3KWQC

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kwqC00
4Z5TB 4H9PA 4KGCA 3MVDC 5BNXB 3AN2C 5GT3C 5B24C 3C1CA 1ZLAA 4J8WC 5AV6D 4EO5B 3UT9C 5B0ZA 3UTBA 3X1SB 3AZNC 5B1MD 3B6FB 5AV8C 3KXBB 3MGSB 4YS3C 3VH5W 3REJA 3WTPB 5CPIB 3W96B 3AZID 3KUYB 3AZFC 3A6NB 3AZGD 3AZJD 4KUDA 4CSRA 3NQJA 5G49A 3UTAC 1P3AB 5AVCA 3AZHC 1R4VA 1P34C 2YFVA 3R45B 1JFIB 1KX3B 5B0YC 2NQBB 3X1TB 5FUGB 3AV1D 5DNNC 1P3KA 3MGRB 1P3ID 4WU9C 1P3OA 1EQZD 1KX5C 3MGPB 5B2ID 4J8XA 1P3LB 4KUDC 5CPJB 1P3MB 3KWQB 4ZUXB 1H3OB 3W98D 3LZ1D 3AZMD 3AV2C 4E45A 3LJAD 2YFWB 5BNVA 3LELC 4Z2MG 4DRAA 5GT0A 3AFAC 1S32D 1HQ3C 4J8UD 2AROD 4E44A 4ZBJC 5AV5C 3LZ0C 5BS7C 5AV6A 3REKD 1P3GA 2PYOB 2IO5C 5AY8B 5CP6C 3C1BA 5DNMB 2FJ7A 5B1MA 3AZKD 3W99B 3MVDD 3X1UB 1BFMA 5BT1D 4H9OB 5B24D 3RELD 3MNNC 5GSUB 4J8WD 3AZGA 4YM6C 4Z66B 4X23B 1U35B 4JJNC 4AWLC 3MGQC 4DRBA 4YS3D 1ID3A 4UUZB 5AVBC 3B6GB 3REID 3WAAA 5GSUC 3AYWC 3AZFD 1F66A 4KGCD 4J8VB 3AZEA 4LD9C 1P3IA 1EQZA 1BH9B 2BYKA 5B2IA 1P34D 2CV5C 3WKJC 5B0YD 2F8NA 2HIOC 3VH5T 3UTBD 1KX4B 1M19B 3WA9A 5B33A 3AZMA 3V9RB 5B32C 4XUJC 3LJAA 5E5AA 3AZJB 1S32A 3WAAC 3O62B 1KX5D 4J8UA 4WU8A 2AROA 4KUDD 1F66C 1TZYB 5F99C 3AZEC 2F8NH 5B40A 1N1JA 5CPKC 4XZQB 3TU4B 3AV2D 3NQUB 3LELD 3MVDA 3VH5A 3W97C 1HQ3D 3AN2A 5GT3A 5B24A 5AV9A 4H9RB 5AV5D 3LZ0D 4J8WA 3UT9A 1M18B 2NZDC 5JRGB 5B2JC 1P3BC 1P3OD 1P3PC 3W98B 3AZNA 1P3FB 3LZ1B 2BYMA 5AV8A 4YS3A 4QLCB 5JA4B 3MNND 3X1VB 3AZFA 4YM6D 4JJND 5GT0D 5B31C 3REKB 4KHAA 3UTAA 3AZHA 3MGQD 5AV9C 4HGAB 1M1AB 1P34A 4H9QB 5AVBD 3AZKB 1AOIB 5B0YA 1P3GD 1P3FC 3W96A 3C1BD 4CAYB 4Z5TC 5DNNA 5GXQB 3AYWD 2FJ7D 3RELB 4LD9D 4WU9A 1KX5A 4EO5C 4R8PB 5B1LB 2CV5D 2CWEA 2HIOD 5BO0B 3X1SC 5KDMB 3B6FC 2RVQC 3KXBC 3MGSC 3REHB 3REIB 3AV2A 1ID3D 4XUJD 5B32D 3AZLB 3LELA 4H9PB 3AFAA 5CPIC 3WTPC 3W96C 1HQ3A 3WAAD 4KGCB 3KUYC 3A6NC 4NE6A 4G91B 5AV5A 3LZ0A 3C1CB 5BS7A 1F66D 1ZLAB 3AZED 1H3OA 1P3AC 5B0ZB 5CPKD 1BH8A 5CP6A 3UTBB 1KX3C 2NQBC 3VH6W 3X1TC 2F8ND 3REJB 3MGRC 3WA9D 3MNNA 5B33D 4YM6A 2PYOA 4JJNA 1P3BD 5E5AD 3MGPC 4CSRB 4H9SC 5C3IB 1P3LC 2HUEB 3B0CW 3NQJB 5G49B 3MGQA 4WU8D 5AVCB 1P3PD 5CPJC 1P3MC 3KWQC 4ZUXC 5AVBA 5B40D 4H9NA 5GSUA 3AYWA 1P3KB 5C3IC 4LD9A 1TAFA 5B31D 3AN2D 5GT3D 2JSSA 1P3OB 5AV9D 4J8XB 3UT9D 2PYOC 2CV5A 3WKJA 4G92B 5AY8C 5DNMC 4WNNA 2HIOA 3AZND 4Z5TD 5AV8D 3W99C 4XUJA 5B32A 3X1UC 5BNVB 5GT0B 4X23C 4Z66C 1U35C 4Z2MH 5F99A 4WV4B 5AV6B 3UTAD 3KSYA 3AZHD 5CPKA 1P3GB 3B6FD 2RVQD 3KXBD 3MGSD 2FJ7B 5B1MB 3B6GC 3O62A 3WTPE 3W97A 3WTPD 3W96D 5DNND 3KUYD 4J8VC 2NZDA 3AZIB 1P3AD 3AZGB 5B2JA 4WU9D 1P3BA 2LY8A 1P3PA 1KX3D 3X1TD 1ID3B 1KX4C 1M19C 3MGRD 3AV1B 3AZJC 3O62C 3MGPD 3AFAD 5B31A 1P3LD 1P3IB 1EQZB 1TZYC 5CPJD 2BYKB 5B2IB 3KWQD 4ZUXD 1F1EA 1P3FA 3VH6T 4XZQC 3TU4C 2F8NB 5CP6D 1Q9CA 4Z5TA 5BNXA 5B33B 3AZMB 3LJAB 5E5AB 1S32B 1M1AA 3B0CT 4J8UB 5JRGC 1M18C 4WU8B 2AROB 2PYOD 5DNMD 3W98C 3X1SA 5B40B 3LZ1C 3B6FA 3KXBA 3MGSA 4QLCC 3W99D 3VH6A 3WTPA 3MVDB 5CPIA 5GSUD 3X1VC 3KUYA 4NFTA 3A6NA 3AN2B 5GT3B 5B24B 3REKC 4J8WB 1P3AA 3UT9B 1WWIA 4HGAC 1M1AC 3R45A 1JFIA 3AZKC 1KX3A 3AZNB 3AZLA 1AOIC 2NQBA 3X1TA 2BYMB 5AV8B 3B6GD 3WKJD 5FUGA 4YS3B 5GXQC 3MGRA 5BT1C 3RELC 4J8VD 1A7WA 3AZFB 3MGPA 1P3LA 4H9SA 4R8PC 3UTAB 4KHAB 5B1LC 3AZHB 5CPJA 1P3MA 3KWQA 4ZUXA 5F99D 1P34B 1KX4D 1M19D 5B0YB 3REHC 3REIC 3AZLC 5DNNB 2YFWA 4KGCC 3O62D 3W97D 4G91C 4WU9B 3C1CC 1TZYD 1KX5B 1ZLAC 2NZDD 5B0ZC 1B6WA 5B2JD 4KUDB 4XZQD 5AY8A 3TU4D 5DNMA 3UTBC 3W99A 3X1UA 2YFVB 3AV2B 3REJC 4H9OA 3LELB 3AFAB 3B0DB 1HQ3B 4X23A 4Z66A 1U35A 5JRGD 1M18D 4ZBJB 5AV5B 3LZ0B 2HUEC 5AVCC 2IO5B 4QLCD 4UUZA 1BH8B 5CP6B 3B6GA 1P3FD 1KU5A 2L5AA 3B0DC 3X1VD 1P3KC 3MNNB 4J8VA 4YM6B 1BH9A 1P3OC 4JJNB 1M1AD 4NE5A 5B32G 4J8XC 4AWLB 3MGQB 1AOID 4G92C 1KX4A 5AVBB 3X1SD 1M19A 5GXQD 3V9RA 4H9NB 3C1BB 3AZIA 4M6BA 3AYWB 3AZJA 3B0BA 5GT0C 5CPID 4LD9B 1TAFB 4R8PD 5B1LD 3A6ND 2F8NG 1TZYA 5AV6C 1P3GC 4XZQA 3TU4A 2CV5B 3WKJB 1HTAA 3REHD 4WNNB 2HIOB 3C1BC 3AV1A 3NQUA 5B1MC 2FJ7C 3AZLD 2NQBD 5B32B 4XUJB 4H9RA 3C1CD 3WAAB 1ZLAD 1M18A 5JRGA 3AZIC 5CHLB 3AZGC 5B0ZD 1F66B 5F99B 3AZEB 3W98A 3LZ1A 5CPKB 1P3MD 4QLCA 5B31G 1ID3C 3REJD 5JA4A 3AV1C 3X1VA 3W97B 4NE3A 2F8NK 3WA9B 3REKA 1P3IC 2NZDB 5AVCD 5B2JB 1P3BB 1EQZC 5B2IC 4H9QA 3AZKA 1P3PB 1AOIA 5AY8D 4CAYA 5GXQA 1N1JB 3RELA 1ULYA 1P3KD 5B33C 3AZMC 3WA9C 1WWSA 3X1UD 4WZSB 3LJAC 5E5AC 1S32C 4J8UC 5B31B 4R8PA 4J8XD 5B1LA 4Z66D 4X23D 2AROC 4WU8C 1U35D 5AV9B 5BO0A 5KDMA 5B40C 1B67A 3REHA 3REIA
