3VH6T

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
EPEIASSLIKQIFSHYVKTPVTRDAYKIVEKASERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 31
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh6T00
2PYOA 3WTPA 2AROD 3W98A 2YFVB 4R8PA 5B24D 3AV2D 3AZIA 3KSYA 3MGQC 4J8WC 1P3PA 5AV6A 5B0ZD 4ZUXA 3UTBD 1AOIA 2CV5C 3AZJD 5E5AA 2BYKB 1JFIB 5AV9A 3AZEB 2HUEB 3W97B 5AY8C 4Z66C 3W99D 3AZGA 1TAFB 3X1VA 3AV2C 4X23A 4LD9A 1P3AC 5GT3C 3AN2D 5KDMB 3KWQC 3AZMB 3W98D 5GT0A 3UTBC 1P34B 1WWIA 5AVCA 1KX5A 3O62B 1P3PD 3VH6A 5AV6D 3AZND 1M18A 4KUDA 4ZUXD 1AOID 5CPJA 3LJAB 5E5AD 3LELA 3WA9C 5AV9D 1TZYB 2YFVA 3AZGD 3AN2C 3MGRB 3X1VD 3W98C 1KU5A 4LD9D 4X23D 3AZFB 3X1UC 5B33C 1BH9A 4G92B 1S32A 3AZNC 1P3FC 2BYKA 1JFIA 2FJ7C 3AZEA 1AOIC 5AVCD 4CAYB 3MNNC 1KX5D 3B6GB 1M18D 4KUDD 1TAFA 5CPJD 4EO5B 3LELD 3VH6T 1P3GD 3REJC 1M19B 4QLCB 3AZMA 1ID3B 5B1MB 1P3KB 1P34A 3AZLB 3O62A 5B32B 1U35C 3LZ1B 5F99B 4WU9C 2YFWB 5JRGC 3REHC 3LJAA 4KUDC 5GXQB 5B31B 3AZED 5CPJC 1TZYA 1B67A 3W97D 1P3GC 3MGRA 4H9RB 3UTAB 3RELB 1ZLAC 3AZFA 3KUYB 4DRAA 2PYOB 3WTPB 4XUJB 3REKC 3AZMD 3C1CB 4XZQC 4R8PB 5B2JC 3X1TB 1P34D 1P3BC 4YS3B 4CAYA 3KXBA 3AZHB 3O62D 5GSUB 3B6GA 5B2IB 3W97C 3R45B 5BO0A 3AFAB 3LJAD 1EQZC 1P3LC 1TZYD 4J8VB 1M19A 5AVBB 4CSRB 4QLCA 1ID3A 1P3KA 3MGRD 3AZLA 4YM6B 3UT9C 1F1EA 2NQBB 3AZFD 5B32A 3LZ1A 2HIOA 5AV8D 5F99A 3O62C 2YFWA 3MGSC 5DNMB 3WKJC 4H9QB 5GT0B 5GXQA 5B31A 3LJAC 3AV1B 4NE5A 4J8XB 3B6GD 3B6FA 4H9RA 3UTAA 3AZKB 3REIB 3AYWC 3X1SB 3MVDB 3KUYA 2F8NA 1M19D 4XUJA 4QLCD 1ID3D 3C1CA 5B1MD 5AV8C 1P3KD 4J8UC 3X1TA 5B0YB 3AZLD 3C1BB 4YS3A 4Z5TC 2LY8A 3AZHA 5GSUA 5B32D 3LZ1D 5B2IA 3R45A 5F99D 4HGAB 1BH9B 3AFAA 1S32B 1HQ3B 5CP6C 5GXQD 4EO5C 2IO5B 4J8VA 5AVBA 4ZBJC 4CSRA 5B1LB 3W96B 2AROC 3UTAD 5B1MC 4YM6A 3RELD 1P3KC 2NQBA 5B24C 3KUYD 5BNVB 2PYOD 3WTPE 4XUJD 3WTPD 3WAAB 3LZ1C 5DNMA 3C1CD 4H9QA 5B0ZC 5CPIA 3X1TD 5JA4B 4R8PD 5C3IB 4YS3D 3AZID 3AZHD 3AZJC 3AV1A 4J8XA 5GSUD 5B2ID 1ULYA 3VH6W 3AFAD 3W99C 3AZKA 3REIA 4H9SA 5CHLB 3X1SA 3MVDA 3RELC 4J8VD 5AVBD 3KUYC 1P3IB 4NFTA 5AV5B 5B0YA 1F66B 3WTPC 3C1BA 2PYOC 4YM6D 2NQBD 4R8PC 4JJNB 4YS3C 3AZIC 1P3PC 4AWLB 5B32G 5AV6C 5DNMD 1HQ3A 5GT0D 4ZUXC 4G91B 3B0DC 3LZ0B 3AFAC 5DNNB 3AV1D 3A6NB 5E5AC 3KXBB 4J8XD 5B31G 5AV9C 5B1LA 1P3MB 4J8VC 3W96A 5BO0B 1P3OA 4WU8B 3AZKD 3AZGC 3REID 3X1SD 3X1VC 3MVDD 5BNVA 2NQBC 4LD9C 4X23C 1KX3B 3WAAA 4H9NB 3MGPB 2F8NG 2F8NK 5JA4A 1HTAA 5B0YD 3C1BD 5GT0C 5BNXB 5AVCC 4J8WB 3MGQB 2HIOB 4J8XC 1KX5C 1S32D 1M18C 1HQ3D 2CV5B 5FUGB 4M6BA 3LELC 5B1LD 3B6FB 1P3IA 3V9RB 3W96D 5AV5A 5BT1D 1F66A 5AY8B 4Z66B 4JJNA 5B0YC 2F8NB 2L5AA 4HGAC 1P3AB 5GT3B 3LZ0A 1S32C 5DNNA 3A6NA 3KWQB 2RVQD 1KX4B 3AZEC 1P3MA 2HUEC 3VH5A 4WU8A 1B6WA 3VH5W 5BT1C 2BYMB 1KX3A 3WA9B 4H9NA 3MGPA 1P3ID 5AV5D 1F66D 3AZMC 5BNXA 4JJND 5C3IC 3AN2B 1P34C 4J8WA 3MGQA 3X1UB 5CPIB 5B33B 3LZ0D 5DNND 3A6ND 3KXBD 1Q9CA 2CV5A 1P3FB 5FUGA 2FJ7B 1TZYC 3V9RA 3MNNB 4WV4B 4DRBA 5AY8A 4Z66A 4WU8D 4KGCB 5CPKB 1F66C 3MGRC 4JJNC 1KX3D 3AZFC 3VH5T 3AV2A 3B0BA 3MGPD 3REJB 1P3AA 5GT3A 4G92C 3KWQA 1H3OB 3NQUB 1KX4A 3UTBA 3KXBC 3MGQD 2HIOD 4J8WD 3B6GC 1U35B 5B31D 4WU9B 5JRGB 2BYMA 3REHB 2CV5D 3WA9A 4H9PB 3B6FD 1M19C 5AY8D 4QLCC 4Z66D 1P3OB 1ID3C 3AN2A 3AZLC 2F8ND 1ZLAB 4NE3A 5B32C 3X1UA 2HIOC 1P3AD 5F99C 5B33A 5GT3D 3AZNA 3KWQD 3REKB 1P3FA 1KX4D 5GXQC 4NE6A 4XZQB 5B31C 5B2JB 2FJ7A 1P3BB 3MNNA 3B6FC 1N1JB 4KGCA 5CPKA 1M1AB 3NQJB 3UTAC 1EQZB 3WA9D 1P3LB 3REJA 4XUJC 3TU4B 3C1CC 1H3OA 3NQUA 3X1TC 2NZDB 3AZHC 4UUZB 1KX4C 3UT9B 5GSUC 1U35A 3X1UD 5CPID 5B2IC 5B33D 4WZSB 4WU9A 5JRGA 3REHA 3MGSB 1P3FD 3WKJB 2FJ7D 4H9PA 3MNND 1WWSA 5AVBC 4KGCD 5CPKD 1P3GA 5B40B 4YM6C 1ZLAA 1R4VA 4E44A 3AYWB 3REJD 5CPIC 5DNMC 4WNNB 3REKA 1BFMA 5AV8B 4XZQA 4J8UB 5B2JA 1P3BA 4Z5TB 3AV1C 2F8NH 5G49B 2CWEA 1U35D 1N1JA 3W97A 4H9OB 5BS7A 1M1AA 3NQJA 4WU9D 5JRGD 4KHAB 1A7WA 3REHD 4KGCC 5CPKC 1EQZA 3AZKC 5CP6B 3REIC 4H9SC 3MVDC 3X1SC 1P3LA 1BH8B 1P3OD 4ZBJB 3TU4A 3C1BC 2NZDA 2AROB 5KDMA 4UUZA 2JSSA 1ZLAD 3UT9A 5B24B 3AV2B 3WAAD 3MGSA 3REKD 1HQ3C 3WKJA 5B0ZB 4XZQD 5B2JD 3UTBB 1P3BD 2IO5C 3AZJB 5B1LC 3W96C 1M1AD 5B40A 1P3OC 1EQZD 3W99B 3AYWA 1P3LD 3TU4D 3WAAC 4WNNA 3B0CW 5AV8A 4J8UA 2NZDD 4Z5TA 2RVQC 5G49A 3UT9D 3W98B 3AZIB 4H9OA 4KHAA 1P3PB 3MGSD 5AV6B 3AZNB 3WKJD 5BS7C 5CP6A 1M1AC 4ZUXB 3B0DB 1P3MD 1AOIB 1BH8A 5E5AB 5AV9B 1P3IC 5AV5C 4E45A 5B40D 3TU4C 2AROA 5B1MA 3AZGB 5B24A 2NZDC 3AYWD 3X1VB 4AWLC 4LD9B 4X23B 5B0ZA 4G91C 4J8UD 3LZ0C 5DNNC 4Z5TD 3A6NC 3AZJA 4Z2MG 3B0CT 1P3MC 5AVCB 1KX5B 4WU8C 1M18B 4KUDB 4Z2MH 5CP6D 3W99A 5B40C 5CPJB 3RELA 1KX3C 3LELB 3MGPC 1P3GB
