3VH6T

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'EPEIASSLIKQIFSHYVKTPVTRDAYKIVEKASERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLIPIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 31
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh6T00
4G91C 3B6GD 1P3IC 3X1TB 4Z5TA 3B6GB 3WAAA 5G49B 3WKJA 3B0DB 3UTBD 2HUEB 3UTBB 3AZIC 5GT0A 5DNNB 3UTAC 4Z5TC 3B0CW 3MVDD 3MVDB 3WKJC 4XUJA 4CAYB 5B1LD 5GT0C 1P3BD 5B1LB 3AN2D 3W97A 3AFAD 1P3OA 3AN2B 2CV5D 4H9NB 3AV1D 3AZHC 2PYOC 2CV5B 3W98C 5E5AA 3MGRA 1H3OA 3W97C 2F8NA 1BFMA 2FJ7A 5B2JD 3REHD 5JRGA 3X1SD 5B2JB 3REHB 3X1SB 5B0YA 2HIOD 5JRGC 3TU4B 4E45A 4LD9B 5C3IB 5AVBA 5CPKD 5CPKB 5DNMA 1ID3A 3R45A 5AVBC 2NQBA 5DNMC 5CPID 3WTPA 3LJAD 3KUYA 1A7WA 3LELC 4WU8A 4JJNB 3VH6A 4QLCD 3RELC 4QLCB 3AZMC 1HTAA 4KGCD 4WU8C 4KGCB 3AYWA 5B2IA 5B1MC 1HQ3D 5BNXB 4YS3C 1HQ3B 4ZUXC 5B32B 3WA9A 3AYWC 5B2IC 3REID 3REIB 3AZFD 3AZLA 5B31G 1ZLAC 3LZ1D 1KX3A 1P3KA 3AZLC 3AZJC 1P34B 3O62D 5DNNA 3MGPA 1KX3C 2RVQD 1P3KC 5CPJA 4CAYA 4Z66A 3X1VB 3X1UA 4ZBJB 3W99C 4H9NA 3NQJB 5JA4A 5GXQA 1AOIC 3VH5T 4Z66C 4J8VD 3X1UC 4J8VB 3MNND 5GXQC 3MNNB 5CP6B 4J8UD 1EQZB 3VH6W 4J8UB 1S32C 3B6FD 1R4VA 4AWLB 1P3ID 3AV2D 3TU4A 3B6FB 3REKA 3AV2B 2BYMB 4LD9A 3AZID 3UTAD 3REKC 3C1BC 3LZ0D 5GT3C 5B0ZC 3LZ0B 3UT9D 5AV8A 3AZKB 3UT9B 3MGSA 3AZHD 2PYOD 4JJNA 1P3FC 3W98D 4H9RB 2PYOB 4H9QB 5AV8C 3MGSC 2YFWA 2CWEA 3A6NC 3AZGC 1M18D 1JFIB 1P3GA 1M18B 1TZYD 4H9OB 5AV5A 1TZYB 5B32A 1M19D 2AROA 4UUZA 1F66B 1M19B 1P3GC 5AY8D 5AY8B 4H9PA 4J8XA 5AV5C 1P3MA 2AROC 3REJB 1P34A 4J8XC 1P3MC 2NZDC 3KWQA 1U35C 5BNVB 3LELD 5B40D 4KUDC 2IO5C 5F99D 5B40B 3AZND 3X1VA 5F99B 3RELD 3AZNB 1B6WA 3AZMD 1TAFB 3KXBC 3NQJA 1M1AD 5B31D 1M1AB 5B31B 2L5AA 4HGAC 5B1MD 4YS3D 3WAAC 4J8WA 5AVCA 4ZUXD 4WNNB 4ZUXB 5CP6A 3AZED 1EQZA 1P3BB 3AZEB 4J8WC 1ZLAD 3C1CD 4XUJC 3AFAB 5AV6D 3C1CB 5B33D 3AV1B 5AV6B 4WZSB 5B33B 2BYMA 3AZJD 5B24A 1P3OC 5GSUA 3AZJB 4DRAA 1BH9B 4YM6A 5E5AC 3MGRC 5B24C 4H9SA 4G92B 5GSUC 2HIOB 1KX4A 2FJ7C 1P3PD 4YM6C 3W99D 3AZKA 1P3PB 5B0YC 4R8PD 4H9SC 4WU9A 4H9RA 4R8PB 1KX4C 1AOID 4H9QA 2BYKA 4XZQA 5AV9A 3MGQD 3MGQB 3B0CT 4XZQC 5FUGB 1S32D 5CPIB 3LJAB 1ID3C 5AV9C 1F66A 3NQUB 2NQBC 1KX5A 4Z2MH 3WTPC 1N1JA 3KUYC 4WV4B 3REJA 1KX5C 3C1BD 5GT3D 5B0ZD 5BNVA 1P3FD 4X23D 4EO5B 3AZFB 4KHAB 4X23B 1BH8B 1P3FB 3X1TA 2F8NK 3LZ1B 3B6GA 3WA9C 5G49A 1WWIA 3UTBA 3A6ND 3AZGD 3X1TC 3AZGB 3O62B 2JSSA 3B6GC 1P3AD 3MVDA 3B0DC 1P3AB 3B0BA 2HUEC 1Q9CA 5DNNC 3MGPC 5B1LA 1P3BA 3MVDC 3AN2A 3AFAA 5CPJC 2CV5A 3AV1A 5B1LC 3W96D 1P3LD 3AN2C 3W96B 1P3LB 2NZDD 2CV5C 1BH9A 1U35D 5B2JA 3REHA 3X1SA 4KUDD 2HIOA 4G91B 1P3IB 3KXBD 4Z2MG 3X1SC 5CPKA 3AZIB 4Z5TD 3TU4C 3WAAD 3UTAB 4Z5TB 3WKJD 3WKJB 4LD9C 5C3IC 5GT0D 5CPKC 5GT0B 5CPIA 4XUJD 3LJAA 3AZHB 3NQUA 3W98B 1WWSA 4QLCA 3W97D 1P3OD 3W97B 1P3OB 4JJNC 4KGCA 5E5AD 3MGRD 5KDMB 5BNXA 4QLCC 2F8ND 1HQ3A 2FJ7D 4KGCC 5JRGD 3VH6T 5JRGB 5B0YD 3REIA 1HQ3C 3AZFA 4KHAA 4NE3A 5B32C 3LZ1A 5BT1C 4CSRB 2F8NH 3REIC 4NE6A 5AVBD 5AVBB 5DNMD 5DNMB 1P34C 1ID3D 3LELB 2NQBD 3R45B 3KWQC 3KSYA 3WTPD 3RELB 3AZMB 3KUYD 4WU8D 4WU8B 1F1EA 3X1VC 5B1MB 4ZBJC 4J8VA 4YS3B 1ULYA 3MNNA 3AYWD 5B2ID 3AYWB 5B2IB 4J8UA 4J8VC 5AVCC 1ZLAB 4E44A 3WA9D 3MNNC 1P3IA 3B6FA 5CP6C 3AV2A 1EQZC 4J8UC 3AZLD 3AZLB 1KX3D 3AZIA 3B6FC 1KX3B 5BS7A 3UTAA 1P3KD 3AV2C 1P3KB 3VH5A 5DNND 3MGPD 5BS7C 3LZ0A 3MGPB 3UT9A 5CPJD 3W99B 4DRBA 3AZHA 5CPJB 2PYOA 4Z66D 1AOIB 3W98A 4Z66B 3LZ0C 3X1UD 2F8NG 3AZKC 3UT9C 3X1UB 5GXQD 4WU9C 1JFIA 5GXQB 5JA4B 1M18A 5KDMA 4H9OA 1TZYA 1S32B 1M19A 1M18C 2LY8A 5AY8A 1TZYC 3TU4D 4CSRA 3REKD 1M19C 1F66C 3REKB 3V9RB 5AY8C 4LD9D 3C1BB 3REJC 5GT3B 5B0ZB 5CHLB 3LELA 5B40A 5F99A 3WTPE 3AZNA 1TAFA 5AV8D 3RELA 3MGSD 3AZMA 5AV8B 4JJND 3MGSB 1M1AA 5B31A 5B40C 3A6NB 3VH5W 5F99C 3AZNC 5B1MA 4YS3A 4WNNA 4ZUXA 1B67A 3UTBC 1M1AC 5B31C 2YFWB 1P3GD 3AZEA 1P3GB 1ZLAA 5AV5D 3C1CA 5B32D 5AV5B 2AROD 5AV6A 5BT1D 5B33A 2AROB 4UUZB 1P3BC 3AZEC 4J8XD 3AZJA 1P3MD 3AFAC 2YFVB 4H9PB 3C1CC 4J8XB 1P3MB 3AV1C 5AV6C 2NZDB 5B33C 1U35B 1P34D 4NFTA 3KWQD 5BO0B 2IO5B 4KUDB 3KWQB 5B2JC 3REHC 1P3PA 3W99A 3KXBB 4G92C 4R8PA 2HIOC 1AOIA 3X1VD 4HGAB 1P3PC 1KU5A 3WAAB 4R8PC 3MGQA 4J8WD 5FUGA 5AVCD 4J8WB 5AVCB 1S32A 4XUJB 5CP6D 3MGQC 1EQZD 4NE5A 5CPIC 3LJAC 3V9RA 5E5AB 3MGRB 5B24D 5GSUD 1H3OB 5B24B 2F8NB 3C1BA 5GSUB 2FJ7B 4YM6D 5GT3A 5B0ZA 4YM6B 5B0YB 1KX4D 1P3FA 4X23A 1BH8A 1KX4B 3AZKD 4WU9D 4EO5C 3AZFC 4X23C 4WU9B 3A6NA 3LZ1C 4XZQD 3O62A 3AZGA 2BYKB 4XZQB 1P3AA 4M6BA 5B32G 5AV9D 1ID3B 5AV9B 3O62C 2NQBB 2RVQC 1P3AC 3WTPB 3KUYB 1F66D 1KX5D 1KX5B 3W96A 1P3LA 2YFVA 2NZDA 1N1JB 3REJD 1U35A 3W96C 1P3LC 4KUDA 5BO0A 3WA9B 3KXBA 4AWLC 3X1TD