chains in the Genus database with same CATH superfamily
3H0RC 4Z5TB 4H9PA 4KGCA 3MVDC 5BNXB 3AN2C 5GT3C 5B24C 3C1CA 1ZLAA 4J8WC 2Y2KA 5AV6D 4EO5B 3UT9C 5B0ZA 2DF4C 3UTBA 3X1SB 3AZNC 5B1MD 3B6FB 5AV8C 3KXBB 3MGSB 4YS3C 3VH5W 3REJA 3WTPB 5CPIB 3EG5B 3W96B 3AZID 3KUYB 3AZFC 3A6NB 3AZGD 3AZJD 4KUDA 4CSRA 3NQJA 5G49A 3UTAC 1P3AB 5AVCA 3AZHC 1R4VA 1P34C 2YFVA 3R45B 3EPJA 1JFIB 1KX3B 5B0YC 2NQBB 3X1TB 5FUGB 3AV1D 5DNNC 1P3KA 3MGRB 1PZRA 1P3ID 4WU9C 1P3OA 1EQZD 1KX5C 3MGPB 5B2ID 4J8XA 1P3LB 4KUDC 2VQRA 5CPJB 1P3MB 3KWQB 4ZUXB 1H3OB 3W98D 3LZ1D 2ZM5A 3AZMD 3AV2C 4E45A 3LJAD 2YFWB 5BNVA 3LELC 4Z2MG 4DRAA 5GT0A 3AFAC 1S32D 1HQ3C 4J8UD 2XD5A 2AROD 4E44A 5AV5C 4ZBJC 3LZ0C 5BS7C 5AV6A 3REKD 3AL0C 3F6TA 1P3GA 2PYOB 2IO5C 5AY8B 5CP6C 3C1BA 5DNMB 2FJ7A 5B1MA 3AZKD 3W99B 3MVDD 3X1UB 1BFMA 5BT1D 4H9OB 5B24D 3RELD 3MNNC 3EPKA 5GSUB 4J8WD 3AZGA 4YM6C 4Z66B 4X23B 1U35B 4JJNC 4AWLC 3MGQC 4DRBA 4YS3D 1ID3A 4UUZB 5AVBC 3B6GB 3REID 3WAAA 5GSUC 3AYWC 3AZFD 1F66A 4KGCD 4J8VB 3AZEA 4LD9C 1P3IA 1EQZA 1BH9B 2BYKA 5B2IA 1P34D 2CV5C 3WKJC 5B0YD 2F8NA 2HIOC 3VH5T 2Y2GA 3UTBD 1KX4B 1M19B 3WA9A 5B33A 3AZMA 3FDDA 3V9RB 5B32C 4XUJC 2Y2HA 3LJAA 5E5AA 3AZJB 1S32A 3WAAC 3O62B 1KX5D 4J8UA 4WU8A 2AROA 4KUDD 1F66C 1TZYB 5F99C 3AZEC 2F8NH 5B40A 1N1JA 5CPKC 4XZQB 3TU4B 3AV2D 3NQUB 3LELD 3MVDA 3VH5A 3W97C 1HQ3D 3AN2A 5GT3A 5B24A 5AV9A 4H9RB 5AV5D 3LZ0D 4J8WA 3UT9A 1M18B 2NZDC 5JRGB 5B2JC 1P3BC 1P3OD 1P3PC 3W98B 3AZNA 1P3FB 3LZ1B 2BYMA 5AV8A 4YS3A 4QLCB 5JA4B 3MNND 3X1VB 3AZFA 4YM6D 4JJND 5GT0D 5B31C 3REKB 4KHAA 3UTAA 3AZHA 3IP4C 3MGQD 5AV9C 4HGAB 1M1AB 1P34A 4H9QB 5AVBD 3AZKB 1AOIB 5B0YA 1P3GD 2Y2MA 1P3FC 3W96A 3C1BD 4CAYB 4Z5TC 5DNNA 5GXQB 3H0LC 3AYWD 2FJ7D 3RELB 4LD9D 4WU9A 1KX5A 4EO5C 4R8PB 5B1LB 2CV5D 2CWEA 2HIOD 2Y2PA 5BO0B 3X1SC 5KDMB 3B6FC 2RVQC 3KXBC 3MGSC 3REHB 3REIB 3AV2A 1ID3D 4XUJD 5B32D 3AZLB 3LELA 4H9PB 3AFAA 5CPIC 3WTPC 3W96C 1HQ3A 2J8PA 3WAAD 4KGCB 3KUYC 3A6NC 4NE6A 4G91B 5AV5A 3LZ0A 3C1CB 5BS7A 1F66D 1ZLAB 3AZED 1H3OA 1P3AC 5B0ZB 5CPKD 1BH8A 5CP6A 3UTBB 1KX3C 2NQBC 3VH6W 3X1TC 2F8ND 3REJB 3MGRC 3WA9D 3MNNA 5B33D 4YM6A 2PYOA 4JJNA 1P3BD 5E5AD 3MGPC 4CSRB 4H9SC 5C3IB 3A1IA 2HUEB 3B0CW 3NQJB 5G49B 3MGQA 4WU8D 5AVCB 1P3PD 5CPJC 1P3MC 3KWQC 4ZUXC 5AVBA 5B40D 3EPLA 4H9NA 2XD1A 5GSUA 3AYWA 1P3KB 5C3IC 4LD9A 1TAFA 5B31D 3AN2D 5GT3D 2JSSA 1P3OB 5AV9D 4J8XB 3UT9D 2PYOC 2CV5A 3WKJA 4G92B 5AY8C 5DNMC 4WNNA 2HIOA 3AZND 4Z5TD 5AV8D 3W99C 4XUJA 5B32A 3X1UC 5BNVB 5GT0B 4X23C 4Z66C 1U35C 4Z2MH 5F99A 4WV4B 5AV6B 3UTAD 4WJ3C 3KSYA 3AZHD 5CPKA 1P3GB 3B6FD 2RVQD 3KXBD 3MGSD 4DQYB 2FJ7B 5B1MB 2ZY2A 3B6GC 3O62A 3WTPE 3W97A 3WTPD 3W96D 5DNND 3KUYD 4J8VC 3EPHA 2NZDA 3AZIB 1P3AD 3AZGB 2BG1A 5B2JA 4WU9D 1P3BA 2LY8A 1P3PA 1KX3D 3X1TD 1ID3B 4UPKA 1KX4C 1M19C 3MGRD 2ZY4A 2FFFB 3AV1B 3AZJC 3O62C 3MGPD 3AFAD 5B31A 1P3LD 1P3IB 1EQZB 1TZYC 5CPJD 2BYKB 5B2IB 3KWQD 4ZUXD 1F1EA 1P3FA 3VH6T 4XZQC 3TU4C 2F8NB 2F2AC 5CP6D 1Q9CA 4Z5TA 2Y2NA 5BNXA 5B33B 3AZMB 3LJAB 5E5AB 1S32B 1M1AA 3B0CT 4J8UB 5JRGC 1M18C 4WU8B 2AROB 2PYOD 5DNMD 3W98C 3X1SA 5B40B 3LZ1C 3B6FA 3KXBA 3MGSA 3H0MC 3W99D 4QLCC 3VH6A 3WTPA 3MVDB 5CPIA 2Y2LA 5GSUD 3X1VC 3KUYA 4NFTA 3A6NA 3AN2B 5GT3B 5B24B 2Y2JA 2G5IC 3REKC 4J8WB 1P3AA 3UT9B 1WWIA 4HGAC 1M1AC 3R45A 1JFIA 3AZKC 1KX3A 3AZNB 3AZLA 1AOIC 2NQBA 3X1TA 2BYMB 5AV8B 3B6GD 3WKJD 5FUGA 4YS3B 5GXQC 3MGRA 5BT1C 3RELC 4J8VD 1A7WA 2ZY3A 3AZFB 3MGPA 3A1KA 1P3LA 4H9SA 4R8PC 3UTAB 4KHAB 5B1LC 3AZHB 5CPJA 1P3MA 3KWQA 4ZUXA 2W8SA 5F99D 1P34B 1KX4D 1M19D 5B0YB 3REHC 3REIC 3AZLC 5DNNB 2YFWA 4KGCC 3O62D 3W97D 4G91C 4WU9B 3C1CC 1TZYD 1KX5B 1ZLAC 2NZDD 5B0ZC 1B6WA 5B2JD 4KUDB 4XZQD 5AY8A 3TU4D 5DNMA 3UTBC 3W99A 3X1UA 2YFVB 3AV2B 3REJC 4H9OA 3LELB 3AFAB 3B0DB 1HQ3B 4X23A 4Z66A 1U35A 5JRGD 1M18D 4ZBJB 5AV5B 3LZ0B 2ZY5A 2HUEC 3KFUG 5AVCC 2G5HC 2IO5B 4QLCD 4UUZA 1BH8B 5CP6B 3B6GA 1P3FD 1KU5A 2L5AA 3B0DC 3X1VD 1P3KC 3MNNB 4J8VA 4YM6B 1BH9A 1P3OC 4JJNB 1M1AD 4NE5A 5B32G 4J8XC 4AWLB 3MGQB 2DQNC 1AOID 4G92C 2JE5A 2Y2IA 1KX4A 5AVBB 3X1SD 1M19A 5GXQD 2JCHA 3V9RA 4H9NB 3C1BB 3AZIA 4M6BA 3AYWB 3AZJA 3B0BA 5GT0C 5CPID 4LD9B 1TAFB 4R8PD 5B1LD 3A6ND 2F8NG 1TZYA 5AV6C 1P3GC 4XZQA 3TU4A 2CV5B 3WKJB 1HTAA 3REHD 4WNNB 2HIOB 3C1BC 3AV1A 3NQUA 5B1MC 2FJ7C 3AZLD 1Z2CB 2NQBD 3P5JB 5B32B 4XUJB 2Y2QA 4H9RA 3C1CD 3WAAB 1ZLAD 1M18A 5JRGA 3AZIC 5CHLB 3AZGC 5B0ZD 2UWXA 1F66B 5F99B 3AZEB 3W98A 2Y2OA 3LZ1A 5CPKB 1P3MD 4QLCA 5B31G 1ID3C 3REJD 1W2EA 5JA4A 3AV1C 3X1VA 3W97B 4NE3A 2F8NK 3WA9B 1T3UA 3REKA 1P3IC 2NZDB 5AVCD 5B2JB 1P3BB 1EQZC 5B2IC 4H9QA 3AZKA 1P3PB 1AOIA 5AY8D 4CAYA 5GXQA 1N1JB 3RELA 1ULYA 1P3KD 5B33C 3AZMC 3WA9C 1WWSA 3X1UD 4WZSB 3LJAC 5E5AC 1S32C 4J8UC 5B31B 4R8PA 4J8XD 5B1LA 4Z66D 4X23D 2AROC 4WU8C 1U35D 5AV9B 2RIQA 5BO0A 5KDMA 5B40C 1P3LC 1B67A 3REHA 3REIA
