3VH6T

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
EPEIASSLIKQIFSHYVKTPVTRDAYKIVEKASERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
total genus 31
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh6T00
3AZJA 5GT3D 3B6GC 3AZMD 3X1UC 3W96D 5B0ZA 1WWSA 3C1BA 3UT9B 3AZED 1KX3A 5CPKB 2NZDD 1HQ3D 3A6NA 4WU8D 5B32B 1B67A 3NQJB 5AY8C 4XUJA 1S32B 3AZKB 3LZ0D 3WA9B 4LD9D 5GT3C 5CPJA 2AROA 5AV9A 3AZMC 1P3LD 4DRAA 3W96C 5BNXB 3KWQD 3AZLA 2FJ7D 3KXBD 5AV6D 1KX5B 5GSUB 3TU4B 2NZDC 3WTPD 4WU8C 5B1LB 4NFTA 3LZ0C 3AYWD 1HTAA 4JJNA 4LD9C 5AVBB 3AV1B 2NQBB 1P3LC 3KWQC 2FJ7C 3O62B 3KXBC 5AV6C 3AV2A 5GXQD 3WTPC 3WAAD 1ZLAA 3AYWC 4QLCA 1JFIB 3W99D 3REIA 5B0ZD 4J8WB 4WZSB 5GXQC 3A6ND 5DNND 1M18A 3WAAC 4Z2MG 3AFAA 5CPJD 2F8NB 2AROD 5AV9D 3W99C 1P3OB 3AZLD 5B0ZC 5AV8B 2JSSA 3LJAA 3A6NC 5DNNC 1KX4A 3B0DB 2PYOA 3X1SA 5CPJC 2AROC 5AV9C 5CP6B 5JRGA 5B1MB 3MVDD 3REKA 3AZLC 2HIOB 4WNNB 1P3KD 1P34A 1ZLAD 4H9NA 5E5AA 4QLCD 3REJD 3REID 3MVDC 1ID3A 3W98B 4KUDB 4G91B 4R8PD 1P3KC 1ZLAC 4QLCC 3REJC 5B24A 1TAFA 3RELA 3REIC 3AZND 1P3BA 5JA4A 5AV5B 5AVCD 4KHAB 4Z5TB 5GT0B 1N1JB 4HGAB 1P3GA 5C3IC 1F1EA 4X23A 1KX4D 4R8PC 1AOIA 3REKD 1U35B 2PYOB 5JRGB 5DNMB 3W97B 1KX4C 1P34D 3AZGB 4CAYB 3B6GA 3KUYA 5E5AD 5FUGA 3REKC 1ID3D 4KGCB 5AY8A 1B6WA 1M1AB 4YM6D 3B0CW 1P34C 4AWLC 5CPIB 4ZUXA 1P3FD 5E5AC 3MNND 2CWEA 3RELD 3W96A 1P3BD 1ID3C 4WV4B 3AZEA 4J8XA 1HQ3A 4X23D 5B40D 5G49B 3MGSD 2CV5D 1M19A 4YM6C 3LZ0A 3X1TB 1P3FC 3MGQB 5B31G 5BNVA 5B24C 3MNNC 3RELC 3KWQA 2FJ7A 1P3BC 3KXBA 5AV6A 1H3OB 3AZHD 1P3AD 3B6FD 4X23C 2BYKA 2IO5C 3MGSC 5B40C 2CV5C 1Q9CA 3VH5W 3KUYD 4J8UB 3C1CA 3AN2D 3X1UB 4WU9D 4EO5C 3AZHC 1F66D 3WAAA 3B6FC 5B31A 4ZUXD 3KUYC 3W99A 5GT3B 3AN2C 2F8NH 3AZMB 2HUEC 4WU9C 5B33A 4J8XD 1F66C 5DNNA 3REHA 2NZDB 4H9QA 1M19D 4WU8B 3AZIB 3UTBD 4ZUXC 3UTAA 4LD9B 1P3LB 3AZEC 3NQUA 2FJ7B 1EQZA 4J8XC 1HQ3C 1M19C 3WTPB 5B2JB 3UTBC 3WKJD 4CSRA 4J8VA 3X1VA 3C1CD 4Z66A 3LZ1A 3MVDA 3AYWB 3VH6T 5B2IB 3UT9D 3AZFB 5B32D 5GXQB 5B31D 1P3KA 3AZKD 3V9RB 3WA9D 3WKJC 3REJA 3C1CC 3AZJB 3W99B 3UT9C 5GSUD 5B33D 5B0ZB 3C1BB 1BH9A 2YFWA 5B32C 3REHD 1KX3B 5B31C 4R8PA 3A6NB 3AZKC 4XUJB 3WA9C 3AV1D 3UTAD 3AZNA 5CPJB 2AROB 5AV9B 5AVCA 3O62D 4G92B 5KDMA 5GSUC 5B33C 3AZLB 1EQZD 3REHC 4J8VD 3X1VD 4Z66D 3UTAC 3LZ1D 3AV1C 4CSRB 4JJNB 5BT1D 3O62C 3MVDB 4H9SA 3B0CT 1EQZC 3AV2B 4ZBJC 4DRBA 2F8ND 3MGPA 4H9PA 3X1VC 4J8VC 4Z66C 1ZLAB 3LZ1C 4QLCB 3REJB 5BT1C 3LELA 5AV8D 3REIB 1P3MD 4YM6A 1M18B 1P3FA 3MNNA 5B1MD 3AFAB 1ULYA 5AV8C 1P3MC 5B40A 2CV5A 3LJAB 3MGSA 1TZYA 1KX4B 3AZNC 5B1MC 4UUZA 3X1SB 4YS3A 3W98D 4KUDD 5AVCC 3REKB 4NE5A 3AZHA 3MGRD 1P3AA 3B6FA 3MGPD 1P34B 4AWLB 2YFVA 4H9NB 3AN2A 5E5AB 5AV5D 4H9PB 3W98C 3LELD 4Z5TD 5GT0D 4KUDC 4WU9A 4H9SC 1ID3B 1F66A 3MGRC 4G91C 1R4VA 4XZQA 3MGPC 3KSYA 1U35D 1P3IA 5AV5C 5B24B 1TAFB 3LELC 4Z5TC 5GT0C 3RELB 1P3BB 5JA4B 3W97D 1P3GB 1TZYD 3UTBA 5B0YD 4X23B 2IO5B 3MGSB 2CV5B 5B32G 1U35C 1AOIB 4YS3D 4H9OA 1P3PA 3W97C 4EO5B 2BYMA 1M1AD 1TZYC 3WKJA 5B0YC 3B6GB 3KUYB 4YS3C 2YFVB 5FUGB 3UT9A 3AN2B 5CPKA 1BFMA 5B32A 3WTPE 3NQJA 4WU9B 1P3AC 4XZQD 1M1AC 3AZKA 3WA9A 5AY8B 4H9RA 5CHLB 4ZUXB 5BNXA 1P3ID 3W96B 5GSUA 3TU4A 3AZEB 5B1LA 1HQ3B 4XZQC 4J8XB 2RVQD 4J8UD 1M19B 5AVBA 3AV1A 2NQBA 3LZ0B 5F99D 1P3IC 3O62A 5BNVB 2F8NG 3KWQB 3KXBB 5AV6B 1P3PD 2RVQC 2BYKB 4J8UC 3WKJB 3R45A 5F99C 3C1CB 4J8WA 5CPKD 1P3PC 3AZID 1S32D 3WAAB 5B31B 2F8NA 1P3OA 3VH6A 4H9RB 5AV8A 1KX5D 3TU4D 5CPKC 1P3MA 5B33B 5B2JD 5B1LD 3AZIC 1S32C 5DNNB 3REHB 4H9QB 5AVBD 5CP6A 2NQBD 5B1MA 5B2ID 3UTAB 2HIOA 2F8NK 4WNNA 1KX5C 3TU4C 3AZFD 3NQUB 1EQZB 5B2JC 5B1LC 1KU5A 4ZBJB 4Z2MH 5AVBC 3AZJD 2NQBC 5B2IC 4J8VB 3X1VB 3W98A 4Z66B 4KUDA 3LZ1B 3R45B 4J8WD 3C1BD 3AZFC 3MGRA 1KX3D 5BS7C 4XUJD 1P3KB 3B0BA 3AZJC 5AV5A 1P3OD 4KHAA 4Z5TA 5GT0A 1N1JA 4J8WC 1A7WA 3C1BC 1KX3C 1P3MB 5C3IB 1BH9B 2YFWB 4XUJC 4R8PB 5CP6D 1U35A 2LY8A 4JJND 1P3OC 5DNMA 4G92C 2HIOD 3AZNB 3VH5T 5AVCB 4NE6A 3W97A 3AV2D 5KDMB 3AZGA 4CAYA 3B0DC 5B0YA 5CP6C 4JJNC 4KGCA 2HIOC 3VH5A 3AV2C 1M1AA 3MGRB 3VH6W 1M18D 5CPIA 3AFAD 3MGPB 4E45A 3LELB 1BH8A 5G49A 3LJAD 1M18C 3X1TA 5BO0A 3MGQA 4YM6B 2PYOD 3AFAC 4E44A 3X1SD 1P3FB 3MNNB 5JRGD 5DNMD 4HGAC 1H3OA 3LJAC 3AZGD 5B40B 4J8UA 1TZYB 5B0YB 2PYOC 5F99A 3X1SC 4KGCD 3X1UA 5JRGC 5DNMC 4UUZB 4YS3B 2L5AA 3AZHB 4NE3A 1P3AB 3AZGC 3B6FB 5CPID 4M6BA 5GT3A 3AZMA 5B24D 4KGCC 2HUEB 2NZDA 1P3GD 4WU8A 3AZIA 1S32A 1F66B 1BH8B 3X1TD 5CPIC 4XZQB 3MGQD 4LD9A 1AOID 5BO0B 1P3LA 1P3IB 1KX5A 5B2JA 3WTPA 1P3GC 3X1TC 1WWIA 3MGQC 3UTBB 3AYWA 3B6GD 5B2IA 1AOIC 3X1UD 5F99B 3AZFA 4H9OB 5GXQA 5BS7A 1P3PB 3V9RA 5AY8D 2BYMB 1JFIA
