 3AZNA 1KX4D 3W99D 2DF4C 3W96C 2Y2KA 3TU4A 4CAYB 3REJB 3B6FB 3LZ1A 1ID3B 5JA4B 4YS3D 2F8NK 2BYMA 4YM6D 5AV6A 3AZFA 5CPIA 3MGSD 1P3FD 5DNNC 3AV1D 3W97A 3A1KA 5GSUA 5CPKB 5E5AB 4CSRB 1P3GA 2IO5C 5AV9A 4E44A 3AV2D 2AROB 4H9RA 3LZ0C 4G92B 3AZLC 3X1VA 5DNMC 4H9SC 3EPLA 4X23A 1KX3B 5BNXA 2Y2IA 5JRGD 3REHB 4HGAC 5B40B 5AVCC 3AZKB 1AOID 5B32B 1TAFB 3REKC 5AV5D 5B24A 4KGCC 4WNNB 3KWQC 1KX4B 4UUZA 4Z5TA 2CV5C 1TZYD 3B0CT 5GT3D 5B31C 3AL0C 3LZ0D 5DNMD 5AY8A 4YM6B 3MNND 5BO0A 3MGSB 3AV1B 3AFAA 3C1BD 5AVBC 4KUDA 3LJAA 4Z66D 4J8WA 4KHAA 3C1CA 2G5IC 4QLCA 3X1UC 4H9QB 3WA9B 4ZBJB 3B6GB 4AWLB 1P3PA 3WTPE 2CV5D 5B0YA 1M18D 3UTBB 3AZJA 2NQBC 2ZY5A 1U35D 2FJ7C 5AV5B 3MGPD 5BNVA 2HUEC 5F99A 4JJNC 3UT9A 5GT3B 3W98D 4XUJA 3X1UD 3REIA 1ZLAA 4WU9D 2Y2GA 3MNNB 4ZUXB 5AY8B 3C1BB 1WWSA 4Z66B 4KUDB 3KWQA 4J8WB 4H9PB 3C1CB 4NE5A 5B33C 1S32D 5B2JC 3MGQB 1P3IC 4WU8B 3O62D 1M18B 1M1AA 4WV4B 3MGPB 2HIOD 3X1SA 3UT9B 1U35B 3KSYA 5B1MA 3R45A 3W98B 4J8VA 3KUYA 3KXBA 3IP4C 3H0LC 5B33D 5B2JD 1P3ID 4DRBA 1P3LC 5B1LC 1P34A 1H3OA 1M19A 1KX5B 1P3OC 1Z2CB 1S32B 5GXQD 3X1TC 4EO5B 3AZGC 2YFVA 3AN2C 1HQ3B 1F66D 3AZMB 1R4VA 2BYKA 2Y2NA 2HIOB 1P3LD 3REJC 5B0ZD 3WKJA 3B6FC 3WAAA 1P3MD 2Y2MA 1P3KB 3X1TD 3EG5B 1F1EA 4NE3A 3AZGD 5B2ID 1N1JA 2AROC 3AZEA 4LD9A 4H9NA 4J8XB 5CP6B 3REHC 3AZKC 3MVDA 5B40C 1ID3D 3RELA 1F66B 5B32C 1T3UA 1P3BD 3A6NC 1KX4C 3W99C 5CPKD 5E5AD 3UTAA 1EQZA 5B0ZB 3AYWD 3FDDA 4XZQA 4J8UD 4YM6C 3WTPD 3MGSC 3AZHA 1P3FC 3AV1C 3AN2A 3MGRA 1KX3D 5FUGB 2W8SA 2Y2HA 5B40D 4NFTA 5B32D 5B2IB 3AV2C 3WA9C 2PYOA 4ZBJC 3B6GC 4AWLC 4H9NB 2DQNC 5JRGC 3P5JB 1AOIC 3MVDB 1P3BB 5AV5C 2F8NA 5AV6D 5G49B 5CHLB 3NQUB 5AV8B 2YFWB 3W97D 1TZYC 5GT3C 3AYWB 5CPJA 4J8UB 3VH6T 3AZIA 1JFIB 3WA9D 3WTPB 3MNNC 3B6GD 3X1VD 3VH5A 4XZQB 4ZUXC 3VH5T 3C1BC 4WZSB 3MGRB 4Z66C 3UTBD 1BH9B 3A6NA 4DRAA 2Y2JA 5GT0A 2PYOB 3LELA 3AZNB 4YS3A 4Z5TD 3V9RA 4WU8C 1M18C 3TU4B 2JSSA 2NZDA 1P3FA 3LZ1B 5BS7C 2Y2OA 3MGPC 3H0MC 1P3AA 2BYMB 4ZUXD 3AZFB 5AY8D 5AV6B 5CPIB 2RVQD 3AV2A 4R8PA 4KUDD 3W97B 1U35C 4J8WD 5GSUB 3W98C 1P3GB 3W96A 3C1CD 5AV9B 4QLCD 4H9RB 4WU9C 3X1VB 3MGQD 2XD1A 2Y2LA 4X23B 5BNXB 4WU8D 5DNNA 5B0YD 3AZJD 1KX5C 1S32C 5GT0B 5B24B 3LZ0A 4UUZB 4Z5TB 5DNMA 3LELB 1W2EA 4H9SA 4EO5C 3O62C 3UT9D 3AZLA 1HQ3C 4XUJD 3AZMC 3REID 1ZLAD 5AVCA 2HIOC 5BO0B 3REKA 3AFAB 4KGCA 3LJAB 2RIQA 3B0DB 4KHAB 1KX5D 4Z2MG 5B31G 4QLCB 4E45A 2CV5A 5B31A 2CWEA 1P3KC 3EPHA 1P3PB 1HQ3D 5B0YB 3AZJB 5KDMA 3AZMD 5AVBA 2ZY2A 4J8XC 5BNVB 3A1IA 5F99B 2IO5B 5GXQC 3X1UA 4WU9A 1F66C 4XUJB 4J8VD 3KUYD 3KXBD 3REIB 1ZLAB 2NQBA 1P3KD 3EPKA 2FJ7A 2G5HC 5B0ZC 3REKB 4JJNA 4KGCB 3KWQB 1P34D 1P3MC 4J8XD 5CP6D 5B31B 2FFFB 5B2IC 1M1AB 1HTAA 5AVBB 3NQJA 3X1SB 5B33A 5B2JA 1ID3C 3WAAD 5B1MB 2BG1A 3R45B 1P3BC 4J8VB 1P3IA 1PZRA 3WKJD 3KUYB 1ULYA 3KXBB 1B6WA 2NQBB 5AV8C 5CPKC 5E5AC 2FJ7B 3AYWC 2HUEB 1P34B 4G92C 5GXQA 4J8UC 1H3OB 1M19B 3WTPC 1KX3C 3B0CW 3MVDD 2YFVB 3RELD 1P3LA 5B1LA 2BYKB 3AZNC 5AV8D 1P3OA 3TU4C 3UTAD 3WKJB 3WAAB 3LZ1C 3X1TA 4XZQD 4H9OA 5CPIC 5AV6C 3AZGA 3AZHD 3MGRD 5C3IB 3W97C 5GSUC 1P3GC 1BFMA 5AV9C 4CAYA 1N1JB 3REJA 3B6FA 3X1VC 2PYOD 3AZEB 3AZND 5JA4A 1ID3A 4LD9B 4X23C 3UTBC 3TU4D 3LZ1D 4G91B 2F8NG 3RELB 5E5AA 4CSRA 3AZFD 5CPID 5B24C 5B1LB 2AROA 4Z5TC 5GSUD 3UTAB 1P3GD 1KX3A 3VH6A 5AV9D 1EQZB 3REHA 5B32G 3AZKA 5B40A 3AZID 5AY8C 5B32A 4X23D 3AZHB 2RVQC 1TAFA 3AN2B 3AFAC 4KUDC 3LJAC 4J8WC 3B0DC 1KX4A 3W99A 3C1CC 4QLCC 5GT0D 5B24D 3MGQC 2F2AC 3LELD 4YM6A 3MGSA 1P3PC 3AV1A 5B0YC 3AZJC 2NZDD 2UWXA 1P3AD 2Y2PA 2F8NB 5F99C 4NE6A 4H9QA 1Q9CA 2LY8A 3AFAD 3UT9C 3WA9A 3LJAD 1BH8A 4R8PD 3B6GA 4XUJC 3W96D 5JRGA 5CPJB 3REIC 3UTBA 1AOIA 3AZIB 1ZLAC 2L5AA 2F8NH 5AV5A 1P3PD 5DNND 3A6NB 3W99B 1TZYA 5GT3A 5F99D 2Y2QA 4YS3B 3MNNA 4ZUXA 3AZLD 3V9RB 3F6TA 3C1BA 1P3FB 2NZDB 1M1AC 4Z66A 1P3AB 5AVCD 4H9PA 3X1SC 3REKD 1KU5A 3AV2B 4R8PB 4KGCD 3KWQD 5B1MC 1BH8B 3MGQA 4J8VC 3W96B 3KUYC 4WU8A 3KXBC 1M18A 5JRGB 5B31D 1AOIB 5BS7A 3MGPA 5DNNB 1P34C 1M1AD 5AVBD 1U35A 1M19C 2J8PA 5CP6C 3W98A 1TZYB 3X1SD 3LZ0B 3AZLB 5DNMB 5B1MD 4UPKA 2ZM5A 4HGAB 5AVCB 2NQBD 1KX5A 2FJ7D 1S32A 1A7WA 3WAAC 3WKJC 4JJND 1M19D 3O62A 2CV5B 1HQ3A 3AZMA 5C3IC 2HIOA