chains in the Genus database with same CATH topology
3H0RC 4Z5TB 4H9PA 4KGCA 3MVDC 5BNXB 3AN2C 5GT3C 5B24C 3C1CA 1ZLAA 4J8WC 2Y2KA 5AV6D 4EO5B 3UT9C 5B0ZA 2DF4C 3UTBA 3X1SB 3AZNC 5B1MD 3B6FB 5AV8C 3KXBB 3MGSB 4YS3C 3VH5W 3REJA 3WTPB 5CPIB 3EG5B 3W96B 3AZID 3KUYB 3AZFC 3A6NB 3AZGD 3AZJD 4KUDA 4CSRA 3NQJA 5G49A 3UTAC 1P3AB 5AVCA 3AZHC 1R4VA 1P34C 2YFVA 3R45B 3EPJA 1JFIB 1KX3B 5B0YC 2NQBB 3X1TB 5FUGB 3AV1D 5DNNC 1P3KA 3MGRB 1PZRA 1P3ID 4WU9C 1P3OA 1EQZD 1KX5C 3MGPB 5B2ID 4J8XA 1P3LB 4KUDC 2VQRA 5CPJB 1P3MB 3KWQB 4ZUXB 1H3OB 3W98D 3LZ1D 2ZM5A 3AZMD 3AV2C 4E45A 3LJAD 2YFWB 5BNVA 3LELC 4Z2MG 4DRAA 5GT0A 3AFAC 1S32D 1HQ3C 4J8UD 2XD5A 2AROD 4E44A 5AV5C 4ZBJC 3LZ0C 5BS7C 5AV6A 3REKD 3AL0C 3F6TA 1P3GA 2PYOB 2IO5C 5AY8B 5CP6C 3C1BA 5DNMB 2FJ7A 5B1MA 3AZKD 3W99B 3MVDD 3X1UB 1BFMA 5BT1D 4H9OB 5B24D 3RELD 3MNNC 3EPKA 5GSUB 4J8WD 3AZGA 4YM6C 4Z66B 4X23B 1U35B 4JJNC 4AWLC 3MGQC 4DRBA 4YS3D 1ID3A 4UUZB 5AVBC 3B6GB 3REID 3WAAA 5GSUC 3AYWC 3AZFD 1F66A 4KGCD 4J8VB 3AZEA 4LD9C 1P3IA 1EQZA 1BH9B 2BYKA 5B2IA 1P34D 2CV5C 3WKJC 5B0YD 2F8NA 2HIOC 3VH5T 2Y2GA 3UTBD 1KX4B 1M19B 3WA9A 5B33A 3AZMA 3FDDA 3V9RB 5B32C 4XUJC 2Y2HA 3LJAA 5E5AA 3AZJB 1S32A 3WAAC 3O62B 1KX5D 4J8UA 4WU8A 2AROA 4KUDD 1F66C 1TZYB 5F99C 3AZEC 2F8NH 5B40A 1N1JA 5CPKC 4XZQB 3TU4B 3AV2D 3NQUB 3LELD 3MVDA 3VH5A 3W97C 1HQ3D 3AN2A 5GT3A 5B24A 5AV9A 4H9RB 5AV5D 3LZ0D 4J8WA 3UT9A 1M18B 2NZDC 5JRGB 5B2JC 1P3BC 1P3OD 1P3PC 3W98B 3AZNA 1P3FB 3LZ1B 2BYMA 5AV8A 4YS3A 4QLCB 5JA4B 3MNND 3X1VB 3AZFA 4YM6D 4JJND 5GT0D 5B31C 3REKB 4KHAA 3UTAA 3AZHA 3IP4C 3MGQD 5AV9C 4HGAB 1M1AB 1P34A 4H9QB 5AVBD 3AZKB 1AOIB 5B0YA 1P3GD 2Y2MA 1P3FC 3W96A 3C1BD 4CAYB 4Z5TC 5DNNA 5GXQB 3H0LC 3AYWD 2FJ7D 3RELB 4LD9D 4WU9A 1KX5A 4EO5C 4R8PB 5B1LB 2CV5D 2CWEA 2HIOD 2Y2PA 5BO0B 3X1SC 5KDMB 3B6FC 2RVQC 3KXBC 3MGSC 3REHB 3REIB 3AV2A 1ID3D 4XUJD 5B32D 3AZLB 3LELA 4H9PB 3AFAA 5CPIC 3WTPC 3W96C 1HQ3A 2J8PA 3WAAD 4KGCB 3KUYC 3A6NC 4NE6A 4G91B 5AV5A 3LZ0A 3C1CB 5BS7A 1F66D 1ZLAB 3AZED 1H3OA 1P3AC 5B0ZB 5CPKD 1BH8A 5CP6A 3UTBB 1KX3C 2NQBC 3VH6W 3X1TC 2F8ND 3REJB 3MGRC 3WA9D 3MNNA 5B33D 4YM6A 2PYOA 4JJNA 1P3BD 5E5AD 3MGPC 4CSRB 4H9SC 5C3IB 3A1IA 2HUEB 3B0CW 3NQJB 5G49B 3MGQA 4WU8D 5AVCB 1P3PD 5CPJC 1P3MC 3KWQC 4ZUXC 5AVBA 5B40D 3EPLA 4H9NA 2XD1A 5GSUA 3AYWA 1P3KB 5C3IC 4LD9A 1TAFA 5B31D 3AN2D 5GT3D 2JSSA 1P3OB 5AV9D 4J8XB 3UT9D 2PYOC 2CV5A 3WKJA 4G92B 5AY8C 5DNMC 4WNNA 2HIOA 3AZND 4Z5TD 5AV8D 3W99C 4XUJA 5B32A 3X1UC 5BNVB 5GT0B 4X23C 4Z66C 1U35C 4Z2MH 5F99A 4WV4B 5AV6B 3UTAD 4WJ3C 3KSYA 3AZHD 5CPKA 1P3GB 3B6FD 2RVQD 3KXBD 3MGSD 4DQYB 2FJ7B 5B1MB 2ZY2A 3B6GC 3O62A 3WTPE 3W97A 3WTPD 3W96D 5DNND 3KUYD 4J8VC 3EPHA 2NZDA 3AZIB 1P3AD 3AZGB 2BG1A 5B2JA 4WU9D 1P3BA 2LY8A 1P3PA 1KX3D 3X1TD 1ID3B 4UPKA 1KX4C 1M19C 3MGRD 2ZY4A 2FFFB 3AV1B 3AZJC 3O62C 3MGPD 3AFAD 5B31A 1P3LD 1P3IB 1EQZB 1TZYC 5CPJD 2BYKB 5B2IB 3KWQD 4ZUXD 1F1EA 1P3FA 3VH6T 4XZQC 3TU4C 2F8NB 2F2AC 5CP6D 1Q9CA 4Z5TA 2Y2NA 5BNXA 5B33B 3AZMB 3LJAB 5E5AB 1S32B 1M1AA 3B0CT 4J8UB 5JRGC 1M18C 4WU8B 2AROB 2PYOD 5DNMD 3W98C 3X1SA 5B40B 3LZ1C 3B6FA 3KXBA 3MGSA 3H0MC 3W99D 4QLCC 3VH6A 3WTPA 3MVDB 5CPIA 2Y2LA 5GSUD 3X1VC 3KUYA 4NFTA 3A6NA 3AN2B 5GT3B 5B24B 2Y2JA 2G5IC 3REKC 4J8WB 1P3AA 3UT9B 1WWIA 4HGAC 1M1AC 3R45A 1JFIA 3AZKC 1KX3A 3AZNB 3AZLA 1AOIC 2NQBA 3X1TA 2BYMB 5AV8B 3B6GD 3WKJD 5FUGA 4YS3B 5GXQC 3MGRA 5BT1C 3RELC 4J8VD 1A7WA 2ZY3A 3AZFB 3MGPA 3A1KA 1P3LA 4H9SA 4R8PC 3UTAB 4KHAB 5B1LC 3AZHB 5CPJA 1P3MA 3KWQA 4ZUXA 2W8SA 5F99D 1P34B 1KX4D 1M19D 5B0YB 3REHC 3REIC 3AZLC 5DNNB 2YFWA 4KGCC 3O62D 3W97D 4G91C 4WU9B 3C1CC 1TZYD 1KX5B 1ZLAC 2NZDD 5B0ZC 1B6WA 5B2JD 4KUDB 4XZQD 5AY8A 3TU4D 5DNMA 3UTBC 3W99A 3X1UA 2YFVB 3AV2B 3REJC 4H9OA 3LELB 3AFAB 3B0DB 1HQ3B 4X23A 4Z66A 1U35A 5JRGD 1M18D 4ZBJB 5AV5B 3LZ0B 2ZY5A 2HUEC 3KFUG 5AVCC 2G5HC 2IO5B 4QLCD 4UUZA 1BH8B 5CP6B 3B6GA 1P3FD 1KU5A 2L5AA 3B0DC 3X1VD 