chains in the Genus database with same CATH superfamily
3AZJA 5GT3D 3B6GC 3AZMD 3X1UC 3A1IA 2FFFB 3W96D 5B0ZA 1WWSA 3C1BA 3UT9B 3AZED 1KX3A 5CPKB 2NZDD 1HQ3D 3A6NA 4WU8D 5B32B 1B67A 3NQJB 5AY8C 4XUJA 1S32B 3AZKB 3LZ0D 3WA9B 4LD9D 5GT3C 5CPJA 2AROA 5AV9A 3AZMC 3FDDA 3EG5B 1P3LD 4DRAA 3W96C 5BNXB 3KWQD 3AZLA 2FJ7D 3KXBD 5AV6D 1KX5B 5GSUB 3TU4B 2NZDC 3WTPD 4WU8C 5B1LB 4NFTA 3LZ0C 3AYWD 1HTAA 4JJNA 4LD9C 5AVBB 3AV1B 2NQBB 1P3LC 3KWQC 2FJ7C 3O62B 3KXBC 5AV6C 3AV2A 5GXQD 2Y2HA 3WTPC 3WAAD 1ZLAA 3AYWC 4QLCA 1JFIB 3W99D 3REIA 5B0ZD 4J8WB 4WZSB 5GXQC 3A6ND 5DNND 1M18A 3WAAC 2RIQA 4Z2MG 3AFAA 5CPJD 2F8NB 2AROD 5AV9D 3W99C 1P3OB 3AZLD 5B0ZC 5AV8B 3H0RC 2JSSA 3LJAA 3A6NC 5DNNC 1KX4A 3B0DB 3F6TA 2PYOA 3X1SA 5CPJC 2AROC 5AV9C 5CP6B 5JRGA 5B1MB 3MVDD 3REKA 3AZLC 2HIOB 4WNNB 1P3KD 1P34A 4DQYB 1ZLAD 4H9NA 5E5AA 4QLCD 3REJD 3REID 3MVDC 1ID3A 3W98B 4KUDB 4G91B 4R8PD 1P3KC 1ZLAC 4QLCC 3REJC 5B24A 1TAFA 3RELA 3REIC 3AZND 1P3BA 5JA4A 5AV5B 5AVCD 4KHAB 4Z5TB 5GT0B 1N1JB 4HGAB 1P3GA 5C3IC 1F1EA 4X23A 1KX4D 4R8PC 1AOIA 3REKD 1U35B 2PYOB 5JRGB 5DNMB 3W97B 1KX4C 2DQNC 3AZGB 4CAYB 1P34D 3B6GA 3KUYA 5E5AD 5FUGA 3REKC 1ID3D 4KGCB 5AY8A 1B6WA 1M1AB 4YM6D 3B0CW 1P34C 4AWLC 5CPIB 4ZUXA 1P3FD 5E5AC 3MNND 2CWEA 3RELD 3W96A 1P3BD 1ID3C 4WV4B 2XD1A 3AZEA 4J8XA 1HQ3A 4X23D 5B40D 5G49B 3MGSD 2CV5D 1M19A 4YM6C 3LZ0A 2VQRA 3X1TB 1P3FC 3MGQB 5B31G 5BNVA 5B24C 3MNNC 3RELC 3KWQA 2FJ7A 1P3BC 3KXBA 2Y2MA 5AV6A 1H3OB 3AZHD 1P3AD 3B6FD 4X23C 2BYKA 2IO5C 3MGSC 5B40C 2CV5C 1Q9CA 3VH5W 3KUYD 4J8UB 3C1CA 2Y2GA 3AN2D 2Y2IA 2ZY4A 3X1UB 4WU9D 4EO5C 3AZHC 1F66D 3WAAA 3B6FC 5B31A 4ZUXD 3KUYC 3W99A 5GT3B 3AN2C 2F8NH 3AZMB 2HUEC 4WU9C 5B33A 4J8XD 1F66C 5DNNA 3REHA 2NZDB 4H9QA 1M19D 4WU8B 3AZIB 3UTBD 4ZUXC 3UTAA 4LD9B 1P3LB 3AZEC 3NQUA 2FJ7B 1EQZA 4J8XC 1HQ3C 2JE5A 1M19C 3WTPB 5B2JB 3UTBC 3WKJD 4CSRA 4J8VA 3X1VA 3C1CD 4Z66A 3LZ1A 3MVDA 3AYWB 3VH6T 5B2IB 3UT9D 3AZFB 5B32D 5GXQB 5B31D 1P3KA 3AZKD 3V9RB 3WA9D 3WKJC 3REJA 3C1CC 3AZJB 3W99B 3UT9C 2Y2OA 5GSUD 5B33D 5B0ZB 3C1BB 1BH9A 2YFWA 5B32C 3REHD 1KX3B 5B31C 4R8PA 3A6NB 3AZKC 3EPKA 4XUJB 3EPLA 3WA9C 3AV1D 3UTAD 3AZNA 5CPJB 2AROB 5AV9B 5AVCA 3O62D 4G92B 5KDMA 5GSUC 5B33C 3AZLB 1EQZD 3REHC 4J8VD 3X1VD 4Z66D 3UTAC 3LZ1D 3AV1C 4CSRB 3H0MC 4JJNB 5BT1D 3O62C 3MVDB 4H9SA 3B0CT 1EQZC 3AV2B 4ZBJC 4DRBA 2F8ND 3MGPA 4H9PA 3X1VC 4J8VC 4Z66C 1ZLAB 3LZ1C 3AL0C 4QLCB 3REJB 5BT1C 3LELA 5AV8D 3REIB 1P3MD 4YM6A 1M18B 1P3FA 3MNNA 5B1MD 3AFAB 1ULYA 5AV8C 2ZM5A 2ZY2A 3KFUG 1P3MC 2G5HC 5B40A 3LJAB 3MGSA 2CV5A 1TZYA 1KX4B 3AZNC 5B1MC 4UUZA 3X1SB 4YS3A 3W98D 4KUDD 5AVCC 3REKB 4NE5A 3AZHA 3MGRD 1P3AA 3B6FA 3MGPD 1P34B 4AWLB 2YFVA 4H9NB 3AN2A 5E5AB 5AV5D 4H9PB 3W98C 3LELD 4Z5TD 5GT0D 4KUDC 4WU9A 4H9SC 1ID3B 1F66A 3MGRC 4G91C 3EPJA 1R4VA 4XZQA 2Y2NA 3MGPC 3EPHA 2JCHA 3KSYA 1U35D 1P3IA 3A1KA 3IP4C 5AV5C 5B24B 1TAFB 3LELC 4Z5TC 5GT0C 3RELB 1P3BB 5JA4B 3W97D 1P3GB 2Y2JA 1TZYD 3UTBA 5B0YD 4X23B 2IO5B 3MGSB 2CV5B 5B32G 1U35C 1AOIB 4YS3D 4H9OA 1P3PA 3W97C 4EO5B 2BYMA 1M1AD 1TZYC 3WKJA 5B0YC 3B6GB 3KUYB 4YS3C 2YFVB 5FUGB 3UT9A 3AN2B 2UWXA 5CPKA 1BFMA 5B32A 3WTPE 3NQJA 3P5JB 4WU9B 1P3AC 4XZQD 1M1AC 3AZKA 3WA9A 5AY8B 4H9RA 2Y2LA 5CHLB 4ZUXB 5BNXA 1P3ID 3W96B 5GSUA 3TU4A 3AZEB 5B1LA 1HQ3B 4XZQC 4J8XB 2RVQD 4J8UD 1M19B 5AVBA 3AV1A 2NQBA 3LZ0B 5F99D 1P3IC 3O62A 5BNVB 2F8NG 3KWQB 3KXBB 1Z2CB 5AV6B 1P3PD 2RVQC 2BYKB 4J8UC 3WKJB 3R45A 5F99C 3C1CB 4J8WA 5CPKD 1P3PC 3AZID 1S32D 4UPKA 2F2AC 2G5IC 3WAAB 5B31B 2F8NA 1P3OA 3VH6A 4H9RB 5AV8A 1KX5D 3TU4D 5CPKC 1P3MA 5B33B 5B2JD 5B1LD 3AZIC 1S32C 5DNNB 3REHB 4H9QB 5AVBD 3H0LC 5CP6A 5B1MA 2NQBD 5B2ID 3UTAB 2HIOA 2F8NK 4WNNA 1KX5C 3TU4C 3AZFD 3NQUB 1EQZB 5B2JC 5B1LC 1KU5A 4ZBJB 4Z2MH 5AVBC 3AZJD 2NQBC 5B2IC 4J8VB 3X1VB 3W98A 4Z66B 4KUDA 3LZ1B 3R45B 4J8WD 3C1BD 3AZFC 3MGRA 1KX3D 5BS7C 4XUJD 2XD5A 1P3KB 3B0BA 3AZJC 4WJ3C 5AV5A 1P3OD 4KHAA 4Z5TA 5GT0A 1N1JA 4J8WC 1A7WA 3C1BC 2Y2KA 1KX3C 1P3MB 5C3IB 1BH9B 2YFWB 4XUJC 4R8PB 5CP6D 1U35A 2LY8A 4JJND 1P3OC 5DNMA 4G92C 2HIOD 3AZNB 3VH5T 2BG1A 2J8PA 5AVCB 4NE6A 3W97A 3AV2D 5KDMB 3AZGA 4CAYA 3B0DC 5B0YA 5CP6C 4JJNC 4KGCA 2HIOC 3VH5A 3AV2C 1M1AA 3MGRB 3VH6W 1M18D 5CPIA 3AFAD 2Y2PA 3MGPB 4E45A 3LELB 2ZY3A 1BH8A 5G49A 3LJAD 1M18C 3X1TA 5BO0A 2ZY5A 3MGQA 4YM6B 2PYOD 3AFAC 4E44A 3X1SD 1P3FB 3MNNB 5JRGD 5DNMD 4HGAC 1H3OA 3LJAC 3AZGD 5B40B 4J8UA 1TZYB 5B0YB 2PYOC 5F99A 3X1SC 4KGCD 3X1UA 5JRGC 5DNMC 4UUZB 4YS3B 2L5AA 3AZHB 4NE3A 1P3AB 3AZGC 3B6FB 5CPID 1T3UA 4M6BA 5GT3A 3AZMA 5B24D 4KGCC 2HUEB 2NZDA 1P3GD 4WU8A 3AZIA 1S32A 1F66B 1BH8B 3X1TD 5CPIC 4XZQB 3MGQD 4LD9A 1AOID 5BO0B 1P3LA 2DF4C 1P3IB 1KX5A 5B2JA 3WTPA 1P3GC 3X1TC 1WWIA 3MGQC 3UTBB 3AYWA 3B6GD 2Y2QA 5B2IA 1AOIC 2W8SA 1W2EA 3X1UD 5F99B 3AZFA 4H9OB 5GXQA 5BS7A 1P3PB 1PZRA 3V9RA 5AY8D 2BYMB 1JFIA