chains in the Genus database with same CATH superfamily
4G91C 3B6GD 1P3IC 3X1TB 4Z5TA 3B6GB 3WAAA 5G49B 3WKJA 3B0DB 3UTBD 2HUEB 3UTBB 3AZIC 5GT0A 3FDDA 5DNNB 3UTAC 4Z5TC 3B0CW 3MVDD 3MVDB 3WKJC 4XUJA 4CAYB 5B1LD 5GT0C 1P3BD 5B1LB 3AN2D 3W97A 3AFAD 1P3OA 3AN2B 2CV5D 4H9NB 3AV1D 3AZHC 2PYOC 2CV5B 3W98C 5E5AA 3MGRA 1H3OA 3W97C 2F8NA 1BFMA 2FJ7A 5B2JD 3REHD 5JRGA 3X1SD 5B2JB 3REHB 3X1SB 5B0YA 2HIOD 5JRGC 3TU4B 4E45A 4LD9B 5C3IB 5AVBA 5CPKD 5CPKB 5DNMA 1ID3A 3R45A 5AVBC 2NQBA 5DNMC 5CPID 3WTPA 3LJAD 3KUYA 1A7WA 3LELC 4WU8A 4JJNB 3VH6A 4QLCD 3RELC 4QLCB 3AZMC 1HTAA 4KGCD 4WU8C 2UWXA 4KGCB 3AYWA 5B2IA 3EG5B 5B1MC 1HQ3D 5BNXB 4YS3C 1HQ3B 4ZUXC 5B32B 3WA9A 3AYWC 5B2IC 3REID 3REIB 3AZFD 3AZLA 5B31G 1ZLAC 3LZ1D 3A1IA 1KX3A 1P3KA 2JCHA 3AZLC 3AZJC 1P34B 3O62D 5DNNA 3MGPA 1KX3C 2RVQD 1P3KC 5CPJA 4CAYA 4Z66A 2ZM5A 3X1VB 3X1UA 4ZBJB 3W99C 4H9NA 3NQJB 5JA4A 5GXQA 1AOIC 3VH5T 4Z66C 4J8VD 3X1UC 4J8VB 3MNND 5GXQC 3MNNB 5CP6B 4J8UD 1EQZB 3VH6W 3KFUG 4J8UB 1S32C 3B6FD 1R4VA 4AWLB 1P3ID 3AV2D 3TU4A 3B6FB 2Y2JA 3REKA 3AV2B 2Y2LA 2BYMB 3EPJA 4LD9A 2Y2HA 3AZID 3UTAD 3REKC 3C1BC 3LZ0D 5GT3C 5B0ZC 3LZ0B 3UT9D 5AV8A 3AZKB 3UT9B 3MGSA 3AZHD 2PYOD 1W2EA 4JJNA 1P3FC 3W98D 4H9RB 2PYOB 4H9QB 5AV8C 3MGSC 2YFWA 2CWEA 3A6NC 3AZGC 1M18D 1JFIB 1P3GA 1M18B 1TZYD 4H9OB 5AV5A 1TZYB 5B32A 1M19D 2AROA 4UUZA 1F66B 1M19B 1P3GC 5AY8D 5AY8B 4H9PA 4J8XA 5AV5C 1P3MA 2AROC 3REJB 1P34A 4J8XC 1P3MC 2NZDC 3KWQA 2VQRA 1U35C 5BNVB 3LELD 5B40D 4KUDC 2IO5C 5F99D 5B40B 3AZND 3X1VA 5F99B 3RELD 3AZNB 1B6WA 3AZMD 1TAFB 3KXBC 3NQJA 2FFFB 1M1AD 5B31D 1M1AB 5B31B 2L5AA 4HGAC 5B1MD 4YS3D 3WAAC 4J8WA 5AVCA 4ZUXD 4WNNB 4ZUXB 5CP6A 3AZED 1EQZA 1P3BB 3AZEB 4J8WC 1ZLAD 3C1CD 3A1KA 4XUJC 3AFAB 5AV6D 3C1CB 5B33D 3AV1B 5AV6B 4WZSB 5B33B 2BYMA 3H0MC 3AZJD 5B24A 1P3OC 5GSUA 3AZJB 4DRAA 1BH9B 4YM6A 5E5AC 3MGRC 3P5JB 5B24C 4H9SA 4G92B 5GSUC 2HIOB 1KX4A 2FJ7C 1P3PD 4YM6C 3W99D 3AZKA 1P3PB 5B0YC 4R8PD 4H9SC 4WU9A 4H9RA 4R8PB 3H0RC 1KX4C 1AOID 4H9QA 2BYKA 4XZQA 5AV9A 3MGQD 2DQNC 3MGQB 3B0CT 4XZQC 4DQYB 5FUGB 1S32D 5CPIB 3EPKA 3LJAB 1ID3C 5AV9C 1F66A 3NQUB 2NQBC 1KX5A 4Z2MH 3WTPC 1N1JA 3KUYC 4WV4B 3REJA 1KX5C 3C1BD 3AL0C 5GT3D 5B0ZD 5BNVA 1P3FD 4X23D 4EO5B 3AZFB 4KHAB 4X23B 1BH8B 1P3FB 3X1TA 2F8NK 3LZ1B 3B6GA 3WA9C 5G49A 2F2AC 2W8SA 1WWIA 3UTBA 3A6ND 3AZGD 3X1TC 3AZGB 3O62B 2JSSA 3B6GC 1P3AD 3MVDA 3B0DC 1P3AB 3B0BA 2HUEC 1Q9CA 5DNNC 3MGPC 5B1LA 1P3BA 3MVDC 3AN2A 3AFAA 5CPJC 2CV5A 3AV1A 5B1LC 2J8PA 3W96D 1P3LD 3AN2C 3W96B 1P3LB 2NZDD 2CV5C 1BH9A 1U35D 5B2JA 3REHA 3X1SA 4KUDD 2HIOA 4G91B 1P3IB 3KXBD 4Z2MG 3X1SC 2JE5A 5CPKA 3AZIB 4Z5TD 3TU4C 3WAAD 3UTAB 4Z5TB 3WKJD 3WKJB 4LD9C 5C3IC 5GT0D 5CPKC 5GT0B 2Y2PA 5CPIA 2ZY4A 4XUJD 3LJAA 3AZHB 3NQUA 3W98B 1WWSA 4QLCA 3W97D 1P3OD 3W97B 1P3OB 4JJNC 4KGCA 5E5AD 3MGRD 5KDMB 5BNXA 4QLCC 2F8ND 1HQ3A 1PZRA 2FJ7D 4KGCC 5JRGD 3VH6T 5JRGB 5B0YD 3REIA 1HQ3C 3AZFA 4KHAA 4NE3A 5B32C 3LZ1A 5BT1C 4CSRB 2F8NH 3REIC 4NE6A 5AVBD 3EPLA 2Y2NA 5AVBB 5DNMD 5DNMB 1P34C 1ID3D 3LELB 2NQBD 3R45B 3KWQC 3KSYA 3WTPD 3RELB 3AZMB 3KUYD 4WU8D 4WU8B 1F1EA 3X1VC 5B1MB 4ZBJC 4J8VA 4YS3B 1ULYA 3MNNA 3AYWD 5B2ID 2BG1A 3AYWB 5B2IB 4J8UA 2Y2OA 4J8VC 5AVCC 1ZLAB 4E44A 3WA9D 3MNNC 1P3IA 3B6FA 5CP6C 3AV2A 1EQZC 4J8UC 3AZLD 3AZLB 1KX3D 3AZIA 2Y2KA 3B6FC 1KX3B 5BS7A 3UTAA 1P3KD 3AV2C 1P3KB 3VH5A 3IP4C 5DNND 3MGPD 5BS7C 3LZ0A 3MGPB 3UT9A 5CPJD 3W99B 4DRBA 3AZHA 5CPJB 2PYOA 3H0LC 4Z66D 1AOIB 3W98A 4Z66B 3LZ0C 3X1UD 2F8NG 3AZKC 3UT9C 3X1UB 5GXQD 4WU9C 1JFIA 5GXQB 5JA4B 1M18A 5KDMA 4WJ3C 4H9OA 1TZYA 1S32B 2Y2GA 2DF4C 1M19A 1M18C 2Y2IA 2LY8A 5AY8A 2ZY3A 1TZYC 3TU4D 4CSRA 3REKD 1M19C 1F66C 3REKB 3V9RB 5AY8C 4LD9D 3C1BB 3REJC 5GT3B 5B0ZB 5CHLB 3LELA 5B40A 5F99A 3WTPE 3AZNA 1TAFA 5AV8D 3RELA 3MGSD 3AZMA 5AV8B 4JJND 3MGSB 1M1AA 5B31A 4UPKA 5B40C 3A6NB 3EPHA 3VH5W 5F99C 3AZNC 5B1MA 4YS3A 1Z2CB 4WNNA 1T3UA 4ZUXA 1B67A 2XD5A 3UTBC 1M1AC 5B31C 2YFWB 1P3GD 3AZEA 1P3GB 1ZLAA 5AV5D 3C1CA 5B32D 5AV5B 2AROD 5AV6A 5BT1D 5B33A 2AROB 4UUZB 1P3BC 3AZEC 4J8XD 3AZJA 1P3MD 3AFAC 2YFVB 4H9PB 3C1CC 4J8XB 1P3MB 3AV1C 5AV6C 2NZDB 5B33C 1U35B 1P34D 4NFTA 3KWQD 5BO0B 2IO5B 4KUDB 3KWQB 5B2JC 3REHC 1P3PA 3W99A 3KXBB 4G92C 4R8PA 2HIOC 1AOIA 3X1VD 4HGAB 1P3PC 1KU5A 3WAAB 4R8PC 3MGQA 2RIQA 2ZY5A 5FUGA 4J8WD 5AVCD 4J8WB 5AVCB 3F6TA 1S32A 4XUJB 5CP6D 3MGQC 1EQZD 4NE5A 2XD1A 5CPIC 3LJAC 3V9RA 5E5AB 3MGRB 5B24D 5GSUD 1H3OB 5B24B 2F8NB 3C1BA 5GSUB 2Y2QA 2FJ7B 4YM6D 5GT3A 5B0ZA 4YM6B 5B0YB 1KX4D 1P3FA 4X23A 1BH8A 1KX4B 3AZKD 2Y2MA 4WU9D 4EO5C 3AZFC 4X23C 4WU9B 3A6NA 3LZ1C 4XZQD 3O62A 3AZGA 2BYKB 4XZQB 1P3AA 4M6BA 5B32G 5AV9D 1ID3B 5AV9B 3O62C 2NQBB 2RVQC 1P3AC 3WTPB 2G5IC 3KUYB 1F66D 1KX5D 1KX5B 2G5HC 3W96A 1P3LA 2YFVA 2NZDA 1N1JB 3REJD 1U35A 3W96C 1P3LC 4KUDA 5BO0A 3WA9B 3KXBA 2ZY2A 4AWLC 3X1TD