chains in the Genus database with same CATH topology
5KDMB 3AZEC 4LD9C 1B67A 4Z2MH 2JCHA 3X1UB 2VQRA 3KFUG 1P3KA 3MVDC 4G91C 4WU9B 3RELC 3VH6W 4WJ3C 3VH5W 4J8XA 3UTAC 1EQZC 5CP6A 4JJNB 4XZQC 3AZED 4LD9D 1F66A 3O62B 3AZHC 3MGRC 3B0BA 5B0ZA 5B1LD 2PYOC 3NQJB 1P3MA 1EQZD 1P3OD 5B33B 5FUGA 5B2JB 2ZY4A 3AZFC 4DQYB 1P3IB 5B2IA 3AN2D 3EPJA 3H0RC 5BT1C 2ZY3A 5CPJC 5GXQB 3REJD 3AZIC 3B6FD 1P3BA 2XD5A 5G49A 3NQUA 4M6BA 5AV8A 5CPKA 2YFWA 5GT0C 1P3LB 3AYWA 2F8ND 4J8UA 3LELC 2AROD 2JE5A 4YS3C 5BT1D 1WWIA 3WTPA 1P3MB 1P3OB 1JFIA 2NZDC 5CPJD 1BH9A 3REHD 3X1TB 3AZKD 1P3AC 4H9OB 3AZGB 4WNNA 4R8PC 3A6ND 3AZNA 1KX4D 3W99D 2DF4C 3W96C 2Y2KA 3TU4A 4CAYB 3REJB 3B6FB 3LZ1A 1ID3B 5JA4B 4YS3D 2F8NK 2BYMA 4YM6D 5AV6A 3AZFA 5CPIA 3MGSD 1P3FD 5DNNC 3AV1D 3W97A 3A1KA 5GSUA 5CPKB 5E5AB 4CSRB 1P3GA 2IO5C 5AV9A 4E44A 3AV2D 2AROB 4H9RA 3LZ0C 4G92B 3AZLC 3X1VA 5DNMC 4H9SC 3EPLA 4X23A 1KX3B 5BNXA 2Y2IA 5JRGD 3REHB 4HGAC 5B40B 5AVCC 3AZKB 1AOID 5B32B 1TAFB 3REKC 5AV5D 5B24A 4KGCC 4WNNB 3KWQC 1KX4B 4UUZA 4Z5TA 2CV5C 1TZYD 3B0CT 5GT3D 5B31C 3AL0C 3LZ0D 5DNMD 5AY8A 4YM6B 3MNND 5BO0A 3MGSB 3AV1B 3AFAA 3C1BD 5AVBC 4KUDA 3LJAA 4Z66D 4J8WA 4KHAA 3C1CA 2G5IC 4QLCA 3X1UC 4H9QB 3WA9B 4ZBJB 3B6GB 4AWLB 1P3PA 3WTPE 2CV5D 5B0YA 1M18D 3UTBB 3AZJA 2NQBC 2ZY5A 1U35D 2FJ7C 5AV5B 3MGPD 5BNVA 2HUEC 5F99A 4JJNC 3UT9A 5GT3B 3W98D 4XUJA 3X1UD 3REIA 1ZLAA 4WU9D 2Y2GA 3MNNB 4ZUXB 5AY8B 3C1BB 1WWSA 4Z66B 4KUDB 3KWQA 4J8WB 4H9PB 3C1CB 4NE5A 5B33C 1S32D 5B2JC 3MGQB 1P3IC 4WU8B 3O62D 1M18B 1M1AA 4WV4B 3MGPB 2HIOD 3X1SA 3UT9B 1U35B 3KSYA 5B1MA 3R45A 3W98B 4J8VA 3KUYA 3KXBA 3IP4C 3H0LC 5B33D 5B2JD 1P3ID 4DRBA 1P3LC 5B1LC 1P34A 1H3OA 1M19A 1KX5B 1P3OC 1Z2CB 1S32B 5GXQD 3X1TC 4EO5B 3AZGC 2YFVA 3AN2C 1HQ3B 1F66D 3AZMB 1R4VA 2BYKA 2Y2NA 2HIOB 1P3LD 3REJC 5B0ZD 3WKJA 3B6FC 3WAAA 1P3MD 2Y2MA 1P3KB 3X1TD 3EG5B 1F1EA 4NE3A 3AZGD 5B2ID 1N1JA 2AROC 3AZEA 4LD9A 4H9NA 4J8XB 5CP6B 3REHC 3AZKC 3MVDA 5B40C 1ID3D 3RELA 1F66B 5B32C 1T3UA 1P3BD 3A6NC 1KX4C 3W99C 5CPKD 5E5AD 3UTAA 1EQZA 5B0ZB 3AYWD 3FDDA 4XZQA 4J8UD 4YM6C 3WTPD 3MGSC 3AZHA 1P3FC 3AV1C 3AN2A 3MGRA 1KX3D 5FUGB 2W8SA 2Y2HA 5B40D 4NFTA 5B32D 5B2IB 3AV2C 3WA9C 2PYOA 4ZBJC 3B6GC 4AWLC 4H9NB 2DQNC 5JRGC 3P5JB 1AOIC 3MVDB 1P3BB 5AV5C 2F8NA 5AV6D 5G49B 5CHLB 3NQUB 5AV8B 2YFWB 3W97D 1TZYC 5GT3C 3AYWB 5CPJA 4J8UB 3VH6T 3AZIA 1JFIB 3WA9D 3WTPB 3MNNC 3B6GD 3X1VD 3VH5A 4XZQB 4ZUXC 3VH5T 3C1BC 4WZSB 3MGRB 4Z66C 3UTBD 1BH9B 3A6NA 4DRAA 2Y2JA 5GT0A 2PYOB 3LELA 3AZNB 4YS3A 4Z5TD 3V9RA 4WU8C 1M18C 3TU4B 2JSSA 2NZDA 1P3FA 3LZ1B 5BS7C 2Y2OA 3MGPC 3H0MC 1P3AA 2BYMB 4ZUXD 3AZFB 5AY8D 5AV6B 5CPIB 2RVQD 3AV2A 4R8PA 4KUDD 3W97B 1U35C 4J8WD 5GSUB 3W98C 1P3GB 3W96A 3C1CD 5AV9B 4QLCD 4H9RB 4WU9C 3X1VB 3MGQD 2XD1A 2Y2LA 4X23B 5BNXB 4WU8D 5DNNA 5B0YD 3AZJD 1KX5C 1S32C 5GT0B 5B24B 3LZ0A 4UUZB 4Z5TB 5DNMA 3LELB 1W2EA 4H9SA 4EO5C 3O62C 3UT9D 3AZLA 1HQ3C 4XUJD 3AZMC 3REID 1ZLAD 5AVCA 2HIOC 5BO0B 3REKA 3AFAB 4KGCA 3LJAB 2RIQA 3B0DB 4KHAB 1KX5D 4Z2MG 5B31G 4QLCB 4E45A 2CV5A 5B31A 2CWEA 1P3KC 3EPHA 1P3PB 1HQ3D 5B0YB 3AZJB 5KDMA 3AZMD 5AVBA 2ZY2A 4J8XC 5BNVB 3A1IA 5F99B 2IO5B 5GXQC 3X1UA 4WU9A 1F66C 4XUJB 4J8VD 3KUYD 3KXBD 3REIB 1ZLAB 2NQBA 1P3KD 3EPKA 2FJ7A 2G5HC 5B0ZC 3REKB 4JJNA 4KGCB 3KWQB 1P34D 1P3MC 4J8XD 5CP6D 5B31B 2FFFB 5B2IC 1M1AB 1HTAA 5AVBB 