chains in the Genus database with same CATH superfamily
2PYOA 3WTPA 2AROD 3W98A 2YFVB 4R8PA 5B24D 3AV2D 3AZIA 3KSYA 3MGQC 4J8WC 3AL0C 1P3PA 5AV6A 5B0ZD 4ZUXA 3UTBD 1AOIA 2CV5C 3AZJD 5E5AA 2BYKB 1JFIB 5AV9A 3AZEB 2HUEB 3W97B 5AY8C 4Z66C 3W99D 3AZGA 1TAFB 3X1VA 3AV2C 4X23A 4LD9A 1P3AC 5GT3C 3AN2D 5KDMB 3KWQC 3AZMB 3W98D 5GT0A 3UTBC 1P34B 1WWIA 5AVCA 1KX5A 3O62B 1P3PD 3VH6A 5AV6D 3AZND 1M18A 4KUDA 4ZUXD 1AOID 5CPJA 3LJAB 5E5AD 3LELA 3WA9C 5AV9D 1TZYB 2YFVA 3AZGD 3AN2C 3MGRB 3X1VD 3W98C 1KU5A 4LD9D 4X23D 3AZFB 3X1UC 2Y2OA 5B33C 1BH9A 4G92B 1S32A 3AZNC 1P3FC 2BYKA 1JFIA 2FJ7C 3AZEA 1AOIC 5AVCD 4CAYB 3MNNC 1KX5D 3B6GB 1M18D 4KUDD 1TAFA 5CPJD 4EO5B 2ZY3A 3LELD 3VH6T 1P3GD 3REJC 1M19B 4UPKA 4QLCB 3AZMA 1ID3B 5B1MB 1P3KB 1P34A 3AZLB 3O62A 5B32B 1U35C 3LZ1B 5F99B 4WU9C 2YFWB 5JRGC 3REHC 3LJAA 4KUDC 5GXQB 5B31B 3AZED 5CPJC 1TZYA 1B67A 3W97D 1P3GC 3MGRA 4H9RB 3UTAB 3RELB 1ZLAC 3AZFA 2J8PA 3KUYB 4DRAA 2PYOB 3WTPB 4XUJB 3REKC 3AZMD 3C1CB 4XZQC 4R8PB 5B2JC 3X1TB 1PZRA 1P34D 1P3BC 4YS3B 4CAYA 3KXBA 3AZHB 3P5JB 3O62D 5GSUB 3B6GA 5B2IB 2DQNC 3R45B 3W97C 5BO0A 3AFAB 3LJAD 1EQZC 1P3LC 1TZYD 3FDDA 4J8VB 1M19A 5AVBB 4CSRB 4QLCA 1ID3A 3EPLA 1P3KA 3MGRD 3AZLA 4YM6B 3UT9C 1F1EA 2NQBB 3AZFD 5B32A 3LZ1A 2HIOA 5AV8D 5F99A 3O62C 2YFWA 2ZY2A 3MGSC 5DNMB 3WKJC 4H9QB 5GT0B 5GXQA 5B31A 3LJAC 2ZM5A 3AV1B 4NE5A 4J8XB 3B6GD 3B6FA 3EPHA 4H9RA 3UTAA 3AZKB 3REIB 3AYWC 3X1SB 3MVDB 3KUYA 2F8NA 1M19D 4XUJA 2Y2LA 4QLCD 1ID3D 3C1CA 5B1MD 5AV8C 1P3KD 4J8UC 3X1TA 5B0YB 3AZLD 3C1BB 4YS3A 4Z5TC 2LY8A 3AZHA 5GSUA 5B32D 3LZ1D 5B2IA 3R45A 5F99D 4HGAB 1BH9B 3AFAA 1S32B 1HQ3B 5CP6C 5GXQD 4EO5C 2IO5B 4J8VA 5AVBA 4ZBJC 4CSRA 5B1LB 3W96B 2AROC 3UTAD 5B1MC 4YM6A 3RELD 1P3KC 2NQBA 2BG1A 5B24C 2ZY5A 3KUYD 5BNVB 2PYOD 3WTPE 4XUJD 3WTPD 3WAAB 3LZ1C 5DNMA 3C1CD 4H9QA 5B0ZC 5CPIA 3X1TD 5JA4B 4R8PD 5C3IB 4YS3D 3AZID 3AZHD 3AZJC 3AV1A 4J8XA 1W2EA 5GSUD 5B2ID 3KFUG 1ULYA 3VH6W 3AFAD 2JCHA 3W99C 3AZKA 2Y2NA 3REIA 4H9SA 5CHLB 3X1SA 3MVDA 3RELC 4J8VD 5AVBD 3KUYC 3IP4C 1P3IB 4NFTA 5AV5B 5B0YA 1F66B 3WTPC 3C1BA 2PYOC 4YM6D 2NQBD 4R8PC 4JJNB 4YS3C 3AZIC 1P3PC 4AWLB 5B32G 5AV6C 5DNMD 1HQ3A 5GT0D 4ZUXC 4G91B 3B0DC 3LZ0B 3AFAC 4WJ3C 5DNNB 2G5IC 3AV1D 3A6NB 5E5AC 3KXBB 4J8XD 5B31G 5AV9C 5B1LA 1P3MB 4J8VC 3W96A 5BO0B 1P3OA 4WU8B 3AZKD 3AZGC 3REID 3X1SD 3X1VC 3MVDD 3EG5B 5BNVA 2NQBC 4LD9C 4X23C 1KX3B 3WAAA 4H9NB 3MGPB 2F8NG 2F8NK 5JA4A 1HTAA 5B0YD 3C1BD 5GT0C 5BNXB 5AVCC 4J8WB 3MGQB 2HIOB 4J8XC 1KX5C 1S32D 2Y2HA 1M18C 1HQ3D 2CV5B 5FUGB 4M6BA 3LELC 5B1LD 3B6FB 1P3IA 3V9RB 3W96D 5AV5A 5BT1D 1F66A 5AY8B 4Z66B 4JJNA 5B0YC 2F8NB 2G5HC 2L5AA 4HGAC 1P3AB 5GT3B 3LZ0A 1S32C 5DNNA 3A6NA 3KWQB 2RVQD 1KX4B 3AZEC 1P3MA 2Y2MA 2HUEC 2RIQA 3VH5A 4WU8A 1B6WA 3VH5W 5BT1C 2BYMB 1KX3A 3WA9B 4H9NA 3MGPA 1P3ID 5AV5D 1Z2CB 1F66D 3AZMC 4DQYB 5BNXA 4JJND 5C3IC 3AN2B 1P34C 4J8WA 3MGQA 2VQRA 3X1UB 5CPIB 5B33B 3LZ0D 5DNND 3A6ND 3KXBD 1Q9CA 2CV5A 1P3FB 5FUGA 2FJ7B 1TZYC 3V9RA 3MNNB 4WV4B 4DRBA 5AY8A 4Z66A 4WU8D 4KGCB 5CPKB 1F66C 3MGRC 4JJNC 1KX3D 3AZFC 3VH5T 3AV2A 3B0BA 3MGPD 3REJB 1P3AA 5GT3A 4G92C 3KWQA 1H3OB 3NQUB 1KX4A 3UTBA 3KXBC 3MGQD 2HIOD 4J8WD 2XD1A 3B6GC 1U35B 5B31D 4WU9B 5JRGB 2BYMA 3REHB 2CV5D 3WA9A 4H9PB 2Y2PA 3B6FD 1M19C 5AY8D 4QLCC 4Z66D 1P3OB 1ID3C 3AN2A 3AZLC 2F8ND 1ZLAB 4NE3A 5B32C 3X1UA 2HIOC 1P3AD 5F99C 5B33A 5GT3D 3AZNA 3KWQD 3REKB 1P3FA 2Y2QA 1KX4D 5GXQC 4NE6A 4XZQB 5B31C 5B2JB 2FJ7A 1P3BB 3MNNA 3B6FC 1N1JB 4KGCA 5CPKA 1M1AB 3NQJB 3UTAC 2JE5A 1EQZB 3WA9D 3EPJA 1P3LB 2Y2IA 3REJA 4XUJC 3TU4B 3C1CC 1H3OA 3NQUA 3X1TC 2NZDB 3AZHC 4UUZB 1KX4C 3UT9B 5GSUC 1U35A 3X1UD 5CPID 5B2IC 5B33D 4WZSB 4WU9A 5JRGA 3REHA 3MGSB 1P3FD 3WKJB 2FJ7D 4H9PA 2Y2KA 3MNND 1WWSA 3F6TA 5AVBC 4KGCD 5CPKD 1P3GA 5B40B 4YM6C 1ZLAA 1R4VA 2UWXA 3A1IA 4E44A 3AYWB 3REJD 5CPIC 5DNMC 4WNNB 3REKA 1BFMA 5AV8B 4XZQA 4J8UB 3H0RC 5B2JA 1P3BA 4Z5TB 3AV1C 2F8NH 5G49B 1T3UA 2CWEA 1U35D 1N1JA 3W97A 4H9OB 5BS7A 1M1AA 3NQJA 4WU9D 5JRGD 4KHAB 1A7WA 3REHD 4KGCC 5CPKC 1EQZA 3AZKC 5CP6B 2DF4C 3REIC 4H9SC 3MVDC 3X1SC 1P3LA 1BH8B 1P3OD 4ZBJB 3TU4A 3C1BC 2NZDA 2AROB 5KDMA 4UUZA 2JSSA 1ZLAD 3UT9A 5B24B 3AV2B 3WAAD 3A1KA 3MGSA 3REKD 1HQ3C 3WKJA 5B0ZB 4XZQD 3H0LC 5B2JD 3UTBB 1P3BD 2FFFB 2IO5C 3AZJB 5B1LC 3W96C 1M1AD 5B40A 1P3OC 1EQZD 3W99B 3AYWA 1P3LD 2Y2JA 3TU4D 3WAAC 4WNNA 2Y2GA 3B0CW 5AV8A 4J8UA 2W8SA 2NZDD 4Z5TA 2RVQC 5G49A 3UT9D 3W98B 3AZIB 4H9OA 4KHAA 1P3PB 3MGSD 5AV6B 2F2AC 3AZNB 3WKJD 5BS7C 5CP6A 1M1AC 4ZUXB 3B0DB 1P3MD 1AOIB 1BH8A 5E5AB 5AV9B 1P3IC 5AV5C 4E45A 5B40D 3TU4C 2AROA 5B1MA 3AZGB 3H0MC 5B24A 2NZDC 3AYWD 3X1VB 4AWLC 4LD9B 4X23B 5B0ZA 4G91C 4J8UD 3LZ0C 5DNNC 4Z5TD 3A6NC 3AZJA 4Z2MG 3B0CT 1P3MC 5AVCB 2XD5A 1KX5B 3EPKA 4WU8C 1M18B 2ZY4A 4KUDB 4Z2MH 5CP6D 3W99A 5B40C 5CPJB 3RELA 1KX3C 3LELB 3MGPC 1P3GB