1P3KC 3MNNB 4J8VA 4YM6B 1BH9A 1P3OC 4JJNB 1M1AD 4NE5A 5B32G 4J8XC 4AWLB 3MGQB 2DQNC 1AOID 4G92C 2JE5A 2Y2IA 1KX4A 5AVBB 3X1SD 1M19A 5GXQD 2JCHA 3V9RA 4H9NB 3C1BB 3AZIA 4M6BA 3AYWB 3AZJA 3B0BA 5GT0C 5CPID 4LD9B 1TAFB 4R8PD 5B1LD 3A6ND 2F8NG 1TZYA 5AV6C 1P3GC 4XZQA 3TU4A 2CV5B 3WKJB 1HTAA 3REHD 4WNNB 2HIOB 3C1BC 3AV1A 3NQUA 5B1MC 2FJ7C 3AZLD 1Z2CB 2NQBD 3P5JB 5B32B 4XUJB 2Y2QA 4H9RA 3C1CD 3WAAB 1ZLAD 1M18A 5JRGA 3AZIC 5CHLB 3AZGC 5B0ZD 2UWXA 1F66B 5F99B 3AZEB 3W98A 2Y2OA 3LZ1A 5CPKB 1P3MD 4QLCA 5B31G 1ID3C 3REJD 1W2EA 5JA4A 3AV1C 3X1VA 3W97B 4NE3A 2F8NK 3WA9B 1T3UA 3REKA 1P3IC 2NZDB 5AVCD 5B2JB 1P3BB 1EQZC 5B2IC 4H9QA 3AZKA 1P3PB 1AOIA 5AY8D 4CAYA 5GXQA 1N1JB 3RELA 1ULYA 1P3KD 5B33C 3AZMC 3WA9C 1WWSA 3X1UD 4WZSB 3LJAC 5E5AC 1S32C 4J8UC 5B31B 4R8PA 4J8XD 5B1LA 4Z66D 4X23D 2AROC 4WU8C 1U35D 5AV9B 2RIQA 5BO0A 5KDMA 5B40C 1P3LC 1B67A 3REHA 3REIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T B;  4H9P A;  4KGC A;  3MVD C;  5BNX B;  3AN2 C;  5GT3 C;  5B24 C;  3C1C A;  1ZLA A;  4J8W C;  5AV6 D;  4EO5 B;  3UT9 C;  5B0Z A;  3UTB A;  3X1S B;  3AZN C;  5B1M D;  3B6F B;  5AV8 C;  3KXB B;  3MGS B;  4YS3 C;  3VH5 W;  3REJ A;  3WTP B;  5CPI B;  3W96 B;  3AZI D;  3KUY B;  3AZF C;  3A6N B;  3AZG D;  3AZJ D;  4KUD A;  4CSR A;  3NQJ A;  5G49 A;  3UTA C;  1P3A B;  5AVC A;  3AZH C;  1R4V A;  1P34 C;  2YFV A;  3R45 B;  1JFI B;  1KX3 B;  5B0Y C;  2NQB B;  3X1T B;  5FUG B;  3AV1 D;  5DNN C;  1P3K A;  3MGR B;  1P3I D;  4WU9 C;  1P3O A;  1EQZ D;  1KX5 C;  3MGP B;  5B2I D;  4J8X A;  1P3L B;  4KUD C;  5CPJ B;  1P3M B;  3KWQ B;  4ZUX B;  1H3O B;  3W98 D;  3LZ1 D;  3AZM D;  3AV2 C;  4E45 A;  3LJA D;  2YFW B;  5BNV A;  3LEL C;  4Z2M G;  4DRA A;  5GT0 A;  3AFA C;  1S32 D;  1HQ3 C;  4J8U D;  2ARO D;  4E44 A;  4ZBJ C;  5AV5 C;  3LZ0 C;  5BS7 C;  5AV6 A;  3REK D;  1P3G A;  2PYO B;  2IO5 C;  5AY8 B;  5CP6 C;  3C1B A;  5DNM B;  2FJ7 A;  5B1M A;  3AZK D;  3W99 B;  3MVD D;  3X1U B;  1BFM A;  5BT1 D;  4H9O B;  5B24 D;  3REL D;  3MNN C;  5GSU B;  4J8W D;  3AZG A;  4YM6 C;  4Z66 B;  4X23 B;  1U35 B;  4JJN C;  4AWL C;  3MGQ C;  4DRB A;  4YS3 D;  1ID3 A;  4UUZ B;  5AVB C;  3B6G B;  3REI D;  3WAA A;  5GSU C;  3AYW C;  3AZF D;  1F66 A;  4KGC D;  4J8V B;  3AZE A;  4LD9 C;  1P3I A;  1EQZ A;  1BH9 B;  2BYK A;  5B2I A;  1P34 D;  2CV5 C;  3WKJ C;  5B0Y D;  2F8N A;  2HIO C;  3VH5 T;  3UTB D;  1KX4 B;  1M19 B;  3WA9 A;  5B33 A;  3AZM A;  3V9R B;  5B32 C;  4XUJ C;  3LJA A;  5E5A A;  3AZJ B;  1S32 A;  3WAA C;  3O62 B;  1KX5 D;  4J8U A;  4WU8 A;  2ARO A;  4KUD D;  1F66 C;  1TZY B;  5F99 C;  3AZE C;  2F8N H;  5B40 A;  1N1J A;  5CPK C;  4XZQ B;  3TU4 B;  3AV2 D;  3NQU B;  3LEL D;  3MVD A;  3VH5 A;  3W97 C;  1HQ3 D;  3AN2 A;  5GT3 A;  5B24 A;  5AV9 A;  4H9R B;  5AV5 D;  3LZ0 D;  4J8W A;  3UT9 A;  1M18 B;  2NZD C;  5JRG B;  5B2J C;  1P3B C;  1P3O D;  1P3P C;  3W98 B;  3AZN A;  1P3F B;  3LZ1 B;  2BYM A;  5AV8 A;  4YS3 A;  4QLC B;  5JA4 B;  3MNN D;  3X1V B;  3AZF A;  4YM6 D;  4JJN D;  5GT0 D;  5B31 C;  3REK B;  4KHA A;  3UTA A;  3AZH A;  3MGQ D;  5AV9 C;  4HGA B;  1M1A B;  1P34 A;  4H9Q B;  5AVB D;  3AZK B;  1AOI B;  5B0Y A;  1P3G D;  1P3F C;  3W96 A;  3C1B D;  4CAY B;  4Z5T C;  5DNN A;  5GXQ B;  3AYW D;  2FJ7 D;  3REL B;  4LD9 D;  4WU9 A;  1KX5 A;  4EO5 C;  4R8P B;  5B1L B;  2CV5 D;  2CWE A;  2HIO D;  5BO0 B;  3X1S C;  5KDM B;  3B6F C;  2RVQ C;  3KXB C;  3MGS C;  3REH B;  3REI B;  3AV2 A;  1ID3 D;  4XUJ D;  5B32 D;  3AZL B;  3LEL A;  4H9P B;  3AFA A;  5CPI C;  3WTP C;  3W96 C;  1HQ3 A;  3WAA D;  4KGC B;  3KUY C;  3A6N C;  4NE6 A;  4G91 B;  5AV5 A;  3LZ0 A;  3C1C B;  5BS7 A;  1F66 D;  1ZLA B;  3AZE D;  1H3O A;  1P3A C;  5B0Z B;  5CPK D;  1BH8 A;  5CP6 A;  3UTB B;  1KX3 C;  2NQB C;  3VH6 W;  3X1T C;  2F8N D;  3REJ B;  3MGR C;  3WA9 D;  3MNN A;  5B33 D;  4YM6 A;  2PYO A;  4JJN A;  1P3B D;  5E5A D;  3MGP C;  4CSR B;  4H9S C;  5C3I B;  1P3L C;  2HUE B;  3B0C W;  3NQJ B;  5G49 B;  3MGQ A;  4WU8 D;  5AVC B;  1P3P D;  5CPJ C;  1P3M C;  3KWQ C;  4ZUX C;  5AVB A;  5B40 D;  4H9N A;  5GSU A;  3AYW A;  1P3K B;  5C3I C;  4LD9 A;  1TAF A;  5B31 D;  3AN2 D;  5GT3 D;  2JSS A;  1P3O B;  5AV9 D;  4J8X B;  3UT9 D;  2PYO C;  2CV5 A;  3WKJ A;  4G92 B;  5AY8 C;  5DNM C;  4WNN A;  2HIO A;  3AZN D;  4Z5T D;  5AV8 D;  3W99 C;  4XUJ A;  5B32 A;  3X1U C;  5BNV B;  5GT0 