chains in the Genus database with same CATH topology
4G91C 3B6GD 1P3IC 3X1TB 4Z5TA 3B6GB 3WAAA 5G49B 3WKJA 3B0DB 3UTBD 2HUEB 3UTBB 3AZIC 5GT0A 3FDDA 5DNNB 3UTAC 4Z5TC 3B0CW 3MVDD 3MVDB 3WKJC 4XUJA 4CAYB 5B1LD 5GT0C 1P3BD 5B1LB 3AN2D 3W97A 3AFAD 1P3OA 3AN2B 2CV5D 4H9NB 3AV1D 3AZHC 2PYOC 2CV5B 3W98C 5E5AA 3MGRA 1H3OA 3W97C 2F8NA 1BFMA 2FJ7A 5B2JD 3REHD 5JRGA 3X1SD 5B2JB 3REHB 3X1SB 5B0YA 2HIOD 5JRGC 3TU4B 4E45A 4LD9B 5C3IB 5AVBA 5CPKD 5CPKB 5DNMA 1ID3A 3R45A 5AVBC 2NQBA 5DNMC 5CPID 3WTPA 3LJAD 3KUYA 1A7WA 3LELC 4WU8A 4JJNB 3VH6A 4QLCD 3RELC 4QLCB 3AZMC 1HTAA 4KGCD 4WU8C 2UWXA 4KGCB 3AYWA 5B2IA 3EG5B 5B1MC 1HQ3D 5BNXB 4YS3C 1HQ3B 4ZUXC 5B32B 3WA9A 3AYWC 5B2IC 3REID 3REIB 3AZFD 3AZLA 5B31G 1ZLAC 3LZ1D 3A1IA 1KX3A 1P3KA 2JCHA 3AZLC 3AZJC 1P34B 3O62D 5DNNA 3MGPA 1KX3C 2RVQD 1P3KC 5CPJA 4CAYA 4Z66A 2ZM5A 3X1VB 3X1UA 4ZBJB 3W99C 4H9NA 3NQJB 5JA4A 5GXQA 1AOIC 3VH5T 4Z66C 4J8VD 3X1UC 4J8VB 3MNND 5GXQC 3MNNB 5CP6B 4J8UD 1EQZB 3VH6W 3KFUG 4J8UB 1S32C 3B6FD 1R4VA 4AWLB 1P3ID 3AV2D 3TU4A 3B6FB 2Y2JA 3REKA 3AV2B 2Y2LA 2BYMB 3EPJA 4LD9A 2Y2HA 3AZID 3UTAD 3REKC 3C1BC 3LZ0D 5GT3C 5B0ZC 3LZ0B 3UT9D 5AV8A 3AZKB 3UT9B 3MGSA 3AZHD 2PYOD 1W2EA 4JJNA 1P3FC 3W98D 4H9RB 2PYOB 4H9QB 5AV8C 3MGSC 2YFWA 2CWEA 3A6NC 3AZGC 1M18D 1JFIB 1P3GA 1M18B 1TZYD 4H9OB 5AV5A 1TZYB 5B32A 1M19D 2AROA 4UUZA 1F66B 1M19B 1P3GC 5AY8D 5AY8B 4H9PA 4J8XA 5AV5C 1P3MA 2AROC 3REJB 1P34A 4J8XC 1P3MC 2NZDC 3KWQA 2VQRA 1U35C 5BNVB 3LELD 5B40D 4KUDC 2IO5C 5F99D 5B40B 3AZND 3X1VA 5F99B 3RELD 3AZNB 1B6WA 3AZMD 1TAFB 3KXBC 3NQJA 2FFFB 1M1AD 5B31D 1M1AB 5B31B 2L5AA 4HGAC 5B1MD 4YS3D 3WAAC 4J8WA 5AVCA 4ZUXD 4WNNB 4ZUXB 5CP6A 3AZED 1EQZA 1P3BB 3AZEB 4J8WC 1ZLAD 3C1CD 3A1KA 4XUJC 3AFAB 5AV6D 3C1CB 5B33D 3AV1B 5AV6B 4WZSB 5B33B 2BYMA 3H0MC 3AZJD 5B24A 1P3OC 5GSUA 3AZJB 4DRAA 1BH9B 4YM6A 5E5AC 3MGRC 3P5JB 5B24C 4H9SA 4G92B 5GSUC 2HIOB 1KX4A 2FJ7C 1P3PD 4YM6C 3W99D 3AZKA 1P3PB 5B0YC 4R8PD 4H9SC 4WU9A 4H9RA 4R8PB 3H0RC 1KX4C 1AOID 4H9QA 2BYKA 4XZQA 5AV9A 3MGQD 2DQNC 3MGQB 3B0CT 4XZQC 4DQYB 5FUGB 1S32D 5CPIB 3EPKA 3LJAB 1ID3C 5AV9C 1F66A 3NQUB 2NQBC 1KX5A 4Z2MH 3WTPC 1N1JA 3KUYC 4WV4B 3REJA 1KX5C 3C1BD 3AL0C 5GT3D 5B0ZD 5BNVA 1P3FD 4X23D 4EO5B 3AZFB 4KHAB 4X23B 1BH8B 1P3FB 3X1TA 2F8NK 3LZ1B 3B6GA 3WA9C 5G49A 2F2AC 2W8SA 1WWIA 3UTBA 3A6ND 3AZGD 3X1TC 3AZGB 3O62B 2JSSA 3B6GC 1P3AD 3MVDA 3B0DC 1P3AB 3B0BA 2HUEC 1Q9CA 5DNNC 3MGPC 5B1LA 1P3BA 3MVDC 3AN2A 3AFAA 5CPJC 2CV5A 3AV1A 5B1LC 2J8PA 3W96D 1P3LD 3AN2C 3W96B 1P3LB 2NZDD 2CV5C 1BH9A 1U35D 5B2JA 3REHA 3X1SA 4KUDD 2HIOA 4G91B 1P3IB 3KXBD 4Z2MG 3X1SC 2JE5A 5CPKA 3AZIB 4Z5TD 3TU4C 3WAAD 3UTAB 4Z5TB 3WKJD 3WKJB 4LD9C 5C3IC 5GT0D 5CPKC 5GT0B 2Y2PA 5CPIA 2ZY4A 4XUJD 3LJAA 3AZHB 3NQUA 3W98B 1WWSA 4QLCA 3W97D 1P3OD 3W97B 1P3OB 4JJNC 4KGCA 5E5AD 3MGRD 5KDMB 5BNXA 4QLCC 2F8ND 1HQ3A 1PZRA 2FJ7D 4KGCC 5JRGD 3VH6T 5JRGB 5B0YD 3REIA 1HQ3C 3AZFA 4KHAA 4NE3A 5B32C 3LZ1A 5BT1C 4CSRB 2F8NH 3REIC 4NE6A 5AVBD 3EPLA 2Y2NA 5AVBB 5DNMD 5DNMB 1P34C 1ID3D 3LELB 2NQBD 3R45B 3KWQC 3KSYA 3WTPD 3RELB 3AZMB 3KUYD 4WU8D 4WU8B 1F1EA 3X1VC 5B1MB 4ZBJC 4J8VA 4YS3B 1ULYA 3MNNA 3AYWD 5B2ID 2BG1A 3AYWB 5B2IB 4J8UA 2Y2OA 4J8VC 5AVCC 1ZLAB 4E44A 3WA9D 3MNNC 1P3IA 3B6FA 5CP6C 3AV2A 1EQZC 4J8UC 3AZLD 3AZLB 1KX3D 3AZIA 2Y2KA 3B6FC 1KX3B 5BS7A 3UTAA 1P3KD 3AV2C 1P3KB 3VH5A 3IP4C 5DNND 3MGPD 5BS7C 3LZ0A 3MGPB 3UT9A 5CPJD 3W99B 4DRBA 3AZHA 5CPJB 2PYOA 3H0LC 4Z66D 1AOIB 3W98A 4Z66B 3LZ0C 3X1UD 2F8NG 3AZKC 3UT9C 3X1UB 5GXQD 4WU9C 1JFIA 5GXQB 5JA4B 1M18A 5KDMA 4WJ3C 4H9OA 1TZYA 1S32B 2Y2GA 2DF4C 1M19A 1M18C 2Y2IA 2LY8A 5AY8A 2ZY3A 1TZYC 3TU4D 4CSRA 3REKD 1M19C 1F66C 3REKB 3V9RB 5AY8C 4LD9D 3C1BB 3REJC 5GT3B 5B0ZB 5CHLB 3LELA 5B40A 5F99A 3WTPE 3AZNA 1TAFA 5AV8D 3RELA 3MGSD 3AZMA 