chains in the Genus database with same CATH topology
2PYOA 3WTPA 2AROD 3W98A 2YFVB 4R8PA 5B24D 3AV2D 3AZIA 3KSYA 3MGQC 4J8WC 3AL0C 1P3PA 5AV6A 5B0ZD 4ZUXA 3UTBD 1AOIA 2CV5C 3AZJD 5E5AA 2BYKB 1JFIB 5AV9A 3AZEB 2HUEB 3W97B 5AY8C 4Z66C 3W99D 3AZGA 1TAFB 3X1VA 3AV2C 4X23A 4LD9A 1P3AC 5GT3C 3AN2D 5KDMB 3KWQC 3AZMB 3W98D 5GT0A 3UTBC 1P34B 1WWIA 5AVCA 1KX5A 3O62B 1P3PD 3VH6A 5AV6D 3AZND 1M18A 4KUDA 4ZUXD 1AOID 5CPJA 3LJAB 5E5AD 3LELA 3WA9C 5AV9D 1TZYB 2YFVA 3AZGD 3AN2C 3MGRB 3X1VD 3W98C 1KU5A 4LD9D 4X23D 3AZFB 3X1UC 2Y2OA 5B33C 1BH9A 4G92B 1S32A 3AZNC 1P3FC 2BYKA 1JFIA 2FJ7C 3AZEA 1AOIC 5AVCD 4CAYB 3MNNC 1KX5D 3B6GB 1M18D 4KUDD 1TAFA 5CPJD 4EO5B 2ZY3A 3LELD 3VH6T 1P3GD 3REJC 1M19B 4UPKA 4QLCB 3AZMA 1ID3B 5B1MB 1P3KB 1P34A 3AZLB 3O62A 5B32B 1U35C 3LZ1B 5F99B 4WU9C 2YFWB 5JRGC 3REHC 3LJAA 4KUDC 5GXQB 5B31B 3AZED 5CPJC 1TZYA 1B67A 3W97D 1P3GC 3MGRA 4H9RB 3UTAB 3RELB 1ZLAC 3AZFA 2J8PA 3KUYB 4DRAA 2PYOB 3WTPB 4XUJB 3REKC 3AZMD 3C1CB 4XZQC 4R8PB 5B2JC 3X1TB 1PZRA 1P34D 1P3BC 4YS3B 4CAYA 3KXBA 3AZHB 3P5JB 3O62D 5GSUB 3B6GA 5B2IB 2DQNC 3R45B 3W97C 5BO0A 3AFAB 3LJAD 1EQZC 1P3LC 1TZYD 3FDDA 4J8VB 1M19A 5AVBB 4CSRB 4QLCA 1ID3A 3EPLA 1P3KA 3MGRD 3AZLA 4YM6B 3UT9C 1F1EA 2NQBB 3AZFD 5B32A 3LZ1A 2HIOA 5AV8D 5F99A 3O62C 2YFWA 2ZY2A 3MGSC 5DNMB 3WKJC 4H9QB 5GT0B 5GXQA 5B31A 3LJAC 2ZM5A 3AV1B 4NE5A 4J8XB 3B6GD 3B6FA 3EPHA 4H9RA 3UTAA 3AZKB 3REIB 3AYWC 3X1SB 3MVDB 3KUYA 2F8NA 1M19D 4XUJA 2Y2LA 4QLCD 1ID3D 3C1CA 5B1MD 5AV8C 1P3KD 4J8UC 3X1TA 5B0YB 3AZLD 3C1BB 4YS3A 4Z5TC 2LY8A 3AZHA 5GSUA 5B32D 3LZ1D 5B2IA 3R45A 5F99D 4HGAB 1BH9B 3AFAA 1S32B 1HQ3B 5CP6C 5GXQD 4EO5C 2IO5B 4J8VA 5AVBA 4ZBJC 4CSRA 5B1LB 3W96B 2AROC 3UTAD 5B1MC 4YM6A 3RELD 1P3KC 2NQBA 2BG1A 5B24C 2ZY5A 3KUYD 5BNVB 2PYOD 3WTPE 4XUJD 3WTPD 3WAAB 3LZ1C 5DNMA 3C1CD 4H9QA 5B0ZC 5CPIA 3X1TD 5JA4B 4R8PD 5C3IB 4YS3D 3AZID 3AZHD 3AZJC 3AV1A 4J8XA 1W2EA 5GSUD 5B2ID 3KFUG 1ULYA 3VH6W 3AFAD 2JCHA 3W99C 3AZKA 2Y2NA 3REIA 4H9SA 5CHLB 3X1SA 3MVDA 3RELC 4J8VD 5AVBD 3KUYC 3IP4C 1P3IB 4NFTA 5AV5B 5B0YA 1F66B 3WTPC 3C1BA 2PYOC 4YM6D 2NQBD 4R8PC 4JJNB 4YS3C 3AZIC 1P3PC 4AWLB 5B32G 5AV6C 5DNMD 1HQ3A 5GT0D 4ZUXC 4G91B 3B0DC 3LZ0B 3AFAC 4WJ3C 5DNNB 2G5IC 3AV1D 3A6NB 5E5AC 3KXBB 4J8XD 5B31G 5AV9C 5B1LA 1P3MB 4J8VC 3W96A 5BO0B 1P3OA 4WU8B 3AZKD 3AZGC 3REID 3X1SD 3X1VC 3MVDD 3EG5B 5BNVA 2NQBC 4LD9C 4X23C 1KX3B 3WAAA 4H9NB 3MGPB 2F8NG 2F8NK 5JA4A 1HTAA 5B0YD 3C1BD 5GT0C 5BNXB 5AVCC 4J8WB 3MGQB 2HIOB 4J8XC 1KX5C 1S32D 2Y2HA 1M18C 1HQ3D 2CV5B 5FUGB 4M6BA 3LELC 5B1LD 3B6FB 1P3IA 3V9RB 3W96D 5AV5A 5BT1D 1F66A 5AY8B 4Z66B 4JJNA 5B0YC 2F8NB 2G5HC 2L5AA 4HGAC 1P3AB 5GT3B 3LZ0A 1S32C 5DNNA 3A6NA 3KWQB 2RVQD 1KX4B 3AZEC 1P3MA 2Y2MA 2HUEC 2RIQA 3VH5A 4WU8A 1B6WA 3VH5W 5BT1C 2BYMB 1KX3A 3WA9B 4H9NA 3MGPA 1P3ID 5AV5D 1Z2CB 1F66D 3AZMC 4DQYB 5BNXA 4JJND 5C3IC 3AN2B 1P34C 4J8WA 3MGQA 2VQRA 3X1UB 5CPIB 5B33B 3LZ0D 5DNND 3A6ND 3KXBD 1Q9CA 2CV5A 1P3FB 5FUGA 2FJ7B 1TZYC 3V9RA 3MNNB 4WV4B 4DRBA 5AY8A 4Z66A 4WU8D 4KGCB 5CPKB 1F66C 3MGRC 4JJNC 1KX3D 3AZFC 3VH5T 3AV2A 3B0BA 3MGPD 3REJB 1P3AA 5GT3A 4G92C 3KWQA 1H3OB 3NQUB 1KX4A 3UTBA 3KXBC 3MGQD 2HIOD 4J8WD 2XD1A 3B6GC 1U35B 5B31D 4WU9B 5JRGB 2BYMA 3REHB 2CV5D 3WA9A 4H9PB 2Y2PA 3B6FD 1M19C 5AY8D 4QLCC 4Z66D 1P3OB 1ID3C 3AN2A 3AZLC 2F8ND 1ZLAB 4NE3A 5B32C 3X1UA 2HIOC 1P3AD 5F99C 5B33A 5GT3D 3AZNA 3KWQD 3REKB 1P3FA 2Y2QA 1KX4D 5GXQC 4NE6A 4XZQB 5B31C 5B2JB 2FJ7A 1P3BB 3MNNA 3B6FC 1N1JB 4KGCA 5CPKA 1M1AB 3NQJB 3UTAC 2JE5A 1EQZB 3WA9D 3EPJA 1P3LB 2Y2IA 3REJA 4XUJC 3TU4B 3C1CC 1H3OA 3NQUA 3X1TC 2NZDB 3AZHC 4UUZB 1KX4C 3UT9B 5GSUC 1U35A 3X1UD 5CPID 5B2IC 5B33D 4WZSB 4WU9A 5JRGA 3REHA 3MGSB 1P3FD 3WKJB 2FJ7D 4H9PA 2Y2KA 3MNND 1WWSA 3F6TA 5AVBC 4KGCD 5CPKD 1P3GA 5B40B 4YM6C 1ZLAA 1R4VA 2UWXA 3A1IA 4E44A 3AYWB 