B;  4X23 C;  4Z66 C;  1U35 C;  4Z2M H;  5F99 A;  4WV4 B;  5AV6 B;  3UTA D;  3KSY A;  3AZH D;  5CPK A;  1P3G B;  3B6F D;  2RVQ D;  3KXB D;  3MGS D;  2FJ7 B;  5B1M B;  3B6G C;  3O62 A;  3WTP E;  3W97 A;  3WTP D;  3W96 D;  5DNN D;  3KUY D;  4J8V C;  2NZD A;  3AZI B;  1P3A D;  3AZG B;  5B2J A;  4WU9 D;  1P3B A;  2LY8 A;  1P3P A;  1KX3 D;  3X1T D;  1ID3 B;  1KX4 C;  1M19 C;  3MGR D;  3AV1 B;  3AZJ C;  3O62 C;  3MGP D;  3AFA D;  5B31 A;  1P3L D;  1P3I B;  1EQZ B;  1TZY C;  5CPJ D;  2BYK B;  5B2I B;  3KWQ D;  4ZUX D;  1F1E A;  1P3F A;  3VH6 T;  4XZQ C;  3TU4 C;  2F8N B;  5CP6 D;  1Q9C A;  4Z5T A;  5BNX A;  5B33 B;  3AZM B;  3LJA B;  5E5A B;  1S32 B;  1M1A A;  3B0C T;  4J8U B;  5JRG C;  1M18 C;  4WU8 B;  2ARO B;  2PYO D;  5DNM D;  3W98 C;  3X1S A;  5B40 B;  3LZ1 C;  3B6F A;  3KXB A;  3MGS A;  4QLC C;  3W99 D;  3VH6 A;  3WTP A;  3MVD B;  5CPI A;  5GSU D;  3X1V C;  3KUY A;  4NFT A;  3A6N A;  3AN2 B;  5GT3 B;  5B24 B;  3REK C;  4J8W B;  1P3A A;  3UT9 B;  1WWI A;  4HGA C;  1M1A C;  3R45 A;  1JFI A;  3AZK C;  1KX3 A;  3AZN B;  3AZL A;  1AOI C;  2NQB A;  3X1T A;  2BYM B;  5AV8 B;  3B6G D;  3WKJ D;  5FUG A;  4YS3 B;  5GXQ C;  3MGR A;  5BT1 C;  3REL C;  4J8V D;  1A7W A;  3AZF B;  3MGP A;  1P3L A;  4H9S A;  4R8P C;  3UTA B;  4KHA B;  5B1L C;  3AZH B;  5CPJ A;  1P3M A;  3KWQ A;  4ZUX A;  5F99 D;  1P34 B;  1KX4 D;  1M19 D;  5B0Y B;  3REH C;  3REI C;  3AZL C;  5DNN B;  2YFW A;  4KGC C;  3O62 D;  3W97 D;  4G91 C;  4WU9 B;  3C1C C;  1TZY D;  1KX5 B;  1ZLA C;  2NZD D;  5B0Z C;  1B6W A;  5B2J D;  4KUD B;  4XZQ D;  5AY8 A;  3TU4 D;  5DNM A;  3UTB C;  3W99 A;  3X1U A;  2YFV B;  3AV2 B;  3REJ C;  4H9O A;  3LEL B;  3AFA B;  3B0D B;  1HQ3 B;  4X23 A;  4Z66 A;  1U35 A;  5JRG D;  1M18 D;  4ZBJ B;  5AV5 B;  3LZ0 B;  2HUE C;  5AVC C;  2IO5 B;  4QLC D;  4UUZ A;  1BH8 B;  5CP6 B;  3B6G A;  1P3F D;  1KU5 A;  2L5A A;  3B0D C;  3X1V D;  1P3K C;  3MNN B;  4J8V A;  4YM6 B;  1BH9 A;  1P3O C;  4JJN B;  1M1A D;  4NE5 A;  5B32 G;  4J8X C;  4AWL B;  3MGQ B;  1AOI D;  4G92 C;  1KX4 A;  5AVB B;  3X1S D;  1M19 A;  5GXQ D;  3V9R A;  4H9N B;  3C1B B;  3AZI A;  4M6B A;  3AYW B;  3AZJ A;  3B0B A;  5GT0 C;  5CPI D;  4LD9 B;  1TAF B;  4R8P D;  5B1L D;  3A6N D;  2F8N G;  1TZY A;  5AV6 C;  1P3G C;  4XZQ A;  3TU4 A;  2CV5 B;  3WKJ B;  1HTA A;  3REH D;  4WNN B;  2HIO B;  3C1B C;  3AV1 A;  3NQU A;  5B1M C;  2FJ7 C;  3AZL D;  2NQB D;  5B32 B;  4XUJ B;  4H9R A;  3C1C D;  3WAA B;  1ZLA D;  1M18 A;  5JRG A;  3AZI C;  5CHL B;  3AZG C;  5B0Z D;  1F66 B;  5F99 B;  3AZE B;  3W98 A;  3LZ1 A;  5CPK B;  1P3M D;  4QLC A;  5B31 G;  1ID3 C;  3REJ D;  5JA4 A;  3AV1 C;  3X1V A;  3W97 B;  4NE3 A;  2F8N K;  3WA9 B;  3REK A;  1P3I C;  2NZD B;  5AVC D;  5B2J B;  1P3B B;  1EQZ C;  5B2I C;  4H9Q A;  3AZK A;  1P3P B;  1AOI A;  5AY8 D;  4CAY A;  5GXQ A;  1N1J B;  3REL A;  1ULY A;  1P3K D;  5B33 C;  3AZM C;  3WA9 C;  1WWS A;  3X1U D;  4WZS B;  3LJA C;  5E5A C;  1S32 C;  4J8U C;  5B31 B;  4R8P A;  4J8X D;  5B1L A;  4Z66 D;  4X23 D;  2ARO C;  4WU8 C;  1U35 D;  5AV9 B;  5BO0 A;  5KDM A;  5B40 C;  1B67 A;  3REH A;  3REI A; 
#chains in the Genus database with same CATH topology
 3H0R C;  4Z5T B;  4H9P A;  4KGC A;  3MVD C;  5BNX B;  3AN2 C;  5GT3 C;  5B24 C;  3C1C A;  1ZLA A;  4J8W C;  2Y2K A;  5AV6 D;  4EO5 B;  3UT9 C;  5B0Z A;  2DF4 C;  3UTB A;  3X1S B;  3AZN C;  5B1M D;  3B6F B;  5AV8 C;  3KXB B;  3MGS B;  4YS3 C;  3VH5 W;  3REJ A;  3WTP B;  5CPI B;  3EG5 B;  3W96 B;  3AZI D;  3KUY B;  3AZF C;  3A6N B;  3AZG D;  3AZJ D;  4KUD A;  4CSR A;  3NQJ A;  5G49 A;  3UTA C;  1P3A B;  5AVC A;  3AZH C;  1R4V A;  1P34 C;  2YFV A;  3R45 B;  3EPJ A;  1JFI B;  1KX3 B;  5B0Y C;  2NQB B;  3X1T B;  5FUG B;  3AV1 D;  5DNN C;  1P3K A;  3MGR B;  1PZR A;  1P3I D;  4WU9 C;  1P3O A;  1EQZ D;  1KX5 C;  3MGP B;  5B2I D;  4J8X A;  1P3L B;  4KUD C;  2VQR A;  5CPJ B;  1P3M B;  3KWQ B;  4ZUX B;  1H3O B;  3W98 D;  3LZ1 D;  2ZM5 A;  3AZM D;  3AV2 C;  4E45 A;  3LJA D;  2YFW B;  5BNV A;  3LEL C;  4Z2M G;  4DRA A;  5GT0 A;  3AFA C;  1S32 D;  1HQ3 C;  4J8U D;  2XD5 A;  2ARO D;  4E44 A;  5AV5 C;  4ZBJ C;  3LZ0 C;  5BS7 C;  5AV6 A;  3REK D;  3AL0 C;  3F6T A;  1P3G A;  2PYO B;  2IO5 C;  5AY8 B;  5CP6 C;  3C1B A;  5DNM B;  2FJ7 A;  5B1M A;  3AZK D;  3W99 B;  3MVD D;  3X1U B;  1BFM A;  5BT1 D;  4H9O B;  5B24 D;  