3NQJA 3X1SB 5B33A 5B2JA 1ID3C 3WAAD 5B1MB 2BG1A 3R45B 1P3BC 4J8VB 1P3IA 1PZRA 3WKJD 3KUYB 1ULYA 3KXBB 1B6WA 2NQBB 5AV8C 5CPKC 5E5AC 2FJ7B 3AYWC 2HUEB 1P34B 4G92C 5GXQA 4J8UC 1H3OB 1M19B 3WTPC 1KX3C 3B0CW 3MVDD 2YFVB 3RELD 1P3LA 5B1LA 2BYKB 3AZNC 5AV8D 1P3OA 3TU4C 3UTAD 3WKJB 3WAAB 3LZ1C 3X1TA 4XZQD 4H9OA 5CPIC 5AV6C 3AZGA 3AZHD 3MGRD 5C3IB 3W97C 5GSUC 1P3GC 1BFMA 5AV9C 4CAYA 1N1JB 3REJA 3B6FA 3X1VC 2PYOD 3AZEB 3AZND 5JA4A 1ID3A 4LD9B 4X23C 3UTBC 3TU4D 3LZ1D 4G91B 2F8NG 3RELB 5E5AA 4CSRA 3AZFD 5CPID 5B24C 5B1LB 2AROA 4Z5TC 5GSUD 3UTAB 1P3GD 1KX3A 3VH6A 5AV9D 1EQZB 3REHA 5B32G 3AZKA 5B40A 3AZID 5AY8C 5B32A 4X23D 3AZHB 2RVQC 1TAFA 3AN2B 3AFAC 4KUDC 3LJAC 4J8WC 3B0DC 1KX4A 3W99A 3C1CC 4QLCC 5GT0D 5B24D 3MGQC 2F2AC 3LELD 4YM6A 3MGSA 1P3PC 3AV1A 5B0YC 3AZJC 2NZDD 2UWXA 1P3AD 2Y2PA 2F8NB 5F99C 4NE6A 4H9QA 1Q9CA 2LY8A 3AFAD 3UT9C 3WA9A 3LJAD 1BH8A 4R8PD 3B6GA 4XUJC 3W96D 5JRGA 5CPJB 3REIC 3UTBA 1AOIA 3AZIB 1ZLAC 2L5AA 2F8NH 5AV5A 1P3PD 5DNND 3A6NB 3W99B 1TZYA 5GT3A 5F99D 2Y2QA 4YS3B 3MNNA 4ZUXA 3AZLD 3V9RB 3F6TA 3C1BA 1P3FB 2NZDB 1M1AC 4Z66A 1P3AB 5AVCD 4H9PA 3X1SC 3REKD 1KU5A 3AV2B 4R8PB 4KGCD 3KWQD 5B1MC 1BH8B 3MGQA 4J8VC 3W96B 3KUYC 4WU8A 3KXBC 1M18A 5JRGB 5B31D 1AOIB 5BS7A 3MGPA 5DNNB 1P34C 1M1AD 5AVBD 1U35A 1M19C 2J8PA 5CP6C 3W98A 1TZYB 3X1SD 3LZ0B 3AZLB 5DNMB 5B1MD 4UPKA 2ZM5A 4HGAB 5AVCB 2NQBD 1KX5A 2FJ7D 1S32A 1A7WA 3WAAC 3WKJC 4JJND 1M19D 3O62A 2CV5B 1HQ3A 3AZMA 5C3IC 2HIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM B;  3AZE C;  4LD9 C;  1B67 A;  4Z2M H;  3X1U B;  1P3K A;  3MVD C;  4G91 C;  4WU9 B;  3REL C;  3VH6 W;  3VH5 W;  4J8X A;  3UTA C;  1EQZ C;  5CP6 A;  4JJN B;  4XZQ C;  3AZE D;  4LD9 D;  1F66 A;  3O62 B;  3AZH C;  3MGR C;  3B0B A;  5B0Z A;  5B1L D;  2PYO C;  3NQJ B;  1P3M A;  1EQZ D;  1P3O D;  5B33 B;  5FUG A;  5B2J B;  3AZF C;  1P3I B;  5B2I A;  3AN2 D;  5BT1 C;  5CPJ C;  5GXQ B;  3REJ D;  3AZI C;  3B6F D;  1P3B A;  5G49 A;  3NQU A;  4M6B A;  5AV8 A;  5CPK A;  2YFW A;  5GT0 C;  1P3L B;  3AYW A;  2F8N D;  4J8U A;  3LEL C;  2ARO D;  1JFI A;  4YS3 C;  5BT1 D;  1WWI A;  3WTP A;  1P3M B;  1P3O B;  2NZD C;  5CPJ D;  1BH9 A;  3REH D;  3X1T B;  3AZK D;  1P3A C;  4H9O B;  3AZG B;  4WNN A;  4R8P C;  3A6N D;  3AZN A;  1KX4 D;  3W99 D;  3W96 C;  3TU4 A;  4CAY B;  3REJ B;  3B6F B;  3LZ1 A;  1ID3 B;  5JA4 B;  4YS3 D;  2F8N K;  2BYM A;  4YM6 D;  5AV6 A;  3AZF A;  5CPI A;  3MGS D;  1P3F D;  5DNN C;  3AV1 D;  3W97 A;  5GSU A;  5CPK B;  5E5A B;  4CSR B;  1P3G A;  2IO5 C;  5AV9 A;  4E44 A;  3AV2 D;  2ARO B;  4H9R A;  3LZ0 C;  4G92 B;  3AZL C;  3X1V A;  5DNM C;  4H9S C;  4X23 A;  1KX3 B;  5BNX A;  5JRG D;  3REH B;  4HGA C;  5B40 B;  5AVC C;  3AZK B;  1AOI D;  5B32 B;  1TAF B;  3REK C;  5AV5 D;  5B24 A;  4KGC C;  4WNN B;  3KWQ C;  1KX4 B;  4UUZ A;  4Z5T A;  2CV5 C;  1TZY D;  3B0C T;  5GT3 D;  5B31 C;  3LZ0 D;  5DNM D;  5AY8 A;  4YM6 B;  3MNN D;  5BO0 A;  3MGS B;  3AV1 B;  3AFA A;  3C1B D;  5AVB C;  4KUD A;  3LJA A;  4Z66 D;  4J8W A;  4KHA A;  3C1C A;  4QLC A;  3X1U C;  4H9Q B;  3WA9 B;  4ZBJ B;  3B6G B;  4AWL B;  1P3P A;  3WTP E;  2CV5 D;  5B0Y A;  1M18 D;  3UTB B;  3AZJ A;  2NQB C;  2FJ7 C;  5AV5 B;  3MGP D;  5BNV A;  2HUE C;  5F99 A;  4JJN C;  3UT9 A;  5GT3 B;  3W98 D;  4XUJ A;  3X1U D;  3REI A;  1ZLA A;  4WU9 D;  3MNN B;  4ZUX B;  5AY8 B;  3C1B B;  1WWS A;  4Z66 B;  4KUD B;  3KWQ A;  4J8W B;  4H9P B;  3C1C B;  4NE5 A;  5B33 C;  1S32 D;  5B2J C;  3MGQ B;  1P3I C;  4WU8 B;  3O62 D;  1M18 B;  1M1A A;  4WV4 B;  3MGP B;  2HIO D;  3X1S A;  3UT9 B;  1U35 B;  3KSY A;  5B1M A;  3R45 A;  3W98 B;  4J8V A;  3KUY A;  3KXB A;  5B33 D;  5B2J D;  1P3I D;  4DRB A;  1P3L C;  5B1L C;  1P34 A;  1H3O A;  1M19 A;  