3REJD 5CPIC 5DNMC 4WNNB 3REKA 1BFMA 5AV8B 4XZQA 4J8UB 3H0RC 5B2JA 1P3BA 4Z5TB 3AV1C 2F8NH 5G49B 1T3UA 2CWEA 1U35D 1N1JA 3W97A 4H9OB 5BS7A 1M1AA 3NQJA 4WU9D 5JRGD 4KHAB 1A7WA 3REHD 4KGCC 5CPKC 1EQZA 3AZKC 5CP6B 2DF4C 3REIC 4H9SC 3MVDC 3X1SC 1P3LA 1BH8B 1P3OD 4ZBJB 3TU4A 3C1BC 2NZDA 2AROB 5KDMA 4UUZA 2JSSA 1ZLAD 3UT9A 5B24B 3AV2B 3WAAD 3A1KA 3MGSA 3REKD 1HQ3C 3WKJA 5B0ZB 4XZQD 3H0LC 5B2JD 3UTBB 1P3BD 2FFFB 2IO5C 3AZJB 5B1LC 3W96C 1M1AD 5B40A 1P3OC 1EQZD 3W99B 3AYWA 1P3LD 2Y2JA 3TU4D 3WAAC 4WNNA 2Y2GA 3B0CW 5AV8A 4J8UA 2W8SA 2NZDD 4Z5TA 2RVQC 5G49A 3UT9D 3W98B 3AZIB 4H9OA 4KHAA 1P3PB 3MGSD 5AV6B 2F2AC 3AZNB 3WKJD 5BS7C 5CP6A 1M1AC 4ZUXB 3B0DB 1P3MD 1AOIB 1BH8A 5E5AB 5AV9B 1P3IC 5AV5C 4E45A 5B40D 3TU4C 2AROA 5B1MA 3AZGB 3H0MC 5B24A 2NZDC 3AYWD 3X1VB 4AWLC 4LD9B 4X23B 5B0ZA 4G91C 4J8UD 3LZ0C 5DNNC 4Z5TD 3A6NC 3AZJA 4Z2MG 3B0CT 1P3MC 5AVCB 2XD5A 1KX5B 3EPKA 4WU8C 1M18B 2ZY4A 4KUDB 4Z2MH 5CP6D 3W99A 5B40C 5CPJB 3RELA 1KX3C 3LELB 3MGPC 1P3GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO A;  3WTP A;  2ARO D;  3W98 A;  2YFV B;  4R8P A;  5B24 D;  3AV2 D;  3AZI A;  3KSY A;  3MGQ C;  4J8W C;  1P3P A;  5AV6 A;  5B0Z D;  4ZUX A;  3UTB D;  1AOI A;  2CV5 C;  3AZJ D;  5E5A A;  2BYK B;  1JFI B;  5AV9 A;  3AZE B;  2HUE B;  3W97 B;  5AY8 C;  4Z66 C;  3W99 D;  3AZG A;  1TAF B;  3X1V A;  3AV2 C;  4X23 A;  4LD9 A;  1P3A C;  5GT3 C;  3AN2 D;  5KDM B;  3KWQ C;  3AZM B;  3W98 D;  5GT0 A;  3UTB C;  1P34 B;  1WWI A;  5AVC A;  1KX5 A;  3O62 B;  1P3P D;  3VH6 A;  5AV6 D;  3AZN D;  1M18 A;  4KUD A;  4ZUX D;  1AOI D;  5CPJ A;  3LJA B;  5E5A D;  3LEL A;  3WA9 C;  5AV9 D;  1TZY B;  2YFV A;  3AZG D;  3AN2 C;  3MGR B;  3X1V D;  3W98 C;  1KU5 A;  4LD9 D;  4X23 D;  3AZF B;  3X1U C;  5B33 C;  1BH9 A;  4G92 B;  1S32 A;  3AZN C;  1P3F C;  2BYK A;  1JFI A;  2FJ7 C;  3AZE A;  1AOI C;  5AVC D;  4CAY B;  3MNN C;  1KX5 D;  3B6G B;  1M18 D;  4KUD D;  1TAF A;  5CPJ D;  4EO5 B;  3LEL D;  3VH6 T;  1P3G D;  3REJ C;  1M19 B;  4QLC B;  3AZM A;  1ID3 B;  5B1M B;  1P3K B;  1P34 A;  3AZL B;  3O62 A;  5B32 B;  1U35 C;  3LZ1 B;  5F99 B;  4WU9 C;  2YFW B;  5JRG C;  3REH C;  3LJA A;  4KUD C;  5GXQ B;  5B31 B;  3AZE D;  5CPJ C;  1TZY A;  1B67 A;  3W97 D;  1P3G C;  3MGR A;  4H9R B;  3UTA B;  3REL B;  1ZLA C;  3AZF A;  3KUY B;  4DRA A;  2PYO B;  3WTP B;  4XUJ B;  3REK C;  3AZM D;  3C1C B;  4XZQ C;  4R8P B;  5B2J C;  3X1T B;  1P34 D;  1P3B C;  4YS3 B;  4CAY A;  3KXB A;  3AZH B;  3O62 D;  5GSU B;  3B6G A;  5B2I B;  3W97 C;  3R45 B;  5BO0 A;  3AFA B;  3LJA D;  1EQZ C;  1P3L C;  1TZY D;  4J8V B;  1M19 A;  5AVB B;  4CSR B;  4QLC A;  1ID3 A;  1P3K A;  3MGR D;  3AZL A;  4YM6 B;  3UT9 C;  1F1E A;  2NQB B;  3AZF D;  5B32 A;  3LZ1 A;  2HIO A;  5AV8 D;  5F99 A;  3O62 C;  2YFW A;  3MGS C;  5DNM B;  3WKJ C;  4H9Q B;  5GT0 B;  5GXQ A;  5B31 A;  3LJA C;  3AV1 B;  4NE5 A;  4J8X B;  3B6G D;  3B6F A;  4H9R A;  3UTA A;  3AZK B;  3REI B;  3AYW C;  3X1S B;  3MVD B;  3KUY A;  2F8N A;  1M19 D;  4XUJ A;  4QLC D;  1ID3 D;  3C1C A;  5B1M D;  5AV8 C;  1P3K D;  4J8U C;  3X1T A;  5B0Y B;  3AZL D;  3C1B B;  4YS3 A;  4Z5T C;  2LY8 A;  3AZH A;  5GSU A;  5B32 D;  3LZ1 D;  5B2I A;  3R45 A;  5F99 D;  4HGA B;  1BH9 B;  3AFA A;  1S32 B;  1HQ3 B;  5CP6 C;  5GXQ D;  4EO5 C;  2IO5 B;  4J8V A;  5AVB A;  4ZBJ C;  4CSR A;  5B1L B;  3W96 B;  2ARO C;  3UTA D;  5B1M C;  4YM6 A;  3REL D;  1P3K C;  2NQB A;  5B24 C;  3KUY D;  5BNV B;  2PYO D;  3WTP E;  4XUJ D;  3WTP D;  3WAA B;  3LZ1 C;  5DNM A;  3C1C D;  4H9Q A;  5B0Z C;  5CPI A;  3X1T D;  5JA4 B;  4R8P D;  5C3I B;  4YS3 D;  3AZI D;  3AZH D;  3AZJ C;  3AV1 A;  4J8X A;  5GSU D;  5B2I D;  1ULY A;  3VH6 W;  3AFA D;  3W99 C;  3AZK A;  3REI A;  4H9S A;  5CHL B;  3X1S A;  3MVD A;  3REL C;  4J8V D;  5AVB D;  3KUY C;  1P3I B;  4NFT A;  5AV5 B;  5B0Y A;  1F66 B;  3WTP C;  3C1B A;  2PYO C;  4YM6 D;  2NQB D;  4R8P C;  4JJN B;  4YS3 C;  3AZI C;  1P3P C;  4AWL B;  5B32 G;  5AV6 C;  5DNM D;  1HQ3 A;  5GT0 D;  4ZUX C;  4G91 B;  3B0D C;  3LZ0 B;  3AFA C;  5DNN B;  3AV1 D;  3A6N B;  5E5A C;  3KXB B;  4J8X D;  5B31 G;  5AV9 C;  5B1L A;  1P3M B;  4J8V C;  3W96 A;  5BO0 B;  1P3O A;  4WU8 B;  3AZK D;  3AZG C;  3REI D;  3X1S D;  3X1V C;  3MVD D;  5BNV A;  2NQB C;  4LD9 C;  4X23 C;  1KX3 B;  3WAA A;  4H9N B;  3MGP B;  2F8N G;  2F8N K;  5JA4 A;  1HTA A;  5B0Y D;  3C1B D;  5GT0 C;  