3KWQC

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kwqC00
3B6GB 5FUGA 3KUYD 3MVDB 1M1AC 3W96D 3AZJC 1P3MD 4NFTA 3RELC 1HQ3A 2NZDA 5AV8D 5B2IA 1M19D 3AZLD 3LJAC 4NE5A 3NQJA 5AV5C 3REJD 3MGPB 3AFAA 3AZND 4H9NB 3KXBA 3MGRA 3AZHC 1R4VA 2HUEB 5BT1C 5B32D 1P3GB 1S32D 4KGCC 3C1BA 5B31A 1KX3B 3B6FC 3AV2D 4R8PB 5B40C 3AZJB 3RELB 5JRGD 3WA9D 1P3LB 5DNMD 3LJAB 3B6GD 4KHAA 5AV5B 2F8NB 5B33A 5BS7A 4YM6A 4J8XA 3KXBC 3MGRC 3VH5T 3AZHB 3MVDD 3X1SC 3C1BC 5GT0A 1P3IC 4KGCB 3AZEA 5B1LC 3B6FB 4LD9A 4ZBJC 3WAAD 1H3OA 1KX5C 5B40B 4NE3A 1KX4B 1F66C 4CAYB 4J8WA 3MGPD 1P3KD 3WTPE 3O62A 4Z5TA 1P3GD 5BS7C 4YM6C 4J8XC 3TU4A 4H9OA 3UTBA 1ID3A 5CPIC 1KX3D 4XUJA 1P3OB 3REKA 5GT0C 3X1SB 4R8PD 3R45B 3AZEC 5AVCA 1P3IB 5KDMB 5B1LB 4LD9C 1P3LD 3X1TA 3LJAD 1KX5B 5AV5D 1F66B 2F8ND 3O62C 3AZKA 4Z5TC 5CPKD 5C3IC 5B1MA 3MGQC 4JJNA 4G92C 3TU4C 3KWQD 4J8VC 3UTBC 1ID3C 4KGCD 4XUJC 5CPIB 3B6FD 5DNNA 5AVCC 5B40D 1KX4D 1Q9CA 3X1TC 3W98C 4UUZB 1TZYA 3AN2A 3LZ1A 1P3FB 4H9SA 3AZIC 3AZKC 2YFWA 5B1MC 4JJNC 4G91C 5AV8A 3MGQB 1P3OD 2FJ7A 2CV5D 4G92B 1M19A 4J8VB 1AOIA 1P3ID 5GXQC 2PYOD 5B1LD 1ULYA 3A6NA 1EQZB 1P34A 5B0YC 2HIOC 1BFMA 2BYMA 3AZMA 2F8NK 1KX5D 3REHA 4KUDC 5B2JC 2BYKA 1P3AA 1TZYC 3W98B 2RVQD 3AN2C 4H9RB 3AZFB 3LZ1C 4CSRB 4WU8A 3MGSA 4H9SC 3AZGA 1B67A 1N1JA 3AZIB 4ZUXC 5CPID 1P3BC 2FJ7C 4G91B 3AV1B 4DRBA 5DNMA 4E44A 5GXQB 3A6NC 1P34C 3AZMC 5B0YB 2HIOB 4WV4B 3W99C 4KUDB 3UTAC 2YFVA 3WKJB 5E5AB 5B2JB 1U35B 1P3FD 3LZ0D 4QLCA 5B24C 4WU8C 4J8UC 3MGQD 5AV9A 4J8VD 5BO0B 3WAAA 4ZUXB 5BNXA 5BNVA 5B0ZA 1P3BB 1EQZD 2CWEA 1ZLAB 5CPJB 1M18A 1F1EA 4H9QB 3W97B 4XZQA 3UT9D 3W99B 4Z2MG 5AVBB 3MNNA 3UTAB 3AZFD 4NE6A 3AZID 5G49A 3REIA 5B24B 4J8UB 3AV1D 2AROA 3NQUB 5GXQD 3VH6T 5B0ZC 1P3PA 5CP6A 3WTPC 5B0YD 4Z66A 2HIOD 2F8NG 1M18C 3WKJD 5E5AD 1U35D 5CPKA 5GT3A 4WNNA 4DRAA 3KWQA 3MNNC 4X23A 1M1AB 1HQ3C 3AYWA 2NZDC 5B2IC 1WWIA 3REIC 4ZUXD 3KSYA 1P3BD 3X1UA 1ZLAD 5CPJD 2NQBA 3W97D 3AFAC 4Z66C 4YS3A 3WTPB 5FUGB 3W99D 5AVBD 3UTAD 5B31C 5GSUA 4X23C 2CV5A 5B24D 2PYOA 4H9PA 4J8UD 1HQ3B 3LELA 2NZDB 3C1CA 5B2IB 3X1VA 3NQJB 2NQBC 2L5AA 5F99A 5B33C 4YS3C 3B0DC 3AFAB 3KXBB 3MGRB 1JFIA 5AY8A 3VH5A 1M1AD 5AV6A 3C1BB 5B31B 3AZJD 3RELD 5JA4A 4ZBJB 3C1CC 4J8WC 3X1VC 3WTPD 5F99C 4KHAB 3AZHD 5BT1D 5B33B 4YM6B 4Z2MH 4J8XB 3REKC 1BH8A 5AV6C 5GT0B 1HQ3D 3AZEB 4WU9A 5B2ID 1P3KA 4LD9B 1H3OB 3V9RA 2F8NH 3UT9A 4AWLC 4J8WB 3KUYA 1TAFA 4HGAC 3W96A 3O62B 3KXBD 3MGRD 1P3MA 4Z5TB 5C3IB 3X1SD 3TU4B 4H9OB 5B31D 3C1BD 3UTBB 3AZLA 1ID3B 4XUJB 5DNNC 3REKB 3B0CW 3REJA 4WU9C 5AVCB 3AZNA 1F66D 3X1TB 2JSSA 5B32A 1S32A 5B33D 3KUYC 4YM6D 4J8XD 1A7WA 3AZKB 3AV2A 5B1MB 5AV8C 5JRGA 4JJNB 1M19C 3WA9A 5GT0D 1BH9A 3AZLC 1AOIC 3AZED 4LD9D 3B6GA 5DNNB 3REJC 3AZNC 3REHC 4J8WD 5B32C 1P3AC 3MVDA 3O62D 1S32C 1TZYB 4Z5TD 3AN2B 3MGSC 3AZGC 3LZ1B 3TU4D 1ID3D 2YFWB 3UTBD 4XUJD 4M6BA 3WA9C 5AV8B 3REKD 2FJ7B 5CHLB 5DNMC 1M19B 1AOIB 5AVCD 3MGPA 4H9NA 3A6NB 3B6GC 1P34B 3X1TD 2BYMB 3AZMB 1P3GA 3W98D 3REHB 1KX3A 3MVDC 2BYKB 1P3AB 3AZKD 4QLCC 4R8PA 4E45A 3AZJA 5B1MD 3RELA 3MGSB 4WU8B 4JJND 5AV9C 3AZGB 1P3LA 1N1JB 3WAAC 3LJAA 3VH6W 5AV5A 2F8NA 5DNMB 4KUDD 5B2JD 2HUEC 4XZQC 3AZHA 1P3GC 1TZYD 3AN2D 4KGCA 2YFVB 1KX3C 3LZ1D 3B6FA 4R8PC 4QLCB 5B40A 1KX4A 2FJ7D 4CAYA 1P3LC 5AV9B 2AROC 1AOID 3WAAB 1P3PC 5BNXB 3A6ND 5BNVB 5CP6C 5B0ZB 1P34D 3AZMD 3VH6A 1M18B 3VH5W 3REHD 5CPKC 5GT3C 4XZQB 1P3AD 1P3OA 3KWQC 3X1SA 3R45A 3MNNB 1P3IA 5B31G 3MGSD 5KDMA 3AYWC 5B1LA 3AZGD 4WU8D 5G49B 3REIB 1KX4C 1KX5A 3X1UC 1F66A 1HTAA 2AROB 1WWSA 1P3PB 5CP6B 4Z66B 5CPKB 5CPIA 5GSUC 5GT3B 1P3OC 4WNNB 2CV5C 3KWQB 4QLCD 4X23B 2PYOC 3AYWB 3LELC 5AV9D 4UUZA 5B0ZD 3X1UB 2NQBB 1P3FA 1M18D 3LZ0A 2RVQC 4YS3B 3B0DB 4XZQD 5AY8C 3MGQA 4J8VA 3MNND 5GSUB 2NZDD 1EQZA 2IO5C 2CV5B 3REID 2PYOB 4H9PB 3LELB 3C1CB 2AROD 1P3PD 3W98A 3AFAD 5CP6D 4H9RA 4Z66D 3AZFA 3X1VB 4CSRA 5F99B 1P3FC 3LZ0C 3AZIA 2LY8A 4EO5C 5GT3D 1JFIB 5AY8B 3AV1A 4X23D 5AV6B 5GXQA 3AYWD 1EQZC 1P3KC 5JA4B 5B0YA 2HIOA 2IO5B 3X1UD 3WKJA 3B0BA 4KUDA 5E5AA 5B2JA 1U35A 2NQBD 3UT9C 4AWLB 4YS3D 3AZFC 3W96C 4HGAB 1P3MC 3LZ0B 5BO0A 4ZUXA 5GSUD 1P3BA 3AV1C 4EO5B 1ZLAA 5CPJA 1BH8B 4H9QA 3W97A 3LELD 4WU9B 3B0CT 3C1CD 1P3KB 1B6WA 3W99A 3WKJC 3V9RB 3X1VD 5E5AC 5AVBA 1U35C 3UTAA 5F99D 3UT9B 5B32G 3KUYB 1TAFB 3AV2C 3W96B 5B24A 1P3MB 1KU5A 5AY8D 4J8UA 5JRGC 3NQUA 5AV6D 3AZLB 1ZLAC 5CPJC 3W97C 3REJB 4WZSB 3AZNB 5B32B 5AVBC 1M1AA 1S32B 3AV2B 5JRGB 5DNND 3WA9B 1BH9B 3MGPC 4WU9D 3WTPA