5AV8B 4JJND 3MGSB 1M1AA 5B31A 4UPKA 5B40C 3A6NB 3EPHA 3VH5W 5F99C 3AZNC 5B1MA 4YS3A 1Z2CB 4WNNA 1T3UA 4ZUXA 1B67A 2XD5A 3UTBC 1M1AC 5B31C 2YFWB 1P3GD 3AZEA 1P3GB 1ZLAA 5AV5D 3C1CA 5B32D 5AV5B 2AROD 5AV6A 5BT1D 5B33A 2AROB 4UUZB 1P3BC 3AZEC 4J8XD 3AZJA 1P3MD 3AFAC 2YFVB 4H9PB 3C1CC 4J8XB 1P3MB 3AV1C 5AV6C 2NZDB 5B33C 1U35B 1P34D 4NFTA 3KWQD 5BO0B 2IO5B 4KUDB 3KWQB 5B2JC 3REHC 1P3PA 3W99A 3KXBB 4G92C 4R8PA 2HIOC 1AOIA 3X1VD 4HGAB 1P3PC 1KU5A 3WAAB 4R8PC 3MGQA 2RIQA 2ZY5A 5FUGA 4J8WD 5AVCD 4J8WB 5AVCB 3F6TA 1S32A 4XUJB 5CP6D 3MGQC 1EQZD 4NE5A 2XD1A 5CPIC 3LJAC 3V9RA 5E5AB 3MGRB 5B24D 5GSUD 1H3OB 5B24B 2F8NB 3C1BA 5GSUB 2Y2QA 2FJ7B 4YM6D 5GT3A 5B0ZA 4YM6B 5B0YB 1KX4D 1P3FA 4X23A 1BH8A 1KX4B 3AZKD 2Y2MA 4WU9D 4EO5C 3AZFC 4X23C 4WU9B 3A6NA 3LZ1C 4XZQD 3O62A 3AZGA 2BYKB 4XZQB 1P3AA 4M6BA 5B32G 5AV9D 1ID3B 5AV9B 3O62C 2NQBB 2RVQC 1P3AC 3WTPB 2G5IC 3KUYB 1F66D 1KX5D 1KX5B 2G5HC 3W96A 1P3LA 2YFVA 2NZDA 1N1JB 3REJD 1U35A 3W96C 1P3LC 4KUDA 5BO0A 3WA9B 3KXBA 2ZY2A 4AWLC 3X1TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G91 C;  3B6G D;  1P3I C;  3X1T B;  4Z5T A;  3B6G B;  3WAA A;  5G49 B;  3WKJ A;  3B0D B;  3UTB D;  2HUE B;  3UTB B;  3AZI C;  5GT0 A;  5DNN B;  3UTA C;  4Z5T C;  3B0C W;  3MVD D;  3MVD B;  3WKJ C;  4XUJ A;  4CAY B;  5B1L D;  5GT0 C;  1P3B D;  5B1L B;  3AN2 D;  3W97 A;  3AFA D;  1P3O A;  3AN2 B;  2CV5 D;  4H9N B;  3AV1 D;  3AZH C;  2PYO C;  2CV5 B;  3W98 C;  5E5A A;  3MGR A;  1H3O A;  3W97 C;  2F8N A;  1BFM A;  2FJ7 A;  5B2J D;  3REH D;  5JRG A;  3X1S D;  5B2J B;  3REH B;  3X1S B;  5B0Y A;  2HIO D;  5JRG C;  3TU4 B;  4E45 A;  4LD9 B;  5C3I B;  5AVB A;  5CPK D;  5CPK B;  5DNM A;  1ID3 A;  3R45 A;  5AVB C;  2NQB A;  5DNM C;  5CPI D;  3WTP A;  3LJA D;  3KUY A;  1A7W A;  3LEL C;  4WU8 A;  4JJN B;  3VH6 A;  4QLC D;  3REL C;  4QLC B;  3AZM C;  1HTA A;  4KGC D;  4WU8 C;  4KGC B;  3AYW A;  5B2I A;  5B1M C;  1HQ3 D;  5BNX B;  4YS3 C;  1HQ3 B;  4ZUX C;  5B32 B;  3WA9 A;  3AYW C;  5B2I C;  3REI D;  3REI B;  3AZF D;  3AZL A;  5B31 G;  1ZLA C;  3LZ1 D;  1KX3 A;  1P3K A;  3AZL C;  3AZJ C;  1P34 B;  3O62 D;  5DNN A;  3MGP A;  1KX3 C;  2RVQ D;  1P3K C;  5CPJ A;  4CAY A;  4Z66 A;  3X1V B;  3X1U A;  4ZBJ B;  3W99 C;  4H9N A;  3NQJ B;  5JA4 A;  5GXQ A;  1AOI C;  3VH5 T;  4Z66 C;  4J8V D;  3X1U C;  4J8V B;  3MNN D;  5GXQ C;  3MNN B;  5CP6 B;  4J8U D;  1EQZ B;  3VH6 W;  4J8U B;  1S32 C;  3B6F D;  1R4V A;  4AWL B;  1P3I D;  3AV2 D;  3TU4 A;  3B6F B;  3REK A;  3AV2 B;  2BYM B;  4LD9 A;  3AZI D;  3UTA D;  3REK C;  3C1B C;  3LZ0 D;  5GT3 C;  5B0Z C;  3LZ0 B;  3UT9 D;  5AV8 A;  3AZK B;  3UT9 B;  3MGS A;  3AZH D;  2PYO D;  4JJN A;  1P3F C;  3W98 D;  4H9R B;  2PYO B;  4H9Q B;  5AV8 C;  3MGS C;  2YFW A;  2CWE A;  3A6N C;  3AZG C;  1M18 D;  1JFI B;  1P3G A;  1M18 B;  1TZY D;  4H9O B;  5AV5 A;  1TZY B;  5B32 A;  1M19 D;  2ARO A;  4UUZ A;  1F66 B;  1M19 B;  1P3G C;  5AY8 D;  5AY8 B;  4H9P A;  4J8X A;  5AV5 C;  1P3M A;  2ARO C;  3REJ B;  1P34 A;  4J8X C;  1P3M C;  2NZD C;  3KWQ A;  1U35 C;  5BNV B;  3LEL D;  5B40 D;  4KUD C;  2IO5 C;  5F99 D;  5B40 B;  3AZN D;  3X1V A;  5F99 B;  3REL D;  3AZN B;  1B6W A;  3AZM D;  1TAF B;  3KXB C;  3NQJ A;  1M1A D;  5B31 D;  1M1A B;  5B31 B;  2L5A A;  4HGA C;  5B1M D;  4YS3 D;  3WAA C;  4J8W A;  5AVC A;  4ZUX D;  4WNN B;  4ZUX B;  5CP6 A;  3AZE D;  1EQZ A;  1P3B B;  3AZE B;  4J8W C;  1ZLA D;  3C1C D;  4XUJ C;  3AFA B;  5AV6 D;  3C1C B;  5B33 D;  3AV1 B;  5AV6 B;  4WZS B;  5B33 B;  2BYM A;  3AZJ D;  5B24 A;  1P3O C;  5GSU A;  3AZJ B;  4DRA A;  1BH9 B;  4YM6 A;  5E5A C;  3MGR C;  5B24 C;  4H9S A;  4G92 B;  5GSU C;  2HIO B;  1KX4 A;  2FJ7 C;  1P3P D;  4YM6 C;  3W99 D;  3AZK A;  1P3P B;  5B0Y C;  4R8P D;  4H9S C;  4WU9 A;  4H9R A;  4R8P B;  1KX4 C;  1AOI D;  4H9Q A;  2BYK A;  4XZQ A;  5AV9 A;  3MGQ D;  3MGQ B;  3B0C T;  4XZQ C;  5FUG B;  1S32 D;  5CPI B;  3LJA B;  1ID3 C;  5AV9 C;  1F66 A;  3NQU B;  2NQB C;  1KX5 A;  4Z2M H;  3WTP C;  1N1J A;  3KUY C;  4WV4 B;  3REJ A;  1KX5 C;  3C1B D;  5GT3 D;  5B0Z D;  5BNV A;  1P3F D;  4X23 D;  4EO5 B;  3AZF B;  4KHA B;  4X23 B;  1BH8 B;  1P3F B;  3X1T A;  2F8N K;  3LZ1 B;  3B6G A;  3WA9 C;  5G49 A;  1WWI A;  3UTB A;  3A6N D;  3AZG D;  3X1T C;  3AZG B;  3O62 B;  2JSS A;  3B6G C;  1P3A D;  3MVD A;  3B0D C;  1P3A B;  3B0B A;  2HUE C;  1Q9C A;  5DNN C;  3MGP C;  5B1L A;  