5BNX B;  5AVC C;  4J8W B;  3MGQ B;  2HIO B;  4J8X C;  1KX5 C;  1S32 D;  1M18 C;  1HQ3 D;  2CV5 B;  5FUG B;  4M6B A;  3LEL C;  5B1L D;  3B6F B;  1P3I A;  3V9R B;  3W96 D;  5AV5 A;  5BT1 D;  1F66 A;  5AY8 B;  4Z66 B;  4JJN A;  5B0Y C;  2F8N B;  2L5A A;  4HGA C;  1P3A B;  5GT3 B;  3LZ0 A;  1S32 C;  5DNN A;  3A6N A;  3KWQ B;  2RVQ D;  1KX4 B;  3AZE C;  1P3M A;  2HUE C;  3VH5 A;  4WU8 A;  1B6W A;  3VH5 W;  5BT1 C;  2BYM B;  1KX3 A;  3WA9 B;  4H9N A;  3MGP A;  1P3I D;  5AV5 D;  1F66 D;  3AZM C;  5BNX A;  4JJN D;  5C3I C;  3AN2 B;  1P34 C;  4J8W A;  3MGQ A;  3X1U B;  5CPI B;  5B33 B;  3LZ0 D;  5DNN D;  3A6N D;  3KXB D;  1Q9C A;  2CV5 A;  1P3F B;  5FUG A;  2FJ7 B;  1TZY C;  3V9R A;  3MNN B;  4WV4 B;  4DRB A;  5AY8 A;  4Z66 A;  4WU8 D;  4KGC B;  5CPK B;  1F66 C;  3MGR C;  4JJN C;  1KX3 D;  3AZF C;  3VH5 T;  3AV2 A;  3B0B A;  3MGP D;  3REJ B;  1P3A A;  5GT3 A;  4G92 C;  3KWQ A;  1H3O B;  3NQU B;  1KX4 A;  3UTB A;  3KXB C;  3MGQ D;  2HIO D;  4J8W D;  3B6G C;  1U35 B;  5B31 D;  4WU9 B;  5JRG B;  2BYM A;  3REH B;  2CV5 D;  3WA9 A;  4H9P B;  3B6F D;  1M19 C;  5AY8 D;  4QLC C;  4Z66 D;  1P3O B;  1ID3 C;  3AN2 A;  3AZL C;  2F8N D;  1ZLA B;  4NE3 A;  5B32 C;  3X1U A;  2HIO C;  1P3A D;  5F99 C;  5B33 A;  5GT3 D;  3AZN A;  3KWQ D;  3REK B;  1P3F A;  1KX4 D;  5GXQ C;  4NE6 A;  4XZQ B;  5B31 C;  5B2J B;  2FJ7 A;  1P3B B;  3MNN A;  3B6F C;  1N1J B;  4KGC A;  5CPK A;  1M1A B;  3NQJ B;  3UTA C;  1EQZ B;  3WA9 D;  1P3L B;  3REJ A;  4XUJ C;  3TU4 B;  3C1C C;  1H3O A;  3NQU A;  3X1T C;  2NZD B;  3AZH C;  4UUZ B;  1KX4 C;  3UT9 B;  5GSU C;  1U35 A;  3X1U D;  5CPI D;  5B2I C;  5B33 D;  4WZS B;  4WU9 A;  5JRG A;  3REH A;  3MGS B;  1P3F D;  3WKJ B;  2FJ7 D;  4H9P A;  3MNN D;  1WWS A;  5AVB C;  4KGC D;  5CPK D;  1P3G A;  5B40 B;  4YM6 C;  1ZLA A;  1R4V A;  4E44 A;  3AYW B;  3REJ D;  5CPI C;  5DNM C;  4WNN B;  3REK A;  1BFM A;  5AV8 B;  4XZQ A;  4J8U B;  5B2J A;  1P3B A;  4Z5T B;  3AV1 C;  2F8N H;  5G49 B;  2CWE A;  1U35 D;  1N1J A;  3W97 A;  4H9O B;  5BS7 A;  1M1A A;  3NQJ A;  4WU9 D;  5JRG D;  4KHA B;  1A7W A;  3REH D;  4KGC C;  5CPK C;  1EQZ A;  3AZK C;  5CP6 B;  3REI C;  4H9S C;  3MVD C;  3X1S C;  1P3L A;  1BH8 B;  1P3O D;  4ZBJ B;  3TU4 A;  3C1B C;  2NZD A;  2ARO B;  5KDM A;  4UUZ A;  2JSS A;  1ZLA D;  3UT9 A;  5B24 B;  3AV2 B;  3WAA D;  3MGS A;  3REK D;  1HQ3 C;  3WKJ A;  5B0Z B;  4XZQ D;  5B2J D;  3UTB B;  1P3B D;  2IO5 C;  3AZJ B;  5B1L C;  3W96 C;  1M1A D;  5B40 A;  1P3O C;  1EQZ D;  3W99 B;  3AYW A;  1P3L D;  3TU4 D;  3WAA C;  4WNN A;  3B0C W;  5AV8 A;  4J8U A;  2NZD D;  4Z5T A;  2RVQ C;  5G49 A;  3UT9 D;  3W98 B;  3AZI B;  4H9O A;  4KHA A;  1P3P B;  3MGS D;  5AV6 B;  3AZN B;  3WKJ D;  5BS7 C;  5CP6 A;  1M1A C;  4ZUX B;  3B0D B;  1P3M D;  1AOI B;  1BH8 A;  5E5A B;  5AV9 B;  1P3I C;  5AV5 C;  4E45 A;  5B40 D;  3TU4 C;  2ARO A;  5B1M A;  3AZG B;  5B24 A;  2NZD C;  3AYW D;  3X1V B;  4AWL C;  4LD9 B;  4X23 B;  5B0Z A;  4G91 C;  4J8U D;  3LZ0 C;  5DNN C;  4Z5T D;  3A6N C;  3AZJ A;  4Z2M G;  3B0C T;  1P3M C;  5AVC B;  1KX5 B;  4WU8 C;  1M18 B;  4KUD B;  4Z2M H;  5CP6 D;  3W99 A;  5B40 C;  5CPJ B;  3REL A;  1KX3 C;  3LEL B;  3MGP C;  1P3G B; 
#chains in the Genus database with same CATH topology
 2PYO A;  3WTP A;  2ARO D;  3W98 A;  2YFV B;  4R8P A;  5B24 D;  3AV2 D;  3AZI A;  3KSY A;  3MGQ C;  4J8W C;  3AL0 C;  1P3P A;  5AV6 A;  5B0Z D;  4ZUX A;  3UTB D;  1AOI A;  2CV5 C;  3AZJ D;  5E5A A;  2BYK B;  1JFI B;  5AV9 A;  3AZE B;  2HUE B;  3W97 B;  5AY8 C;  4Z66 C;  3W99 D;  3AZG A;  1TAF B;  3X1V A;  3AV2 C;  4X23 A;  4LD9 A;  1P3A C;  5GT3 C;  3AN2 D;  5KDM B;  3KWQ C;  3AZM B;  3W98 D;  5GT0 A;  3UTB C;  1P34 B;  1WWI A;  5AVC A;  1KX5 A;  3O62 B;  1P3P D;  3VH6 A;  5AV6 D;  3AZN D;  1M18 A;  4KUD A;  4ZUX D;  1AOI D;  5CPJ A;  3LJA B;  5E5A D;  3LEL A;  3WA9 C;  5AV9 D;  1TZY B;  2YFV A;  3AZG D;  3AN2 C;  3MGR B;  3X1V D;  3W98 C;  1KU5 A;  4LD9 D;  4X23 D;  3AZF B;  3X1U C;  2Y2O A;  5B33 C;  1BH9 A;  4G92 B;  1S32 A;  3AZN C;  1P3F C;  2BYK A;  1JFI A;  2FJ7 C;  3AZE A;  1AOI C;  5AVC D;  4CAY B;  3MNN C;  1KX5 D;  3B6G B;  1M18 D;  4KUD D;  1TAF A;  5CPJ D;  4EO5 B;  2ZY3 A;  3LEL D;  3VH6 T;  1P3G D;  3REJ C;  1M19 B;  4UPK A;  4QLC B;  3AZM A;  1ID3 B;  5B1M B;  1P3K B;  1P34 A;  3AZL B;  3O62 A;  5B32 B;  1U35 C;  3LZ1 B;  5F99 B;  