chains in the Genus database with same CATH superfamily
3B6GB 5FUGA 3KUYD 3MVDB 1M1AC 2DQNC 3W96D 2F2AC 3AZJC 4NFTA 3RELC 1P3MD 1HQ3A 2NZDA 5AV8D 5B2IA 1M19D 3AZLD 3LJAC 4NE5A 3NQJA 5AV5C 3REJD 3MGPB 3AFAA 2DF4C 3AZND 4H9NB 3KXBA 3MGRA 3AZHC 1R4VA 2HUEB 5BT1C 5B32D 1P3GB 2Y2GA 1S32D 4KGCC 3C1BA 5B31A 2XD1A 1KX3B 3B6FC 2Y2LA 3AV2D 4R8PB 5B40C 3AZJB 3RELB 5JRGD 3WA9D 1P3LB 5DNMD 3LJAB 3B6GD 4KHAA 2J8PA 5AV5B 2F8NB 5B33A 5BS7A 4YM6A 4J8XA 3KXBC 3MGRC 3VH5T 3AZHB 3MVDD 3X1SC 3C1BC 5GT0A 1P3IC 4KGCB 3F6TA 3AZEA 5B1LC 3B6FB 4DQYB 4LD9A 4ZBJC 3WAAD 1H3OA 3IP4C 1KX5C 5B40B 4NE3A 1KX4B 1F66C 4CAYB 4J8WA 3MGPD 1P3KD 3WTPE 3O62A 4Z5TA 1P3GD 5BS7C 4YM6C 4J8XC 3TU4A 4H9OA 3UTBA 1ID3A 3KFUG 5CPIC 1KX3D 4XUJA 1P3OB 3REKA 5GT0C 3X1SB 4R8PD 3R45B 3AZEC 5AVCA 1P3IB 5KDMB 5B1LB 4LD9C 3AL0C 1P3LD 2G5IC 3X1TA 3LJAD 1KX5B 5AV5D 1F66B 2F8ND 3O62C 3AZKA 3EPKA 4Z5TC 1PZRA 5CPKD 5C3IC 5B1MA 3MGQC 4JJNA 4G92C 3TU4C 3KWQD 4J8VC 3UTBC 1ID3C 4KGCD 4XUJC 5CPIB 2Y2NA 3B6FD 5DNNA 5AVCC 2W8SA 5B40D 1KX4D 1Q9CA 3X1TC 3W98C 4UUZB 1TZYA 3AN2A 3LZ1A 1P3FB 4H9SA 2Y2QA 3AZKC 3AZIC 2YFWA 5B1MC 4JJNC 4G91C 2G5HC 5AV8A 3MGQB 1P3OD 2FJ7A 2CV5D 4G92B 1M19A 4J8VB 1AOIA 1P3ID 5GXQC 2PYOD 5B1LD 1ULYA 3A6NA 1EQZB 1P34A 5B0YC 3EPHA 2HIOC 3A1KA 2BYMA 3AZMA 1BFMA 2F8NK 1KX5D 3REHA 4KUDC 5B2JC 2BYKA 1P3AA 1TZYC 3W98B 2RVQD 3AN2C 4H9RB 3AZFB 3LZ1C 4CSRB 4WU8A 3MGSA 4H9SC 3AZGA 1B67A 1N1JA 3AZIB 4ZUXC 5CPID 1P3BC 2FJ7C 4G91B 3AV1B 4DRBA 5DNMA 4E44A 5GXQB 3A6NC 1P34C 3AZMC 5B0YB 2HIOB 4WV4B 3W99C 4KUDB 3UTAC 2YFVA 3WKJB 5E5AB 5B2JB 1U35B 2Y2OA 1P3FD 3LZ0D 4QLCA 5B24C 4WU8C 4J8UC 3MGQD 5AV9A 4J8VD 5BO0B 3WAAA 4ZUXB 5BNXA 5BNVA 5B0ZA 1P3BB 1EQZD 4UPKA 2CWEA 1ZLAB 5CPJB 1M18A 1F1EA 4H9QB 3W97B 4XZQA 3UT9D 3W99B 4Z2MG 5AVBB 3MNNA 3UTAB 3AZFD 4NE6A 2FFFB 3AZID 5G49A 3REIA 2Y2KA 5B24B 4J8UB 3AV1D 2AROA 1T3UA 3NQUB 5GXQD 3VH6T 5B0ZC 1P3PA 5CP6A 3WTPC 5B0YD 4Z66A 2HIOD 2F8NG 1M18C 3WKJD 5E5AD 1U35D 5CPKA 5GT3A 4WNNA 4DRAA 3KWQA 3MNNC 4X23A 1M1AB 1HQ3C 3AYWA 2NZDC 4WJ3C 5B2IC 1WWIA 2UWXA 3REIC 4ZUXD 3KSYA 1P3BD 3X1UA 1ZLAD 5CPJD 2NQBA 3W97D 3EG5B 3AFAC 4Z66C 4YS3A 3WTPB 5FUGB 3W99D 2Y2HA 2Y2IA 5AVBD 3UTAD 5B31C 5GSUA 4X23C 2CV5A 5B24D 2PYOA 4H9PA 4J8UD 1HQ3B 3LELA 2NZDB 3C1CA 5B2IB 3P5JB 3X1VA 3NQJB 2NQBC 2L5AA 5F99A 5B33C 2Y2PA 3B0DC 4YS3C 3AFAB 3KXBB 3MGRB 1JFIA 5AY8A 3VH5A 1M1AD 5AV6A 3C1BB 5B31B 3AZJD 3RELD 5JA4A 4ZBJB 3C1CC 4J8WC 3X1VC 3WTPD 5F99C 4KHAB 3AZHD 5BT1D 5B33B 4YM6B 4Z2MH 4J8XB 3REKC 1BH8A 5AV6C 5GT0B 1HQ3D 3AZEB 4WU9A 5B2ID 2XD5A 1P3KA 4LD9B 1H3OB 3V9RA 2F8NH 3UT9A 4AWLC 4J8WB 3KUYA 1TAFA 4HGAC 3W96A 3O62B 3KXBD 3MGRD 1P3MA 4Z5TB 5C3IB 3X1SD 3TU4B 3EPJA 4H9OB 5B31D 3C1BD 3UTBB 3AZLA 1ID3B 4XUJB 5DNNC 3REKB 3B0CW 3REJA 4WU9C 5AVCB 3AZNA 1F66D 3X1TB 2JSSA 2BG1A 5B32A 1S32A 5B33D 3KUYC 4YM6D 4J8XD 1A7WA 3AZKB 3AV2A 5B1MB 5AV8C 5JRGA 4JJNB 1M19C 3WA9A 5GT0D 1BH9A 3AZLC 1AOIC 3AZED 4LD9D 3B6GA 5DNNB 3REJC 3AZNC 3REHC 4J8WD 5B32C 1P3AC 3MVDA 3O62D 1S32C 1TZYB 4Z5TD 3AN2B 3MGSC 3AZGC 3LZ1B 3TU4D 1ID3D 2YFWB 3UTBD 4XUJD 4M6BA 3WA9C 5AV8B 3REKD 2FJ7B 5CHLB 5DNMC 1M19B 1AOIB 5AVCD 3MGPA 4H9NA 3A6NB 3B6GC 1P34B 3X1TD 2BYMB 3AZMB 1P3GA 3W98D 3REHB 1KX3A 3MVDC 2BYKB 1P3AB 3AZKD 3EPLA 4QLCC 4R8PA 4E45A 3AZJA 5B1MD 3RELA 3MGSB 4WU8B 4JJND 5AV9C 3AZGB 1P3LA 1N1JB 3WAAC 3LJAA 3VH6W 2ZY4A 5AV5A 2F8NA 5DNMB 4KUDD 5B2JD 2HUEC 4XZQC 3AZHA 1P3GC 1TZYD 3AN2D 4KGCA 2YFVB 1KX3C 3LZ1D 3B6FA 4R8PC 4QLCB 5B40A 1KX4A 2FJ7D 4CAYA 1P3LC 5AV9B 2AROC 1AOID 3WAAB 3H0MC 1P3PC 5BNXB 3A6ND 5BNVB 5CP6C 5B0ZB 1P34D 3AZMD 3VH6A 1M18B 3VH5W 3REHD 5CPKC 5GT3C 4XZQB 1P3AD 1P3OA 3KWQC 3X1SA 3R45A 3MNNB 1P3IA 5B31G 3MGSD 5KDMA 3AYWC 5B1LA 3AZGD 4WU8D 5G49B 3H0LC 3REIB 3H0RC 1KX4C 1KX5A 2ZM5A 3X1UC 1F66A 2ZY3A 1HTAA 2AROB 1WWSA 2RIQA 1P3PB 5CP6B 4Z66B 5CPKB 5CPIA 5GSUC 5GT3B 1P3OC 4WNNB 2CV5C 3KWQB 4QLCD 4X23B 2PYOC 3AYWB 3LELC 5AV9D 4UUZA 5B0ZD 2Y2JA 2ZY5A 3X1UB 2NQBB 1P3FA 1M18D 3LZ0A 2RVQC 4YS3B 3B0DB 4XZQD 5AY8C 1Z2CB 3MGQA 4J8VA 3MNND 5GSUB 2NZDD 1EQZA 2IO5C 2CV5B 3REID 2PYOB 4H9PB 3LELB 3C1CB 2AROD 1P3PD 3W98A 3AFAD 5CP6D 4H9RA 4Z66D 3AZFA 3X1VB 4CSRA 5F99B 1P3FC 3LZ0C 3AZIA 2LY8A 4EO5C 5GT3D 1JFIB 3A1IA 5AY8B 3AV1A 4X23D 5AV6B 5GXQA 3AYWD 1EQZC 1P3KC 5JA4B 5B0YA 2HIOA 2IO5B 3FDDA 3X1UD 3WKJA 3B0BA 4KUDA 2JCHA 5E5AA 5B2JA 1U35A 3UT9C 2NQBD 2ZY2A 4AWLB 4YS3D 3AZFC 3W96C 4HGAB 1P3MC 3LZ0B 5BO0A 4ZUXA 5GSUD 1P3BA 3AV1C 4EO5B 1ZLAA 5CPJA 1BH8B 4H9QA 3W97A 3LELD 4WU9B 3B0CT 3C1CD 1P3KB 1B6WA 3W99A 3WKJC 3V9RB 3X1VD 5E5AC 5AVBA 1U35C 3UTAA 5F99D 2VQRA 3UT9B 5B32G 3KUYB 1TAFB 3AV2C 1W2EA 3W96B 5B24A 1P3MB 1KU5A 5AY8D 4J8UA 5JRGC 3NQUA 5AV6D 3AZLB 2JE5A 1ZLAC 5CPJC 3W97C 3REJB 4WZSB 3AZNB 5B32B 5AVBC 1M1AA 1S32B 3AV2B 5JRGB 5DNND 3WA9B 1BH9B 2Y2MA 3MGPC 4WU9D 3WTPA