1P3B A;  3MVD C;  3AN2 A;  3AFA A;  5CPJ C;  2CV5 A;  3AV1 A;  5B1L C;  3W96 D;  1P3L D;  3AN2 C;  3W96 B;  1P3L B;  2NZD D;  2CV5 C;  1BH9 A;  1U35 D;  5B2J A;  3REH A;  3X1S A;  4KUD D;  2HIO A;  4G91 B;  1P3I B;  3KXB D;  4Z2M G;  3X1S C;  5CPK A;  3AZI B;  4Z5T D;  3TU4 C;  3WAA D;  3UTA B;  4Z5T B;  3WKJ D;  3WKJ B;  4LD9 C;  5C3I C;  5GT0 D;  5CPK C;  5GT0 B;  5CPI A;  4XUJ D;  3LJA A;  3AZH B;  3NQU A;  3W98 B;  1WWS A;  4QLC A;  3W97 D;  1P3O D;  3W97 B;  1P3O B;  4JJN C;  4KGC A;  5E5A D;  3MGR D;  5KDM B;  5BNX A;  4QLC C;  2F8N D;  1HQ3 A;  2FJ7 D;  4KGC C;  5JRG D;  3VH6 T;  5JRG B;  5B0Y D;  3REI A;  1HQ3 C;  3AZF A;  4KHA A;  4NE3 A;  5B32 C;  3LZ1 A;  5BT1 C;  4CSR B;  2F8N H;  3REI C;  4NE6 A;  5AVB D;  5AVB B;  5DNM D;  5DNM B;  1P34 C;  1ID3 D;  3LEL B;  2NQB D;  3R45 B;  3KWQ C;  3KSY A;  3WTP D;  3REL B;  3AZM B;  3KUY D;  4WU8 D;  4WU8 B;  1F1E A;  3X1V C;  5B1M B;  4ZBJ C;  4J8V A;  4YS3 B;  1ULY A;  3MNN A;  3AYW D;  5B2I D;  3AYW B;  5B2I B;  4J8U A;  4J8V C;  5AVC C;  1ZLA B;  4E44 A;  3WA9 D;  3MNN C;  1P3I A;  3B6F A;  5CP6 C;  3AV2 A;  1EQZ C;  4J8U C;  3AZL D;  3AZL B;  1KX3 D;  3AZI A;  3B6F C;  1KX3 B;  5BS7 A;  3UTA A;  1P3K D;  3AV2 C;  1P3K B;  3VH5 A;  5DNN D;  3MGP D;  5BS7 C;  3LZ0 A;  3MGP B;  3UT9 A;  5CPJ D;  3W99 B;  4DRB A;  3AZH A;  5CPJ B;  2PYO A;  4Z66 D;  1AOI B;  3W98 A;  4Z66 B;  3LZ0 C;  3X1U D;  2F8N G;  3AZK C;  3UT9 C;  3X1U B;  5GXQ D;  4WU9 C;  1JFI A;  5GXQ B;  5JA4 B;  1M18 A;  5KDM A;  4H9O A;  1TZY A;  1S32 B;  1M19 A;  1M18 C;  2LY8 A;  5AY8 A;  1TZY C;  3TU4 D;  4CSR A;  3REK D;  1M19 C;  1F66 C;  3REK B;  3V9R B;  5AY8 C;  4LD9 D;  3C1B B;  3REJ C;  5GT3 B;  5B0Z B;  5CHL B;  3LEL A;  5B40 A;  5F99 A;  3WTP E;  3AZN A;  1TAF A;  5AV8 D;  3REL A;  3MGS D;  3AZM A;  5AV8 B;  4JJN D;  3MGS B;  1M1A A;  5B31 A;  5B40 C;  3A6N B;  3VH5 W;  5F99 C;  3AZN C;  5B1M A;  4YS3 A;  4WNN A;  4ZUX A;  1B67 A;  3UTB C;  1M1A C;  5B31 C;  2YFW B;  1P3G D;  3AZE A;  1P3G B;  1ZLA A;  5AV5 D;  3C1C A;  5B32 D;  5AV5 B;  2ARO D;  5AV6 A;  5BT1 D;  5B33 A;  2ARO B;  4UUZ B;  1P3B C;  3AZE C;  4J8X D;  3AZJ A;  1P3M D;  3AFA C;  2YFV B;  4H9P B;  3C1C C;  4J8X B;  1P3M B;  3AV1 C;  5AV6 C;  2NZD B;  5B33 C;  1U35 B;  1P34 D;  4NFT A;  3KWQ D;  5BO0 B;  2IO5 B;  4KUD B;  3KWQ B;  5B2J C;  3REH C;  1P3P A;  3W99 A;  3KXB B;  4G92 C;  4R8P A;  2HIO C;  1AOI A;  3X1V D;  4HGA B;  1P3P C;  1KU5 A;  3WAA B;  4R8P C;  3MGQ A;  4J8W D;  5FUG A;  5AVC D;  4J8W B;  5AVC B;  1S32 A;  4XUJ B;  5CP6 D;  3MGQ C;  1EQZ D;  4NE5 A;  5CPI C;  3LJA C;  3V9R A;  5E5A B;  3MGR B;  5B24 D;  5GSU D;  1H3O B;  5B24 B;  2F8N B;  3C1B A;  5GSU B;  2FJ7 B;  4YM6 D;  5GT3 A;  5B0Z A;  4YM6 B;  5B0Y B;  1KX4 D;  1P3F A;  4X23 A;  1BH8 A;  1KX4 B;  3AZK D;  4WU9 D;  4EO5 C;  3AZF C;  4X23 C;  4WU9 B;  3A6N A;  3LZ1 C;  4XZQ D;  3O62 A;  3AZG A;  2BYK B;  4XZQ B;  1P3A A;  4M6B A;  5B32 G;  5AV9 D;  1ID3 B;  5AV9 B;  3O62 C;  2NQB B;  2RVQ C;  1P3A C;  3WTP B;  3KUY B;  1F66 D;  1KX5 D;  1KX5 B;  3W96 A;  1P3L A;  2YFV A;  2NZD A;  1N1J B;  3REJ D;  1U35 A;  3W96 C;  1P3L C;  4KUD A;  5BO0 A;  3WA9 B;  3KXB A;  4AWL C;  3X1T D; 
#chains in the Genus database with same CATH topology
 4G91 C;  3B6G D;  1P3I C;  3X1T B;  4Z5T A;  3B6G B;  3WAA A;  5G49 B;  3WKJ A;  3B0D B;  3UTB D;  2HUE B;  3UTB B;  3AZI C;  5GT0 A;  3FDD A;  5DNN B;  3UTA C;  4Z5T C;  3B0C W;  3MVD D;  3MVD B;  3WKJ C;  4XUJ A;  4CAY B;  5B1L D;  5GT0 C;  1P3B D;  5B1L B;  3AN2 D;  3W97 A;  3AFA D;  1P3O A;  3AN2 B;  2CV5 D;  4H9N B;  3AV1 D;  3AZH C;  2PYO C;  2CV5 B;  3W98 C;  5E5A A;  3MGR A;  1H3O A;  3W97 C;  2F8N A;  1BFM A;  2FJ7 A;  5B2J D;  3REH D;  5JRG A;  3X1S D;  5B2J B;  3REH B;  3X1S B;  5B0Y A;  2HIO D;  5JRG C;  3TU4 B;  4E45 A;  4LD9 B;  5C3I B;  5AVB A;  5CPK D;  5CPK B;  5DNM A;  1ID3 A;  3R45 A;  5AVB C;  2NQB A;  5DNM C;  5CPI D;  3WTP A;  3LJA D;  3KUY A;  1A7W A;  3LEL C;  4WU8 A;  4JJN B;  3VH6 A;  4QLC D;  3REL C;  4QLC B;  3AZM C;  1HTA A;  4KGC D;  4WU8 C;  2UWX A;  4KGC B;  3AYW A;  5B2I A;  3EG5 B;  5B1M C;  1HQ3 D;  5BNX B;  4YS3 C;  1HQ3 B;  4ZUX C;  5B32 B;  3WA9 A;  3AYW C;  5B2I C;  3REI D;  3REI B;  3AZF D;  3AZL A;  5B31 G;  1ZLA C;  3LZ1 D;  3A1I A;  1KX3 A;  1P3K A;  2JCH A;  3AZL C;  3AZJ C;  1P34 