5B33A

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33A00
5CHLB 4CSRA 5BT1D 3VH5T 1P3KC 5CP6B 3KSYA 1P3OC 1P34C 4EO5B 1P3MC 3WAAB 3W96D 2NZDD 5BNXA 3V9RA 3MGRD 1M18B 1HQ3A 4Z66C 5AV6A 3B6FB 5B33D 3AFAC 1ZLAD 4XZQB 1KX3A 4YM6C 5B0YC 1P3BC 5GXQD 3X1UA 3TU4C 4H9RB 5JRGA 3AZHB 5B1LA 1HTAA 3KUYD 3VH5A 3AZMD 3X1TA 4H9QB 2BYKB 4J8XB 3AN2A 2PYOC 1U35B 3LJAC 3AYWB 3W98A 5B32B 2AROB 3KWQC 1P3KD 1P3OD 1P34D 1KX4A 1N1JA 3C1BD 1ULYA 5BNVA 1P3MD 5GT0A 3W97C 4R8PB 3LZ1D 3NQJB 3MGSD 3C1CA 4NE5A 3AZFC 5CPJB 3AV2B 5GT3B 3X1SA 3AZIB 3AZJC 5E5AA 4CSRB 5B0YD 3LELC 1KX5C 3AZGC 5F99A 1P3PD 4QLCC 3AZLC 3WA9B 5B1MB 3REIA 1P3AC 1EQZC 2L5AA 5BNXB 3W99A 3V9RB 3X1VB 5DNMC 5AV6B 5DNND 3W96A 1M1AC 1KX3B 2NZDA 3LJAD 2NQBC 3MGRA 3KWQD 1TZYB 5B0ZC 1A7WA 3UT9D 5GSUC 4DRBA 1ZLAA 3X1UB 4YS3C 5AY8C 5B1LB 3REJC 4X23D 3X1TB 5GXQA 3AZKC 3AN2B 1JFIA 3LZ0D 5B31C 3WTPC 3W98B 5C3IC 3B0CT 3KUYA 3AZEA 4H9SC 3AZLD 3AZMA 1KX4B 1N1JB 1P3GD 5BNVB 4J8WD 4ZUXC 3C1CB 1P3KA 5B40C 1P3OA 1P34A 3C1BA 3REKC 4LD9C 3MNNC 1P3MA 3X1SB 1M1AD 3LZ1A 2NQBD 1HQ3D 4ZBJB 5F99B 1AOID 1P3FB 1BH9A 5B24D 4HGAB 5B32G 3REIB 3W99B 4YM6A 5B0YA 3REJD 1KU5A 1P3PA 3B0DC 3A6NC 3W96B 2NZDB 3MGRB 3UTAD 5B33B 1ID3C 1ZLAB 5FUGA 3UTBC 2FJ7C 5DNNA 4ZUXD 3MVDC 3LJAA 3REHB 3KWQA 5GXQB 1JFIB 3KXBC 5GT0D 4LD9D 3MNND 3UT9A 2CV5D 3KUYB 3AZFA 3AZMB 2IO5B 4E44A 3LZ0A 1M19C 3AZGA 1P3KB 3AZLA 3VH6W 1P34B 3C1BB 1P3OB 5B2IC 1P3GA 1P3AA 1EQZA 4J8WA 3B0BA 3LZ1B 3MGSB 1Q9CA 4WU9C 1P3IC 1F66D 2FJ7D 5KDMA 4KUDC 1M1AA 4XUJC 4WNNA 5AVBC 1P3LC 5B0YB 4J8VC 2NQBA 5AV9C 1P3PB 1AOIA 5B24A 5GSUA 5CPIC 5CPKD 4Z2MG 3O62D 3REJA 1BH8A 5FUGB 3B6GC 3AV1C 3NQUA 5DNNB 5B31A 3MGPD 3AZNC 3LJAB 3RELD 3AZED 4Z5TC 3KWQB 4H9NA 3UTAA 5B2ID 3UT9B 4G92B 4ZUXA 