chains in the Genus database with same CATH topology
3B6GB 5FUGA 3KUYD 3MVDB 1M1AC 2DQNC 3W96D 2F2AC 3AZJC 4NFTA 3RELC 1P3MD 1HQ3A 2NZDA 5AV8D 5B2IA 1M19D 3AZLD 3LJAC 4NE5A 3NQJA 5AV5C 3REJD 3MGPB 3AFAA 2DF4C 3AZND 4H9NB 3KXBA 3MGRA 3AZHC 1R4VA 2HUEB 5BT1C 5B32D 1P3GB 2Y2GA 1S32D 4KGCC 3C1BA 5B31A 2XD1A 1KX3B 3B6FC 2Y2LA 3AV2D 4R8PB 5B40C 3AZJB 3RELB 5JRGD 3WA9D 1P3LB 5DNMD 3LJAB 3B6GD 4KHAA 2J8PA 5AV5B 2F8NB 5B33A 5BS7A 4YM6A 4J8XA 3KXBC 3MGRC 3VH5T 3AZHB 3MVDD 3X1SC 3C1BC 5GT0A 1P3IC 4KGCB 3F6TA 3AZEA 5B1LC 3B6FB 4DQYB 4LD9A 4ZBJC 3WAAD 1H3OA 3IP4C 1KX5C 5B40B 4NE3A 1KX4B 1F66C 4CAYB 4J8WA 3MGPD 1P3KD 3WTPE 3O62A 4Z5TA 1P3GD 5BS7C 4YM6C 4J8XC 3TU4A 4H9OA 3UTBA 1ID3A 3KFUG 5CPIC 1KX3D 4XUJA 1P3OB 3REKA 5GT0C 3X1SB 4R8PD 3R45B 3AZEC 5AVCA 1P3IB 5KDMB 5B1LB 4LD9C 3AL0C 1P3LD 2G5IC 3X1TA 3LJAD 1KX5B 5AV5D 1F66B 2F8ND 3O62C 3AZKA 3EPKA 4Z5TC 1PZRA 5CPKD 5C3IC 5B1MA 3MGQC 4JJNA 4G92C 3TU4C 3KWQD 4J8VC 3UTBC 1ID3C 4KGCD 4XUJC 5CPIB 2Y2NA 3B6FD 5DNNA 5AVCC 2W8SA 5B40D 1KX4D 1Q9CA 3X1TC 3W98C 4UUZB 1TZYA 3AN2A 3LZ1A 1P3FB 4H9SA 2Y2QA 3AZKC 3AZIC 2YFWA 5B1MC 4JJNC 4G91C 2G5HC 5AV8A 3MGQB 1P3OD 2FJ7A 2CV5D 4G92B 1M19A 4J8VB 1AOIA 1P3ID 5GXQC 2PYOD 5B1LD 1ULYA 3A6NA 1EQZB 1P34A 5B0YC 3EPHA 2HIOC 3A1KA 2BYMA 3AZMA 1BFMA 2F8NK 1KX5D 3REHA 4KUDC 5B2JC 2BYKA 1P3AA 1TZYC 3W98B 2RVQD 3AN2C 4H9RB 3AZFB 3LZ1C 4CSRB 4WU8A 3MGSA 4H9SC 3AZGA 1B67A 1N1JA 3AZIB 4ZUXC 5CPID 1P3BC 2FJ7C 4G91B 3AV1B 4DRBA 5DNMA 4E44A 5GXQB 3A6NC 1P34C 3AZMC 5B0YB 2HIOB 4WV4B 3W99C 4KUDB 3UTAC 2YFVA 3WKJB 5E5AB 5B2JB 1U35B 2Y2OA 1P3FD 3LZ0D 4QLCA 5B24C 4WU8C 4J8UC 3MGQD 5AV9A 4J8VD 5BO0B 3WAAA 4ZUXB 5BNXA 5BNVA 5B0ZA 1P3BB 1EQZD 4UPKA 2CWEA 1ZLAB 5CPJB 1M18A 1F1EA 4H9QB 3W97B 4XZQA 3UT9D 3W99B 4Z2MG 5AVBB 3MNNA 3UTAB 3AZFD 4NE6A 2FFFB 3AZID 5G49A 3REIA 2Y2KA 5B24B 4J8UB 3AV1D 2AROA 1T3UA 3NQUB 5GXQD 3VH6T 5B0ZC 1P3PA 5CP6A 3WTPC 5B0YD 4Z66A 2HIOD 2F8NG 1M18C 3WKJD 5E5AD 1U35D 5CPKA 5GT3A 4WNNA 4DRAA 3KWQA 3MNNC 4X23A 1M1AB 1HQ3C 3AYWA 2NZDC 4WJ3C 5B2IC 1WWIA 2UWXA 3REIC 4ZUXD 3KSYA 1P3BD 3X1UA 1ZLAD 5CPJD 2NQBA 3W97D 3EG5B 3AFAC 4Z66C 4YS3A 3WTPB 5FUGB 3W99D 2Y2HA 2Y2IA 5AVBD 3UTAD 5B31C 5GSUA 4X23C 2CV5A 5B24D 2PYOA 4H9PA 4J8UD 1HQ3B 3LELA 2NZDB 3C1CA 5B2IB 3P5JB 3X1VA 3NQJB 2NQBC 2L5AA 5F99A 5B33C 2Y2PA 3B0DC 4YS3C 3AFAB 3KXBB 3MGRB 1JFIA 5AY8A 3VH5A 1M1AD 5AV6A 3C1BB 5B31B 3AZJD 3RELD 5JA4A 4ZBJB 3C1CC 4J8WC 3X1VC 3WTPD 5F99C 4KHAB 3AZHD 5BT1D 5B33B 4YM6B 4Z2MH 4J8XB 3REKC 1BH8A 5AV6C 5GT0B 1HQ3D 3AZEB 4WU9A 5B2ID 2XD5A 1P3KA 4LD9B 1H3OB 3V9RA 2F8NH 3UT9A 4AWLC 4J8WB 3KUYA 1TAFA 4HGAC 3W96A 3O62B 3KXBD 3MGRD 1P3MA 4Z5TB 5C3IB 3X1SD 3TU4B 3EPJA 4H9OB 5B31D 3C1BD 3UTBB 3AZLA 1ID3B 4XUJB 5DNNC 3REKB 3B0CW 3REJA 4WU9C 5AVCB 3AZNA 1F66D 3X1TB 2JSSA 2BG1A 5B32A 1S32A 5B33D 3KUYC 4YM6D 4J8XD 1A7WA 3AZKB 3AV2A 5B1MB 5AV8C 5JRGA 4JJNB 1M19C 3WA9A 5GT0D 1BH9A 3AZLC 1AOIC 3AZED 4LD9D 3B6GA 5DNNB 3REJC 3AZNC 3REHC 4J8WD 5B32C 1P3AC 3MVDA 3O62D 1S32C 1TZYB 4Z5TD 3AN2B 3MGSC 3AZGC 3LZ1B 3TU4D 1ID3D 2YFWB 3UTBD 4XUJD 4M6BA 3WA9C 5AV8B 3REKD 2FJ7B 5CHLB 5DNMC 1M19B 1AOIB 5AVCD 3MGPA 4H9NA 3A6NB 3B6GC 1P34B 3X1TD 2BYMB 3AZMB 1P3GA 3W98D 3REHB 1KX3A 3MVDC 2BYKB 1P3AB 3AZKD 3EPLA 4QLCC 4R8PA 4E45A 3AZJA 5B1MD 3RELA 3MGSB 4WU8B 4JJND 5AV9C 3AZGB 1P3LA 1N1JB 3WAAC 3LJAA 3VH6W 2ZY4A 5AV5A 2F8NA 5DNMB 4KUDD 5B2JD 2HUEC 4XZQC 3AZHA 1P3GC 1TZYD 3AN2D 4KGCA 2YFVB 1KX3C 3LZ1D 3B6FA 4R8PC 4QLCB 5B40A 1KX4A 2FJ7D 4CAYA 1P3LC 5AV9B 2AROC 1AOID 3WAAB 3H0MC 1P3PC 5BNXB 3A6ND 5BNVB 5CP6C 5B0ZB 1P34D 3AZMD 3VH6A 1M18B 3VH5W 3REHD 5CPKC 5GT3C 4XZQB 1P3AD 1P3OA 3KWQC 3X1SA 3R45A 3MNNB 1P3IA 5B31G 3MGSD 5KDMA 3AYWC 5B1LA 3AZGD 4WU8D 5G49B 3H0LC 3REIB 3H0RC 1KX4C 1KX5A 2ZM5A 3X1UC 1F66A 2ZY3A 1HTAA 2AROB 1WWSA 2RIQA 1P3PB 5CP6B 4Z66B 5CPKB 5CPIA 5GSUC 5GT3B 1P3OC 4WNNB 2CV5C 3KWQB 4QLCD 4X23B 2PYOC 3AYWB 