3REL D;  3MNN C;  3EPK A;  5GSU B;  4J8W D;  3AZG A;  4YM6 C;  4Z66 B;  4X23 B;  1U35 B;  4JJN C;  4AWL C;  3MGQ C;  4DRB A;  4YS3 D;  1ID3 A;  4UUZ B;  5AVB C;  3B6G B;  3REI D;  3WAA A;  5GSU C;  3AYW C;  3AZF D;  1F66 A;  4KGC D;  4J8V B;  3AZE A;  4LD9 C;  1P3I A;  1EQZ A;  1BH9 B;  2BYK A;  5B2I A;  1P34 D;  2CV5 C;  3WKJ C;  5B0Y D;  2F8N A;  2HIO C;  3VH5 T;  2Y2G A;  3UTB D;  1KX4 B;  1M19 B;  3WA9 A;  5B33 A;  3AZM A;  3FDD A;  3V9R B;  5B32 C;  4XUJ C;  2Y2H A;  3LJA A;  5E5A A;  3AZJ B;  1S32 A;  3WAA C;  3O62 B;  1KX5 D;  4J8U A;  4WU8 A;  2ARO A;  4KUD D;  1F66 C;  1TZY B;  5F99 C;  3AZE C;  2F8N H;  5B40 A;  1N1J A;  5CPK C;  4XZQ B;  3TU4 B;  3AV2 D;  3NQU B;  3LEL D;  3MVD A;  3VH5 A;  3W97 C;  1HQ3 D;  3AN2 A;  5GT3 A;  5B24 A;  5AV9 A;  4H9R B;  5AV5 D;  3LZ0 D;  4J8W A;  3UT9 A;  1M18 B;  2NZD C;  5JRG B;  5B2J C;  1P3B C;  1P3O D;  1P3P C;  3W98 B;  3AZN A;  1P3F B;  3LZ1 B;  2BYM A;  5AV8 A;  4YS3 A;  4QLC B;  5JA4 B;  3MNN D;  3X1V B;  3AZF A;  4YM6 D;  4JJN D;  5GT0 D;  5B31 C;  3REK B;  4KHA A;  3UTA A;  3AZH A;  3IP4 C;  3MGQ D;  5AV9 C;  4HGA B;  1M1A B;  1P34 A;  4H9Q B;  5AVB D;  3AZK B;  1AOI B;  5B0Y A;  1P3G D;  2Y2M A;  1P3F C;  3W96 A;  3C1B D;  4CAY B;  4Z5T C;  5DNN A;  5GXQ B;  3H0L C;  3AYW D;  2FJ7 D;  3REL B;  4LD9 D;  4WU9 A;  1KX5 A;  4EO5 C;  4R8P B;  5B1L B;  2CV5 D;  2CWE A;  2HIO D;  2Y2P A;  5BO0 B;  3X1S C;  5KDM B;  3B6F C;  2RVQ C;  3KXB C;  3MGS C;  3REH B;  3REI B;  3AV2 A;  1ID3 D;  4XUJ D;  5B32 D;  3AZL B;  3LEL A;  4H9P B;  3AFA A;  5CPI C;  3WTP C;  3W96 C;  1HQ3 A;  2J8P A;  3WAA D;  4KGC B;  3KUY C;  3A6N C;  4NE6 A;  4G91 B;  5AV5 A;  3LZ0 A;  3C1C B;  5BS7 A;  1F66 D;  1ZLA B;  3AZE D;  1H3O A;  1P3A C;  5B0Z B;  5CPK D;  1BH8 A;  5CP6 A;  3UTB B;  1KX3 C;  2NQB C;  3VH6 W;  3X1T C;  2F8N D;  3REJ B;  3MGR C;  3WA9 D;  3MNN A;  5B33 D;  4YM6 A;  2PYO A;  4JJN A;  1P3B D;  5E5A D;  3MGP C;  4CSR B;  4H9S C;  5C3I B;  3A1I A;  2HUE B;  3B0C W;  3NQJ B;  5G49 B;  3MGQ A;  4WU8 D;  5AVC B;  1P3P D;  5CPJ C;  1P3M C;  3KWQ C;  4ZUX C;  5AVB A;  5B40 D;  3EPL A;  4H9N A;  2XD1 A;  5GSU A;  3AYW A;  1P3K B;  5C3I C;  4LD9 A;  1TAF A;  5B31 D;  3AN2 D;  5GT3 D;  2JSS A;  1P3O B;  5AV9 D;  4J8X B;  3UT9 D;  2PYO C;  2CV5 A;  3WKJ A;  4G92 B;  5AY8 C;  5DNM C;  4WNN A;  2HIO A;  3AZN D;  4Z5T D;  5AV8 D;  3W99 C;  4XUJ A;  5B32 A;  3X1U C;  5BNV B;  5GT0 B;  4X23 C;  4Z66 C;  1U35 C;  4Z2M H;  5F99 A;  4WV4 B;  5AV6 B;  3UTA D;  4WJ3 C;  3KSY A;  3AZH D;  5CPK A;  1P3G B;  3B6F D;  2RVQ D;  3KXB D;  3MGS D;  4DQY B;  2FJ7 B;  5B1M B;  2ZY2 A;  3B6G C;  3O62 A;  3WTP E;  3W97 A;  3WTP D;  3W96 D;  5DNN D;  3KUY D;  4J8V C;  3EPH A;  2NZD A;  3AZI B;  1P3A D;  3AZG B;  2BG1 A;  5B2J A;  4WU9 D;  1P3B A;  2LY8 A;  1P3P A;  1KX3 D;  3X1T D;  1ID3 B;  4UPK A;  1KX4 C;  1M19 C;  3MGR D;  2ZY4 A;  2FFF B;  3AV1 B;  3AZJ C;  3O62 C;  3MGP D;  3AFA D;  5B31 A;  1P3L D;  1P3I B;  1EQZ B;  1TZY C;  5CPJ D;  2BYK B;  5B2I B;  3KWQ D;  4ZUX D;  1F1E A;  1P3F A;  3VH6 T;  4XZQ C;  3TU4 C;  2F8N B;  2F2A C;  5CP6 D;  1Q9C A;  4Z5T A;  2Y2N A;  5BNX A;  5B33 B;  3AZM B;  3LJA B;  5E5A B;  1S32 B;  1M1A A;  3B0C T;  4J8U B;  5JRG C;  1M18 C;  4WU8 B;  2ARO B;  2PYO D;  5DNM D;  3W98 C;  3X1S A;  5B40 B;  3LZ1 C;  3B6F A;  3KXB A;  3MGS A;  3H0M C;  3W99 D;  4QLC C;  3VH6 A;  3WTP A;  3MVD B;  5CPI A;  2Y2L A;  5GSU D;  3X1V C;  3KUY A;  4NFT A;  3A6N A;  3AN2 B;  5GT3 B;  5B24 B;  2Y2J A;  2G5I C;  3REK C;  4J8W B;  1P3A A;  3UT9 B;  1WWI A;  4HGA C;  1M1A C;  3R45 A;  1JFI A;  3AZK C;  1KX3 A;  3AZN B;  3AZL A;  1AOI C;  2NQB A;  3X1T A;  2BYM B;  5AV8 B;  3B6G D;  3WKJ D;  5FUG A;  4YS3 B;  5GXQ C;  3MGR A;  5BT1 C;  3REL C;  4J8V D;  1A7W A;  2ZY3 A;  3AZF B;  3MGP A;  3A1K A;  1P3L A;  4H9S A;  4R8P C;  3UTA B;  4KHA B;  5B1L C;  3AZH B;  5CPJ A;  1P3M A;  3KWQ A;  4ZUX A;  2W8S A;  5F99 D;  1P34 B;  1KX4 D;  1M19 D;  5B0Y B;  3REH C;  3REI C;  3AZL C;  5DNN B;  2YFW A;  4KGC C;  3O62 D;  3W97 D;  4G91 C;  4WU9 B;  3C1C C;  1TZY D;  1KX5 B;  1ZLA C;  2NZD D;  5B0Z C;  1B6W A;  5B2J D;  4KUD B;  4XZQ D;  5AY8 A;  3TU4 D;  5DNM A;  3UTB C;  3W99 A;  3X1U A;  2YFV B;  3AV2 B;  3REJ C;  4H9O A;  3LEL B;  3AFA B;  3B0D B;  1HQ3 B;  4X23 A;  4Z66 A;  1U35 