4EO5C 4J8UB 4X23B 4WU8C 3WAAC 5B40A 4Z2MH 3REKA 4LD9A 3MNNA 3LZ0B 2CV5A 1M18C 5AV8C 1P3LD 2YFVA 4Z66D 5AV9D 4XZQC 3AFAD 5B2JC 3AZLB 1P3GB 5AVCC 4J8WB 4YM6D 1P3BD 3AZHC 5KDMB 3TU4D 1M1AB 4WNNB 2NQBB 1HQ3B 4Z5TD 4J8XC 4DRAA 2PYOD 3WTPE 1AOIB 5B24B 1ID3A 1F66A 2FJ7A 5AV5C 3AYWC 5B32C 2AROC 1H3OA 1TAFA 3REJB 4WU8D 1BH8B 4R8PC 3W97D 5CPKA 5JRGB 5AV8D 5CPJC 5BO0A 3AZFD 5JA4A 4H9NB 3O62A 3UTAB 5BS7A 5B2JD 2HIOC 3AZIC 5AVCD 3AZJD 4ZUXB 3LELD 3MGPA 1KX5D 3RELA 3AZGD 3WA9C 5B1MC 4QLCD 5GT0B 3VH6A 5B2IA 1P3AD 4AWLB 1EQZD 4LD9B 3X1VC 2CV5B 5DNMD 2YFVB 1F1EA 5AV6C 4JJNC 1KX3C 2YFWA 5AV5D 5E5AB 1TZYC 1P3LA 4Z66A 4KGCC 1BFMA 5AV9A 5B0ZD 3AFAA 5GSUD 2LY8A 5B1LC 5AY8D 4YS3D 5CPIA 2HUEC 3X1TC 2F8ND 1P3BA 3AN2C 3AZKD 2HIOD 4CAYA 1F66B 2FJ7B 5B31D 3TU4A 3WTPD 2JSSA 1KX4C 1H3OB 1TAFB 4Z5TA 2PYOA 5CPKB 5BO0B 3O62B 1WWSA 5B40D 4JJND 4WU8A 3REKD 3X1SC 4G91B 3W97A 5G49A 3MGPB 5F99C 5AV8A 3RELB 3AZEB 1P3FC 4KGCD 4HGAC 5B2JA 5B2IB 5AVCA 3AZJA 3LELA 1KX5A 4QLCA 5B31G 3W96C 1S32C 1P3MB 2YFWB 3A6ND 2NZDC 3MGRC 4KHAA 5DNMA 1P3LB 4Z66B 4H9QA 5B33C 1ZLAC 5AV9B 1BH9B 3AFAB 1ID3D 3UTBD 5AV5A 3REHC 3MVDD 4YM6B 1P3BB 3KXBD 1WWIA 4CAYB 5B0ZA 3TU4B 4YS3A 3NQJA 5AY8A 3R45A 3KUYC 3MGQC 1B67A 3WKJC 4H9OA 3AZMC 2F8NA 4Z5TB 2IO5C 3AZKA 2PYOB 2HIOA 3WTPA 1M19D 3C1BC 4H9SA 5B1MA 4WU8B 3WA9A 1S32D 3W97B 5G49B 3LZ1C 3X1VA 3MGSC 5CP6C 5AV8B 3AZFB 4JJNA 4WU9D 1P3ID 5B2JB 4KUDD 5AVCB 4NE3A 3B0CW 4XUJD 3REHD 3AZJB 5AVBD 3LELB 4J8VD 1P3PC 1KX5B 3B6FC 3AZGB 1TZYA 4QLCB 4KGCA 5CPID 1P3AB 1EQZB 4KHAB 3MGQD 5DNMB 3WKJD 1R4VA 5DNNC 3B6GD 2CWEA 3AV1D 3A6NA 5AV5B 3AZND 4NFTA 3UT9C 3VH6T 5B0ZB 4G92C 5GSUB 3UTBA 1U35C 4YS3B 5AY8B 3R45B 5CP6D 3MVDA 4H9OB 4X23C 4J8UC 2F8NB 3WAAD 3AZKB 3KXBA 2HIOB 3NQUB 