chains in the Genus database with same CATH topology
3AZJA 5GT3D 3B6GC 3AZMD 3X1UC 3A1IA 2FFFB 3W96D 5B0ZA 1WWSA 3C1BA 3UT9B 3AZED 1KX3A 5CPKB 2NZDD 1HQ3D 3A6NA 4WU8D 5B32B 1B67A 3NQJB 5AY8C 4XUJA 1S32B 3AZKB 3LZ0D 3WA9B 4LD9D 5GT3C 5CPJA 2AROA 5AV9A 3AZMC 3FDDA 3EG5B 1P3LD 4DRAA 3W96C 5BNXB 3KWQD 3AZLA 2FJ7D 3KXBD 5AV6D 1KX5B 5GSUB 3TU4B 2NZDC 3WTPD 4WU8C 5B1LB 4NFTA 3LZ0C 3AYWD 1HTAA 4JJNA 4LD9C 5AVBB 3AV1B 2NQBB 1P3LC 3KWQC 2FJ7C 3O62B 3KXBC 5AV6C 3AV2A 5GXQD 2Y2HA 3WTPC 3WAAD 1ZLAA 3AYWC 4QLCA 1JFIB 3W99D 3REIA 5B0ZD 4J8WB 4WZSB 5GXQC 3A6ND 5DNND 1M18A 3WAAC 2RIQA 4Z2MG 3AFAA 5CPJD 2F8NB 2AROD 5AV9D 3W99C 1P3OB 3AZLD 5B0ZC 5AV8B 3H0RC 2JSSA 3LJAA 3A6NC 5DNNC 1KX4A 3B0DB 3F6TA 2PYOA 3X1SA 5CPJC 2AROC 5AV9C 5CP6B 5JRGA 5B1MB 3MVDD 3REKA 3AZLC 2HIOB 4WNNB 1P3KD 1P34A 4DQYB 1ZLAD 4H9NA 5E5AA 4QLCD 3REJD 3REID 3MVDC 1ID3A 3W98B 4KUDB 4G91B 4R8PD 1P3KC 1ZLAC 4QLCC 3REJC 5B24A 1TAFA 3RELA 3REIC 3AZND 1P3BA 5JA4A 5AV5B 5AVCD 4KHAB 4Z5TB 5GT0B 1N1JB 4HGAB 1P3GA 5C3IC 1F1EA 4X23A 1KX4D 4R8PC 1AOIA 3REKD 1U35B 2PYOB 5JRGB 5DNMB 3W97B 1KX4C 2DQNC 3AZGB 4CAYB 1P34D 3B6GA 3KUYA 5E5AD 5FUGA 3REKC 1ID3D 4KGCB 5AY8A 1B6WA 1M1AB 4YM6D 3B0CW 1P34C 4AWLC 5CPIB 4ZUXA 1P3FD 5E5AC 3MNND 2CWEA 3RELD 3W96A 1P3BD 1ID3C 4WV4B 2XD1A 3AZEA 4J8XA 1HQ3A 4X23D 5B40D 5G49B 3MGSD 2CV5D 1M19A 4YM6C 3LZ0A 2VQRA 3X1TB 1P3FC 3MGQB 5B31G 5BNVA 5B24C 3MNNC 3RELC 3KWQA 2FJ7A 1P3BC 3KXBA 2Y2MA 5AV6A 1H3OB 3AZHD 1P3AD 3B6FD 4X23C 2BYKA 2IO5C 3MGSC 5B40C 2CV5C 1Q9CA 3VH5W 3KUYD 4J8UB 3C1CA 2Y2GA 3AN2D 2Y2IA 2ZY4A 3X1UB 4WU9D 4EO5C 3AZHC 1F66D 3WAAA 3B6FC 5B31A 4ZUXD 3KUYC 3W99A 5GT3B 3AN2C 2F8NH 3AZMB 2HUEC 4WU9C 5B33A 4J8XD 1F66C 5DNNA 3REHA 2NZDB 4H9QA 1M19D 4WU8B 3AZIB 3UTBD 4ZUXC 3UTAA 4LD9B 1P3LB 3AZEC 3NQUA 2FJ7B 1EQZA 4J8XC 1HQ3C 2JE5A 1M19C 3WTPB 5B2JB 3UTBC 3WKJD 4CSRA 4J8VA 3X1VA 3C1CD 4Z66A 3LZ1A 3MVDA 3AYWB 3VH6T 5B2IB 3UT9D 3AZFB 5B32D 5GXQB 5B31D 1P3KA 3AZKD 3V9RB 3WA9D 3WKJC 3REJA 3C1CC 3AZJB 3W99B 3UT9C 2Y2OA 5GSUD 5B33D 5B0ZB 3C1BB 1BH9A 2YFWA 5B32C 3REHD 1KX3B 5B31C 4R8PA 3A6NB 3AZKC 3EPKA 4XUJB 3EPLA 3WA9C 3AV1D 3UTAD 3AZNA 5CPJB 2AROB 5AV9B 5AVCA 3O62D 4G92B 5KDMA 5GSUC 5B33C 3AZLB 1EQZD 3REHC 4J8VD 3X1VD 4Z66D 3UTAC 3LZ1D 3AV1C 4CSRB 3H0MC 4JJNB 5BT1D 3O62C 3MVDB 4H9SA 3B0CT 1EQZC 3AV2B 4ZBJC 4DRBA 2F8ND 3MGPA 4H9PA 3X1VC 4J8VC 4Z66C 1ZLAB 3LZ1C 3AL0C 4QLCB 3REJB 5BT1C 3LELA 5AV8D 3REIB 1P3MD 4YM6A 1M18B 1P3FA 3MNNA 5B1MD 3AFAB 1ULYA 5AV8C 2ZM5A 2ZY2A 3KFUG 1P3MC 2G5HC 5B40A 3LJAB 3MGSA 2CV5A 1TZYA 1KX4B 3AZNC 5B1MC 4UUZA 3X1SB 4YS3A 3W98D 4KUDD 5AVCC 3REKB 4NE5A 3AZHA 3MGRD 1P3AA 3B6FA 3MGPD 1P34B 4AWLB 2YFVA 4H9NB 3AN2A 5E5AB 5AV5D 4H9PB 3W98C 3LELD 4Z5TD 5GT0D 4KUDC 4WU9A 4H9SC 1ID3B 1F66A 3MGRC 4G91C 3EPJA 1R4VA 4XZQA 2Y2NA 3MGPC 3EPHA 2JCHA 3KSYA 1U35D 1P3IA 3A1KA 3IP4C 5AV5C 5B24B 1TAFB 3LELC 4Z5TC 5GT0C 3RELB 1P3BB 5JA4B 3W97D 1P3GB 2Y2JA 1TZYD 3UTBA 5B0YD 4X23B 2IO5B 3MGSB 2CV5B 5B32G 1U35C 1AOIB 4YS3D 4H9OA 1P3PA 3W97C 4EO5B 2BYMA 1M1AD 1TZYC 3WKJA 5B0YC 3B6GB 3KUYB 4YS3C 2YFVB 5FUGB 3UT9A 3AN2B 2UWXA 5CPKA 1BFMA 5B32A 3WTPE 3NQJA 3P5JB 4WU9B 1P3AC 4XZQD 1M1AC 3AZKA 3WA9A 5AY8B 4H9RA 2Y2LA 5CHLB 4ZUXB 5BNXA 1P3ID 3W96B 5GSUA 3TU4A 3AZEB 5B1LA 1HQ3B 4XZQC 4J8XB 2RVQD 4J8UD 1M19B 5AVBA 3AV1A 2NQBA 3LZ0B 5F99D 1P3IC 3O62A 5BNVB 2F8NG 3KWQB 3KXBB 1Z2CB 5AV6B 1P3PD 2RVQC 2BYKB 4J8UC 3WKJB 3R45A 5F99C 3C1CB 4J8WA 5CPKD 1P3PC 3AZID 1S32D 4UPKA 2F2AC 2G5IC 3WAAB 5B31B 2F8NA 1P3OA 3VH6A 4H9RB 5AV8A 1KX5D 3TU4D 5CPKC 1P3MA 5B33B 5B2JD 5B1LD 3AZIC 1S32C 5DNNB 3REHB 4H9QB 5AVBD 3H0LC 5CP6A 5B1MA 2NQBD 5B2ID 3UTAB 2HIOA 2F8NK 4WNNA 1KX5C 3TU4C 3AZFD 3NQUB 1EQZB 5B2JC 5B1LC 1KU5A 4ZBJB 4Z2MH 5AVBC 3AZJD 2NQBC 5B2IC 4J8VB 3X1VB 3W98A 4Z66B 4KUDA 3LZ1B 3R45B 