B;  3O62 D;  5DNN A;  3MGP A;  1KX3 C;  2RVQ D;  1P3K C;  5CPJ A;  4CAY A;  4Z66 A;  2ZM5 A;  3X1V B;  3X1U A;  4ZBJ B;  3W99 C;  4H9N A;  3NQJ B;  5JA4 A;  5GXQ A;  1AOI C;  3VH5 T;  4Z66 C;  4J8V D;  3X1U C;  4J8V B;  3MNN D;  5GXQ C;  3MNN B;  5CP6 B;  4J8U D;  1EQZ B;  3VH6 W;  3KFU G;  4J8U B;  1S32 C;  3B6F D;  1R4V A;  4AWL B;  1P3I D;  3AV2 D;  3TU4 A;  3B6F B;  2Y2J A;  3REK A;  3AV2 B;  2Y2L A;  2BYM B;  3EPJ A;  4LD9 A;  2Y2H A;  3AZI D;  3UTA D;  3REK C;  3C1B C;  3LZ0 D;  5GT3 C;  5B0Z C;  3LZ0 B;  3UT9 D;  5AV8 A;  3AZK B;  3UT9 B;  3MGS A;  3AZH D;  2PYO D;  1W2E A;  4JJN A;  1P3F C;  3W98 D;  4H9R B;  2PYO B;  4H9Q B;  5AV8 C;  3MGS C;  2YFW A;  2CWE A;  3A6N C;  3AZG C;  1M18 D;  1JFI B;  1P3G A;  1M18 B;  1TZY D;  4H9O B;  5AV5 A;  1TZY B;  5B32 A;  1M19 D;  2ARO A;  4UUZ A;  1F66 B;  1M19 B;  1P3G C;  5AY8 D;  5AY8 B;  4H9P A;  4J8X A;  5AV5 C;  1P3M A;  2ARO C;  3REJ B;  1P34 A;  4J8X C;  1P3M C;  2NZD C;  3KWQ A;  2VQR A;  1U35 C;  5BNV B;  3LEL D;  5B40 D;  4KUD C;  2IO5 C;  5F99 D;  5B40 B;  3AZN D;  3X1V A;  5F99 B;  3REL D;  3AZN B;  1B6W A;  3AZM D;  1TAF B;  3KXB C;  3NQJ A;  2FFF B;  1M1A D;  5B31 D;  1M1A B;  5B31 B;  2L5A A;  4HGA C;  5B1M D;  4YS3 D;  3WAA C;  4J8W A;  5AVC A;  4ZUX D;  4WNN B;  4ZUX B;  5CP6 A;  3AZE D;  1EQZ A;  1P3B B;  3AZE B;  4J8W C;  1ZLA D;  3C1C D;  3A1K A;  4XUJ C;  3AFA B;  5AV6 D;  3C1C B;  5B33 D;  3AV1 B;  5AV6 B;  4WZS B;  5B33 B;  2BYM A;  3H0M C;  3AZJ D;  5B24 A;  1P3O C;  5GSU A;  3AZJ B;  4DRA A;  1BH9 B;  4YM6 A;  5E5A C;  3MGR C;  3P5J B;  5B24 C;  4H9S A;  4G92 B;  5GSU C;  2HIO B;  1KX4 A;  2FJ7 C;  1P3P D;  4YM6 C;  3W99 D;  3AZK A;  1P3P B;  5B0Y C;  4R8P D;  4H9S C;  4WU9 A;  4H9R A;  4R8P B;  3H0R C;  1KX4 C;  1AOI D;  4H9Q A;  2BYK A;  4XZQ A;  5AV9 A;  3MGQ D;  2DQN C;  3MGQ B;  3B0C T;  4XZQ C;  4DQY B;  5FUG B;  1S32 D;  5CPI B;  3EPK A;  3LJA B;  1ID3 C;  5AV9 C;  1F66 A;  3NQU B;  2NQB C;  1KX5 A;  4Z2M H;  3WTP C;  1N1J A;  3KUY C;  4WV4 B;  3REJ A;  1KX5 C;  3C1B D;  3AL0 C;  5GT3 D;  5B0Z D;  5BNV A;  1P3F D;  4X23 D;  4EO5 B;  3AZF B;  4KHA B;  4X23 B;  1BH8 B;  1P3F B;  3X1T A;  2F8N K;  3LZ1 B;  3B6G A;  3WA9 C;  5G49 A;  2F2A C;  2W8S A;  1WWI A;  3UTB A;  3A6N D;  3AZG D;  3X1T C;  3AZG B;  3O62 B;  2JSS A;  3B6G C;  1P3A D;  3MVD A;  3B0D C;  1P3A B;  3B0B A;  2HUE C;  1Q9C A;  5DNN C;  3MGP C;  5B1L A;  1P3B A;  3MVD C;  3AN2 A;  3AFA A;  5CPJ C;  2CV5 A;  3AV1 A;  5B1L C;  2J8P A;  3W96 D;  1P3L D;  3AN2 C;  3W96 B;  1P3L B;  2NZD D;  2CV5 C;  1BH9 A;  1U35 D;  5B2J A;  3REH A;  3X1S A;  4KUD D;  2HIO A;  4G91 B;  1P3I B;  3KXB D;  4Z2M G;  3X1S C;  2JE5 A;  5CPK A;  3AZI B;  4Z5T D;  3TU4 C;  3WAA D;  3UTA B;  4Z5T B;  3WKJ D;  3WKJ B;  4LD9 C;  5C3I C;  5GT0 D;  5CPK C;  5GT0 B;  2Y2P A;  5CPI A;  2ZY4 A;  4XUJ D;  3LJA A;  3AZH B;  3NQU A;  3W98 B;  1WWS A;  4QLC A;  3W97 D;  1P3O D;  3W97 B;  1P3O B;  4JJN C;  4KGC A;  5E5A D;  3MGR D;  5KDM B;  5BNX A;  4QLC C;  2F8N D;  1HQ3 A;  1PZR A;  2FJ7 D;  4KGC C;  5JRG D;  3VH6 T;  5JRG B;  5B0Y D;  3REI A;  1HQ3 C;  3AZF A;  4KHA A;  4NE3 A;  5B32 C;  3LZ1 A;  5BT1 C;  4CSR B;  2F8N H;  3REI C;  4NE6 A;  5AVB D;  3EPL A;  2Y2N A;  5AVB B;  5DNM D;  5DNM B;  1P34 C;  1ID3 D;  3LEL B;  2NQB D;  3R45 B;  3KWQ C;  3KSY A;  3WTP D;  3REL B;  3AZM B;  3KUY D;  4WU8 D;  4WU8 B;  1F1E A;  3X1V C;  5B1M B;  4ZBJ C;  4J8V A;  4YS3 B;  1ULY A;  3MNN A;  3AYW D;  5B2I D;  2BG1 A;  3AYW B;  5B2I B;  4J8U A;  2Y2O A;  4J8V C;  5AVC C;  1ZLA B;  4E44 A;  3WA9 D;  3MNN C;  1P3I A;  3B6F A;  5CP6 C;  3AV2 A;  1EQZ C;  4J8U C;  3AZL D;  3AZL B;  1KX3 D;  3AZI A;  2Y2K A;  3B6F C;  1KX3 B;  5BS7 A;  3UTA A;  1P3K D;  3AV2 C;  1P3K B;  3VH5 A;  3IP4 C;  5DNN D;  3MGP D;  5BS7 C;  3LZ0 A;  3MGP B;  3UT9 A;  5CPJ D;  3W99 B;  4DRB A;  3AZH A;  5CPJ B;  2PYO A;  3H0L C;  4Z66 D;  1AOI B;  3W98 A;  4Z66 B;  3LZ0 C;  3X1U D;  2F8N G;  3AZK C;  3UT9 C;  3X1U B;  5GXQ D;  4WU9 C;  1JFI A;  5GXQ B;  5JA4 B;  1M18 A;  5KDM A;  4WJ3 C;  4H9O A;  1TZY A;  1S32 B;  2Y2G A;  2DF4 C;  1M19 A;  1M18 C;  2Y2I A;  2LY8 A;  5AY8 A;  2ZY3 A;  1TZY C;  3TU4 D;  4CSR A;  3REK D;  1M19 C;  1F66 C;  3REK B;  3V9R B;  5AY8 C;  4LD9 D;  3C1B B;  3REJ C;  5GT3 B;  5B0Z B;  5CHL B;  3LEL A;  5B40 A;  5F99 A;  3WTP E;  