3LZ0C 1M18D 5B31B 3WTPB 5C3IB 3B6FD 3AV2C 4XZQD 1P3GC 5GT3C 1P3FA 4WV4B 4J8WC 4H9PA 1M19A 5B40B 4JJNB 3REKB 3AZHD 3MNNB 1S32A 1HQ3C 4M6BA 4J8XD 1AOIC 5B24C 5B33A 4KGCB 4WU9A 1P3IA 1U35D 3AYWD 4KUDA 5B32D 2AROD 4XUJA 3REHA 2BYMA 2HUEB 5AVBA 4J8UD 4J8VA 4NE6A 4UUZA 3X1UC 4R8PD 3B0DB 5JRGC 3A6NB 3VH5W 5CPJD 3MGQA 3UTAC 3WKJA 3AV2D 5GT3D 1ID3B 3AZID 3UTBB 3B6GA 3AV1A 4E45A 3W98C 3AZNA 3MVDB 3WA9D 5B1MD 4WZSB 5GT0C 3KXBB 4AWLC 2CV5C 3X1VD 3C1CC 3MGSA 5JA4B 5CP6A 5AV6D 2RVQC 3WAAA 1KX3D 4H9PB 5E5AC 4ZBJC 1M18A 1M19B 1TZYD 3B6FA 4XZQA 3REIC 3X1UD 5JRGD 1S32B 3W99C 5B1LD 2F8NG 5BT1C 3X1TD 3AN2D 1F66C 4WU9B 1P3IB 3AZHA 4H9RA 3W98D 4KUDB 4XUJB 2F8NK 2BYMB 5AVBB 1KX4D 4J8VB 2BYKA 4J8XA 4UUZB 5CPKC 1B6WA 5CPIB 1U35A 3AYWA 3C1CD 5B32A 2AROA 3O62C 3MGQB 3WKJB 5BS7C 5GXQC 4J8UA 4X23A 2F8NH 2RVQD 4G91C 3X1SD 4R8PA 3B6GB 3AV1B 5E5AD 3MGPC 3AZNB 3RELC 5F99D 3AZEC 5CPJA 1P3FD 3AV2A 3REID 5GT3A 3W99D 3AZIA
chains in the Genus database with same CATH superfamily
5CHLB 4CSRA 5BT1D 3VH5T 1P3KC 5CP6B 3KSYA 1P3OC 1P34C 2G5IC 4EO5B 2Y2KA 1P3MC 3WAAB 3W96D 2NZDD 5BNXA 3V9RA 3MGRD 1M18B 1HQ3A 4Z66C 5AV6A 3B6FB 5B33D 3AFAC 1ZLAD 4XZQB 1KX3A 3EG5B 4YM6C 5B0YC 1P3BC 5GXQD 3X1UA 3TU4C 4H9RB 5JRGA 3AZHB 5B1LA 1HTAA 3KUYD 3VH5A 3AZMD 3X1TA 4H9QB 2BYKB 4J8XB 3AN2A 2PYOC 1U35B 3LJAC 3AYWB 3W98A 5B32B 2AROB 3KWQC 1P3KD 1P3OD 1P34D 1KX4A 1N1JA 3C1BD 1ULYA 5BNVA 1P3MD 5GT0A 3W97C 4R8PB 3LZ1D 3NQJB 3MGSD 3C1CA 4NE5A 3AZFC 5CPJB 3AV2B 5GT3B 3X1SA 3AZIB 3AZJC 5E5AA 4CSRB 5B0YD 3LELC 1KX5C 3AZGC 5F99A 1P3PD 4QLCC 3AZLC 3WA9B 5B1MB 3REIA 1P3AC 1EQZC 2L5AA 5BNXB 3W99A 3V9RB 3X1VB 5DNMC 5AV6B 5DNND 3W96A 1M1AC 1KX3B 2NZDA 3LJAD 2NQBC 3MGRA 3KWQD 1TZYB 1PZRA 1A7WA 5B0ZC 5GSUC 4DRBA 3UT9D 