1KX5 B;  1P3O C;  1S32 B;  5GXQ D;  3X1T C;  4EO5 B;  3AZG C;  2YFV A;  3AN2 C;  1HQ3 B;  1F66 D;  3AZM B;  1R4V A;  2BYK A;  2HIO B;  1P3L D;  3REJ C;  5B0Z D;  3WKJ A;  3B6F C;  3WAA A;  1P3M D;  1P3K B;  3X1T D;  1F1E A;  4NE3 A;  3AZG D;  5B2I D;  1N1J A;  2ARO C;  3AZE A;  4LD9 A;  4H9N A;  4J8X B;  5CP6 B;  3REH C;  3AZK C;  3MVD A;  5B40 C;  1ID3 D;  3REL A;  1F66 B;  5B32 C;  1P3B D;  3A6N C;  1KX4 C;  3W99 C;  5CPK D;  5E5A D;  3UTA A;  1EQZ A;  5B0Z B;  3AYW D;  4J8U D;  4XZQ A;  4YM6 C;  3WTP D;  3MGS C;  3AZH A;  1P3F C;  3AV1 C;  3AN2 A;  3MGR A;  1KX3 D;  5FUG B;  5B40 D;  4NFT A;  5B32 D;  5B2I B;  3AV2 C;  3WA9 C;  2PYO A;  4ZBJ C;  3B6G C;  4AWL C;  4H9N B;  5JRG C;  1AOI C;  3MVD B;  1P3B B;  5AV5 C;  2F8N A;  5AV6 D;  5G49 B;  5CHL B;  3NQU B;  5AV8 B;  2YFW B;  3W97 D;  1TZY C;  5GT3 C;  3AYW B;  5CPJ A;  4J8U B;  3VH6 T;  3AZI A;  1JFI B;  3WA9 D;  3WTP B;  3MNN C;  3B6G D;  3X1V D;  3VH5 A;  4XZQ B;  4ZUX C;  3VH5 T;  3C1B C;  4WZS B;  3MGR B;  4Z66 C;  3UTB D;  1BH9 B;  3A6N A;  4DRA A;  5GT0 A;  2PYO B;  3LEL A;  3AZN B;  4YS3 A;  4Z5T D;  3V9R A;  4WU8 C;  1M18 C;  3TU4 B;  2JSS A;  2NZD A;  1P3F A;  3LZ1 B;  5BS7 C;  3MGP C;  1P3A A;  2BYM B;  4ZUX D;  3AZF B;  5AY8 D;  5AV6 B;  5CPI B;  2RVQ D;  3AV2 A;  4R8P A;  4KUD D;  3W97 B;  1U35 C;  4J8W D;  5GSU B;  3W98 C;  1P3G B;  3W96 A;  3C1C D;  5AV9 B;  4QLC D;  4H9R B;  4WU9 C;  3X1V B;  3MGQ D;  4X23 B;  5BNX B;  4WU8 D;  5DNN A;  5B0Y D;  3AZJ D;  1KX5 C;  1S32 C;  5GT0 B;  5B24 B;  3LZ0 A;  4UUZ B;  4Z5T B;  5DNM A;  3LEL B;  4H9S A;  3O62 C;  4EO5 C;  3UT9 D;  3AZL A;  1U35 D;  1HQ3 C;  4XUJ D;  3AZM C;  3REI D;  1ZLA D;  5AVC A;  2HIO C;  5BO0 B;  3REK A;  3AFA B;  4KGC A;  3LJA B;  3B0D B;  4KHA B;  1KX5 D;  4Z2M G;  5B31 G;  4QLC B;  4E45 A;  2CV5 A;  5B31 A;  2CWE A;  1P3K C;  1P3P B;  1HQ3 D;  5B0Y B;  3AZJ B;  5KDM A;  3AZM D;  5AVB A;  4J8X C;  5BNV B;  5F99 B;  2IO5 B;  5GXQ C;  3X1U A;  4WU9 A;  1F66 C;  4XUJ B;  4J8V D;  3KUY D;  3KXB D;  3REI B;  1ZLA B;  2NQB A;  1P3K D;  2FJ7 A;  5B0Z C;  3REK B;  4JJN A;  4KGC B;  3KWQ B;  1P34 D;  1P3M C;  4J8X D;  5CP6 D;  5B31 B;  5B2I C;  1M1A B;  1HTA A;  5AVB B;  3NQJ A;  3X1S B;  5B33 A;  5B2J A;  1ID3 C;  3WAA D;  5B1M B;  3WKJ D;  3R45 B;  1P3B C;  4J8V B;  1P3I A;  3KUY B;  1ULY A;  3KXB B;  1B6W A;  2NQB B;  5AV8 C;  5CPK C;  5E5A C;  2FJ7 B;  3AYW C;  2HUE B;  1P34 B;  4G92 C;  5GXQ A;  4J8U C;  1H3O B;  1M19 B;  3WTP C;  1KX3 C;  3B0C W;  3MVD D;  2YFV B;  3REL D;  1P3L A;  5B1L A;  2BYK B;  3AZN C;  5AV8 D;  1P3O A;  3TU4 C;  3UTA D;  3WKJ B;  3WAA B;  3LZ1 C;  3X1T A;  4XZQ D;  4H9O A;  5CPI C;  5AV6 C;  3AZG A;  3AZH D;  3MGR D;  5C3I B;  3W97 C;  5GSU C;  1P3G C;  1BFM A;  5AV9 C;  4CAY A;  1N1J B;  3REJ A;  3B6F A;  3X1V C;  2PYO D;  3AZE B;  3AZN D;  5JA4 A;  1ID3 A;  4LD9 B;  4X23 C;  3UTB C;  3TU4 D;  3LZ1 D;  4G91 B;  2F8N G;  3REL B;  5E5A A;  4CSR A;  3AZF D;  5CPI D;  5B24 C;  5B1L B;  2ARO A;  4Z5T C;  5GSU D;  3UTA B;  1P3G D;  1KX3 A;  3VH6 A;  5AV9 D;  1EQZ B;  3REH A;  5B32 G;  3AZK A;  5B40 A;  3AZI D;  5AY8 C;  5B32 A;  4X23 D;  3AZH B;  2RVQ C;  1TAF A;  3AN2 B;  3AFA C;  4KUD C;  3LJA C;  4J8W C;  3B0D C;  1KX4 A;  3W99 A;  3C1C C;  4QLC C;  5GT0 D;  5B24 D;  3MGQ C;  3LEL D;  4YM6 A;  3MGS A;  1P3P C;  3AV1 A;  5B0Y C;  3AZJ C;  2NZD D;  1P3A D;  2F8N B;  5F99 C;  4NE6 A;  4H9Q A;  1Q9C A;  2LY8 A;  3AFA D;  3UT9 C;  3WA9 A;  3LJA D;  1BH8 A;  4R8P D;  3B6G A;  4XUJ C;  3W96 D;  5JRG A;  5CPJ B;  3REI C;  3UTB A;  1AOI A;  3AZI B;  1ZLA C;  2L5A A;  2F8N H;  5AV5 A;  1P3P D;  5DNN D;  3A6N B;  3W99 B;  1TZY A;  5GT3 A;  5F99 D;  4YS3 