3LELC 5AV9D 4UUZA 5B0ZD 2Y2JA 2ZY5A 3X1UB 2NQBB 1P3FA 1M18D 3LZ0A 2RVQC 4YS3B 3B0DB 4XZQD 5AY8C 1Z2CB 3MGQA 4J8VA 3MNND 5GSUB 2NZDD 1EQZA 2IO5C 2CV5B 3REID 2PYOB 4H9PB 3LELB 3C1CB 2AROD 1P3PD 3W98A 3AFAD 5CP6D 4H9RA 4Z66D 3AZFA 3X1VB 4CSRA 5F99B 1P3FC 3LZ0C 3AZIA 2LY8A 4EO5C 5GT3D 1JFIB 3A1IA 5AY8B 3AV1A 4X23D 5AV6B 5GXQA 3AYWD 1EQZC 1P3KC 5JA4B 5B0YA 2HIOA 2IO5B 3FDDA 3X1UD 3WKJA 3B0BA 4KUDA 2JCHA 5E5AA 5B2JA 1U35A 3UT9C 2NQBD 2ZY2A 4AWLB 4YS3D 3AZFC 3W96C 4HGAB 1P3MC 3LZ0B 5BO0A 4ZUXA 5GSUD 1P3BA 3AV1C 4EO5B 1ZLAA 5CPJA 1BH8B 4H9QA 3W97A 3LELD 4WU9B 3B0CT 3C1CD 1P3KB 1B6WA 3W99A 3WKJC 3V9RB 3X1VD 5E5AC 5AVBA 1U35C 3UTAA 5F99D 2VQRA 3UT9B 5B32G 3KUYB 1TAFB 3AV2C 1W2EA 3W96B 5B24A 1P3MB 1KU5A 5AY8D 4J8UA 5JRGC 3NQUA 5AV6D 3AZLB 2JE5A 1ZLAC 5CPJC 3W97C 3REJB 4WZSB 3AZNB 5B32B 5AVBC 1M1AA 1S32B 3AV2B 5JRGB 5DNND 3WA9B 1BH9B 2Y2MA 3MGPC 4WU9D 3WTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G B;  5FUG A;  3KUY D;  3MVD B;  1M1A C;  3W96 D;  3AZJ C;  1P3M D;  4NFT A;  3REL C;  1HQ3 A;  2NZD A;  5AV8 D;  5B2I A;  1M19 D;  3AZL D;  3LJA C;  4NE5 A;  3NQJ A;  5AV5 C;  3REJ D;  3MGP B;  3AFA A;  3AZN D;  4H9N B;  3KXB A;  3MGR A;  3AZH C;  1R4V A;  2HUE B;  5BT1 C;  5B32 D;  1P3G B;  1S32 D;  4KGC C;  3C1B A;  5B31 A;  1KX3 B;  3B6F C;  3AV2 D;  4R8P B;  5B40 C;  3AZJ B;  3REL B;  5JRG D;  3WA9 D;  1P3L B;  5DNM D;  3LJA B;  3B6G D;  4KHA A;  5AV5 B;  2F8N B;  5B33 A;  5BS7 A;  4YM6 A;  4J8X A;  3KXB C;  3MGR C;  3VH5 T;  3AZH B;  3MVD D;  3X1S C;  3C1B C;  5GT0 A;  1P3I C;  4KGC B;  3AZE A;  5B1L C;  3B6F B;  4LD9 A;  4ZBJ C;  3WAA D;  1H3O A;  1KX5 C;  5B40 B;  4NE3 A;  1KX4 B;  1F66 C;  4CAY B;  4J8W A;  3MGP D;  1P3K D;  3WTP E;  3O62 A;  4Z5T A;  1P3G D;  5BS7 C;  4YM6 C;  4J8X C;  3TU4 A;  4H9O A;  3UTB A;  1ID3 A;  5CPI C;  1KX3 D;  4XUJ A;  1P3O B;  3REK A;  5GT0 C;  3X1S B;  4R8P D;  3R45 B;  3AZE C;  5AVC A;  1P3I B;  5KDM B;  5B1L B;  4LD9 C;  1P3L D;  3X1T A;  3LJA D;  1KX5 B;  5AV5 D;  1F66 B;  2F8N D;  3O62 C;  3AZK A;  4Z5T C;  5CPK D;  5C3I C;  5B1M A;  3MGQ C;  4JJN A;  4G92 C;  3TU4 C;  3KWQ D;  4J8V C;  3UTB C;  1ID3 C;  4KGC D;  4XUJ C;  5CPI B;  3B6F D;  5DNN A;  5AVC C;  5B40 D;  1KX4 D;  1Q9C A;  3X1T C;  3W98 C;  4UUZ B;  1TZY A;  3AN2 A;  3LZ1 A;  1P3F B;  4H9S A;  3AZI C;  3AZK C;  2YFW A;  5B1M C;  4JJN C;  4G91 C;  5AV8 A;  3MGQ B;  1P3O D;  2FJ7 A;  2CV5 D;  4G92 B;  1M19 A;  4J8V B;  1AOI A;  1P3I D;  5GXQ C;  2PYO D;  5B1L D;  1ULY A;  3A6N A;  1EQZ B;  1P34 A;  5B0Y C;  2HIO C;  1BFM A;  2BYM A;  3AZM A;  2F8N K;  1KX5 D;  3REH A;  4KUD C;  5B2J C;  2BYK A;  1P3A A;  1TZY C;  3W98 B;  2RVQ D;  3AN2 C;  4H9R B;  3AZF B;  3LZ1 C;  4CSR B;  4WU8 A;  3MGS A;  4H9S C;  3AZG A;  1B67 A;  1N1J A;  3AZI B;  4ZUX C;  5CPI D;  1P3B C;  2FJ7 C;  4G91 B;  3AV1 B;  4DRB A;  5DNM A;  4E44 A;  5GXQ B;  3A6N C;  1P34 C;  3AZM C;  5B0Y B;  2HIO B;  4WV4 B;  3W99 C;  4KUD B;  3UTA C;  2YFV A;  3WKJ B;  5E5A B;  5B2J B;  1U35 B;  1P3F D;  3LZ0 D;  4QLC A;  5B24 C;  4WU8 C;  4J8U C;  3MGQ D;  5AV9 A;  4J8V D;  5BO0 B;  3WAA A;  4ZUX B;  5BNX A;  5BNV A;  5B0Z A;  1P3B B;  1EQZ D;  2CWE A;  1ZLA B;  5CPJ B;  1M18 A;  1F1E A;  4H9Q B;  3W97 B;  4XZQ A;  3UT9 D;  3W99 B;  4Z2M G;  5AVB B;  3MNN A;  3UTA B;  3AZF D;  4NE6 A;  3AZI D;  5G49 A;  3REI A;  5B24 B;  4J8U B;  3AV1 D;  2ARO A;  3NQU B;  5GXQ D;  3VH6 T;  5B0Z C;  1P3P A;  5CP6 A;  3WTP C;  5B0Y D;  4Z66 A;  2HIO D;  2F8N G;  1M18 C;  3WKJ D;  5E5A D;  1U35 D;  5CPK A;  5GT3 A;  4WNN A;  4DRA A;  3KWQ A;  3MNN C;  4X23 A;  1M1A B;  1HQ3 C;  3AYW A;  2NZD C;  5B2I C;  1WWI A;  3REI C;  4ZUX D;  3KSY A;  1P3B D;  3X1U A;  1ZLA D;  5CPJ D;  2NQB A;  3W97 D;  3AFA C;  4Z66 C;  4YS3 A;  3WTP B;  5FUG B;  3W99 D;  5AVB D;  3UTA D;  5B31 C;  5GSU A;  4X23 C;  2CV5 A;  5B24 D;  2PYO A;  4H9P A;  4J8U D;  1HQ3 B;  3LEL A;  2NZD B;  3C1C A;  5B2I B;  3X1V A;  3NQJ B;  2NQB C;  2L5A A;  5F99 A;  5B33 C;  4YS3 C;  3B0D C;  3AFA B;  3KXB B;  3MGR B;  1JFI A;  5AY8 A;  3VH5 A;  1M1A D;  5AV6 A;  3C1B B;  5B31 B;  3AZJ D;  3REL D;  5JA4 A;  4ZBJ B;  3C1C C;  4J8W C;  3X1V C;  3WTP D;  5F99 C;  4KHA B;  3AZH D;  5BT1 D;  5B33 B;  4YM6 B;  4Z2M H;  4J8X B;  3REK C;  1BH8 A;  5AV6 C;  5GT0 B;  1HQ3 D;  3AZE B;  4WU9 A;  5B2I D;  1P3K A;  4LD9 