1ZLAA 3X1UB 4YS3C 5AY8C 5B1LB 3REJC 4X23D 3X1TB 5GXQA 3AZKC 3AN2B 1JFIA 3LZ0D 5B31C 3WTPC 3W98B 5C3IC 3B0CT 3KUYA 2Y2JA 3AZEA 4H9SC 3AZLD 3AZMA 1KX4B 1N1JB 1P3GD 5BNVB 4J8WD 4ZUXC 3C1CB 1P3KA 5B40C 1P3OA 1P34A 3C1BA 3REKC 4LD9C 3MNNC 1P3MA 3X1SB 1M1AD 3LZ1A 2NQBD 1HQ3D 4ZBJB 5F99B 1AOID 1P3FB 1BH9A 5B24D 4HGAB 5B32G 3REIB 3W99B 4YM6A 3A1IA 5B0YA 3REJD 1KU5A 1P3PA 4UPKA 3B0DC 3A6NC 3W96B 3KFUG 2NZDB 2ZY5A 3MGRB 3UTAD 2FFFB 5B33B 1ID3C 1ZLAB 5FUGA 3UTBC 2FJ7C 5DNNA 4ZUXD 3MVDC 3LJAA 3REHB 3KWQA 5GXQB 1JFIB 3KXBC 5GT0D 4LD9D 3MNND 3UT9A 2CV5D 3KUYB 3AZFA 3AZMB 2IO5B 3EPLA 4E44A 3LZ0A 1M19C 3AZGA 1P3KB 3AZLA 3VH6W 1P34B 3C1BB 1P3OB 5B2IC 1P3GA 1P3AA 1EQZA 4J8WA 3FDDA 3B0BA 2Y2GA 3LZ1B 3MGSB 3EPHA 1Q9CA 4WU9C 1P3IC 1F66D 2FJ7D 5KDMA 4KUDC 1M1AA 4XUJC 4WNNA 2BG1A 5AVBC 1P3LC 5B0YB 4J8VC 2NQBA 5AV9C 1P3PB 2ZY3A 1AOIA 5B24A 5GSUA 5CPIC 5CPKD 2Y2OA 4Z2MG 3O62D 3REJA 1BH8A 5FUGB 3B6GC 3AV1C 3NQUA 5DNNB 5B31A 3MGPD 3AZNC 3LJAB 2W8SA 3RELD 3AZED 4Z5TC 3KWQB 4H9NA 3UTAA 2Y2HA 2XD1A 5B2ID 3UT9B 4G92B 4ZUXA 4EO5C 4J8UB 4X23B 4WU8C 3WAAC 3A1KA 5B40A 4Z2MH 2Y2IA 3REKA 4LD9A 3MNNA 3LZ0B 2CV5A 1M18C 2JCHA 5AV8C 1P3LD 2YFVA 4Z66D 5AV9D 4XZQC 3AFAD 5B2JC 3AZLB 1P3GB 5AVCC 4J8WB 4YM6D 1P3BD 2Y2QA 3AZHC 5KDMB 3TU4D 1M1AB 4WNNB 2NQBB 1HQ3B 4Z5TD 4J8XC 4DRAA 2PYOD 3WTPE 1AOIB 5B24B 1ID3A 1F66A 2FJ7A 5AV5C 3AYWC 3H0LC 5B32C 2AROC 1H3OA 1TAFA 3REJB 4WU8D 1BH8B 4R8PC 3W97D 5CPKA 5JRGB 3IP4C 5AV8D 5CPJC 5BO0A 3AZFD 5JA4A 4H9NB 3O62A 3UTAB 5BS7A 5B2JD 2HIOC 2DQNC 3AZIC 5AVCD 3AZJD 4ZUXB 3LELD 2Y2MA 3MGPA 1KX5D 3RELA 3AZGD 3WA9C 5B1MC 4QLCD 2XD5A 5GT0B 3VH6A 5B2IA 1P3AD 4AWLB 1EQZD 4LD9B 3X1VC 2CV5B 3AL0C 5DNMD 2YFVB 1F1EA 5AV6C 4JJNC 3EPKA 1KX3C 2YFWA 5AV5D 5E5AB 1Z2CB 