B;  3MNN A;  4ZUX A;  3AZL D;  3V9R B;  3C1B A;  2NZD B;  1P3F B;  1M1A C;  4Z66 A;  1P3A B;  5AVC D;  4H9P A;  3X1S C;  3REK D;  1KU5 A;  3AV2 B;  4R8P B;  4KGC D;  3KWQ D;  5B1M C;  1BH8 B;  3MGQ A;  4J8V C;  3W96 B;  3KUY C;  4WU8 A;  3KXB C;  1M18 A;  5JRG B;  5B31 D;  1AOI B;  5BS7 A;  3MGP A;  5DNN B;  1P34 C;  1M1A D;  5AVB D;  1U35 A;  1M19 C;  5CP6 C;  3W98 A;  1TZY B;  3X1S D;  3LZ0 B;  3AZL B;  5DNM B;  5B1M D;  4HGA B;  5AVC B;  2NQB D;  1KX5 A;  2FJ7 D;  1S32 A;  1A7W A;  3WAA C;  3WKJ C;  4JJN D;  1M19 D;  3O62 A;  2CV5 B;  1HQ3 A;  3AZM A;  5C3I C;  2HIO A; 
#chains in the Genus database with same CATH topology
 5KDM B;  3AZE C;  4LD9 C;  1B67 A;  4Z2M H;  2JCH A;  3X1U B;  2VQR A;  3KFU G;  1P3K A;  3MVD C;  4G91 C;  4WU9 B;  3REL C;  3VH6 W;  4WJ3 C;  3VH5 W;  4J8X A;  3UTA C;  1EQZ C;  5CP6 A;  4JJN B;  4XZQ C;  3AZE D;  4LD9 D;  1F66 A;  3O62 B;  3AZH C;  3MGR C;  3B0B A;  5B0Z A;  5B1L D;  2PYO C;  3NQJ B;  1P3M A;  1EQZ D;  1P3O D;  5B33 B;  5FUG A;  5B2J B;  2ZY4 A;  3AZF C;  4DQY B;  1P3I B;  5B2I A;  3AN2 D;  3EPJ A;  3H0R C;  5BT1 C;  2ZY3 A;  5CPJ C;  5GXQ B;  3REJ D;  3AZI C;  3B6F D;  1P3B A;  2XD5 A;  5G49 A;  3NQU A;  4M6B A;  5AV8 A;  5CPK A;  2YFW A;  5GT0 C;  1P3L B;  3AYW A;  2F8N D;  4J8U A;  3LEL C;  2ARO D;  2JE5 A;  4YS3 C;  5BT1 D;  1WWI A;  3WTP A;  1P3M B;  1P3O B;  1JFI A;  2NZD C;  5CPJ D;  1BH9 A;  3REH D;  3X1T B;  3AZK D;  1P3A C;  4H9O B;  3AZG B;  4WNN A;  4R8P C;  3A6N D;  3AZN A;  1KX4 D;  3W99 D;  2DF4 C;  3W96 C;  2Y2K A;  3TU4 A;  4CAY B;  3REJ B;  3B6F B;  3LZ1 A;  1ID3 B;  5JA4 B;  4YS3 D;  2F8N K;  2BYM A;  4YM6 D;  5AV6 A;  3AZF A;  5CPI A;  3MGS D;  1P3F D;  5DNN C;  3AV1 D;  3W97 A;  3A1K A;  5GSU A;  5CPK B;  5E5A B;  4CSR B;  1P3G A;  2IO5 C;  5AV9 A;  4E44 A;  3AV2 D;  2ARO B;  4H9R A;  3LZ0 C;  4G92 B;  3AZL C;  3X1V A;  5DNM C;  4H9S C;  3EPL A;  4X23 A;  1KX3 B;  5BNX A;  2Y2I A;  5JRG D;  3REH B;  4HGA C;  5B40 B;  5AVC C;  3AZK B;  1AOI D;  5B32 B;  1TAF B;  3REK C;  5AV5 D;  5B24 A;  4KGC C;  4WNN B;  3KWQ C;  1KX4 B;  4UUZ A;  4Z5T A;  2CV5 C;  1TZY D;  3B0C T;  5GT3 D;  5B31 C;  3AL0 C;  3LZ0 D;  5DNM D;  5AY8 A;  4YM6 B;  3MNN D;  5BO0 A;  3MGS B;  3AV1 B;  3AFA A;  3C1B D;  5AVB C;  4KUD A;  3LJA A;  4Z66 D;  4J8W A;  4KHA A;  3C1C A;  2G5I C;  4QLC A;  3X1U C;  4H9Q B;  3WA9 B;  4ZBJ B;  3B6G B;  4AWL B;  1P3P A;  3WTP E;  2CV5 D;  5B0Y A;  1M18 D;  3UTB B;  3AZJ A;  2NQB C;  2ZY5 A;  1U35 D;  2FJ7 C;  5AV5 B;  3MGP D;  5BNV A;  2HUE C;  5F99 A;  4JJN C;  3UT9 A;  5GT3 B;  3W98 D;  4XUJ A;  3X1U D;  3REI A;  1ZLA A;  4WU9 D;  2Y2G A;  3MNN B;  4ZUX B;  5AY8 B;  3C1B B;  1WWS A;  4Z66 B;  4KUD B;  3KWQ A;  4J8W B;  4H9P B;  3C1C B;  4NE5 A;  5B33 C;  1S32 D;  5B2J C;  3MGQ B;  1P3I C;  4WU8 B;  3O62 D;  1M18 B;  1M1A A;  4WV4 B;  3MGP B;  2HIO D;  3X1S A;  3UT9 B;  1U35 B;  3KSY A;  5B1M A;  3R45 A;  3W98 B;  4J8V A;  3KUY A;  3KXB A;  3IP4 C;  3H0L C;  5B33 D;  5B2J D;  1P3I D;  4DRB A;  1P3L C;  5B1L C;  1P34 A;  1H3O A;  1M19 A;  1KX5 B;  1P3O C;  1Z2C B;  1S32 B;  5GXQ D;  3X1T C;  4EO5 B;  3AZG C;  2YFV A;  3AN2 C;  1HQ3 B;  1F66 D;  3AZM B;  1R4V A;  2BYK A;  2Y2N A;  2HIO B;  1P3L D;  3REJ C;  5B0Z D;  3WKJ A;  3B6F C;  3WAA A;  1P3M D;  2Y2M A;  1P3K B;  3X1T D;  3EG5 B;  1F1E A;  4NE3 A;  3AZG D;  5B2I D;  1N1J A;  2ARO C;  3AZE A;  4LD9 A;  4H9N A;  4J8X B;  5CP6 B;  3REH C;  3AZK C;  3MVD A;  5B40 C;  1ID3 D;  3REL A;  1F66 B;  5B32 C;  1T3U A;  1P3B D;  3A6N C;  1KX4 C;  3W99 C;  5CPK D;  5E5A D;  3UTA A;  1EQZ A;  5B0Z B;  3AYW D;  3FDD A;  4XZQ A;  4J8U D;  4YM6 C;  3WTP D;  3MGS C;  3AZH A;  1P3F C;  3AV1 C;  