B;  1H3O B;  3V9R A;  2F8N H;  3UT9 A;  4AWL C;  4J8W B;  3KUY A;  1TAF A;  4HGA C;  3W96 A;  3O62 B;  3KXB D;  3MGR D;  1P3M A;  4Z5T B;  5C3I B;  3X1S D;  3TU4 B;  4H9O B;  5B31 D;  3C1B D;  3UTB B;  3AZL A;  1ID3 B;  4XUJ B;  5DNN C;  3REK B;  3B0C W;  3REJ A;  4WU9 C;  5AVC B;  3AZN A;  1F66 D;  3X1T B;  2JSS A;  5B32 A;  1S32 A;  5B33 D;  3KUY C;  4YM6 D;  4J8X D;  1A7W A;  3AZK B;  3AV2 A;  5B1M B;  5AV8 C;  5JRG A;  4JJN B;  1M19 C;  3WA9 A;  5GT0 D;  1BH9 A;  3AZL C;  1AOI C;  3AZE D;  4LD9 D;  3B6G A;  5DNN B;  3REJ C;  3AZN C;  3REH C;  4J8W D;  5B32 C;  1P3A C;  3MVD A;  3O62 D;  1S32 C;  1TZY B;  4Z5T D;  3AN2 B;  3MGS C;  3AZG C;  3LZ1 B;  3TU4 D;  1ID3 D;  2YFW B;  3UTB D;  4XUJ D;  4M6B A;  3WA9 C;  5AV8 B;  3REK D;  2FJ7 B;  5CHL B;  5DNM C;  1M19 B;  1AOI B;  5AVC D;  3MGP A;  4H9N A;  3A6N B;  3B6G C;  1P34 B;  3X1T D;  2BYM B;  3AZM B;  1P3G A;  3W98 D;  3REH B;  1KX3 A;  3MVD C;  2BYK B;  1P3A B;  3AZK D;  4QLC C;  4R8P A;  4E45 A;  3AZJ A;  5B1M D;  3REL A;  3MGS B;  4WU8 B;  4JJN D;  5AV9 C;  3AZG B;  1P3L A;  1N1J B;  3WAA C;  3LJA A;  3VH6 W;  5AV5 A;  2F8N A;  5DNM B;  4KUD D;  5B2J D;  2HUE C;  4XZQ C;  3AZH A;  1P3G C;  1TZY D;  3AN2 D;  4KGC A;  2YFV B;  1KX3 C;  3LZ1 D;  3B6F A;  4R8P C;  4QLC B;  5B40 A;  1KX4 A;  2FJ7 D;  4CAY A;  1P3L C;  5AV9 B;  2ARO C;  1AOI D;  3WAA B;  1P3P C;  5BNX B;  3A6N D;  5BNV B;  5CP6 C;  5B0Z B;  1P34 D;  3AZM D;  3VH6 A;  1M18 B;  3VH5 W;  3REH D;  5CPK C;  5GT3 C;  4XZQ B;  1P3A D;  1P3O A;  3KWQ C;  3X1S A;  3R45 A;  3MNN B;  1P3I A;  5B31 G;  3MGS D;  5KDM A;  3AYW C;  5B1L A;  3AZG D;  4WU8 D;  5G49 B;  3REI B;  1KX4 C;  1KX5 A;  3X1U C;  1F66 A;  1HTA A;  2ARO B;  1WWS A;  1P3P B;  5CP6 B;  4Z66 B;  5CPK B;  5CPI A;  5GSU C;  5GT3 B;  1P3O C;  4WNN B;  2CV5 C;  3KWQ B;  4QLC D;  4X23 B;  2PYO C;  3AYW B;  3LEL C;  5AV9 D;  4UUZ A;  5B0Z D;  3X1U B;  2NQB B;  1P3F A;  1M18 D;  3LZ0 A;  2RVQ C;  4YS3 B;  3B0D B;  4XZQ D;  5AY8 C;  3MGQ A;  4J8V A;  3MNN D;  5GSU B;  2NZD D;  1EQZ A;  2IO5 C;  2CV5 B;  3REI D;  2PYO B;  4H9P B;  3LEL B;  3C1C B;  2ARO D;  1P3P D;  3W98 A;  3AFA D;  5CP6 D;  4H9R A;  4Z66 D;  3AZF A;  3X1V B;  4CSR A;  5F99 B;  1P3F C;  3LZ0 C;  3AZI A;  2LY8 A;  4EO5 C;  5GT3 D;  1JFI B;  5AY8 B;  3AV1 A;  4X23 D;  5AV6 B;  5GXQ A;  3AYW D;  1EQZ C;  1P3K C;  5JA4 B;  5B0Y A;  2HIO A;  2IO5 B;  3X1U D;  3WKJ A;  3B0B A;  4KUD A;  5E5A A;  5B2J A;  1U35 A;  2NQB D;  3UT9 C;  4AWL B;  4YS3 D;  3AZF C;  3W96 C;  4HGA B;  1P3M C;  3LZ0 B;  5BO0 A;  4ZUX A;  5GSU D;  1P3B A;  3AV1 C;  4EO5 B;  1ZLA A;  5CPJ A;  1BH8 B;  4H9Q A;  3W97 A;  3LEL D;  4WU9 B;  3B0C T;  3C1C D;  1P3K B;  1B6W A;  3W99 A;  3WKJ C;  3V9R B;  3X1V D;  5E5A C;  5AVB A;  1U35 C;  3UTA A;  5F99 D;  3UT9 B;  5B32 G;  3KUY B;  1TAF B;  3AV2 C;  3W96 B;  5B24 A;  1P3M B;  1KU5 A;  5AY8 D;  4J8U A;  5JRG C;  3NQU A;  5AV6 D;  3AZL B;  1ZLA C;  5CPJ C;  3W97 C;  3REJ B;  4WZS B;  3AZN B;  5B32 B;  5AVB C;  1M1A A;  1S32 B;  3AV2 B;  5JRG B;  5DNN D;  3WA9 B;  1BH9 B;  3MGP C;  4WU9 D;  3WTP A; 
#chains in the Genus database with same CATH topology
 3B6G B;  5FUG A;  3KUY D;  3MVD B;  1M1A C;  2DQN C;  3W96 D;  2F2A C;  3AZJ C;  4NFT A;  3REL C;  1P3M D;  1HQ3 A;  2NZD A;  5AV8 D;  5B2I A;  1M19 D;  3AZL D;  3LJA C;  4NE5 A;  3NQJ A;  5AV5 C;  3REJ D;  3MGP B;  3AFA A;  2DF4 C;  3AZN D;  4H9N B;  3KXB A;  3MGR A;  3AZH C;  1R4V A;  2HUE B;  5BT1 C;  5B32 D;  1P3G B;  2Y2G A;  1S32 D;  4KGC C;  3C1B A;  5B31 A;  2XD1 A;  1KX3 B;  3B6F C;  2Y2L A;  3AV2 D;  4R8P B;  5B40 C;  3AZJ B;  3REL B;  5JRG D;  3WA9 D;  1P3L B;  5DNM D;  3LJA B;  3B6G D;  4KHA A;  2J8P A;  5AV5 B;  2F8N B;  5B33 A;  5BS7 A;  4YM6 A;  4J8X A;  3KXB C;  3MGR C;  3VH5 T;  3AZH B;  3MVD D;  3X1S C;  3C1B C;  5GT0 A;  1P3I C;  4KGC B;  3F6T A;  3AZE A;  5B1L C;  3B6F B;  4DQY B;  4LD9 A;  4ZBJ C;  3WAA D;  1H3O A;  3IP4 C;  1KX5 C;  5B40 B;  4NE3 A;  1KX4 B;  1F66 C;  4CAY B;  4J8W A;  3MGP D;  1P3K D;  3WTP E;  3O62 A;  4Z5T A;  1P3G D;  5BS7 C;  4YM6 C;  4J8X C;  3TU4 A;  4H9O A;  3UTB A;  1ID3 A;  3KFU G;  5CPI C;  1KX3 D;  4XUJ A;  1P3O B;  3REK A;  5GT0 C;  3X1S B;  4R8P D;  3R45 B;  3AZE C;  5AVC A;  1P3I B;  5KDM B;  5B1L B;  4LD9 C;  3AL0 C;  1P3L D;  2G5I C;  3X1T A;  