4WU9 C;  2YFW B;  5JRG C;  3REH C;  3LJA A;  4KUD C;  5GXQ B;  5B31 B;  3AZE D;  5CPJ C;  1TZY A;  1B67 A;  3W97 D;  1P3G C;  3MGR A;  4H9R B;  3UTA B;  3REL B;  1ZLA C;  3AZF A;  2J8P A;  3KUY B;  4DRA A;  2PYO B;  3WTP B;  4XUJ B;  3REK C;  3AZM D;  3C1C B;  4XZQ C;  4R8P B;  5B2J C;  3X1T B;  1PZR A;  1P34 D;  1P3B C;  4YS3 B;  4CAY A;  3KXB A;  3AZH B;  3P5J B;  3O62 D;  5GSU B;  3B6G A;  5B2I B;  2DQN C;  3R45 B;  3W97 C;  5BO0 A;  3AFA B;  3LJA D;  1EQZ C;  1P3L C;  1TZY D;  3FDD A;  4J8V B;  1M19 A;  5AVB B;  4CSR B;  4QLC A;  1ID3 A;  3EPL A;  1P3K A;  3MGR D;  3AZL A;  4YM6 B;  3UT9 C;  1F1E A;  2NQB B;  3AZF D;  5B32 A;  3LZ1 A;  2HIO A;  5AV8 D;  5F99 A;  3O62 C;  2YFW A;  2ZY2 A;  3MGS C;  5DNM B;  3WKJ C;  4H9Q B;  5GT0 B;  5GXQ A;  5B31 A;  3LJA C;  2ZM5 A;  3AV1 B;  4NE5 A;  4J8X B;  3B6G D;  3B6F A;  3EPH A;  4H9R A;  3UTA A;  3AZK B;  3REI B;  3AYW C;  3X1S B;  3MVD B;  3KUY A;  2F8N A;  1M19 D;  4XUJ A;  2Y2L A;  4QLC D;  1ID3 D;  3C1C A;  5B1M D;  5AV8 C;  1P3K D;  4J8U C;  3X1T A;  5B0Y B;  3AZL D;  3C1B B;  4YS3 A;  4Z5T C;  2LY8 A;  3AZH A;  5GSU A;  5B32 D;  3LZ1 D;  5B2I A;  3R45 A;  5F99 D;  4HGA B;  1BH9 B;  3AFA A;  1S32 B;  1HQ3 B;  5CP6 C;  5GXQ D;  4EO5 C;  2IO5 B;  4J8V A;  5AVB A;  4ZBJ C;  4CSR A;  5B1L B;  3W96 B;  2ARO C;  3UTA D;  5B1M C;  4YM6 A;  3REL D;  1P3K C;  2NQB A;  2BG1 A;  5B24 C;  2ZY5 A;  3KUY D;  5BNV B;  2PYO D;  3WTP E;  4XUJ D;  3WTP D;  3WAA B;  3LZ1 C;  5DNM A;  3C1C D;  4H9Q A;  5B0Z C;  5CPI A;  3X1T D;  5JA4 B;  4R8P D;  5C3I B;  4YS3 D;  3AZI D;  3AZH D;  3AZJ C;  3AV1 A;  4J8X A;  1W2E A;  5GSU D;  5B2I D;  3KFU G;  1ULY A;  3VH6 W;  3AFA D;  2JCH A;  3W99 C;  3AZK A;  2Y2N A;  3REI A;  4H9S A;  5CHL B;  3X1S A;  3MVD A;  3REL C;  4J8V D;  5AVB D;  3KUY C;  3IP4 C;  1P3I B;  4NFT A;  5AV5 B;  5B0Y A;  1F66 B;  3WTP C;  3C1B A;  2PYO C;  4YM6 D;  2NQB D;  4R8P C;  4JJN B;  4YS3 C;  3AZI C;  1P3P C;  4AWL B;  5B32 G;  5AV6 C;  5DNM D;  1HQ3 A;  5GT0 D;  4ZUX C;  4G91 B;  3B0D C;  3LZ0 B;  3AFA C;  4WJ3 C;  5DNN B;  2G5I C;  3AV1 D;  3A6N B;  5E5A C;  3KXB B;  4J8X D;  5B31 G;  5AV9 C;  5B1L A;  1P3M B;  4J8V C;  3W96 A;  5BO0 B;  1P3O A;  4WU8 B;  3AZK D;  3AZG C;  3REI D;  3X1S D;  3X1V C;  3MVD D;  3EG5 B;  5BNV A;  2NQB C;  4LD9 C;  4X23 C;  1KX3 B;  3WAA A;  4H9N B;  3MGP B;  2F8N G;  2F8N K;  5JA4 A;  1HTA A;  5B0Y D;  3C1B D;  5GT0 C;  5BNX B;  5AVC C;  4J8W B;  3MGQ B;  2HIO B;  4J8X C;  1KX5 C;  1S32 D;  2Y2H A;  1M18 C;  1HQ3 D;  2CV5 B;  5FUG B;  4M6B A;  3LEL C;  5B1L D;  3B6F B;  1P3I A;  3V9R B;  3W96 D;  5AV5 A;  5BT1 D;  1F66 A;  5AY8 B;  4Z66 B;  4JJN A;  5B0Y C;  2F8N B;  2G5H C;  2L5A A;  4HGA C;  1P3A B;  5GT3 B;  3LZ0 A;  1S32 C;  5DNN A;  3A6N A;  3KWQ B;  2RVQ D;  1KX4 B;  3AZE C;  1P3M A;  2Y2M A;  2HUE C;  2RIQ A;  3VH5 A;  4WU8 A;  1B6W A;  3VH5 W;  5BT1 C;  2BYM B;  1KX3 A;  3WA9 B;  4H9N A;  3MGP A;  1P3I D;  5AV5 D;  1Z2C B;  1F66 D;  3AZM C;  4DQY B;  5BNX A;  4JJN D;  5C3I C;  3AN2 B;  1P34 C;  4J8W A;  3MGQ A;  2VQR A;  3X1U B;  5CPI B;  5B33 B;  3LZ0 D;  5DNN D;  3A6N D;  3KXB D;  1Q9C A;  2CV5 A;  1P3F B;  5FUG A;  2FJ7 B;  1TZY C;  3V9R A;  3MNN B;  4WV4 B;  4DRB A;  5AY8 A;  4Z66 A;  4WU8 D;  4KGC B;  5CPK B;  1F66 C;  3MGR C;  4JJN C;  1KX3 D;  3AZF C;  3VH5 T;  3AV2 A;  3B0B A;  3MGP D;  3REJ B;  1P3A A;  5GT3 A;  4G92 C;  3KWQ A;  1H3O B;  3NQU B;  1KX4 A;  3UTB A;  3KXB C;  3MGQ D;  2HIO D;  4J8W D;  2XD1 A;  3B6G C;  1U35 B;  5B31 D;  4WU9 B;  5JRG B;  2BYM A;  3REH B;  2CV5 D;  3WA9 A;  4H9P B;  2Y2P A;  3B6F D;  1M19 C;  5AY8 D;  4QLC C;  4Z66 D;  1P3O B;  1ID3 C;  3AN2 A;  3AZL C;  2F8N D;  1ZLA B;  4NE3 A;  5B32 C;  3X1U A;  2HIO C;  1P3A D;  5F99 C;  5B33 A;  5GT3 D;  3AZN A;  3KWQ D;  3REK B;  1P3F A;  2Y2Q A;  1KX4 D;  5GXQ C;  4NE6 A;  4XZQ B;  5B31 C;  5B2J B;  2FJ7 A;  1P3B B;  3MNN A;  3B6F C;  1N1J B;  4KGC A;  5CPK A;  1M1A B;  3NQJ B;  3UTA C;  2JE5 A;  1EQZ B;  3WA9 D;  3EPJ A;  1P3L B;  2Y2I A;  3REJ A;  4XUJ C;  3TU4 B;  3C1C C;  1H3O A;  3NQU A;  3X1T C;  2NZD B;  3AZH C;  4UUZ B;  1KX4 C;  3UT9 B;  5GSU C;  1U35 A;  3X1U D;  5CPI D;  5B2I C;  5B33 D;  4WZS B;  4WU9 A;  5JRG A;  3REH A;  3MGS B;  1P3F D;  3WKJ B;  2FJ7 D;  4H9P A;  2Y2K A;  3MNN D;  1WWS A;  3F6T A;  5AVB C;  4KGC D;  5CPK