1TZYC 1P3LA 4Z66A 4KGCC 1BFMA 5AV9A 2F2AC 5B0ZD 3AFAA 5GSUD 2LY8A 5B1LC 5AY8D 4YS3D 5CPIA 2HUEC 3X1TC 2F8ND 1P3BA 3AN2C 3AZKD 2HIOD 4CAYA 1F66B 2FJ7B 5B31D 3TU4A 3WTPD 2JSSA 2Y2LA 1KX4C 1H3OB 1TAFB 4Z5TA 3EPJA 2PYOA 5CPKB 5BO0B 3O62B 1WWSA 5B40D 4JJND 4WU8A 3REKD 3X1SC 4G91B 2UWXA 3W97A 5G49A 3MGPB 5F99C 5AV8A 3RELB 3AZEB 1P3FC 4KGCD 4HGAC 5B2JA 5B2IB 5AVCA 3P5JB 4DQYB 3AZJA 3LELA 1KX5A 2Y2NA 4QLCA 5B31G 3W96C 1S32C 1P3MB 2YFWB 3A6ND 2NZDC 3MGRC 4KHAA 5DNMA 1P3LB 4Z66B 4H9QA 5B33C 1ZLAC 5AV9B 1BH9B 3AFAB 1ID3D 3UTBD 5AV5A 3REHC 3MVDD 4YM6B 1P3BB 3KXBD 1WWIA 4CAYB 5B0ZA 3TU4B 4YS3A 3NQJA 5AY8A 3R45A 3KUYC 2ZY4A 3MGQC 1B67A 3WKJC 4H9OA 3AZMC 2F8NA 4Z5TB 2IO5C 3AZKA 2PYOB 2VQRA 2HIOA 3WTPA 1M19D 3C1BC 4H9SA 5B1MA 4WU8B 3WA9A 1S32D 3W97B 5G49B 3LZ1C 3X1VA 3H0MC 3MGSC 5CP6C 5AV8B 3AZFB 4JJNA 4WU9D 1P3ID 5B2JB 2ZM5A 4KUDD 5AVCB 4NE3A 3B0CW 4XUJD 3REHD 3AZJB 5AVBD 3LELB 4J8VD 1P3PC 1KX5B 3B6FC 3AZGB 1TZYA 4QLCB 4KGCA 5CPID 1P3AB 1EQZB 4KHAB 3MGQD 5DNMB 3WKJD 1R4VA 5DNNC 3B6GD 2CWEA 3AV1D 3A6NA 5AV5B 3AZND 4NFTA 1T3UA 3UT9C 3VH6T 5B0ZB 4G92C 5GSUB 3UTBA 1U35C 3F6TA 4YS3B 5AY8B 3R45B 5CP6D 3MVDA 4H9OB 4X23C 4J8UC 2F8NB 3WAAD 3AZKB 3KXBA 2HIOB 3NQUB 3LZ0C 1M18D 5B31B 3WTPB 5C3IB 3B6FD 3AV2C 4XZQD 1P3GC 5GT3C 1P3FA 4WV4B 2J8PA 4J8WC 4H9PA 1M19A 5B40B 4JJNB 3REKB 3AZHD 3MNNB 1S32A 1HQ3C 4M6BA 4J8XD 1AOIC 5B24C 5B33A 4KGCB 4WU9A 1P3IA 4WJ3C 1U35D 3AYWD 4KUDA 5B32D 3H0RC 2AROD 4XUJA 3REHA 2BYMA 2HUEB 5AVBA 4J8UD 4J8VA 2G5HC 4NE6A 4UUZA 3X1UC 4R8PD 3B0DB 5JRGC 3A6NB 3VH5W 5CPJD 3MGQA 3UTAC 3WKJA 3AV2D 5GT3D 1ID3B 3AZID 3UTBB 3B6GA 3AV1A 4E45A 3W98C 3AZNA 3MVDB 3WA9D 5B1MD 4WZSB 5GT0C 3KXBB 4AWLC 2CV5C 2ZY2A 3X1VD 3C1CC 3MGSA 5JA4B 5CP6A 5AV6D 2RVQC 3WAAA 