4J8WD 3C1BD 3AZFC 3MGRA 1KX3D 5BS7C 4XUJD 2XD5A 1P3KB 3B0BA 3AZJC 4WJ3C 5AV5A 1P3OD 4KHAA 4Z5TA 5GT0A 1N1JA 4J8WC 1A7WA 3C1BC 2Y2KA 1KX3C 1P3MB 5C3IB 1BH9B 2YFWB 4XUJC 4R8PB 5CP6D 1U35A 2LY8A 4JJND 1P3OC 5DNMA 4G92C 2HIOD 3AZNB 3VH5T 2BG1A 2J8PA 5AVCB 4NE6A 3W97A 3AV2D 5KDMB 3AZGA 4CAYA 3B0DC 5B0YA 5CP6C 4JJNC 4KGCA 2HIOC 3VH5A 3AV2C 1M1AA 3MGRB 3VH6W 1M18D 5CPIA 3AFAD 2Y2PA 3MGPB 4E45A 3LELB 2ZY3A 1BH8A 5G49A 3LJAD 1M18C 3X1TA 5BO0A 2ZY5A 3MGQA 4YM6B 2PYOD 3AFAC 4E44A 3X1SD 1P3FB 3MNNB 5JRGD 5DNMD 4HGAC 1H3OA 3LJAC 3AZGD 5B40B 4J8UA 1TZYB 5B0YB 2PYOC 5F99A 3X1SC 4KGCD 3X1UA 5JRGC 5DNMC 4UUZB 4YS3B 2L5AA 3AZHB 4NE3A 1P3AB 3AZGC 3B6FB 5CPID 1T3UA 4M6BA 5GT3A 3AZMA 5B24D 4KGCC 2HUEB 2NZDA 1P3GD 4WU8A 3AZIA 1S32A 1F66B 1BH8B 3X1TD 5CPIC 4XZQB 3MGQD 4LD9A 1AOID 5BO0B 1P3LA 2DF4C 1P3IB 1KX5A 5B2JA 3WTPA 1P3GC 3X1TC 1WWIA 3MGQC 3UTBB 3AYWA 3B6GD 2Y2QA 5B2IA 1AOIC 2W8SA 1W2EA 3X1UD 5F99B 3AZFA 4H9OB 5GXQA 5BS7A 1P3PB 1PZRA 3V9RA 5AY8D 2BYMB 1JFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ A;  5GT3 D;  3B6G C;  3AZM D;  3X1U C;  3W96 D;  5B0Z A;  1WWS A;  3C1B A;  3UT9 B;  3AZE D;  1KX3 A;  5CPK B;  2NZD D;  1HQ3 D;  3A6N A;  4WU8 D;  5B32 B;  1B67 A;  3NQJ B;  5AY8 C;  4XUJ A;  1S32 B;  3AZK B;  3LZ0 D;  3WA9 B;  4LD9 D;  5GT3 C;  5CPJ A;  2ARO A;  5AV9 A;  3AZM C;  1P3L D;  4DRA A;  3W96 C;  5BNX B;  3KWQ D;  3AZL A;  2FJ7 D;  3KXB D;  5AV6 D;  1KX5 B;  5GSU B;  3TU4 B;  2NZD C;  3WTP D;  4WU8 C;  5B1L B;  4NFT A;  3LZ0 C;  3AYW D;  1HTA A;  4JJN A;  4LD9 C;  5AVB B;  3AV1 B;  2NQB B;  1P3L C;  3KWQ C;  2FJ7 C;  3O62 B;  3KXB C;  5AV6 C;  3AV2 A;  5GXQ D;  3WTP C;  3WAA D;  1ZLA A;  3AYW C;  4QLC A;  1JFI B;  3W99 D;  3REI A;  5B0Z D;  4J8W B;  4WZS B;  5GXQ C;  3A6N D;  5DNN D;  1M18 A;  3WAA C;  4Z2M G;  3AFA A;  5CPJ D;  2F8N B;  2ARO D;  5AV9 D;  3W99 C;  1P3O B;  3AZL D;  5B0Z C;  5AV8 B;  2JSS A;  3LJA A;  3A6N C;  5DNN C;  1KX4 A;  3B0D B;  2PYO A;  3X1S A;  5CPJ C;  2ARO C;  5AV9 C;  5CP6 B;  5JRG A;  5B1M B;  3MVD D;  3REK A;  3AZL C;  2HIO B;  4WNN B;  1P3K D;  1P34 A;  1ZLA D;  4H9N A;  5E5A A;  4QLC D;  3REJ D;  3REI D;  3MVD C;  1ID3 A;  3W98 B;  4KUD B;  4G91 B;  4R8P D;  1P3K C;  1ZLA C;  4QLC C;  3REJ C;  5B24 A;  1TAF A;  3REL A;  3REI C;  3AZN D;  1P3B A;  5JA4 A;  5AV5 B;  5AVC D;  4KHA B;  4Z5T B;  5GT0 B;  1N1J B;  4HGA B;  1P3G A;  5C3I C;  1F1E A;  4X23 A;  1KX4 D;  4R8P C;  1AOI A;  3REK D;  1U35 B;  2PYO B;  5JRG B;  5DNM B;  3W97 B;  1KX4 C;  1P34 D;  3AZG B;  4CAY B;  3B6G A;  3KUY A;  5E5A D;  5FUG A;  3REK C;  1ID3 D;  4KGC B;  5AY8 A;  1B6W A;  1M1A B;  4YM6 D;  3B0C W;  1P34 C;  4AWL C;  5CPI B;  4ZUX A;  1P3F D;  5E5A C;  3MNN D;  2CWE A;  3REL D;  3W96 A;  1P3B D;  1ID3 C;  4WV4 B;  3AZE A;  4J8X A;  1HQ3 A;  4X23 D;  5B40 D;  5G49 B;  3MGS D;  2CV5 D;  1M19 A;  4YM6 C;  3LZ0 A;  3X1T B;  1P3F C;  3MGQ B;  5B31 G;  5BNV A;  5B24 C;  3MNN C;  3REL C;  3KWQ A;  2FJ7 A;  1P3B C;  3KXB A;  5AV6 A;  1H3O B;  3AZH D;  1P3A D;  3B6F D;  4X23 C;  2BYK A;  2IO5 C;  3MGS C;  5B40 C;  2CV5 C;  1Q9C A;  3VH5 W;  3KUY D;  4J8U B;  3C1C A;  3AN2 D;  3X1U B;  4WU9 D;  4EO5 C;  3AZH C;  1F66 D;  3WAA A;  3B6F C;  5B31 A;  4ZUX D;  3KUY C;  3W99 A;  5GT3 B;  3AN2 C;  2F8N H;  3AZM B;  2HUE C;  4WU9 C;  5B33 A;  4J8X D;  1F66 C;  5DNN A;  3REH A;  2NZD B;  4H9Q A;  1M19 D;  4WU8 B;  3AZI B;  3UTB D;  4ZUX C;  3UTA A;  4LD9 B;  1P3L B;  3AZE C;  3NQU A;  2FJ7 B;  1EQZ A;  4J8X C;  1HQ3 C;  1M19 C;  3WTP B;  5B2J B;  3UTB C;  3WKJ D;  4CSR A;  4J8V A;  3X1V A;  3C1C D;  4Z66 A;  3LZ1 A;  3MVD A;  3AYW B;  3VH6 T;  5B2I B;  3UT9 D;  3AZF B;  5B32 D;  5GXQ B;  5B31 D;  1P3K A;  3AZK D;  3V9R B;  3WA9 D;  3WKJ C;  3REJ A;  3C1C C;  3AZJ B;  3W99 B;  3UT9 C;  5GSU D;  5B33 D;  5B0Z B;  3C1B B;  1BH9 A;  2YFW A;  5B32 C;  3REH D;  1KX3 B;  5B31 C;  4R8P A;  3A6N B;  3AZK C;  4XUJ B;  3WA9 C;  3AV1 D;  3UTA D;  3AZN A;  5CPJ B;  2ARO B;  5AV9 B;  5AVC A;  3O62 D;  4G92 B;  5KDM A;  5GSU C;  5B33 C;  3AZL B;  1EQZ D;  3REH C;  4J8V D;  3X1V D;  4Z66 D;  3UTA C;  3LZ1 D;  3AV1 C;  4CSR B;  4JJN B;  5BT1 D;  3O62 C;  3MVD B;  4H9S A;  3B0C T;  1EQZ C;  3AV2 B;  4ZBJ C;  4DRB A;  2F8N D;  3MGP A;  4H9P A;  3X1V C;  4J8V C;  4Z66 C;  1ZLA B;  3LZ1 C;  4QLC B;  3REJ B;  5BT1 C;  3LEL A;  5AV8 D;  3REI