3AZN A;  1TAF A;  5AV8 D;  3REL A;  3MGS D;  3AZM A;  5AV8 B;  4JJN D;  3MGS B;  1M1A A;  5B31 A;  4UPK A;  5B40 C;  3A6N B;  3EPH A;  3VH5 W;  5F99 C;  3AZN C;  5B1M A;  4YS3 A;  1Z2C B;  4WNN A;  1T3U A;  4ZUX A;  1B67 A;  2XD5 A;  3UTB C;  1M1A C;  5B31 C;  2YFW B;  1P3G D;  3AZE A;  1P3G B;  1ZLA A;  5AV5 D;  3C1C A;  5B32 D;  5AV5 B;  2ARO D;  5AV6 A;  5BT1 D;  5B33 A;  2ARO B;  4UUZ B;  1P3B C;  3AZE C;  4J8X D;  3AZJ A;  1P3M D;  3AFA C;  2YFV B;  4H9P B;  3C1C C;  4J8X B;  1P3M B;  3AV1 C;  5AV6 C;  2NZD B;  5B33 C;  1U35 B;  1P34 D;  4NFT A;  3KWQ D;  5BO0 B;  2IO5 B;  4KUD B;  3KWQ B;  5B2J C;  3REH C;  1P3P A;  3W99 A;  3KXB B;  4G92 C;  4R8P A;  2HIO C;  1AOI A;  3X1V D;  4HGA B;  1P3P C;  1KU5 A;  3WAA B;  4R8P C;  3MGQ A;  2RIQ A;  2ZY5 A;  5FUG A;  4J8W D;  5AVC D;  4J8W B;  5AVC B;  3F6T A;  1S32 A;  4XUJ B;  5CP6 D;  3MGQ C;  1EQZ D;  4NE5 A;  2XD1 A;  5CPI C;  3LJA C;  3V9R A;  5E5A B;  3MGR B;  5B24 D;  5GSU D;  1H3O B;  5B24 B;  2F8N B;  3C1B A;  5GSU B;  2Y2Q A;  2FJ7 B;  4YM6 D;  5GT3 A;  5B0Z A;  4YM6 B;  5B0Y B;  1KX4 D;  1P3F A;  4X23 A;  1BH8 A;  1KX4 B;  3AZK D;  2Y2M A;  4WU9 D;  4EO5 C;  3AZF C;  4X23 C;  4WU9 B;  3A6N A;  3LZ1 C;  4XZQ D;  3O62 A;  3AZG A;  2BYK B;  4XZQ B;  1P3A A;  4M6B A;  5B32 G;  5AV9 D;  1ID3 B;  5AV9 B;  3O62 C;  2NQB B;  2RVQ C;  1P3A C;  3WTP B;  2G5I C;  3KUY B;  1F66 D;  1KX5 D;  1KX5 B;  2G5H C;  3W96 A;  1P3L A;  2YFV A;  2NZD A;  1N1J B;  3REJ D;  1U35 A;  3W96 C;  1P3L C;  4KUD A;  5BO0 A;  3WA9 B;  3KXB A;  2ZY2 A;  4AWL C;  3X1T D; 
#chains in the Genus database with same CATH homology
 4G91 C;  3B6G D;  1P3I C;  3X1T B;  4Z5T A;  3B6G B;  3WAA A;  5G49 B;  3WKJ A;  3B0D B;  3UTB D;  2HUE B;  3UTB B;  3AZI C;  5GT0 A;  3FDD A;  5DNN B;  3UTA C;  4Z5T C;  3B0C W;  3MVD D;  3MVD B;  3WKJ C;  4XUJ A;  4CAY B;  5B1L D;  5GT0 C;  1P3B D;  5B1L B;  3AN2 D;  3W97 A;  3AFA D;  1P3O A;  3AN2 B;  2CV5 D;  4H9N B;  3AV1 D;  3AZH C;  2PYO C;  2CV5 B;  3W98 C;  5E5A A;  3MGR A;  1H3O A;  3W97 C;  2F8N A;  1BFM A;  2FJ7 A;  5B2J D;  3REH D;  5JRG A;  3X1S D;  5B2J B;  3REH B;  3X1S B;  5B0Y A;  2HIO D;  5JRG C;  3TU4 B;  4E45 A;  4LD9 B;  5C3I B;  5AVB A;  5CPK D;  5CPK B;  5DNM A;  1ID3 A;  3R45 A;  5AVB C;  2NQB A;  5DNM C;  5CPI D;  3WTP A;  3LJA D;  3KUY A;  1A7W A;  3LEL C;  4WU8 A;  4JJN B;  3VH6 A;  4QLC D;  3REL C;  4QLC B;  3AZM C;  1HTA A;  4KGC D;  4WU8 C;  2UWX A;  4KGC B;  3AYW A;  5B2I A;  3EG5 B;  5B1M C;  1HQ3 D;  5BNX B;  4YS3 C;  1HQ3 B;  4ZUX C;  5B32 B;  3WA9 A;  3AYW C;  5B2I C;  3REI D;  3REI B;  3AZF D;  3AZL A;  5B31 G;  1ZLA C;  3LZ1 D;  3A1I A;  1KX3 A;  1P3K A;  2JCH A;  3AZL C;  3AZJ C;  1P34 B;  3O62 D;  5DNN A;  3MGP A;  1KX3 C;  2RVQ D;  1P3K C;  5CPJ A;  4CAY A;  4Z66 A;  2ZM5 A;  3X1V B;  3X1U A;  4ZBJ B;  3W99 C;  4H9N A;  3NQJ B;  5JA4 A;  5GXQ A;  1AOI C;  3VH5 T;  4Z66 C;  4J8V D;  3X1U C;  4J8V B;  3MNN D;  5GXQ C;  3MNN B;  5CP6 B;  4J8U D;  1EQZ B;  3VH6 W;  3KFU G;  4J8U B;  1S32 C;  3B6F D;  1R4V A;  4AWL B;  1P3I D;  3AV2 D;  3TU4 A;  3B6F B;  2Y2J A;  3REK A;  3AV2 B;  2Y2L A;  2BYM B;  3EPJ A;  4LD9 A;  2Y2H A;  3AZI D;  3UTA D;  3REK C;  3C1B C;  3LZ0 D;  5GT3 C;  5B0Z C;  3LZ0 B;  3UT9 D;  5AV8 A;  3AZK B;  3UT9 B;  3MGS A;  3AZH D;  2PYO D;  1W2E A;  4JJN A;  1P3F C;  3W98 D;  4H9R B;  2PYO B;  4H9Q B;  5AV8 C;  3MGS C;  2YFW A;  2CWE A;  3A6N C;  3AZG C;  1M18 D;  1JFI B;  1P3G A;  1M18 B;  1TZY D;  4H9O B;  5AV5 A;  1TZY B;  5B32 A;  1M19 D;  2ARO A;  4UUZ A;  1F66 B;  1M19 B;  1P3G C;  5AY8 D;  5AY8 B;  4H9P A;  4J8X A;  5AV5 C;  1P3M A;  2ARO C;  3REJ B;  1P34 A;  4J8X C;  1P3M C;  2NZD C;  3KWQ A;  2VQR A;  1U35 C;  5BNV B;  3LEL D;  5B40 D;  4KUD C;  2IO5 C;  5F99 D;  5B40 B;  3AZN D;  3X1V A;  5F99 B;  3REL D;  3AZN B;  1B6W A;  3AZM D;  1TAF B;  3KXB C;  3NQJ A;  2FFF B;  1M1A D;  5B31 D;  1M1A B;  5B31 B;  2L5A A;  4HGA C;  5B1M D;  4YS3 D;  3WAA C;  4J8W A;  5AVC A;  4ZUX D;  4WNN B;  4ZUX B;  5CP6 A;  3AZE D;  1EQZ A;  1P3B B;  3AZE B;  4J8W C;  1ZLA D;  3C1C D;  3A1K A;  4XUJ C;  3AFA B;  5AV6 D;  3C1C B;  5B33 D;  3AV1 B;  5AV6 B;  4WZS B;  5B33 B;  2BYM A;  3H0M C;  3AZJ D;  5B24 A;  1P3O C;  5GSU A;  3AZJ B;  4DRA A;  1BH9 B;  4YM6 A;  5E5A C;  3MGR C;  3P5J B;  5B24 C;  4H9S A;  4G92 B;  5GSU C;  