1KX3D 4H9PB 5E5AC 4ZBJC 1M18A 1M19B 2DF4C 1TZYD 3B6FA 4XZQA 3REIC 3X1UD 5JRGD 1S32B 3W99C 5B1LD 2F8NG 5BT1C 3X1TD 3AN2D 2JE5A 1F66C 4WU9B 1P3IB 3AZHA 1W2EA 4H9RA 3W98D 4KUDB 4XUJB 2F8NK 2BYMB 5AVBB 1KX4D 4J8VB 2BYKA 4J8XA 4UUZB 5CPKC 1B6WA 5CPIB 2RIQA 3AYWA 1U35A 3C1CD 5B32A 2AROA 3O62C 3MGQB 3WKJB 5BS7C 5GXQC 4J8UA 4X23A 2F8NH 2RVQD 4G91C 3X1SD 4R8PA 3B6GB 3AV1B 5E5AD 3MGPC 3AZNB 2Y2PA 5F99D 3RELC 3AZEC 5CPJA 1P3FD 3AV2A 3REID 5GT3A 3W99D 3AZIA
chains in the Genus database with same CATH topology
5CHLB 4CSRA 5BT1D 3VH5T 1P3KC 5CP6B 3KSYA 1P3OC 1P34C 2G5IC 4EO5B 2Y2KA 1P3MC 3WAAB 3W96D 2NZDD 5BNXA 3V9RA 3MGRD 1M18B 1HQ3A 4Z66C 5AV6A 3B6FB 5B33D 3AFAC 1ZLAD 4XZQB 1KX3A 3EG5B 4YM6C 5B0YC 1P3BC 5GXQD 3X1UA 3TU4C 4H9RB 5JRGA 3AZHB 5B1LA 1HTAA 3KUYD 3VH5A 3AZMD 3X1TA 4H9QB 2BYKB 4J8XB 3AN2A 2PYOC 1U35B 3LJAC 3AYWB 3W98A 5B32B 2AROB 3KWQC 1P3KD 1P3OD 1P34D 1KX4A 1N1JA 3C1BD 1ULYA 5BNVA 1P3MD 5GT0A 3W97C 4R8PB 3LZ1D 3NQJB 3MGSD 3C1CA 4NE5A 3AZFC 5CPJB 3AV2B 5GT3B 3X1SA 3AZIB 3AZJC 5E5AA 4CSRB 5B0YD 3LELC 1KX5C 3AZGC 5F99A 1P3PD 4QLCC 3AZLC 3WA9B 5B1MB 3REIA 1P3AC 1EQZC 2L5AA 5BNXB 3W99A 3V9RB 3X1VB 5DNMC 5AV6B 5DNND 3W96A 1M1AC 1KX3B 2NZDA 3LJAD 2NQBC 3MGRA 3KWQD 1TZYB 1PZRA 1A7WA 5B0ZC 5GSUC 4DRBA 3UT9D 1ZLAA 3X1UB 4YS3C 5AY8C 5B1LB 3REJC 4X23D 3X1TB 5GXQA 3AZKC 3AN2B 1JFIA 3LZ0D 5B31C 3WTPC 3W98B 5C3IC 3B0CT 3KUYA 2Y2JA 3AZEA 4H9SC 3AZLD 3AZMA 1KX4B 1N1JB 1P3GD 5BNVB 4J8WD 4ZUXC 3C1CB 1P3KA 5B40C 1P3OA 1P34A 3C1BA 3REKC 4LD9C 3MNNC 1P3MA 3X1SB 1M1AD 3LZ1A 2NQBD 1HQ3D 4ZBJB 5F99B 1AOID 1P3FB 1BH9A 5B24D 4HGAB 5B32G 3REIB 3W99B 4YM6A 3A1IA 5B0YA 3REJD 1KU5A 1P3PA 4UPKA 3B0DC 3A6NC 3W96B 3KFUG 2NZDB 2ZY5A 3MGRB 3UTAD 2FFFB 5B33B 1ID3C 1ZLAB 5FUGA 3UTBC 