B;  1P3M D;  4YM6 A;  1M18 B;  1P3F A;  3MNN A;  5B1M D;  3AFA B;  1ULY A;  5AV8 C;  1P3M C;  5B40 A;  2CV5 A;  3LJA B;  3MGS A;  1TZY A;  1KX4 B;  3AZN C;  5B1M C;  4UUZ A;  3X1S B;  4YS3 A;  3W98 D;  4KUD D;  5AVC C;  3REK B;  4NE5 A;  3AZH A;  3MGR D;  1P3A A;  3B6F A;  3MGP D;  1P34 B;  4AWL B;  2YFV A;  4H9N B;  3AN2 A;  5E5A B;  5AV5 D;  4H9P B;  3W98 C;  3LEL D;  4Z5T D;  5GT0 D;  4KUD C;  4WU9 A;  4H9S C;  1ID3 B;  1F66 A;  3MGR C;  4G91 C;  1R4V A;  4XZQ A;  3MGP C;  3KSY A;  1U35 D;  1P3I A;  5AV5 C;  5B24 B;  1TAF B;  3LEL C;  4Z5T C;  5GT0 C;  3REL B;  1P3B B;  5JA4 B;  3W97 D;  1P3G B;  1TZY D;  3UTB A;  5B0Y D;  4X23 B;  2IO5 B;  3MGS B;  2CV5 B;  5B32 G;  1U35 C;  1AOI B;  4YS3 D;  4H9O A;  1P3P A;  3W97 C;  4EO5 B;  2BYM A;  1M1A D;  1TZY C;  3WKJ A;  5B0Y C;  3B6G B;  3KUY B;  4YS3 C;  2YFV B;  5FUG B;  3UT9 A;  3AN2 B;  5CPK A;  1BFM A;  5B32 A;  3WTP E;  3NQJ A;  4WU9 B;  1P3A C;  4XZQ D;  1M1A C;  3AZK A;  3WA9 A;  5AY8 B;  4H9R A;  5CHL B;  4ZUX B;  5BNX A;  1P3I D;  3W96 B;  5GSU A;  3TU4 A;  3AZE B;  5B1L A;  1HQ3 B;  4XZQ C;  4J8X B;  2RVQ D;  4J8U D;  1M19 B;  5AVB A;  3AV1 A;  2NQB A;  3LZ0 B;  5F99 D;  1P3I C;  3O62 A;  5BNV B;  2F8N G;  3KWQ B;  3KXB B;  5AV6 B;  1P3P D;  2RVQ C;  2BYK B;  4J8U C;  3WKJ B;  3R45 A;  5F99 C;  3C1C B;  4J8W A;  5CPK D;  1P3P C;  3AZI D;  1S32 D;  3WAA B;  5B31 B;  2F8N A;  1P3O A;  3VH6 A;  4H9R B;  5AV8 A;  1KX5 D;  3TU4 D;  5CPK C;  1P3M A;  5B33 B;  5B2J D;  5B1L D;  3AZI C;  1S32 C;  5DNN B;  3REH B;  4H9Q B;  5AVB D;  5CP6 A;  2NQB D;  5B1M A;  5B2I D;  3UTA B;  2HIO A;  2F8N K;  4WNN A;  1KX5 C;  3TU4 C;  3AZF D;  3NQU B;  1EQZ B;  5B2J C;  5B1L C;  1KU5 A;  4ZBJ B;  4Z2M H;  5AVB C;  3AZJ D;  2NQB C;  5B2I C;  4J8V B;  3X1V B;  3W98 A;  4Z66 B;  4KUD A;  3LZ1 B;  3R45 B;  4J8W D;  3C1B D;  3AZF C;  3MGR A;  1KX3 D;  5BS7 C;  4XUJ D;  1P3K B;  3B0B A;  3AZJ C;  5AV5 A;  1P3O D;  4KHA A;  4Z5T A;  5GT0 A;  1N1J A;  4J8W C;  1A7W A;  3C1B C;  1KX3 C;  1P3M B;  5C3I B;  1BH9 B;  2YFW B;  4XUJ C;  4R8P B;  5CP6 D;  1U35 A;  2LY8 A;  4JJN D;  1P3O C;  5DNM A;  4G92 C;  2HIO D;  3AZN B;  3VH5 T;  5AVC B;  4NE6 A;  3W97 A;  3AV2 D;  5KDM B;  3AZG A;  4CAY A;  3B0D C;  5B0Y A;  5CP6 C;  4JJN C;  4KGC A;  2HIO C;  3VH5 A;  3AV2 C;  1M1A A;  3MGR B;  3VH6 W;  1M18 D;  5CPI A;  3AFA D;  3MGP B;  4E45 A;  3LEL B;  1BH8 A;  5G49 A;  3LJA D;  1M18 C;  3X1T A;  5BO0 A;  3MGQ A;  4YM6 B;  2PYO D;  3AFA C;  4E44 A;  3X1S D;  1P3F B;  3MNN B;  5JRG D;  5DNM D;  4HGA C;  1H3O A;  3LJA C;  3AZG D;  5B40 B;  4J8U A;  1TZY B;  5B0Y B;  2PYO C;  5F99 A;  3X1S C;  4KGC D;  3X1U A;  5JRG C;  5DNM C;  4UUZ B;  4YS3 B;  2L5A A;  3AZH B;  4NE3 A;  1P3A B;  3AZG C;  3B6F B;  5CPI D;  4M6B A;  5GT3 A;  3AZM A;  5B24 D;  4KGC C;  2HUE B;  2NZD A;  1P3G D;  4WU8 A;  3AZI A;  1S32 A;  1F66 B;  1BH8 B;  3X1T D;  5CPI C;  4XZQ B;  3MGQ D;  4LD9 A;  1AOI D;  5BO0 B;  1P3L A;  1P3I B;  1KX5 A;  5B2J A;  3WTP A;  1P3G C;  3X1T C;  1WWI A;  3MGQ C;  3UTB B;  3AYW A;  3B6G D;  5B2I A;  1AOI C;  3X1U D;  5F99 B;  3AZF A;  4H9O B;  5GXQ A;  5BS7 A;  1P3P B;  3V9R A;  5AY8 D;  2BYM B;  1JFI A; 
#chains in the Genus database with same CATH topology
 3AZJ A;  5GT3 D;  3B6G C;  3AZM D;  3X1U C;  3A1I A;  2FFF B;  3W96 D;  5B0Z A;  1WWS A;  3C1B A;  3UT9 B;  3AZE D;  1KX3 A;  5CPK B;  2NZD D;  1HQ3 D;  3A6N A;  4WU8 D;  5B32 B;  1B67 A;  3NQJ B;  5AY8 C;  4XUJ A;  1S32 B;  3AZK B;  3LZ0 D;  3WA9 B;  4LD9 D;  5GT3 C;  5CPJ A;  2ARO A;  5AV9 A;  3AZM C;  3FDD A;  3EG5 B;  1P3L D;  4DRA A;  3W96 C;  5BNX B;  3KWQ D;  3AZL A;  2FJ7 D;  3KXB D;  5AV6 D;  1KX5 B;  5GSU B;  3TU4 B;  2NZD C;  3WTP D;  4WU8 C;  5B1L B;  4NFT A;  3LZ0 C;  3AYW D;  1HTA A;  4JJN A;  4LD9 C;  5AVB B;  3AV1 B;  2NQB B;  1P3L C;  3KWQ C;  2FJ7 C;  3O62 B;  3KXB C;  5AV6 C;  3AV2 A;  5GXQ D;  2Y2H A;  3WTP C;  3WAA D;  1ZLA A;  3AYW C;  4QLC A;  1JFI B;  3W99 D;  3REI A;  5B0Z D;  4J8W B;  4WZS B;  5GXQ C;  3A6N D;  5DNN D;  1M18 A;  3WAA C;  2RIQ A;  4Z2M G;  3AFA A;  5CPJ D;  2F8N B;  2ARO D;  5AV9 D;  3W99 C;  1P3O B;  3AZL D;  5B0Z C;  5AV8 B;  3H0R C;  2JSS A;  3LJA A;  3A6N C;  5DNN C;  1KX4 A;  3B0D B;  3F6T A;  2PYO A;  3X1S A;  5CPJ C;  2ARO C;  5AV9 C;  5CP6 B;  5JRG A;  5B1M B;  3MVD D;  3REK A;  3AZL C;  2HIO