3AN2 A;  3MGR A;  1KX3 D;  5FUG B;  2W8S A;  2Y2H A;  5B40 D;  4NFT A;  5B32 D;  5B2I B;  3AV2 C;  3WA9 C;  2PYO A;  4ZBJ C;  3B6G C;  4AWL C;  4H9N B;  2DQN C;  5JRG C;  3P5J B;  1AOI C;  3MVD B;  1P3B B;  5AV5 C;  2F8N A;  5AV6 D;  5G49 B;  5CHL B;  3NQU B;  5AV8 B;  2YFW B;  3W97 D;  1TZY C;  5GT3 C;  3AYW B;  5CPJ A;  4J8U B;  3VH6 T;  3AZI A;  1JFI B;  3WA9 D;  3WTP B;  3MNN C;  3B6G D;  3X1V D;  3VH5 A;  4XZQ B;  4ZUX C;  3VH5 T;  3C1B C;  4WZS B;  3MGR B;  4Z66 C;  3UTB D;  1BH9 B;  3A6N A;  4DRA A;  2Y2J A;  5GT0 A;  2PYO B;  3LEL A;  3AZN B;  4YS3 A;  4Z5T D;  3V9R A;  4WU8 C;  1M18 C;  3TU4 B;  2JSS A;  2NZD A;  1P3F A;  3LZ1 B;  5BS7 C;  2Y2O A;  3MGP C;  3H0M C;  1P3A A;  2BYM B;  4ZUX D;  3AZF B;  5AY8 D;  5AV6 B;  5CPI B;  2RVQ D;  3AV2 A;  4R8P A;  4KUD D;  3W97 B;  1U35 C;  4J8W D;  5GSU B;  3W98 C;  1P3G B;  3W96 A;  3C1C D;  5AV9 B;  4QLC D;  4H9R B;  4WU9 C;  3X1V B;  3MGQ D;  2XD1 A;  2Y2L A;  4X23 B;  5BNX B;  4WU8 D;  5DNN A;  5B0Y D;  3AZJ D;  1KX5 C;  1S32 C;  5GT0 B;  5B24 B;  3LZ0 A;  4UUZ B;  4Z5T B;  5DNM A;  3LEL B;  1W2E A;  4H9S A;  4EO5 C;  3O62 C;  3UT9 D;  3AZL A;  1HQ3 C;  4XUJ D;  3AZM C;  3REI D;  1ZLA D;  5AVC A;  2HIO C;  5BO0 B;  3REK A;  3AFA B;  4KGC A;  3LJA B;  2RIQ A;  3B0D B;  4KHA B;  1KX5 D;  4Z2M G;  5B31 G;  4QLC B;  4E45 A;  2CV5 A;  5B31 A;  2CWE A;  1P3K C;  3EPH A;  1P3P B;  1HQ3 D;  5B0Y B;  3AZJ B;  5KDM A;  3AZM D;  5AVB A;  2ZY2 A;  4J8X C;  5BNV B;  3A1I A;  5F99 B;  2IO5 B;  5GXQ C;  3X1U A;  4WU9 A;  1F66 C;  4XUJ B;  4J8V D;  3KUY D;  3KXB D;  3REI B;  1ZLA B;  2NQB A;  1P3K D;  3EPK A;  2FJ7 A;  2G5H C;  5B0Z C;  3REK B;  4JJN A;  4KGC B;  3KWQ B;  1P34 D;  1P3M C;  4J8X D;  5CP6 D;  5B31 B;  2FFF B;  5B2I C;  1M1A B;  1HTA A;  5AVB B;  3NQJ A;  3X1S B;  5B33 A;  5B2J A;  1ID3 C;  3WAA D;  5B1M B;  2BG1 A;  3R45 B;  1P3B C;  4J8V B;  1P3I A;  1PZR A;  3WKJ D;  3KUY B;  1ULY A;  3KXB B;  1B6W A;  2NQB B;  5AV8 C;  5CPK C;  5E5A C;  2FJ7 B;  3AYW C;  2HUE B;  1P34 B;  4G92 C;  5GXQ A;  4J8U C;  1H3O B;  1M19 B;  3WTP C;  1KX3 C;  3B0C W;  3MVD D;  2YFV B;  3REL D;  1P3L A;  5B1L A;  2BYK B;  3AZN C;  5AV8 D;  1P3O A;  3TU4 C;  3UTA D;  3WKJ B;  3WAA B;  3LZ1 C;  3X1T A;  4XZQ D;  4H9O A;  5CPI C;  5AV6 C;  3AZG A;  3AZH D;  3MGR D;  5C3I B;  3W97 C;  5GSU C;  1P3G C;  1BFM A;  5AV9 C;  4CAY A;  1N1J B;  3REJ A;  3B6F A;  3X1V C;  2PYO D;  3AZE B;  3AZN D;  5JA4 A;  1ID3 A;  4LD9 B;  4X23 C;  3UTB C;  3TU4 D;  3LZ1 D;  4G91 B;  2F8N G;  3REL B;  5E5A A;  4CSR A;  3AZF D;  5CPI D;  5B24 C;  5B1L B;  2ARO A;  4Z5T C;  5GSU D;  3UTA B;  1P3G D;  1KX3 A;  3VH6 A;  5AV9 D;  1EQZ B;  3REH A;  5B32 G;  3AZK A;  5B40 A;  3AZI D;  5AY8 C;  5B32 A;  4X23 D;  3AZH B;  2RVQ C;  1TAF A;  3AN2 B;  3AFA C;  4KUD C;  3LJA C;  4J8W C;  3B0D C;  1KX4 A;  3W99 A;  3C1C C;  4QLC C;  5GT0 D;  5B24 D;  3MGQ C;  2F2A C;  3LEL D;  4YM6 A;  3MGS A;  1P3P C;  3AV1 A;  5B0Y C;  3AZJ C;  2NZD D;  2UWX A;  1P3A D;  2Y2P A;  2F8N B;  5F99 C;  4NE6 A;  4H9Q A;  1Q9C A;  2LY8 A;  3AFA D;  3UT9 C;  3WA9 A;  3LJA D;  1BH8 A;  4R8P D;  3B6G A;  4XUJ C;  3W96 D;  5JRG A;  5CPJ B;  3REI C;  3UTB A;  1AOI A;  3AZI B;  1ZLA C;  2L5A A;  2F8N H;  5AV5 A;  1P3P D;  5DNN D;  3A6N B;  3W99 B;  1TZY A;  5GT3 A;  5F99 D;  2Y2Q A;  4YS3 B;  3MNN A;  4ZUX A;  3AZL D;  3V9R B;  3F6T A;  3C1B A;  1P3F B;  2NZD B;  1M1A C;  4Z66 A;  1P3A B;  5AVC D;  4H9P A;  3X1S C;  3REK D;  1KU5 A;  3AV2 B;  4R8P B;  4KGC D;  3KWQ D;  5B1M C;  1BH8 B;  3MGQ A;  4J8V C;  3W96 B;  3KUY C;  4WU8 A;  3KXB C;  1M18 A;  5JRG B;  5B31 D;  1AOI B;  5BS7 A;  3MGP A;  5DNN B;  1P34 C;  1M1A D;  5AVB D;  1U35 A;  1M19 C;  2J8P A;  5CP6 C;  3W98 A;  1TZY B;  3X1S D;  3LZ0 B;  3AZL B;  5DNM B;  5B1M D;  4UPK A;  2ZM5 A;  4HGA B;  5AVC B;  2NQB D;  1KX5 A;  2FJ7 D;  1S32 A;  1A7W A;  3WAA C;  3WKJ C;  4JJN D;  1M19 D;  3O62 A;  2CV5 B;  1HQ3 A;  3AZM A;  5C3I C;  2HIO A; 