3LJA D;  1KX5 B;  5AV5 D;  1F66 B;  2F8N D;  3O62 C;  3AZK A;  3EPK A;  4Z5T C;  1PZR A;  5CPK D;  5C3I C;  5B1M A;  3MGQ C;  4JJN A;  4G92 C;  3TU4 C;  3KWQ D;  4J8V C;  3UTB C;  1ID3 C;  4KGC D;  4XUJ C;  5CPI B;  2Y2N A;  3B6F D;  5DNN A;  5AVC C;  2W8S A;  5B40 D;  1KX4 D;  1Q9C A;  3X1T C;  3W98 C;  4UUZ B;  1TZY A;  3AN2 A;  3LZ1 A;  1P3F B;  4H9S A;  2Y2Q A;  3AZK C;  3AZI C;  2YFW A;  5B1M C;  4JJN C;  4G91 C;  2G5H C;  5AV8 A;  3MGQ B;  1P3O D;  2FJ7 A;  2CV5 D;  4G92 B;  1M19 A;  4J8V B;  1AOI A;  1P3I D;  5GXQ C;  2PYO D;  5B1L D;  1ULY A;  3A6N A;  1EQZ B;  1P34 A;  5B0Y C;  3EPH A;  2HIO C;  3A1K A;  2BYM A;  3AZM A;  1BFM A;  2F8N K;  1KX5 D;  3REH A;  4KUD C;  5B2J C;  2BYK A;  1P3A A;  1TZY C;  3W98 B;  2RVQ D;  3AN2 C;  4H9R B;  3AZF B;  3LZ1 C;  4CSR B;  4WU8 A;  3MGS A;  4H9S C;  3AZG A;  1B67 A;  1N1J A;  3AZI B;  4ZUX C;  5CPI D;  1P3B C;  2FJ7 C;  4G91 B;  3AV1 B;  4DRB A;  5DNM A;  4E44 A;  5GXQ B;  3A6N C;  1P34 C;  3AZM C;  5B0Y B;  2HIO B;  4WV4 B;  3W99 C;  4KUD B;  3UTA C;  2YFV A;  3WKJ B;  5E5A B;  5B2J B;  1U35 B;  2Y2O A;  1P3F D;  3LZ0 D;  4QLC A;  5B24 C;  4WU8 C;  4J8U C;  3MGQ D;  5AV9 A;  4J8V D;  5BO0 B;  3WAA A;  4ZUX B;  5BNX A;  5BNV A;  5B0Z A;  1P3B B;  1EQZ D;  4UPK A;  2CWE A;  1ZLA B;  5CPJ B;  1M18 A;  1F1E A;  4H9Q B;  3W97 B;  4XZQ A;  3UT9 D;  3W99 B;  4Z2M G;  5AVB B;  3MNN A;  3UTA B;  3AZF D;  4NE6 A;  2FFF B;  3AZI D;  5G49 A;  3REI A;  2Y2K A;  5B24 B;  4J8U B;  3AV1 D;  2ARO A;  1T3U A;  3NQU B;  5GXQ D;  3VH6 T;  5B0Z C;  1P3P A;  5CP6 A;  3WTP C;  5B0Y D;  4Z66 A;  2HIO D;  2F8N G;  1M18 C;  3WKJ D;  5E5A D;  1U35 D;  5CPK A;  5GT3 A;  4WNN A;  4DRA A;  3KWQ A;  3MNN C;  4X23 A;  1M1A B;  1HQ3 C;  3AYW A;  2NZD C;  4WJ3 C;  5B2I C;  1WWI A;  2UWX A;  3REI C;  4ZUX D;  3KSY A;  1P3B D;  3X1U A;  1ZLA D;  5CPJ D;  2NQB A;  3W97 D;  3EG5 B;  3AFA C;  4Z66 C;  4YS3 A;  3WTP B;  5FUG B;  3W99 D;  2Y2H A;  2Y2I A;  5AVB D;  3UTA D;  5B31 C;  5GSU A;  4X23 C;  2CV5 A;  5B24 D;  2PYO A;  4H9P A;  4J8U D;  1HQ3 B;  3LEL A;  2NZD B;  3C1C A;  5B2I B;  3P5J B;  3X1V A;  3NQJ B;  2NQB C;  2L5A A;  5F99 A;  5B33 C;  2Y2P A;  3B0D C;  4YS3 C;  3AFA B;  3KXB B;  3MGR B;  1JFI A;  5AY8 A;  3VH5 A;  1M1A D;  5AV6 A;  3C1B B;  5B31 B;  3AZJ D;  3REL D;  5JA4 A;  4ZBJ B;  3C1C C;  4J8W C;  3X1V C;  3WTP D;  5F99 C;  4KHA B;  3AZH D;  5BT1 D;  5B33 B;  4YM6 B;  4Z2M H;  4J8X B;  3REK C;  1BH8 A;  5AV6 C;  5GT0 B;  1HQ3 D;  3AZE B;  4WU9 A;  5B2I D;  2XD5 A;  1P3K A;  4LD9 B;  1H3O B;  3V9R A;  2F8N H;  3UT9 A;  4AWL C;  4J8W B;  3KUY A;  1TAF A;  4HGA C;  3W96 A;  3O62 B;  3KXB D;  3MGR D;  1P3M A;  4Z5T B;  5C3I B;  3X1S D;  3TU4 B;  3EPJ A;  4H9O B;  5B31 D;  3C1B D;  3UTB B;  3AZL A;  1ID3 B;  4XUJ B;  5DNN C;  3REK B;  3B0C W;  3REJ A;  4WU9 C;  5AVC B;  3AZN A;  1F66 D;  3X1T B;  2JSS A;  2BG1 A;  5B32 A;  1S32 A;  5B33 D;  3KUY C;  4YM6 D;  4J8X D;  1A7W A;  3AZK B;  3AV2 A;  5B1M B;  5AV8 C;  5JRG A;  4JJN B;  1M19 C;  3WA9 A;  5GT0 D;  1BH9 A;  3AZL C;  1AOI C;  3AZE D;  4LD9 D;  3B6G A;  5DNN B;  3REJ C;  3AZN C;  3REH C;  4J8W D;  5B32 C;  1P3A C;  3MVD A;  3O62 D;  1S32 C;  1TZY B;  4Z5T D;  3AN2 B;  3MGS C;  3AZG C;  3LZ1 B;  3TU4 D;  1ID3 D;  2YFW B;  3UTB D;  4XUJ D;  4M6B A;  3WA9 C;  5AV8 B;  3REK D;  2FJ7 B;  5CHL B;  5DNM C;  1M19 B;  1AOI B;  5AVC D;  3MGP A;  4H9N A;  3A6N B;  3B6G C;  1P34 B;  3X1T D;  2BYM B;  3AZM B;  1P3G A;  3W98 D;  3REH B;  1KX3 A;  3MVD C;  2BYK B;  1P3A B;  3AZK D;  3EPL A;  4QLC C;  4R8P A;  4E45 A;  3AZJ A;  5B1M D;  3REL A;  3MGS B;  4WU8 B;  4JJN D;  5AV9 C;  3AZG B;  1P3L A;  1N1J B;  3WAA C;  3LJA A;  3VH6 W;  2ZY4 A;  5AV5 A;  2F8N A;  5DNM B;  4KUD D;  5B2J D;  2HUE C;  4XZQ C;  3AZH A;  1P3G C;  1TZY D;  3AN2 D;  4KGC A;  2YFV B;  1KX3 C;  3LZ1 D;  3B6F A;  4R8P C;  4QLC B;  5B40 A;  1KX4 A;  2FJ7 D;  4CAY A;  1P3L C;  5AV9 B;  2ARO C;  1AOI D;  3WAA B;  3H0M C;  1P3P C;  5BNX B;  3A6N D;  5BNV B;  5CP6 C;  5B0Z B;  1P34 D;  3AZM D;  3VH6 A;  1M18 B;  3VH5 W;  3REH D;  5CPK C;  5GT3 C;  4XZQ B;  1P3A D;  1P3O A;  3KWQ C;  3X1S A;  3R45 A;  3MNN B;  1P3I A;  5B31 G;  3MGS D;  5KDM A;  3AYW C;  5B1L A;  3AZG D;  4WU8 D;  5G49 B;  3H0L C;  3REI B;  3H0R C;  1KX4 C;  1KX5 A;  2ZM5 A;  3X1U C;  1F66 