A;  5JRG D;  1M18 D;  4ZBJ B;  5AV5 B;  3LZ0 B;  2ZY5 A;  2HUE C;  3KFU G;  5AVC C;  2G5H C;  2IO5 B;  4QLC D;  4UUZ A;  1BH8 B;  5CP6 B;  3B6G A;  1P3F D;  1KU5 A;  2L5A A;  3B0D C;  3X1V D;  1P3K C;  3MNN B;  4J8V A;  4YM6 B;  1BH9 A;  1P3O C;  4JJN B;  1M1A D;  4NE5 A;  5B32 G;  4J8X C;  4AWL B;  3MGQ B;  2DQN C;  1AOI D;  4G92 C;  2JE5 A;  2Y2I A;  1KX4 A;  5AVB B;  3X1S D;  1M19 A;  5GXQ D;  2JCH A;  3V9R A;  4H9N B;  3C1B B;  3AZI A;  4M6B A;  3AYW B;  3AZJ A;  3B0B A;  5GT0 C;  5CPI D;  4LD9 B;  1TAF B;  4R8P D;  5B1L D;  3A6N D;  2F8N G;  1TZY A;  5AV6 C;  1P3G C;  4XZQ A;  3TU4 A;  2CV5 B;  3WKJ B;  1HTA A;  3REH D;  4WNN B;  2HIO B;  3C1B C;  3AV1 A;  3NQU A;  5B1M C;  2FJ7 C;  3AZL D;  1Z2C B;  2NQB D;  3P5J B;  5B32 B;  4XUJ B;  2Y2Q A;  4H9R A;  3C1C D;  3WAA B;  1ZLA D;  1M18 A;  5JRG A;  3AZI C;  5CHL B;  3AZG C;  5B0Z D;  2UWX A;  1F66 B;  5F99 B;  3AZE B;  3W98 A;  2Y2O A;  3LZ1 A;  5CPK B;  1P3M D;  4QLC A;  5B31 G;  1ID3 C;  3REJ D;  1W2E A;  5JA4 A;  3AV1 C;  3X1V A;  3W97 B;  4NE3 A;  2F8N K;  3WA9 B;  1T3U A;  3REK A;  1P3I C;  2NZD B;  5AVC D;  5B2J B;  1P3B B;  1EQZ C;  5B2I C;  4H9Q A;  3AZK A;  1P3P B;  1AOI A;  5AY8 D;  4CAY A;  5GXQ A;  1N1J B;  3REL A;  1ULY A;  1P3K D;  5B33 C;  3AZM C;  3WA9 C;  1WWS A;  3X1U D;  4WZS B;  3LJA C;  5E5A C;  1S32 C;  4J8U C;  5B31 B;  4R8P A;  4J8X D;  5B1L A;  4Z66 D;  4X23 D;  2ARO C;  4WU8 C;  1U35 D;  5AV9 B;  2RIQ A;  5BO0 A;  5KDM A;  5B40 C;  1P3L C;  1B67 A;  3REH A;  3REI A; 
#chains in the Genus database with same CATH homology
 3H0R C;  4Z5T B;  4H9P A;  4KGC A;  3MVD C;  5BNX B;  3AN2 C;  5GT3 C;  5B24 C;  3C1C A;  1ZLA A;  4J8W C;  2Y2K A;  5AV6 D;  4EO5 B;  3UT9 C;  5B0Z A;  2DF4 C;  3UTB A;  3X1S B;  3AZN C;  5B1M D;  3B6F B;  5AV8 C;  3KXB B;  3MGS B;  4YS3 C;  3VH5 W;  3REJ A;  3WTP B;  5CPI B;  3EG5 B;  3W96 B;  3AZI D;  3KUY B;  3AZF C;  3A6N B;  3AZG D;  3AZJ D;  4KUD A;  4CSR A;  3NQJ A;  5G49 A;  3UTA C;  1P3A B;  5AVC A;  3AZH C;  1R4V A;  1P34 C;  2YFV A;  3R45 B;  3EPJ A;  1JFI B;  1KX3 B;  5B0Y C;  2NQB B;  3X1T B;  5FUG B;  3AV1 D;  5DNN C;  1P3K A;  3MGR B;  1PZR A;  1P3I D;  4WU9 C;  1P3O A;  1EQZ D;  1KX5 C;  3MGP B;  5B2I D;  4J8X A;  1P3L B;  4KUD C;  2VQR A;  5CPJ B;  1P3M B;  3KWQ B;  4ZUX B;  1H3O B;  3W98 D;  3LZ1 D;  2ZM5 A;  3AZM D;  3AV2 C;  4E45 A;  3LJA D;  2YFW B;  5BNV A;  3LEL C;  4Z2M G;  4DRA A;  5GT0 A;  3AFA C;  1S32 D;  1HQ3 C;  4J8U D;  2XD5 A;  2ARO D;  4E44 A;  5AV5 C;  4ZBJ C;  3LZ0 C;  5BS7 C;  5AV6 A;  3REK D;  3AL0 C;  3F6T A;  1P3G A;  2PYO B;  2IO5 C;  5AY8 B;  5CP6 C;  3C1B A;  5DNM B;  2FJ7 A;  5B1M A;  3AZK D;  3W99 B;  3MVD D;  3X1U B;  1BFM A;  5BT1 D;  4H9O B;  5B24 D;  3REL D;  3MNN C;  3EPK A;  5GSU B;  4J8W D;  3AZG A;  4YM6 C;  4Z66 B;  4X23 B;  1U35 B;  4JJN C;  4AWL C;  3MGQ C;  4DRB A;  4YS3 D;  1ID3 A;  4UUZ B;  5AVB C;  3B6G B;  3REI D;  3WAA A;  5GSU C;  3AYW C;  3AZF D;  1F66 A;  4KGC D;  4J8V B;  3AZE A;  4LD9 C;  1P3I A;  1EQZ A;  1BH9 B;  2BYK A;  5B2I A;  1P34 D;  2CV5 C;  3WKJ C;  5B0Y D;  2F8N A;  2HIO C;  3VH5 T;  2Y2G A;  3UTB D;  1KX4 B;  1M19 B;  3WA9 A;  5B33 A;  3AZM A;  3FDD A;  3V9R B;  5B32 C;  4XUJ C;  2Y2H A;  3LJA A;  5E5A A;  3AZJ B;  1S32 A;  3WAA C;  3O62 B;  1KX5 D;  4J8U A;  4WU8 A;  2ARO A;  4KUD D;  1F66 C;  1TZY B;  5F99 C;  3AZE C;  2F8N H;  5B40 A;  1N1J A;  5CPK C;  4XZQ B;  3TU4 B;  3AV2 D;  3NQU B;  3LEL D;  3MVD A;  3VH5 A;  3W97 C;  1HQ3 D;  3AN2 A;  5GT3 A;  5B24 A;  5AV9 A;  4H9R B;  5AV5 D;  3LZ0 D;  4J8W A;  3UT9 A;  1M18 B;  2NZD C;  5JRG B;  5B2J C;  1P3B C;  1P3O D;  1P3P C;  3W98 B;  3AZN A;  1P3F B;  3LZ1 B;  2BYM A;  5AV8 A;  4YS3 A;  4QLC B;  5JA4 B;  3MNN D;  3X1V B;  3AZF A;  4YM6 D;  4JJN D;  5GT0 D;  5B31 C;  3REK B;  4KHA A;  3UTA A;  3AZH A;  3IP4 C;  3MGQ D;  5AV9 C;  4HGA B;  1M1A B;  1P34 A;  4H9Q B;  5AVB D;  3AZK B;  1AOI B;  5B0Y A;  1P3G D;  2Y2M A;  1P3F C;  3W96 A;  3C1B D;  4CAY B;  4Z5T C;  5DNN A;  5GXQ B;  3H0L C;  3AYW D;  2FJ7 D;  3REL B;  4LD9 D;  4WU9 A;  1KX5 A;  4EO5 C;  4R8P B;  5B1L B;  2CV5 D;  2CWE A;  2HIO D;  2Y2P A;  5BO0 B;  3X1S C;  5KDM B;  3B6F C;  2RVQ C;  3KXB C;  3MGS C;  3REH B;  3REI B;  3AV2 A;  1ID3 D;  4XUJ D;  5B32 D;  3AZL B;  3LEL A;  4H9P B;  3AFA A;  5CPI C;  