D;  1P3G A;  5B40 B;  4YM6 C;  1ZLA A;  1R4V A;  2UWX A;  3A1I A;  4E44 A;  3AYW B;  3REJ D;  5CPI C;  5DNM C;  4WNN B;  3REK A;  1BFM A;  5AV8 B;  4XZQ A;  4J8U B;  3H0R C;  5B2J A;  1P3B A;  4Z5T B;  3AV1 C;  2F8N H;  5G49 B;  1T3U A;  2CWE A;  1U35 D;  1N1J A;  3W97 A;  4H9O B;  5BS7 A;  1M1A A;  3NQJ A;  4WU9 D;  5JRG D;  4KHA B;  1A7W A;  3REH D;  4KGC C;  5CPK C;  1EQZ A;  3AZK C;  5CP6 B;  2DF4 C;  3REI C;  4H9S C;  3MVD C;  3X1S C;  1P3L A;  1BH8 B;  1P3O D;  4ZBJ B;  3TU4 A;  3C1B C;  2NZD A;  2ARO B;  5KDM A;  4UUZ A;  2JSS A;  1ZLA D;  3UT9 A;  5B24 B;  3AV2 B;  3WAA D;  3A1K A;  3MGS A;  3REK D;  1HQ3 C;  3WKJ A;  5B0Z B;  4XZQ D;  3H0L C;  5B2J D;  3UTB B;  1P3B D;  2FFF B;  2IO5 C;  3AZJ B;  5B1L C;  3W96 C;  1M1A D;  5B40 A;  1P3O C;  1EQZ D;  3W99 B;  3AYW A;  1P3L D;  2Y2J A;  3TU4 D;  3WAA C;  4WNN A;  2Y2G A;  3B0C W;  5AV8 A;  4J8U A;  2W8S A;  2NZD D;  4Z5T A;  2RVQ C;  5G49 A;  3UT9 D;  3W98 B;  3AZI B;  4H9O A;  4KHA A;  1P3P B;  3MGS D;  5AV6 B;  2F2A C;  3AZN B;  3WKJ D;  5BS7 C;  5CP6 A;  1M1A C;  4ZUX B;  3B0D B;  1P3M D;  1AOI B;  1BH8 A;  5E5A B;  5AV9 B;  1P3I C;  5AV5 C;  4E45 A;  5B40 D;  3TU4 C;  2ARO A;  5B1M A;  3AZG B;  3H0M C;  5B24 A;  2NZD C;  3AYW D;  3X1V B;  4AWL C;  4LD9 B;  4X23 B;  5B0Z A;  4G91 C;  4J8U D;  3LZ0 C;  5DNN C;  4Z5T D;  3A6N C;  3AZJ A;  4Z2M G;  3B0C T;  1P3M C;  5AVC B;  2XD5 A;  1KX5 B;  3EPK A;  4WU8 C;  1M18 B;  2ZY4 A;  4KUD B;  4Z2M H;  5CP6 D;  3W99 A;  5B40 C;  5CPJ B;  3REL A;  1KX3 C;  3LEL B;  3MGP C;  1P3G B; 
#chains in the Genus database with same CATH homology
 2PYO A;  3WTP A;  2ARO D;  3W98 A;  2YFV B;  4R8P A;  5B24 D;  3AV2 D;  3AZI A;  3KSY A;  3MGQ C;  4J8W C;  3AL0 C;  1P3P A;  5AV6 A;  5B0Z D;  4ZUX A;  3UTB D;  1AOI A;  2CV5 C;  3AZJ D;  5E5A A;  2BYK B;  1JFI B;  5AV9 A;  3AZE B;  2HUE B;  3W97 B;  5AY8 C;  4Z66 C;  3W99 D;  3AZG A;  1TAF B;  3X1V A;  3AV2 C;  4X23 A;  4LD9 A;  1P3A C;  5GT3 C;  3AN2 D;  5KDM B;  3KWQ C;  3AZM B;  3W98 D;  5GT0 A;  3UTB C;  1P34 B;  1WWI A;  5AVC A;  1KX5 A;  3O62 B;  1P3P D;  3VH6 A;  5AV6 D;  3AZN D;  1M18 A;  4KUD A;  4ZUX D;  1AOI D;  5CPJ A;  3LJA B;  5E5A D;  3LEL A;  3WA9 C;  5AV9 D;  1TZY B;  2YFV A;  3AZG D;  3AN2 C;  3MGR B;  3X1V D;  3W98 C;  1KU5 A;  4LD9 D;  4X23 D;  3AZF B;  3X1U C;  2Y2O A;  5B33 C;  1BH9 A;  4G92 B;  1S32 A;  3AZN C;  1P3F C;  2BYK A;  1JFI A;  2FJ7 C;  3AZE A;  1AOI C;  5AVC D;  4CAY B;  3MNN C;  1KX5 D;  3B6G B;  1M18 D;  4KUD D;  1TAF A;  5CPJ D;  4EO5 B;  2ZY3 A;  3LEL D;  3VH6 T;  1P3G D;  3REJ C;  1M19 B;  4UPK A;  4QLC B;  3AZM A;  1ID3 B;  5B1M B;  1P3K B;  1P34 A;  3AZL B;  3O62 A;  5B32 B;  1U35 C;  3LZ1 B;  5F99 B;  4WU9 C;  2YFW B;  5JRG C;  3REH C;  3LJA A;  4KUD C;  5GXQ B;  5B31 B;  3AZE D;  5CPJ C;  1TZY A;  1B67 A;  3W97 D;  1P3G C;  3MGR A;  4H9R B;  3UTA B;  3REL B;  1ZLA C;  3AZF A;  2J8P A;  3KUY B;  4DRA A;  2PYO B;  3WTP B;  4XUJ B;  3REK C;  3AZM D;  3C1C B;  4XZQ C;  4R8P B;  5B2J C;  3X1T B;  1PZR A;  1P34 D;  1P3B C;  4YS3 B;  4CAY A;  3KXB A;  3AZH B;  3P5J B;  3O62 D;  5GSU B;  3B6G A;  5B2I B;  2DQN C;  3R45 B;  3W97 C;  5BO0 A;  3AFA B;  3LJA D;  1EQZ C;  1P3L C;  1TZY D;  3FDD A;  4J8V B;  1M19 A;  5AVB B;  4CSR B;  4QLC A;  1ID3 A;  3EPL A;  1P3K A;  3MGR D;  3AZL A;  4YM6 B;  3UT9 C;  1F1E A;  2NQB B;  3AZF D;  5B32 A;  3LZ1 A;  2HIO A;  5AV8 D;  5F99 A;  3O62 C;  2YFW A;  2ZY2 A;  3MGS C;  5DNM B;  3WKJ C;  4H9Q B;  5GT0 B;  5GXQ A;  5B31 A;  3LJA C;  2ZM5 A;  3AV1 B;  4NE5 A;  4J8X B;  3B6G D;  3B6F A;  3EPH A;  4H9R A;  3UTA A;  3AZK B;  3REI B;  3AYW C;  3X1S B;  3MVD B;  3KUY A;  2F8N A;  1M19 D;  4XUJ A;  2Y2L A;  4QLC D;  1ID3 D;  3C1C A;  5B1M D;  5AV8 C;  1P3K D;  4J8U C;  3X1T A;  5B0Y B;  3AZL D;  3C1B B;  4YS3 A;  4Z5T C;  2LY8 A;  3AZH A;  5GSU A;  5B32 D;  3LZ1 D;  5B2I A;  3R45 A;  5F99 D;  4HGA B;  1BH9 B;  3AFA A;  1S32 B;  1HQ3 B;  5CP6 C;  5GXQ D;  4EO5 C;  2IO5 B;  4J8V A;  5AVB A;  4ZBJ C;  4CSR A;  5B1L B;  3W96 B;  2ARO C;  3UTA D;  5B1M C;  4YM6 A;  3REL D;  1P3K C;  2NQB A;  2BG1 A;  5B24 C;  2ZY5 A;  3KUY D;  5BNV B;  2PYO D;  3WTP E;  4XUJ D;  3WTP D;  3WAA B;  3LZ1 C;  5DNM A;  3C1C D;  4H9Q A;  5B0Z C;  5CPI A;  3X1T D;  5JA4 B;  4R8P D;  5C3I B;  4YS3 D;  3AZI D;  3AZH D;  3AZJ C;  3AV1 A;  