A;  2ZY3 A;  1HTA A;  2ARO B;  1WWS A;  2RIQ A;  1P3P B;  5CP6 B;  4Z66 B;  5CPK B;  5CPI A;  5GSU C;  5GT3 B;  1P3O C;  4WNN B;  2CV5 C;  3KWQ B;  4QLC D;  4X23 B;  2PYO C;  3AYW B;  3LEL C;  5AV9 D;  4UUZ A;  5B0Z D;  2Y2J A;  2ZY5 A;  3X1U B;  2NQB B;  1P3F A;  1M18 D;  3LZ0 A;  2RVQ C;  4YS3 B;  3B0D B;  4XZQ D;  5AY8 C;  1Z2C B;  3MGQ A;  4J8V A;  3MNN D;  5GSU B;  2NZD D;  1EQZ A;  2IO5 C;  2CV5 B;  3REI D;  2PYO B;  4H9P B;  3LEL B;  3C1C B;  2ARO D;  1P3P D;  3W98 A;  3AFA D;  5CP6 D;  4H9R A;  4Z66 D;  3AZF A;  3X1V B;  4CSR A;  5F99 B;  1P3F C;  3LZ0 C;  3AZI A;  2LY8 A;  4EO5 C;  5GT3 D;  1JFI B;  3A1I A;  5AY8 B;  3AV1 A;  4X23 D;  5AV6 B;  5GXQ A;  3AYW D;  1EQZ C;  1P3K C;  5JA4 B;  5B0Y A;  2HIO A;  2IO5 B;  3FDD A;  3X1U D;  3WKJ A;  3B0B A;  4KUD A;  2JCH A;  5E5A A;  5B2J A;  1U35 A;  3UT9 C;  2NQB D;  2ZY2 A;  4AWL B;  4YS3 D;  3AZF C;  3W96 C;  4HGA B;  1P3M C;  3LZ0 B;  5BO0 A;  4ZUX A;  5GSU D;  1P3B A;  3AV1 C;  4EO5 B;  1ZLA A;  5CPJ A;  1BH8 B;  4H9Q A;  3W97 A;  3LEL D;  4WU9 B;  3B0C T;  3C1C D;  1P3K B;  1B6W A;  3W99 A;  3WKJ C;  3V9R B;  3X1V D;  5E5A C;  5AVB A;  1U35 C;  3UTA A;  5F99 D;  2VQR A;  3UT9 B;  5B32 G;  3KUY B;  1TAF B;  3AV2 C;  1W2E A;  3W96 B;  5B24 A;  1P3M B;  1KU5 A;  5AY8 D;  4J8U A;  5JRG C;  3NQU A;  5AV6 D;  3AZL B;  2JE5 A;  1ZLA C;  5CPJ C;  3W97 C;  3REJ B;  4WZS B;  3AZN B;  5B32 B;  5AVB C;  1M1A A;  1S32 B;  3AV2 B;  5JRG B;  5DNN D;  3WA9 B;  1BH9 B;  2Y2M A;  3MGP C;  4WU9 D;  3WTP A; 
#chains in the Genus database with same CATH homology
 3B6G B;  5FUG A;  3KUY D;  3MVD B;  1M1A C;  2DQN C;  3W96 D;  2F2A C;  3AZJ C;  4NFT A;  3REL C;  1P3M D;  1HQ3 A;  2NZD A;  5AV8 D;  5B2I A;  1M19 D;  3AZL D;  3LJA C;  4NE5 A;  3NQJ A;  5AV5 C;  3REJ D;  3MGP B;  3AFA A;  2DF4 C;  3AZN D;  4H9N B;  3KXB A;  3MGR A;  3AZH C;  1R4V A;  2HUE B;  5BT1 C;  5B32 D;  1P3G B;  2Y2G A;  1S32 D;  4KGC C;  3C1B A;  5B31 A;  2XD1 A;  1KX3 B;  3B6F C;  2Y2L A;  3AV2 D;  4R8P B;  5B40 C;  3AZJ B;  3REL B;  5JRG D;  3WA9 D;  1P3L B;  5DNM D;  3LJA B;  3B6G D;  4KHA A;  2J8P A;  5AV5 B;  2F8N B;  5B33 A;  5BS7 A;  4YM6 A;  4J8X A;  3KXB C;  3MGR C;  3VH5 T;  3AZH B;  3MVD D;  3X1S C;  3C1B C;  5GT0 A;  1P3I C;  4KGC B;  3F6T A;  3AZE A;  5B1L C;  3B6F B;  4DQY B;  4LD9 A;  4ZBJ C;  3WAA D;  1H3O A;  3IP4 C;  1KX5 C;  5B40 B;  4NE3 A;  1KX4 B;  1F66 C;  4CAY B;  4J8W A;  3MGP D;  1P3K D;  3WTP E;  3O62 A;  4Z5T A;  1P3G D;  5BS7 C;  4YM6 C;  4J8X C;  3TU4 A;  4H9O A;  3UTB A;  1ID3 A;  3KFU G;  5CPI C;  1KX3 D;  4XUJ A;  1P3O B;  3REK A;  5GT0 C;  3X1S B;  4R8P D;  3R45 B;  3AZE C;  5AVC A;  1P3I B;  5KDM B;  5B1L B;  4LD9 C;  3AL0 C;  1P3L D;  2G5I C;  3X1T A;  3LJA D;  1KX5 B;  5AV5 D;  1F66 B;  2F8N D;  3O62 C;  3AZK A;  3EPK A;  4Z5T C;  1PZR A;  5CPK D;  5C3I C;  5B1M A;  3MGQ C;  4JJN A;  4G92 C;  3TU4 C;  3KWQ D;  4J8V C;  3UTB C;  1ID3 C;  4KGC D;  4XUJ C;  5CPI B;  2Y2N A;  3B6F D;  5DNN A;  5AVC C;  2W8S A;  5B40 D;  1KX4 D;  1Q9C A;  3X1T C;  3W98 C;  4UUZ B;  1TZY A;  3AN2 A;  3LZ1 A;  1P3F B;  4H9S A;  2Y2Q A;  3AZK C;  3AZI C;  2YFW A;  5B1M C;  4JJN C;  4G91 C;  2G5H C;  5AV8 A;  3MGQ B;  1P3O D;  2FJ7 A;  2CV5 D;  4G92 B;  1M19 A;  4J8V B;  1AOI A;  1P3I D;  5GXQ C;  2PYO D;  5B1L D;  1ULY A;  3A6N A;  1EQZ B;  1P34 A;  5B0Y C;  3EPH A;  2HIO C;  3A1K A;  2BYM A;  3AZM A;  1BFM A;  2F8N K;  1KX5 D;  3REH A;  4KUD C;  5B2J C;  2BYK A;  1P3A A;  1TZY C;  3W98 B;  2RVQ D;  3AN2 C;  4H9R B;  3AZF B;  3LZ1 C;  4CSR B;  4WU8 A;  3MGS A;  4H9S C;  3AZG A;  1B67 A;  1N1J A;  3AZI B;  4ZUX C;  5CPI D;  1P3B C;  2FJ7 C;  4G91 B;  3AV1 B;  4DRB A;  5DNM A;  4E44 A;  5GXQ B;  3A6N C;  1P34 C;  3AZM C;  5B0Y B;  2HIO B;  4WV4 B;  3W99 C;  4KUD B;  3UTA C;  2YFV A;  3WKJ B;  5E5A B;  5B2J B;  1U35 B;  2Y2O A;  1P3F D;  3LZ0 D;  4QLC A;  5B24 C;  4WU8 C;  4J8U C;  3MGQ D;  5AV9 A;  4J8V D;  5BO0 B;  3WAA A;  4ZUX B;  5BNX A;  5BNV A;  5B0Z A;  1P3B B;  1EQZ D;  4UPK A;  2CWE A;  1ZLA B;  5CPJ B;  1M18 A;  1F1E A;  4H9Q B;  3W97 B;  4XZQ A;  3UT9 D;  3W99 B;  4Z2M G;  5AVB B;  3MNN A;  3UTA B;  3AZF D;  4NE6 A;  2FFF B;  3AZI D;  5G49 A;  3REI A;  2Y2K A;  5B24 B;  4J8U B;  3AV1 D;  2ARO A;  1T3U A;  3NQU B;  5GXQ D;  3VH6 T;  5B0Z C;  1P3P A;  5CP6 A;  