B;  4WNN B;  1P3K D;  1P34 A;  4DQY B;  1ZLA D;  4H9N A;  5E5A A;  4QLC D;  3REJ D;  3REI D;  3MVD C;  1ID3 A;  3W98 B;  4KUD B;  4G91 B;  4R8P D;  1P3K C;  1ZLA C;  4QLC C;  3REJ C;  5B24 A;  1TAF A;  3REL A;  3REI C;  3AZN D;  1P3B A;  5JA4 A;  5AV5 B;  5AVC D;  4KHA B;  4Z5T B;  5GT0 B;  1N1J B;  4HGA B;  1P3G A;  5C3I C;  1F1E A;  4X23 A;  1KX4 D;  4R8P C;  1AOI A;  3REK D;  1U35 B;  2PYO B;  5JRG B;  5DNM B;  3W97 B;  1KX4 C;  2DQN C;  3AZG B;  4CAY B;  1P34 D;  3B6G A;  3KUY A;  5E5A D;  5FUG A;  3REK C;  1ID3 D;  4KGC B;  5AY8 A;  1B6W A;  1M1A B;  4YM6 D;  3B0C W;  1P34 C;  4AWL C;  5CPI B;  4ZUX A;  1P3F D;  5E5A C;  3MNN D;  2CWE A;  3REL D;  3W96 A;  1P3B D;  1ID3 C;  4WV4 B;  2XD1 A;  3AZE A;  4J8X A;  1HQ3 A;  4X23 D;  5B40 D;  5G49 B;  3MGS D;  2CV5 D;  1M19 A;  4YM6 C;  3LZ0 A;  2VQR A;  3X1T B;  1P3F C;  3MGQ B;  5B31 G;  5BNV A;  5B24 C;  3MNN C;  3REL C;  3KWQ A;  2FJ7 A;  1P3B C;  3KXB A;  2Y2M A;  5AV6 A;  1H3O B;  3AZH D;  1P3A D;  3B6F D;  4X23 C;  2BYK A;  2IO5 C;  3MGS C;  5B40 C;  2CV5 C;  1Q9C A;  3VH5 W;  3KUY D;  4J8U B;  3C1C A;  2Y2G A;  3AN2 D;  2Y2I A;  2ZY4 A;  3X1U B;  4WU9 D;  4EO5 C;  3AZH C;  1F66 D;  3WAA A;  3B6F C;  5B31 A;  4ZUX D;  3KUY C;  3W99 A;  5GT3 B;  3AN2 C;  2F8N H;  3AZM B;  2HUE C;  4WU9 C;  5B33 A;  4J8X D;  1F66 C;  5DNN A;  3REH A;  2NZD B;  4H9Q A;  1M19 D;  4WU8 B;  3AZI B;  3UTB D;  4ZUX C;  3UTA A;  4LD9 B;  1P3L B;  3AZE C;  3NQU A;  2FJ7 B;  1EQZ A;  4J8X C;  1HQ3 C;  2JE5 A;  1M19 C;  3WTP B;  5B2J B;  3UTB C;  3WKJ D;  4CSR A;  4J8V A;  3X1V A;  3C1C D;  4Z66 A;  3LZ1 A;  3MVD A;  3AYW B;  3VH6 T;  5B2I B;  3UT9 D;  3AZF B;  5B32 D;  5GXQ B;  5B31 D;  1P3K A;  3AZK D;  3V9R B;  3WA9 D;  3WKJ C;  3REJ A;  3C1C C;  3AZJ B;  3W99 B;  3UT9 C;  2Y2O A;  5GSU D;  5B33 D;  5B0Z B;  3C1B B;  1BH9 A;  2YFW A;  5B32 C;  3REH D;  1KX3 B;  5B31 C;  4R8P A;  3A6N B;  3AZK C;  3EPK A;  4XUJ B;  3EPL A;  3WA9 C;  3AV1 D;  3UTA D;  3AZN A;  5CPJ B;  2ARO B;  5AV9 B;  5AVC A;  3O62 D;  4G92 B;  5KDM A;  5GSU C;  5B33 C;  3AZL B;  1EQZ D;  3REH C;  4J8V D;  3X1V D;  4Z66 D;  3UTA C;  3LZ1 D;  3AV1 C;  4CSR B;  3H0M C;  4JJN B;  5BT1 D;  3O62 C;  3MVD B;  4H9S A;  3B0C T;  1EQZ C;  3AV2 B;  4ZBJ C;  4DRB A;  2F8N D;  3MGP A;  4H9P A;  3X1V C;  4J8V C;  4Z66 C;  1ZLA B;  3LZ1 C;  3AL0 C;  4QLC B;  3REJ B;  5BT1 C;  3LEL A;  5AV8 D;  3REI B;  1P3M D;  4YM6 A;  1M18 B;  1P3F A;  3MNN A;  5B1M D;  3AFA B;  1ULY A;  5AV8 C;  2ZM5 A;  2ZY2 A;  3KFU G;  1P3M C;  2G5H C;  5B40 A;  3LJA B;  3MGS A;  2CV5 A;  1TZY A;  1KX4 B;  3AZN C;  5B1M C;  4UUZ A;  3X1S B;  4YS3 A;  3W98 D;  4KUD D;  5AVC C;  3REK B;  4NE5 A;  3AZH A;  3MGR D;  1P3A A;  3B6F A;  3MGP D;  1P34 B;  4AWL B;  2YFV A;  4H9N B;  3AN2 A;  5E5A B;  5AV5 D;  4H9P B;  3W98 C;  3LEL D;  4Z5T D;  5GT0 D;  4KUD C;  4WU9 A;  4H9S C;  1ID3 B;  1F66 A;  3MGR C;  4G91 C;  3EPJ A;  1R4V A;  4XZQ A;  2Y2N A;  3MGP C;  3EPH A;  2JCH A;  3KSY A;  1U35 D;  1P3I A;  3A1K A;  3IP4 C;  5AV5 C;  5B24 B;  1TAF B;  3LEL C;  4Z5T C;  5GT0 C;  3REL B;  1P3B B;  5JA4 B;  3W97 D;  1P3G B;  2Y2J A;  1TZY D;  3UTB A;  5B0Y D;  4X23 B;  2IO5 B;  3MGS B;  2CV5 B;  5B32 G;  1U35 C;  1AOI B;  4YS3 D;  4H9O A;  1P3P A;  3W97 C;  4EO5 B;  2BYM A;  1M1A D;  1TZY C;  3WKJ A;  5B0Y C;  3B6G B;  3KUY B;  4YS3 C;  2YFV B;  5FUG B;  3UT9 A;  3AN2 B;  2UWX A;  5CPK A;  1BFM A;  5B32 A;  3WTP E;  3NQJ A;  3P5J B;  4WU9 B;  1P3A C;  4XZQ D;  1M1A C;  3AZK A;  3WA9 A;  5AY8 B;  4H9R A;  2Y2L A;  5CHL B;  4ZUX B;  5BNX A;  1P3I D;  3W96 B;  5GSU A;  3TU4 A;  3AZE B;  5B1L A;  1HQ3 B;  4XZQ C;  4J8X B;  2RVQ D;  4J8U D;  1M19 B;  5AVB A;  3AV1 A;  2NQB A;  3LZ0 B;  5F99 D;  1P3I C;  3O62 A;  5BNV B;  2F8N G;  3KWQ B;  3KXB B;  1Z2C B;  5AV6 B;  1P3P D;  2RVQ C;  2BYK B;  4J8U C;  3WKJ B;  3R45 A;  5F99 C;  3C1C B;  4J8W A;  5CPK D;  1P3P C;  3AZI D;  1S32 D;  4UPK A;  2F2A C;  2G5I C;  3WAA B;  5B31 B;  2F8N A;  1P3O A;  3VH6 A;  4H9R B;  5AV8 A;  1KX5 D;  3TU4 D;  5CPK C;  1P3M A;  5B33 B;  5B2J D;  5B1L D;  3AZI C;  1S32 C;  5DNN B;  3REH B;  4H9Q B;  5AVB D;  3H0L C;  5CP6 A;  5B1M A;  2NQB D;  5B2I D;  3UTA B;  2HIO A;  2F8N K;  4WNN A;  1KX5 C;  3TU4 C;  3AZF D;  3NQU B;  1EQZ B;  5B2J C;  5B1L C;  1KU5 A;  4ZBJ B;  4Z2M H;  5AVB C;  3AZJ D;  