4J8X A;  1W2E A;  5GSU D;  5B2I D;  3KFU G;  1ULY A;  3VH6 W;  3AFA D;  2JCH A;  3W99 C;  3AZK A;  2Y2N A;  3REI A;  4H9S A;  5CHL B;  3X1S A;  3MVD A;  3REL C;  4J8V D;  5AVB D;  3KUY C;  3IP4 C;  1P3I B;  4NFT A;  5AV5 B;  5B0Y A;  1F66 B;  3WTP C;  3C1B A;  2PYO C;  4YM6 D;  2NQB D;  4R8P C;  4JJN B;  4YS3 C;  3AZI C;  1P3P C;  4AWL B;  5B32 G;  5AV6 C;  5DNM D;  1HQ3 A;  5GT0 D;  4ZUX C;  4G91 B;  3B0D C;  3LZ0 B;  3AFA C;  4WJ3 C;  5DNN B;  2G5I C;  3AV1 D;  3A6N B;  5E5A C;  3KXB B;  4J8X D;  5B31 G;  5AV9 C;  5B1L A;  1P3M B;  4J8V C;  3W96 A;  5BO0 B;  1P3O A;  4WU8 B;  3AZK D;  3AZG C;  3REI D;  3X1S D;  3X1V C;  3MVD D;  3EG5 B;  5BNV A;  2NQB C;  4LD9 C;  4X23 C;  1KX3 B;  3WAA A;  4H9N B;  3MGP B;  2F8N G;  2F8N K;  5JA4 A;  1HTA A;  5B0Y D;  3C1B D;  5GT0 C;  5BNX B;  5AVC C;  4J8W B;  3MGQ B;  2HIO B;  4J8X C;  1KX5 C;  1S32 D;  2Y2H A;  1M18 C;  1HQ3 D;  2CV5 B;  5FUG B;  4M6B A;  3LEL C;  5B1L D;  3B6F B;  1P3I A;  3V9R B;  3W96 D;  5AV5 A;  5BT1 D;  1F66 A;  5AY8 B;  4Z66 B;  4JJN A;  5B0Y C;  2F8N B;  2G5H C;  2L5A A;  4HGA C;  1P3A B;  5GT3 B;  3LZ0 A;  1S32 C;  5DNN A;  3A6N A;  3KWQ B;  2RVQ D;  1KX4 B;  3AZE C;  1P3M A;  2Y2M A;  2HUE C;  2RIQ A;  3VH5 A;  4WU8 A;  1B6W A;  3VH5 W;  5BT1 C;  2BYM B;  1KX3 A;  3WA9 B;  4H9N A;  3MGP A;  1P3I D;  5AV5 D;  1Z2C B;  1F66 D;  3AZM C;  4DQY B;  5BNX A;  4JJN D;  5C3I C;  3AN2 B;  1P34 C;  4J8W A;  3MGQ A;  2VQR A;  3X1U B;  5CPI B;  5B33 B;  3LZ0 D;  5DNN D;  3A6N D;  3KXB D;  1Q9C A;  2CV5 A;  1P3F B;  5FUG A;  2FJ7 B;  1TZY C;  3V9R A;  3MNN B;  4WV4 B;  4DRB A;  5AY8 A;  4Z66 A;  4WU8 D;  4KGC B;  5CPK B;  1F66 C;  3MGR C;  4JJN C;  1KX3 D;  3AZF C;  3VH5 T;  3AV2 A;  3B0B A;  3MGP D;  3REJ B;  1P3A A;  5GT3 A;  4G92 C;  3KWQ A;  1H3O B;  3NQU B;  1KX4 A;  3UTB A;  3KXB C;  3MGQ D;  2HIO D;  4J8W D;  2XD1 A;  3B6G C;  1U35 B;  5B31 D;  4WU9 B;  5JRG B;  2BYM A;  3REH B;  2CV5 D;  3WA9 A;  4H9P B;  2Y2P A;  3B6F D;  1M19 C;  5AY8 D;  4QLC C;  4Z66 D;  1P3O B;  1ID3 C;  3AN2 A;  3AZL C;  2F8N D;  1ZLA B;  4NE3 A;  5B32 C;  3X1U A;  2HIO C;  1P3A D;  5F99 C;  5B33 A;  5GT3 D;  3AZN A;  3KWQ D;  3REK B;  1P3F A;  2Y2Q A;  1KX4 D;  5GXQ C;  4NE6 A;  4XZQ B;  5B31 C;  5B2J B;  2FJ7 A;  1P3B B;  3MNN A;  3B6F C;  1N1J B;  4KGC A;  5CPK A;  1M1A B;  3NQJ B;  3UTA C;  2JE5 A;  1EQZ B;  3WA9 D;  3EPJ A;  1P3L B;  2Y2I A;  3REJ A;  4XUJ C;  3TU4 B;  3C1C C;  1H3O A;  3NQU A;  3X1T C;  2NZD B;  3AZH C;  4UUZ B;  1KX4 C;  3UT9 B;  5GSU C;  1U35 A;  3X1U D;  5CPI D;  5B2I C;  5B33 D;  4WZS B;  4WU9 A;  5JRG A;  3REH A;  3MGS B;  1P3F D;  3WKJ B;  2FJ7 D;  4H9P A;  2Y2K A;  3MNN D;  1WWS A;  3F6T A;  5AVB C;  4KGC D;  5CPK D;  1P3G A;  5B40 B;  4YM6 C;  1ZLA A;  1R4V A;  2UWX A;  3A1I A;  4E44 A;  3AYW B;  3REJ D;  5CPI C;  5DNM C;  4WNN B;  3REK A;  1BFM A;  5AV8 B;  4XZQ A;  4J8U B;  3H0R C;  5B2J A;  1P3B A;  4Z5T B;  3AV1 C;  2F8N H;  5G49 B;  1T3U A;  2CWE A;  1U35 D;  1N1J A;  3W97 A;  4H9O B;  5BS7 A;  1M1A A;  3NQJ A;  4WU9 D;  5JRG D;  4KHA B;  1A7W A;  3REH D;  4KGC C;  5CPK C;  1EQZ A;  3AZK C;  5CP6 B;  2DF4 C;  3REI C;  4H9S C;  3MVD C;  3X1S C;  1P3L A;  1BH8 B;  1P3O D;  4ZBJ B;  3TU4 A;  3C1B C;  2NZD A;  2ARO B;  5KDM A;  4UUZ A;  2JSS A;  1ZLA D;  3UT9 A;  5B24 B;  3AV2 B;  3WAA D;  3A1K A;  3MGS A;  3REK D;  1HQ3 C;  3WKJ A;  5B0Z B;  4XZQ D;  3H0L C;  5B2J D;  3UTB B;  1P3B D;  2FFF B;  2IO5 C;  3AZJ B;  5B1L C;  3W96 C;  1M1A D;  5B40 A;  1P3O C;  1EQZ D;  3W99 B;  3AYW A;  1P3L D;  2Y2J A;  3TU4 D;  3WAA C;  4WNN A;  2Y2G A;  3B0C W;  5AV8 A;  4J8U A;  2W8S A;  2NZD D;  4Z5T A;  2RVQ C;  5G49 A;  3UT9 D;  3W98 B;  3AZI B;  4H9O A;  4KHA A;  1P3P B;  3MGS D;  5AV6 B;  2F2A C;  3AZN B;  3WKJ D;  5BS7 C;  5CP6 A;  1M1A C;  4ZUX B;  3B0D B;  1P3M D;  1AOI B;  1BH8 A;  5E5A B;  5AV9 B;  1P3I C;  5AV5 C;  4E45 A;  5B40 D;  3TU4 C;  2ARO A;  5B1M A;  3AZG B;  3H0M C;  5B24 A;  2NZD C;  3AYW D;  3X1V B;  4AWL C;  4LD9 B;  4X23 B;  5B0Z A;  4G91 C;  4J8U D;  3LZ0 C;  5DNN C;  4Z5T D;  3A6N C;  3AZJ A;  4Z2M G;  3B0C T;  1P3M C;  5AVC B;  2XD5 A;  1KX5 B;  3EPK A;  4WU8 C;  1M18 B;  2ZY4 A;  4KUD B;  4Z2M H;  5CP6 D;  3W99 A;  5B40 C;  5CPJ B;  3REL A;  1KX3 C;  3LEL B;  3MGP C;  1P3G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...