3WTP C;  3W96 C;  1HQ3 A;  2J8P A;  3WAA D;  4KGC B;  3KUY C;  3A6N C;  4NE6 A;  4G91 B;  5AV5 A;  3LZ0 A;  3C1C B;  5BS7 A;  1F66 D;  1ZLA B;  3AZE D;  1H3O A;  1P3A C;  5B0Z B;  5CPK D;  1BH8 A;  5CP6 A;  3UTB B;  1KX3 C;  2NQB C;  3VH6 W;  3X1T C;  2F8N D;  3REJ B;  3MGR C;  3WA9 D;  3MNN A;  5B33 D;  4YM6 A;  2PYO A;  4JJN A;  1P3B D;  5E5A D;  3MGP C;  4CSR B;  4H9S C;  5C3I B;  3A1I A;  2HUE B;  3B0C W;  3NQJ B;  5G49 B;  3MGQ A;  4WU8 D;  5AVC B;  1P3P D;  5CPJ C;  1P3M C;  3KWQ C;  4ZUX C;  5AVB A;  5B40 D;  3EPL A;  4H9N A;  2XD1 A;  5GSU A;  3AYW A;  1P3K B;  5C3I C;  4LD9 A;  1TAF A;  5B31 D;  3AN2 D;  5GT3 D;  2JSS A;  1P3O B;  5AV9 D;  4J8X B;  3UT9 D;  2PYO C;  2CV5 A;  3WKJ A;  4G92 B;  5AY8 C;  5DNM C;  4WNN A;  2HIO A;  3AZN D;  4Z5T D;  5AV8 D;  3W99 C;  4XUJ A;  5B32 A;  3X1U C;  5BNV B;  5GT0 B;  4X23 C;  4Z66 C;  1U35 C;  4Z2M H;  5F99 A;  4WV4 B;  5AV6 B;  3UTA D;  4WJ3 C;  3KSY A;  3AZH D;  5CPK A;  1P3G B;  3B6F D;  2RVQ D;  3KXB D;  3MGS D;  4DQY B;  2FJ7 B;  5B1M B;  2ZY2 A;  3B6G C;  3O62 A;  3WTP E;  3W97 A;  3WTP D;  3W96 D;  5DNN D;  3KUY D;  4J8V C;  3EPH A;  2NZD A;  3AZI B;  1P3A D;  3AZG B;  2BG1 A;  5B2J A;  4WU9 D;  1P3B A;  2LY8 A;  1P3P A;  1KX3 D;  3X1T D;  1ID3 B;  4UPK A;  1KX4 C;  1M19 C;  3MGR D;  2ZY4 A;  2FFF B;  3AV1 B;  3AZJ C;  3O62 C;  3MGP D;  3AFA D;  5B31 A;  1P3L D;  1P3I B;  1EQZ B;  1TZY C;  5CPJ D;  2BYK B;  5B2I B;  3KWQ D;  4ZUX D;  1F1E A;  1P3F A;  3VH6 T;  4XZQ C;  3TU4 C;  2F8N B;  2F2A C;  5CP6 D;  1Q9C A;  4Z5T A;  2Y2N A;  5BNX A;  5B33 B;  3AZM B;  3LJA B;  5E5A B;  1S32 B;  1M1A A;  3B0C T;  4J8U B;  5JRG C;  1M18 C;  4WU8 B;  2ARO B;  2PYO D;  5DNM D;  3W98 C;  3X1S A;  5B40 B;  3LZ1 C;  3B6F A;  3KXB A;  3MGS A;  3H0M C;  3W99 D;  4QLC C;  3VH6 A;  3WTP A;  3MVD B;  5CPI A;  2Y2L A;  5GSU D;  3X1V C;  3KUY A;  4NFT A;  3A6N A;  3AN2 B;  5GT3 B;  5B24 B;  2Y2J A;  2G5I C;  3REK C;  4J8W B;  1P3A A;  3UT9 B;  1WWI A;  4HGA C;  1M1A C;  3R45 A;  1JFI A;  3AZK C;  1KX3 A;  3AZN B;  3AZL A;  1AOI C;  2NQB A;  3X1T A;  2BYM B;  5AV8 B;  3B6G D;  3WKJ D;  5FUG A;  4YS3 B;  5GXQ C;  3MGR A;  5BT1 C;  3REL C;  4J8V D;  1A7W A;  2ZY3 A;  3AZF B;  3MGP A;  3A1K A;  1P3L A;  4H9S A;  4R8P C;  3UTA B;  4KHA B;  5B1L C;  3AZH B;  5CPJ A;  1P3M A;  3KWQ A;  4ZUX A;  2W8S A;  5F99 D;  1P34 B;  1KX4 D;  1M19 D;  5B0Y B;  3REH C;  3REI C;  3AZL C;  5DNN B;  2YFW A;  4KGC C;  3O62 D;  3W97 D;  4G91 C;  4WU9 B;  3C1C C;  1TZY D;  1KX5 B;  1ZLA C;  2NZD D;  5B0Z C;  1B6W A;  5B2J D;  4KUD B;  4XZQ D;  5AY8 A;  3TU4 D;  5DNM A;  3UTB C;  3W99 A;  3X1U A;  2YFV B;  3AV2 B;  3REJ C;  4H9O A;  3LEL B;  3AFA B;  3B0D B;  1HQ3 B;  4X23 A;  4Z66 A;  1U35 A;  5JRG D;  1M18 D;  4ZBJ B;  5AV5 B;  3LZ0 B;  2ZY5 A;  2HUE C;  3KFU G;  5AVC C;  2G5H C;  2IO5 B;  4QLC D;  4UUZ A;  1BH8 B;  5CP6 B;  3B6G A;  1P3F D;  1KU5 A;  2L5A A;  3B0D C;  3X1V D;  1P3K C;  3MNN B;  4J8V A;  4YM6 B;  1BH9 A;  1P3O C;  4JJN B;  1M1A D;  4NE5 A;  5B32 G;  4J8X C;  4AWL B;  3MGQ B;  2DQN C;  1AOI D;  4G92 C;  2JE5 A;  2Y2I A;  1KX4 A;  5AVB B;  3X1S D;  1M19 A;  5GXQ D;  2JCH A;  3V9R A;  4H9N B;  3C1B B;  3AZI A;  4M6B A;  3AYW B;  3AZJ A;  3B0B A;  5GT0 C;  5CPI D;  4LD9 B;  1TAF B;  4R8P D;  5B1L D;  3A6N D;  2F8N G;  1TZY A;  5AV6 C;  1P3G C;  4XZQ A;  3TU4 A;  2CV5 B;  3WKJ B;  1HTA A;  3REH D;  4WNN B;  2HIO B;  3C1B C;  3AV1 A;  3NQU A;  5B1M C;  2FJ7 C;  3AZL D;  1Z2C B;  2NQB D;  3P5J B;  5B32 B;  4XUJ B;  2Y2Q A;  4H9R A;  3C1C D;  3WAA B;  1ZLA D;  1M18 A;  5JRG A;  3AZI C;  5CHL B;  3AZG C;  5B0Z D;  2UWX A;  1F66 B;  5F99 B;  3AZE B;  3W98 A;  2Y2O A;  3LZ1 A;  5CPK B;  1P3M D;  4QLC A;  5B31 G;  1ID3 C;  3REJ D;  1W2E A;  5JA4 A;  3AV1 C;  3X1V A;  3W97 B;  4NE3 A;  2F8N K;  3WA9 B;  1T3U A;  3REK A;  1P3I C;  2NZD B;  5AVC D;  5B2J B;  1P3B B;  1EQZ C;  5B2I C;  4H9Q A;  3AZK A;  1P3P B;  1AOI A;  5AY8 D;  4CAY A;  5GXQ A;  1N1J B;  3REL A;  1ULY A;  1P3K D;  5B33 C;  3AZM C;  3WA9 C;  1WWS A;  3X1U D;  4WZS B;  3LJA C;  5E5A C;  1S32 C;  4J8U C;  5B31 B;  4R8P A;  4J8X D;  5B1L A;  4Z66 D;  4X23 D;  2ARO C;  4WU8 C;  1U35 D;  5AV9 B;  2RIQ A;  5BO0 A;  5KDM A;  5B40 C;  1P3L C;  1B67 A;  3REH A;  3REI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...