3WTP C;  5B0Y D;  4Z66 A;  2HIO D;  2F8N G;  1M18 C;  3WKJ D;  5E5A D;  1U35 D;  5CPK A;  5GT3 A;  4WNN A;  4DRA A;  3KWQ A;  3MNN C;  4X23 A;  1M1A B;  1HQ3 C;  3AYW A;  2NZD C;  4WJ3 C;  5B2I C;  1WWI A;  2UWX A;  3REI C;  4ZUX D;  3KSY A;  1P3B D;  3X1U A;  1ZLA D;  5CPJ D;  2NQB A;  3W97 D;  3EG5 B;  3AFA C;  4Z66 C;  4YS3 A;  3WTP B;  5FUG B;  3W99 D;  2Y2H A;  2Y2I A;  5AVB D;  3UTA D;  5B31 C;  5GSU A;  4X23 C;  2CV5 A;  5B24 D;  2PYO A;  4H9P A;  4J8U D;  1HQ3 B;  3LEL A;  2NZD B;  3C1C A;  5B2I B;  3P5J B;  3X1V A;  3NQJ B;  2NQB C;  2L5A A;  5F99 A;  5B33 C;  2Y2P A;  3B0D C;  4YS3 C;  3AFA B;  3KXB B;  3MGR B;  1JFI A;  5AY8 A;  3VH5 A;  1M1A D;  5AV6 A;  3C1B B;  5B31 B;  3AZJ D;  3REL D;  5JA4 A;  4ZBJ B;  3C1C C;  4J8W C;  3X1V C;  3WTP D;  5F99 C;  4KHA B;  3AZH D;  5BT1 D;  5B33 B;  4YM6 B;  4Z2M H;  4J8X B;  3REK C;  1BH8 A;  5AV6 C;  5GT0 B;  1HQ3 D;  3AZE B;  4WU9 A;  5B2I D;  2XD5 A;  1P3K A;  4LD9 B;  1H3O B;  3V9R A;  2F8N H;  3UT9 A;  4AWL C;  4J8W B;  3KUY A;  1TAF A;  4HGA C;  3W96 A;  3O62 B;  3KXB D;  3MGR D;  1P3M A;  4Z5T B;  5C3I B;  3X1S D;  3TU4 B;  3EPJ A;  4H9O B;  5B31 D;  3C1B D;  3UTB B;  3AZL A;  1ID3 B;  4XUJ B;  5DNN C;  3REK B;  3B0C W;  3REJ A;  4WU9 C;  5AVC B;  3AZN A;  1F66 D;  3X1T B;  2JSS A;  2BG1 A;  5B32 A;  1S32 A;  5B33 D;  3KUY C;  4YM6 D;  4J8X D;  1A7W A;  3AZK B;  3AV2 A;  5B1M B;  5AV8 C;  5JRG A;  4JJN B;  1M19 C;  3WA9 A;  5GT0 D;  1BH9 A;  3AZL C;  1AOI C;  3AZE D;  4LD9 D;  3B6G A;  5DNN B;  3REJ C;  3AZN C;  3REH C;  4J8W D;  5B32 C;  1P3A C;  3MVD A;  3O62 D;  1S32 C;  1TZY B;  4Z5T D;  3AN2 B;  3MGS C;  3AZG C;  3LZ1 B;  3TU4 D;  1ID3 D;  2YFW B;  3UTB D;  4XUJ D;  4M6B A;  3WA9 C;  5AV8 B;  3REK D;  2FJ7 B;  5CHL B;  5DNM C;  1M19 B;  1AOI B;  5AVC D;  3MGP A;  4H9N A;  3A6N B;  3B6G C;  1P34 B;  3X1T D;  2BYM B;  3AZM B;  1P3G A;  3W98 D;  3REH B;  1KX3 A;  3MVD C;  2BYK B;  1P3A B;  3AZK D;  3EPL A;  4QLC C;  4R8P A;  4E45 A;  3AZJ A;  5B1M D;  3REL A;  3MGS B;  4WU8 B;  4JJN D;  5AV9 C;  3AZG B;  1P3L A;  1N1J B;  3WAA C;  3LJA A;  3VH6 W;  2ZY4 A;  5AV5 A;  2F8N A;  5DNM B;  4KUD D;  5B2J D;  2HUE C;  4XZQ C;  3AZH A;  1P3G C;  1TZY D;  3AN2 D;  4KGC A;  2YFV B;  1KX3 C;  3LZ1 D;  3B6F A;  4R8P C;  4QLC B;  5B40 A;  1KX4 A;  2FJ7 D;  4CAY A;  1P3L C;  5AV9 B;  2ARO C;  1AOI D;  3WAA B;  3H0M C;  1P3P C;  5BNX B;  3A6N D;  5BNV B;  5CP6 C;  5B0Z B;  1P34 D;  3AZM D;  3VH6 A;  1M18 B;  3VH5 W;  3REH D;  5CPK C;  5GT3 C;  4XZQ B;  1P3A D;  1P3O A;  3KWQ C;  3X1S A;  3R45 A;  3MNN B;  1P3I A;  5B31 G;  3MGS D;  5KDM A;  3AYW C;  5B1L A;  3AZG D;  4WU8 D;  5G49 B;  3H0L C;  3REI B;  3H0R C;  1KX4 C;  1KX5 A;  2ZM5 A;  3X1U C;  1F66 A;  2ZY3 A;  1HTA A;  2ARO B;  1WWS A;  2RIQ A;  1P3P B;  5CP6 B;  4Z66 B;  5CPK B;  5CPI A;  5GSU C;  5GT3 B;  1P3O C;  4WNN B;  2CV5 C;  3KWQ B;  4QLC D;  4X23 B;  2PYO C;  3AYW B;  3LEL C;  5AV9 D;  4UUZ A;  5B0Z D;  2Y2J A;  2ZY5 A;  3X1U B;  2NQB B;  1P3F A;  1M18 D;  3LZ0 A;  2RVQ C;  4YS3 B;  3B0D B;  4XZQ D;  5AY8 C;  1Z2C B;  3MGQ A;  4J8V A;  3MNN D;  5GSU B;  2NZD D;  1EQZ A;  2IO5 C;  2CV5 B;  3REI D;  2PYO B;  4H9P B;  3LEL B;  3C1C B;  2ARO D;  1P3P D;  3W98 A;  3AFA D;  5CP6 D;  4H9R A;  4Z66 D;  3AZF A;  3X1V B;  4CSR A;  5F99 B;  1P3F C;  3LZ0 C;  3AZI A;  2LY8 A;  4EO5 C;  5GT3 D;  1JFI B;  3A1I A;  5AY8 B;  3AV1 A;  4X23 D;  5AV6 B;  5GXQ A;  3AYW D;  1EQZ C;  1P3K C;  5JA4 B;  5B0Y A;  2HIO A;  2IO5 B;  3FDD A;  3X1U D;  3WKJ A;  3B0B A;  4KUD A;  2JCH A;  5E5A A;  5B2J A;  1U35 A;  3UT9 C;  2NQB D;  2ZY2 A;  4AWL B;  4YS3 D;  3AZF C;  3W96 C;  4HGA B;  1P3M C;  3LZ0 B;  5BO0 A;  4ZUX A;  5GSU D;  1P3B A;  3AV1 C;  4EO5 B;  1ZLA A;  5CPJ A;  1BH8 B;  4H9Q A;  3W97 A;  3LEL D;  4WU9 B;  3B0C T;  3C1C D;  1P3K B;  1B6W A;  3W99 A;  3WKJ C;  3V9R B;  3X1V D;  5E5A C;  5AVB A;  1U35 C;  3UTA A;  5F99 D;  2VQR A;  3UT9 B;  5B32 G;  3KUY B;  1TAF B;  3AV2 C;  1W2E A;  3W96 B;  5B24 A;  1P3M B;  1KU5 A;  5AY8 D;  4J8U A;  5JRG C;  3NQU A;  5AV6 D;  3AZL B;  2JE5 A;  1ZLA C;  5CPJ C;  3W97 C;  3REJ B;  4WZS B;  3AZN B;  5B32 B;  5AVB C;  1M1A A;  1S32 B;  3AV2 B;  5JRG B;  5DNN D;  3WA9 B;  1BH9 B;  2Y2M A;  3MGP C;  4WU9 D;  3WTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...