2NQB C;  5B2I C;  4J8V B;  3X1V B;  3W98 A;  4Z66 B;  4KUD A;  3LZ1 B;  3R45 B;  4J8W D;  3C1B D;  3AZF C;  3MGR A;  1KX3 D;  5BS7 C;  4XUJ D;  2XD5 A;  1P3K B;  3B0B A;  3AZJ C;  4WJ3 C;  5AV5 A;  1P3O D;  4KHA A;  4Z5T A;  5GT0 A;  1N1J A;  4J8W C;  1A7W A;  3C1B C;  2Y2K A;  1KX3 C;  1P3M B;  5C3I B;  1BH9 B;  2YFW B;  4XUJ C;  4R8P B;  5CP6 D;  1U35 A;  2LY8 A;  4JJN D;  1P3O C;  5DNM A;  4G92 C;  2HIO D;  3AZN B;  3VH5 T;  2BG1 A;  2J8P A;  5AVC B;  4NE6 A;  3W97 A;  3AV2 D;  5KDM B;  3AZG A;  4CAY A;  3B0D C;  5B0Y A;  5CP6 C;  4JJN C;  4KGC A;  2HIO C;  3VH5 A;  3AV2 C;  1M1A A;  3MGR B;  3VH6 W;  1M18 D;  5CPI A;  3AFA D;  2Y2P A;  3MGP B;  4E45 A;  3LEL B;  2ZY3 A;  1BH8 A;  5G49 A;  3LJA D;  1M18 C;  3X1T A;  5BO0 A;  2ZY5 A;  3MGQ A;  4YM6 B;  2PYO D;  3AFA C;  4E44 A;  3X1S D;  1P3F B;  3MNN B;  5JRG D;  5DNM D;  4HGA C;  1H3O A;  3LJA C;  3AZG D;  5B40 B;  4J8U A;  1TZY B;  5B0Y B;  2PYO C;  5F99 A;  3X1S C;  4KGC D;  3X1U A;  5JRG C;  5DNM C;  4UUZ B;  4YS3 B;  2L5A A;  3AZH B;  4NE3 A;  1P3A B;  3AZG C;  3B6F B;  5CPI D;  1T3U A;  4M6B A;  5GT3 A;  3AZM A;  5B24 D;  4KGC C;  2HUE B;  2NZD A;  1P3G D;  4WU8 A;  3AZI A;  1S32 A;  1F66 B;  1BH8 B;  3X1T D;  5CPI C;  4XZQ B;  3MGQ D;  4LD9 A;  1AOI D;  5BO0 B;  1P3L A;  2DF4 C;  1P3I B;  1KX5 A;  5B2J A;  3WTP A;  1P3G C;  3X1T C;  1WWI A;  3MGQ C;  3UTB B;  3AYW A;  3B6G D;  2Y2Q A;  5B2I A;  1AOI C;  2W8S A;  1W2E A;  3X1U D;  5F99 B;  3AZF A;  4H9O B;  5GXQ A;  5BS7 A;  1P3P B;  1PZR A;  3V9R A;  5AY8 D;  2BYM B;  1JFI A; 
#chains in the Genus database with same CATH homology
 3AZJ A;  5GT3 D;  3B6G C;  3AZM D;  3X1U C;  3A1I A;  2FFF B;  3W96 D;  5B0Z A;  1WWS A;  3C1B A;  3UT9 B;  3AZE D;  1KX3 A;  5CPK B;  2NZD D;  1HQ3 D;  3A6N A;  4WU8 D;  5B32 B;  1B67 A;  3NQJ B;  5AY8 C;  4XUJ A;  1S32 B;  3AZK B;  3LZ0 D;  3WA9 B;  4LD9 D;  5GT3 C;  5CPJ A;  2ARO A;  5AV9 A;  3AZM C;  3FDD A;  3EG5 B;  1P3L D;  4DRA A;  3W96 C;  5BNX B;  3KWQ D;  3AZL A;  2FJ7 D;  3KXB D;  5AV6 D;  1KX5 B;  5GSU B;  3TU4 B;  2NZD C;  3WTP D;  4WU8 C;  5B1L B;  4NFT A;  3LZ0 C;  3AYW D;  1HTA A;  4JJN A;  4LD9 C;  5AVB B;  3AV1 B;  2NQB B;  1P3L C;  3KWQ C;  2FJ7 C;  3O62 B;  3KXB C;  5AV6 C;  3AV2 A;  5GXQ D;  2Y2H A;  3WTP C;  3WAA D;  1ZLA A;  3AYW C;  4QLC A;  1JFI B;  3W99 D;  3REI A;  5B0Z D;  4J8W B;  4WZS B;  5GXQ C;  3A6N D;  5DNN D;  1M18 A;  3WAA C;  2RIQ A;  4Z2M G;  3AFA A;  5CPJ D;  2F8N B;  2ARO D;  5AV9 D;  3W99 C;  1P3O B;  3AZL D;  5B0Z C;  5AV8 B;  3H0R C;  2JSS A;  3LJA A;  3A6N C;  5DNN C;  1KX4 A;  3B0D B;  3F6T A;  2PYO A;  3X1S A;  5CPJ C;  2ARO C;  5AV9 C;  5CP6 B;  5JRG A;  5B1M B;  3MVD D;  3REK A;  3AZL C;  2HIO B;  4WNN B;  1P3K D;  1P34 A;  4DQY B;  1ZLA D;  4H9N A;  5E5A A;  4QLC D;  3REJ D;  3REI D;  3MVD C;  1ID3 A;  3W98 B;  4KUD B;  4G91 B;  4R8P D;  1P3K C;  1ZLA C;  4QLC C;  3REJ C;  5B24 A;  1TAF A;  3REL A;  3REI C;  3AZN D;  1P3B A;  5JA4 A;  5AV5 B;  5AVC D;  4KHA B;  4Z5T B;  5GT0 B;  1N1J B;  4HGA B;  1P3G A;  5C3I C;  1F1E A;  4X23 A;  1KX4 D;  4R8P C;  1AOI A;  3REK D;  1U35 B;  2PYO B;  5JRG B;  5DNM B;  3W97 B;  1KX4 C;  2DQN C;  3AZG B;  4CAY B;  1P34 D;  3B6G A;  3KUY A;  5E5A D;  5FUG A;  3REK C;  1ID3 D;  4KGC B;  5AY8 A;  1B6W A;  1M1A B;  4YM6 D;  3B0C W;  1P34 C;  4AWL C;  5CPI B;  4ZUX A;  1P3F D;  5E5A C;  3MNN D;  2CWE A;  3REL D;  3W96 A;  1P3B D;  1ID3 C;  4WV4 B;  2XD1 A;  3AZE A;  4J8X A;  1HQ3 A;  4X23 D;  5B40 D;  5G49 B;  3MGS D;  2CV5 D;  1M19 A;  4YM6 C;  3LZ0 A;  2VQR A;  3X1T B;  1P3F C;  3MGQ B;  5B31 G;  5BNV A;  5B24 C;  3MNN C;  3REL C;  3KWQ A;  2FJ7 A;  1P3B C;  3KXB A;  2Y2M A;  5AV6 A;  1H3O B;  3AZH D;  1P3A D;  3B6F D;  4X23 C;  2BYK A;  2IO5 C;  3MGS C;  5B40 C;  2CV5 C;  1Q9C A;  3VH5 W;  3KUY D;  4J8U B;  3C1C A;  2Y2G A;  3AN2 D;  2Y2I A;  2ZY4 A;  3X1U B;  4WU9 D;  4EO5 C;  3AZH C;  1F66 D;  3WAA A;  3B6F C;  5B31 A;  4ZUX D;  3KUY C;  3W99 A;  5GT3 B;  3AN2 C;  2F8N H;  3AZM B;  2HUE C;  4WU9 C;  5B33 A;  4J8X D;  1F66 C;  5DNN A;  3REH A;  2NZD B;  4H9Q A;  1M19 D;  4WU8 B;  3AZI B;  3UTB D;  4ZUX C;  3UTA A;  4LD9 B;  1P3L B;  3AZE C;  3NQU A;  2FJ7 B;  1EQZ A;  4J8X C;  1HQ3 C;  2JE5 A;  1M19 C;  3WTP B;  5B2J B;  3UTB C;  3WKJ D;  4CSR A;  4J8V A;  3X1V A;  3C1C D;  4Z66 A;  3LZ1 