#chains in the Genus database with same CATH homology
 5KDM B;  3AZE C;  4LD9 C;  1B67 A;  4Z2M H;  2JCH A;  3X1U B;  2VQR A;  3KFU G;  1P3K A;  3MVD C;  4G91 C;  4WU9 B;  3REL C;  3VH6 W;  4WJ3 C;  3VH5 W;  4J8X A;  3UTA C;  1EQZ C;  5CP6 A;  4JJN B;  4XZQ C;  3AZE D;  4LD9 D;  1F66 A;  3O62 B;  3AZH C;  3MGR C;  3B0B A;  5B0Z A;  5B1L D;  2PYO C;  3NQJ B;  1P3M A;  1EQZ D;  1P3O D;  5B33 B;  5FUG A;  5B2J B;  2ZY4 A;  3AZF C;  4DQY B;  1P3I B;  5B2I A;  3AN2 D;  3EPJ A;  3H0R C;  5BT1 C;  2ZY3 A;  5CPJ C;  5GXQ B;  3REJ D;  3AZI C;  3B6F D;  1P3B A;  2XD5 A;  5G49 A;  3NQU A;  4M6B A;  5AV8 A;  5CPK A;  2YFW A;  5GT0 C;  1P3L B;  3AYW A;  2F8N D;  4J8U A;  3LEL C;  2ARO D;  2JE5 A;  4YS3 C;  5BT1 D;  1WWI A;  3WTP A;  1P3M B;  1P3O B;  1JFI A;  2NZD C;  5CPJ D;  1BH9 A;  3REH D;  3X1T B;  3AZK D;  1P3A C;  4H9O B;  3AZG B;  4WNN A;  4R8P C;  3A6N D;  3AZN A;  1KX4 D;  3W99 D;  2DF4 C;  3W96 C;  2Y2K A;  3TU4 A;  4CAY B;  3REJ B;  3B6F B;  3LZ1 A;  1ID3 B;  5JA4 B;  4YS3 D;  2F8N K;  2BYM A;  4YM6 D;  5AV6 A;  3AZF A;  5CPI A;  3MGS D;  1P3F D;  5DNN C;  3AV1 D;  3W97 A;  3A1K A;  5GSU A;  5CPK B;  5E5A B;  4CSR B;  1P3G A;  2IO5 C;  5AV9 A;  4E44 A;  3AV2 D;  2ARO B;  4H9R A;  3LZ0 C;  4G92 B;  3AZL C;  3X1V A;  5DNM C;  4H9S C;  3EPL A;  4X23 A;  1KX3 B;  5BNX A;  2Y2I A;  5JRG D;  3REH B;  4HGA C;  5B40 B;  5AVC C;  3AZK B;  1AOI D;  5B32 B;  1TAF B;  3REK C;  5AV5 D;  5B24 A;  4KGC C;  4WNN B;  3KWQ C;  1KX4 B;  4UUZ A;  4Z5T A;  2CV5 C;  1TZY D;  3B0C T;  5GT3 D;  5B31 C;  3AL0 C;  3LZ0 D;  5DNM D;  5AY8 A;  4YM6 B;  3MNN D;  5BO0 A;  3MGS B;  3AV1 B;  3AFA A;  3C1B D;  5AVB C;  4KUD A;  3LJA A;  4Z66 D;  4J8W A;  4KHA A;  3C1C A;  2G5I C;  4QLC A;  3X1U C;  4H9Q B;  3WA9 B;  4ZBJ B;  3B6G B;  4AWL B;  1P3P A;  3WTP E;  2CV5 D;  5B0Y A;  1M18 D;  3UTB B;  3AZJ A;  2NQB C;  2ZY5 A;  1U35 D;  2FJ7 C;  5AV5 B;  3MGP D;  5BNV A;  2HUE C;  5F99 A;  4JJN C;  3UT9 A;  5GT3 B;  3W98 D;  4XUJ A;  3X1U D;  3REI A;  1ZLA A;  4WU9 D;  2Y2G A;  3MNN B;  4ZUX B;  5AY8 B;  3C1B B;  1WWS A;  4Z66 B;  4KUD B;  3KWQ A;  4J8W B;  4H9P B;  3C1C B;  4NE5 A;  5B33 C;  1S32 D;  5B2J C;  3MGQ B;  1P3I C;  4WU8 B;  3O62 D;  1M18 B;  1M1A A;  4WV4 B;  3MGP B;  2HIO D;  3X1S A;  3UT9 B;  1U35 B;  3KSY A;  5B1M A;  3R45 A;  3W98 B;  4J8V A;  3KUY A;  3KXB A;  3IP4 C;  3H0L C;  5B33 D;  5B2J D;  1P3I D;  4DRB A;  1P3L C;  5B1L C;  1P34 A;  1H3O A;  1M19 A;  1KX5 B;  1P3O C;  1Z2C B;  1S32 B;  5GXQ D;  3X1T C;  4EO5 B;  3AZG C;  2YFV A;  3AN2 C;  1HQ3 B;  1F66 D;  3AZM B;  1R4V A;  2BYK A;  2Y2N A;  2HIO B;  1P3L D;  3REJ C;  5B0Z D;  3WKJ A;  3B6F C;  3WAA A;  1P3M D;  2Y2M A;  1P3K B;  3X1T D;  3EG5 B;  1F1E A;  4NE3 A;  3AZG D;  5B2I D;  1N1J A;  2ARO C;  3AZE A;  4LD9 A;  4H9N A;  4J8X B;  5CP6 B;  3REH C;  3AZK C;  3MVD A;  5B40 C;  1ID3 D;  3REL A;  1F66 B;  5B32 C;  1T3U A;  1P3B D;  3A6N C;  1KX4 C;  3W99 C;  5CPK D;  5E5A D;  3UTA A;  1EQZ A;  5B0Z B;  3AYW D;  3FDD A;  4XZQ A;  4J8U D;  4YM6 C;  3WTP D;  3MGS C;  3AZH A;  1P3F C;  3AV1 C;  3AN2 A;  3MGR A;  1KX3 D;  5FUG B;  2W8S A;  2Y2H A;  5B40 D;  4NFT A;  5B32 D;  5B2I B;  3AV2 C;  3WA9 C;  2PYO A;  4ZBJ C;  3B6G C;  4AWL C;  4H9N B;  2DQN C;  5JRG C;  3P5J B;  1AOI C;  3MVD B;  1P3B B;  5AV5 C;  2F8N A;  5AV6 D;  5G49 B;  5CHL B;  3NQU B;  5AV8 B;  2YFW B;  3W97 D;  1TZY C;  5GT3 C;  3AYW B;  