2HIO B;  1KX4 A;  2FJ7 C;  1P3P D;  4YM6 C;  3W99 D;  3AZK A;  1P3P B;  5B0Y C;  4R8P D;  4H9S C;  4WU9 A;  4H9R A;  4R8P B;  3H0R C;  1KX4 C;  1AOI D;  4H9Q A;  2BYK A;  4XZQ A;  5AV9 A;  3MGQ D;  2DQN C;  3MGQ B;  3B0C T;  4XZQ C;  4DQY B;  5FUG B;  1S32 D;  5CPI B;  3EPK A;  3LJA B;  1ID3 C;  5AV9 C;  1F66 A;  3NQU B;  2NQB C;  1KX5 A;  4Z2M H;  3WTP C;  1N1J A;  3KUY C;  4WV4 B;  3REJ A;  1KX5 C;  3C1B D;  3AL0 C;  5GT3 D;  5B0Z D;  5BNV A;  1P3F D;  4X23 D;  4EO5 B;  3AZF B;  4KHA B;  4X23 B;  1BH8 B;  1P3F B;  3X1T A;  2F8N K;  3LZ1 B;  3B6G A;  3WA9 C;  5G49 A;  2F2A C;  2W8S A;  1WWI A;  3UTB A;  3A6N D;  3AZG D;  3X1T C;  3AZG B;  3O62 B;  2JSS A;  3B6G C;  1P3A D;  3MVD A;  3B0D C;  1P3A B;  3B0B A;  2HUE C;  1Q9C A;  5DNN C;  3MGP C;  5B1L A;  1P3B A;  3MVD C;  3AN2 A;  3AFA A;  5CPJ C;  2CV5 A;  3AV1 A;  5B1L C;  2J8P A;  3W96 D;  1P3L D;  3AN2 C;  3W96 B;  1P3L B;  2NZD D;  2CV5 C;  1BH9 A;  1U35 D;  5B2J A;  3REH A;  3X1S A;  4KUD D;  2HIO A;  4G91 B;  1P3I B;  3KXB D;  4Z2M G;  3X1S C;  2JE5 A;  5CPK A;  3AZI B;  4Z5T D;  3TU4 C;  3WAA D;  3UTA B;  4Z5T B;  3WKJ D;  3WKJ B;  4LD9 C;  5C3I C;  5GT0 D;  5CPK C;  5GT0 B;  2Y2P A;  5CPI A;  2ZY4 A;  4XUJ D;  3LJA A;  3AZH B;  3NQU A;  3W98 B;  1WWS A;  4QLC A;  3W97 D;  1P3O D;  3W97 B;  1P3O B;  4JJN C;  4KGC A;  5E5A D;  3MGR D;  5KDM B;  5BNX A;  4QLC C;  2F8N D;  1HQ3 A;  1PZR A;  2FJ7 D;  4KGC C;  5JRG D;  3VH6 T;  5JRG B;  5B0Y D;  3REI A;  1HQ3 C;  3AZF A;  4KHA A;  4NE3 A;  5B32 C;  3LZ1 A;  5BT1 C;  4CSR B;  2F8N H;  3REI C;  4NE6 A;  5AVB D;  3EPL A;  2Y2N A;  5AVB B;  5DNM D;  5DNM B;  1P34 C;  1ID3 D;  3LEL B;  2NQB D;  3R45 B;  3KWQ C;  3KSY A;  3WTP D;  3REL B;  3AZM B;  3KUY D;  4WU8 D;  4WU8 B;  1F1E A;  3X1V C;  5B1M B;  4ZBJ C;  4J8V A;  4YS3 B;  1ULY A;  3MNN A;  3AYW D;  5B2I D;  2BG1 A;  3AYW B;  5B2I B;  4J8U A;  2Y2O A;  4J8V C;  5AVC C;  1ZLA B;  4E44 A;  3WA9 D;  3MNN C;  1P3I A;  3B6F A;  5CP6 C;  3AV2 A;  1EQZ C;  4J8U C;  3AZL D;  3AZL B;  1KX3 D;  3AZI A;  2Y2K A;  3B6F C;  1KX3 B;  5BS7 A;  3UTA A;  1P3K D;  3AV2 C;  1P3K B;  3VH5 A;  3IP4 C;  5DNN D;  3MGP D;  5BS7 C;  3LZ0 A;  3MGP B;  3UT9 A;  5CPJ D;  3W99 B;  4DRB A;  3AZH A;  5CPJ B;  2PYO A;  3H0L C;  4Z66 D;  1AOI B;  3W98 A;  4Z66 B;  3LZ0 C;  3X1U D;  2F8N G;  3AZK C;  3UT9 C;  3X1U B;  5GXQ D;  4WU9 C;  1JFI A;  5GXQ B;  5JA4 B;  1M18 A;  5KDM A;  4WJ3 C;  4H9O A;  1TZY A;  1S32 B;  2Y2G A;  2DF4 C;  1M19 A;  1M18 C;  2Y2I A;  2LY8 A;  5AY8 A;  2ZY3 A;  1TZY C;  3TU4 D;  4CSR A;  3REK D;  1M19 C;  1F66 C;  3REK B;  3V9R B;  5AY8 C;  4LD9 D;  3C1B B;  3REJ C;  5GT3 B;  5B0Z B;  5CHL B;  3LEL A;  5B40 A;  5F99 A;  3WTP E;  3AZN A;  1TAF A;  5AV8 D;  3REL A;  3MGS D;  3AZM A;  5AV8 B;  4JJN D;  3MGS B;  1M1A A;  5B31 A;  4UPK A;  5B40 C;  3A6N B;  3EPH A;  3VH5 W;  5F99 C;  3AZN C;  5B1M A;  4YS3 A;  1Z2C B;  4WNN A;  1T3U A;  4ZUX A;  1B67 A;  2XD5 A;  3UTB C;  1M1A C;  5B31 C;  2YFW B;  1P3G D;  3AZE A;  1P3G B;  1ZLA A;  5AV5 D;  3C1C A;  5B32 D;  5AV5 B;  2ARO D;  5AV6 A;  5BT1 D;  5B33 A;  2ARO B;  4UUZ B;  1P3B C;  3AZE C;  4J8X D;  3AZJ A;  1P3M D;  3AFA C;  2YFV B;  4H9P B;  3C1C C;  4J8X B;  1P3M B;  3AV1 C;  5AV6 C;  2NZD B;  5B33 C;  1U35 B;  1P34 D;  4NFT A;  3KWQ D;  5BO0 B;  2IO5 B;  4KUD B;  3KWQ B;  5B2J C;  3REH C;  1P3P A;  3W99 A;  3KXB B;  4G92 C;  4R8P A;  2HIO C;  1AOI A;  3X1V D;  4HGA B;  1P3P C;  1KU5 A;  3WAA B;  4R8P C;  3MGQ A;  2RIQ A;  2ZY5 A;  5FUG A;  4J8W D;  5AVC D;  4J8W B;  5AVC B;  3F6T A;  1S32 A;  4XUJ B;  5CP6 D;  3MGQ C;  1EQZ D;  4NE5 A;  2XD1 A;  5CPI C;  3LJA C;  3V9R A;  5E5A B;  3MGR B;  5B24 D;  5GSU D;  1H3O B;  5B24 B;  2F8N B;  3C1B A;  5GSU B;  2Y2Q A;  2FJ7 B;  4YM6 D;  5GT3 A;  5B0Z A;  4YM6 B;  5B0Y B;  1KX4 D;  1P3F A;  4X23 A;  1BH8 A;  1KX4 B;  3AZK D;  2Y2M A;  4WU9 D;  4EO5 C;  3AZF C;  4X23 C;  4WU9 B;  3A6N A;  3LZ1 C;  4XZQ D;  3O62 A;  3AZG A;  2BYK B;  4XZQ B;  1P3A A;  4M6B A;  5B32 G;  5AV9 D;  1ID3 B;  5AV9 B;  3O62 C;  2NQB B;  2RVQ C;  1P3A C;  3WTP B;  2G5I C;  3KUY B;  1F66 D;  1KX5 D;  1KX5 B;  2G5H C;  3W96 A;  1P3L A;  2YFV A;  2NZD A;  1N1J B;  3REJ D;  1U35 A;  3W96 C;  1P3L C;  4KUD A;  5BO0 A;  3WA9 B;  3KXB A;  2ZY2 A;  4AWL C;  3X1T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...