A;  3MVD A;  3AYW B;  3VH6 T;  5B2I B;  3UT9 D;  3AZF B;  5B32 D;  5GXQ B;  5B31 D;  1P3K A;  3AZK D;  3V9R B;  3WA9 D;  3WKJ C;  3REJ A;  3C1C C;  3AZJ B;  3W99 B;  3UT9 C;  2Y2O A;  5GSU D;  5B33 D;  5B0Z B;  3C1B B;  1BH9 A;  2YFW A;  5B32 C;  3REH D;  1KX3 B;  5B31 C;  4R8P A;  3A6N B;  3AZK C;  3EPK A;  4XUJ B;  3EPL A;  3WA9 C;  3AV1 D;  3UTA D;  3AZN A;  5CPJ B;  2ARO B;  5AV9 B;  5AVC A;  3O62 D;  4G92 B;  5KDM A;  5GSU C;  5B33 C;  3AZL B;  1EQZ D;  3REH C;  4J8V D;  3X1V D;  4Z66 D;  3UTA C;  3LZ1 D;  3AV1 C;  4CSR B;  3H0M C;  4JJN B;  5BT1 D;  3O62 C;  3MVD B;  4H9S A;  3B0C T;  1EQZ C;  3AV2 B;  4ZBJ C;  4DRB A;  2F8N D;  3MGP A;  4H9P A;  3X1V C;  4J8V C;  4Z66 C;  1ZLA B;  3LZ1 C;  3AL0 C;  4QLC B;  3REJ B;  5BT1 C;  3LEL A;  5AV8 D;  3REI B;  1P3M D;  4YM6 A;  1M18 B;  1P3F A;  3MNN A;  5B1M D;  3AFA B;  1ULY A;  5AV8 C;  2ZM5 A;  2ZY2 A;  3KFU G;  1P3M C;  2G5H C;  5B40 A;  3LJA B;  3MGS A;  2CV5 A;  1TZY A;  1KX4 B;  3AZN C;  5B1M C;  4UUZ A;  3X1S B;  4YS3 A;  3W98 D;  4KUD D;  5AVC C;  3REK B;  4NE5 A;  3AZH A;  3MGR D;  1P3A A;  3B6F A;  3MGP D;  1P34 B;  4AWL B;  2YFV A;  4H9N B;  3AN2 A;  5E5A B;  5AV5 D;  4H9P B;  3W98 C;  3LEL D;  4Z5T D;  5GT0 D;  4KUD C;  4WU9 A;  4H9S C;  1ID3 B;  1F66 A;  3MGR C;  4G91 C;  3EPJ A;  1R4V A;  4XZQ A;  2Y2N A;  3MGP C;  3EPH A;  2JCH A;  3KSY A;  1U35 D;  1P3I A;  3A1K A;  3IP4 C;  5AV5 C;  5B24 B;  1TAF B;  3LEL C;  4Z5T C;  5GT0 C;  3REL B;  1P3B B;  5JA4 B;  3W97 D;  1P3G B;  2Y2J A;  1TZY D;  3UTB A;  5B0Y D;  4X23 B;  2IO5 B;  3MGS B;  2CV5 B;  5B32 G;  1U35 C;  1AOI B;  4YS3 D;  4H9O A;  1P3P A;  3W97 C;  4EO5 B;  2BYM A;  1M1A D;  1TZY C;  3WKJ A;  5B0Y C;  3B6G B;  3KUY B;  4YS3 C;  2YFV B;  5FUG B;  3UT9 A;  3AN2 B;  2UWX A;  5CPK A;  1BFM A;  5B32 A;  3WTP E;  3NQJ A;  3P5J B;  4WU9 B;  1P3A C;  4XZQ D;  1M1A C;  3AZK A;  3WA9 A;  5AY8 B;  4H9R A;  2Y2L A;  5CHL B;  4ZUX B;  5BNX A;  1P3I D;  3W96 B;  5GSU A;  3TU4 A;  3AZE B;  5B1L A;  1HQ3 B;  4XZQ C;  4J8X B;  2RVQ D;  4J8U D;  1M19 B;  5AVB A;  3AV1 A;  2NQB A;  3LZ0 B;  5F99 D;  1P3I C;  3O62 A;  5BNV B;  2F8N G;  3KWQ B;  3KXB B;  1Z2C B;  5AV6 B;  1P3P D;  2RVQ C;  2BYK B;  4J8U C;  3WKJ B;  3R45 A;  5F99 C;  3C1C B;  4J8W A;  5CPK D;  1P3P C;  3AZI D;  1S32 D;  4UPK A;  2F2A C;  2G5I C;  3WAA B;  5B31 B;  2F8N A;  1P3O A;  3VH6 A;  4H9R B;  5AV8 A;  1KX5 D;  3TU4 D;  5CPK C;  1P3M A;  5B33 B;  5B2J D;  5B1L D;  3AZI C;  1S32 C;  5DNN B;  3REH B;  4H9Q B;  5AVB D;  3H0L C;  5CP6 A;  5B1M A;  2NQB D;  5B2I D;  3UTA B;  2HIO A;  2F8N K;  4WNN A;  1KX5 C;  3TU4 C;  3AZF D;  3NQU B;  1EQZ B;  5B2J C;  5B1L C;  1KU5 A;  4ZBJ B;  4Z2M H;  5AVB C;  3AZJ D;  2NQB C;  5B2I C;  4J8V B;  3X1V B;  3W98 A;  4Z66 B;  4KUD A;  3LZ1 B;  3R45 B;  4J8W D;  3C1B D;  3AZF C;  3MGR A;  1KX3 D;  5BS7 C;  4XUJ D;  2XD5 A;  1P3K B;  3B0B A;  3AZJ C;  4WJ3 C;  5AV5 A;  1P3O D;  4KHA A;  4Z5T A;  5GT0 A;  1N1J A;  4J8W C;  1A7W A;  3C1B C;  2Y2K A;  1KX3 C;  1P3M B;  5C3I B;  1BH9 B;  2YFW B;  4XUJ C;  4R8P B;  5CP6 D;  1U35 A;  2LY8 A;  4JJN D;  1P3O C;  5DNM A;  4G92 C;  2HIO D;  3AZN B;  3VH5 T;  2BG1 A;  2J8P A;  5AVC B;  4NE6 A;  3W97 A;  3AV2 D;  5KDM B;  3AZG A;  4CAY A;  3B0D C;  5B0Y A;  5CP6 C;  4JJN C;  4KGC A;  2HIO C;  3VH5 A;  3AV2 C;  1M1A A;  3MGR B;  3VH6 W;  1M18 D;  5CPI A;  3AFA D;  2Y2P A;  3MGP B;  4E45 A;  3LEL B;  2ZY3 A;  1BH8 A;  5G49 A;  3LJA D;  1M18 C;  3X1T A;  5BO0 A;  2ZY5 A;  3MGQ A;  4YM6 B;  2PYO D;  3AFA C;  4E44 A;  3X1S D;  1P3F B;  3MNN B;  5JRG D;  5DNM D;  4HGA C;  1H3O A;  3LJA C;  3AZG D;  5B40 B;  4J8U A;  1TZY B;  5B0Y B;  2PYO C;  5F99 A;  3X1S C;  4KGC D;  3X1U A;  5JRG C;  5DNM C;  4UUZ B;  4YS3 B;  2L5A A;  3AZH B;  4NE3 A;  1P3A B;  3AZG C;  3B6F B;  5CPI D;  1T3U A;  4M6B A;  5GT3 A;  3AZM A;  5B24 D;  4KGC C;  2HUE B;  2NZD A;  1P3G D;  4WU8 A;  3AZI A;  1S32 A;  1F66 B;  1BH8 B;  3X1T D;  5CPI C;  4XZQ B;  3MGQ D;  4LD9 A;  1AOI D;  5BO0 B;  1P3L A;  2DF4 C;  1P3I B;  1KX5 A;  5B2J A;  3WTP A;  1P3G C;  3X1T C;  1WWI A;  3MGQ C;  3UTB B;  3AYW A;  3B6G D;  2Y2Q A;  5B2I A;  1AOI C;  2W8S A;  1W2E A;  3X1U D;  5F99 B;  3AZF A;  4H9O B;  5GXQ A;  5BS7 A;  1P3P B;  1PZR A;  3V9R A;  5AY8 D;  2BYM B;  1JFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...