5CPJ A;  4J8U B;  3VH6 T;  3AZI A;  1JFI B;  3WA9 D;  3WTP B;  3MNN C;  3B6G D;  3X1V D;  3VH5 A;  4XZQ B;  4ZUX C;  3VH5 T;  3C1B C;  4WZS B;  3MGR B;  4Z66 C;  3UTB D;  1BH9 B;  3A6N A;  4DRA A;  2Y2J A;  5GT0 A;  2PYO B;  3LEL A;  3AZN B;  4YS3 A;  4Z5T D;  3V9R A;  4WU8 C;  1M18 C;  3TU4 B;  2JSS A;  2NZD A;  1P3F A;  3LZ1 B;  5BS7 C;  2Y2O A;  3MGP C;  3H0M C;  1P3A A;  2BYM B;  4ZUX D;  3AZF B;  5AY8 D;  5AV6 B;  5CPI B;  2RVQ D;  3AV2 A;  4R8P A;  4KUD D;  3W97 B;  1U35 C;  4J8W D;  5GSU B;  3W98 C;  1P3G B;  3W96 A;  3C1C D;  5AV9 B;  4QLC D;  4H9R B;  4WU9 C;  3X1V B;  3MGQ D;  2XD1 A;  2Y2L A;  4X23 B;  5BNX B;  4WU8 D;  5DNN A;  5B0Y D;  3AZJ D;  1KX5 C;  1S32 C;  5GT0 B;  5B24 B;  3LZ0 A;  4UUZ B;  4Z5T B;  5DNM A;  3LEL B;  1W2E A;  4H9S A;  4EO5 C;  3O62 C;  3UT9 D;  3AZL A;  1HQ3 C;  4XUJ D;  3AZM C;  3REI D;  1ZLA D;  5AVC A;  2HIO C;  5BO0 B;  3REK A;  3AFA B;  4KGC A;  3LJA B;  2RIQ A;  3B0D B;  4KHA B;  1KX5 D;  4Z2M G;  5B31 G;  4QLC B;  4E45 A;  2CV5 A;  5B31 A;  2CWE A;  1P3K C;  3EPH A;  1P3P B;  1HQ3 D;  5B0Y B;  3AZJ B;  5KDM A;  3AZM D;  5AVB A;  2ZY2 A;  4J8X C;  5BNV B;  3A1I A;  5F99 B;  2IO5 B;  5GXQ C;  3X1U A;  4WU9 A;  1F66 C;  4XUJ B;  4J8V D;  3KUY D;  3KXB D;  3REI B;  1ZLA B;  2NQB A;  1P3K D;  3EPK A;  2FJ7 A;  2G5H C;  5B0Z C;  3REK B;  4JJN A;  4KGC B;  3KWQ B;  1P34 D;  1P3M C;  4J8X D;  5CP6 D;  5B31 B;  2FFF B;  5B2I C;  1M1A B;  1HTA A;  5AVB B;  3NQJ A;  3X1S B;  5B33 A;  5B2J A;  1ID3 C;  3WAA D;  5B1M B;  2BG1 A;  3R45 B;  1P3B C;  4J8V B;  1P3I A;  1PZR A;  3WKJ D;  3KUY B;  1ULY A;  3KXB B;  1B6W A;  2NQB B;  5AV8 C;  5CPK C;  5E5A C;  2FJ7 B;  3AYW C;  2HUE B;  1P34 B;  4G92 C;  5GXQ A;  4J8U C;  1H3O B;  1M19 B;  3WTP C;  1KX3 C;  3B0C W;  3MVD D;  2YFV B;  3REL D;  1P3L A;  5B1L A;  2BYK B;  3AZN C;  5AV8 D;  1P3O A;  3TU4 C;  3UTA D;  3WKJ B;  3WAA B;  3LZ1 C;  3X1T A;  4XZQ D;  4H9O A;  5CPI C;  5AV6 C;  3AZG A;  3AZH D;  3MGR D;  5C3I B;  3W97 C;  5GSU C;  1P3G C;  1BFM A;  5AV9 C;  4CAY A;  1N1J B;  3REJ A;  3B6F A;  3X1V C;  2PYO D;  3AZE B;  3AZN D;  5JA4 A;  1ID3 A;  4LD9 B;  4X23 C;  3UTB C;  3TU4 D;  3LZ1 D;  4G91 B;  2F8N G;  3REL B;  5E5A A;  4CSR A;  3AZF D;  5CPI D;  5B24 C;  5B1L B;  2ARO A;  4Z5T C;  5GSU D;  3UTA B;  1P3G D;  1KX3 A;  3VH6 A;  5AV9 D;  1EQZ B;  3REH A;  5B32 G;  3AZK A;  5B40 A;  3AZI D;  5AY8 C;  5B32 A;  4X23 D;  3AZH B;  2RVQ C;  1TAF A;  3AN2 B;  3AFA C;  4KUD C;  3LJA C;  4J8W C;  3B0D C;  1KX4 A;  3W99 A;  3C1C C;  4QLC C;  5GT0 D;  5B24 D;  3MGQ C;  2F2A C;  3LEL D;  4YM6 A;  3MGS A;  1P3P C;  3AV1 A;  5B0Y C;  3AZJ C;  2NZD D;  2UWX A;  1P3A D;  2Y2P A;  2F8N B;  5F99 C;  4NE6 A;  4H9Q A;  1Q9C A;  2LY8 A;  3AFA D;  3UT9 C;  3WA9 A;  3LJA D;  1BH8 A;  4R8P D;  3B6G A;  4XUJ C;  3W96 D;  5JRG A;  5CPJ B;  3REI C;  3UTB A;  1AOI A;  3AZI B;  1ZLA C;  2L5A A;  2F8N H;  5AV5 A;  1P3P D;  5DNN D;  3A6N B;  3W99 B;  1TZY A;  5GT3 A;  5F99 D;  2Y2Q A;  4YS3 B;  3MNN A;  4ZUX A;  3AZL D;  3V9R B;  3F6T A;  3C1B A;  1P3F B;  2NZD B;  1M1A C;  4Z66 A;  1P3A B;  5AVC D;  4H9P A;  3X1S C;  3REK D;  1KU5 A;  3AV2 B;  4R8P B;  4KGC D;  3KWQ D;  5B1M C;  1BH8 B;  3MGQ A;  4J8V C;  3W96 B;  3KUY C;  4WU8 A;  3KXB C;  1M18 A;  5JRG B;  5B31 D;  1AOI B;  5BS7 A;  3MGP A;  5DNN B;  1P34 C;  1M1A D;  5AVB D;  1U35 A;  1M19 C;  2J8P A;  5CP6 C;  3W98 A;  1TZY B;  3X1S D;  3LZ0 B;  3AZL B;  5DNM B;  5B1M D;  4UPK A;  2ZM5 A;  4HGA B;  5AVC B;  2NQB D;  1KX5 A;  2FJ7 D;  1S32 A;  1A7W A;  3WAA C;  3WKJ C;  4JJN D;  1M19 D;  3O62 A;  2CV5 B;  1HQ3 A;  3AZM A;  5C3I C;  2HIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...