2FJ7C 5DNNA 4ZUXD 3MVDC 3LJAA 3REHB 3KWQA 5GXQB 1JFIB 3KXBC 5GT0D 4LD9D 3MNND 3UT9A 2CV5D 3KUYB 3AZFA 3AZMB 2IO5B 3EPLA 4E44A 3LZ0A 1M19C 3AZGA 1P3KB 3AZLA 3VH6W 1P34B 3C1BB 1P3OB 5B2IC 1P3GA 1P3AA 1EQZA 4J8WA 3FDDA 3B0BA 2Y2GA 3LZ1B 3MGSB 3EPHA 1Q9CA 4WU9C 1P3IC 1F66D 2FJ7D 5KDMA 4KUDC 1M1AA 4XUJC 4WNNA 2BG1A 5AVBC 1P3LC 5B0YB 4J8VC 2NQBA 5AV9C 1P3PB 2ZY3A 1AOIA 5B24A 5GSUA 5CPIC 5CPKD 2Y2OA 4Z2MG 3O62D 3REJA 1BH8A 5FUGB 3B6GC 3AV1C 3NQUA 5DNNB 5B31A 3MGPD 3AZNC 3LJAB 2W8SA 3RELD 3AZED 4Z5TC 3KWQB 4H9NA 3UTAA 2Y2HA 2XD1A 5B2ID 3UT9B 4G92B 4ZUXA 4EO5C 4J8UB 4X23B 4WU8C 3WAAC 3A1KA 5B40A 4Z2MH 2Y2IA 3REKA 4LD9A 3MNNA 3LZ0B 2CV5A 1M18C 2JCHA 5AV8C 1P3LD 2YFVA 4Z66D 5AV9D 4XZQC 3AFAD 5B2JC 3AZLB 1P3GB 5AVCC 4J8WB 4YM6D 1P3BD 2Y2QA 3AZHC 5KDMB 3TU4D 1M1AB 4WNNB 2NQBB 1HQ3B 4Z5TD 4J8XC 4DRAA 2PYOD 3WTPE 1AOIB 5B24B 1ID3A 1F66A 2FJ7A 5AV5C 3AYWC 3H0LC 5B32C 2AROC 1H3OA 1TAFA 3REJB 4WU8D 1BH8B 4R8PC 3W97D 5CPKA 5JRGB 3IP4C 5AV8D 5CPJC 5BO0A 3AZFD 5JA4A 4H9NB 3O62A 3UTAB 5BS7A 5B2JD 2HIOC 2DQNC 3AZIC 5AVCD 3AZJD 4ZUXB 3LELD 2Y2MA 3MGPA 1KX5D 3RELA 3AZGD 3WA9C 5B1MC 4QLCD 2XD5A 5GT0B 3VH6A 5B2IA 1P3AD 4AWLB 1EQZD 4LD9B 3X1VC 2CV5B 3AL0C 5DNMD 2YFVB 1F1EA 5AV6C 4JJNC 3EPKA 1KX3C 2YFWA 5AV5D 5E5AB 1Z2CB 1TZYC 1P3LA 4Z66A 4KGCC 1BFMA 5AV9A 2F2AC 5B0ZD 3AFAA 5GSUD 2LY8A 5B1LC 5AY8D 4YS3D 5CPIA 2HUEC 3X1TC 2F8ND 1P3BA 3AN2C 3AZKD 2HIOD 4CAYA 1F66B 2FJ7B 5B31D 3TU4A 3WTPD 2JSSA 2Y2LA 1KX4C 1H3OB 1TAFB 4Z5TA 3EPJA 2PYOA 5CPKB 5BO0B 3O62B 1WWSA 5B40D 4JJND 4WU8A 3REKD 3X1SC 4G91B 2UWXA 3W97A 5G49A 3MGPB 5F99C 5AV8A 3RELB 3AZEB 1P3FC 4KGCD 4HGAC 5B2JA 5B2IB 5AVCA 3P5JB 4DQYB 3AZJA 3LELA 1KX5A 2Y2NA 4QLCA 5B31G 3W96C 1S32C 1P3MB 2YFWB 3A6ND 2NZDC 3MGRC 4KHAA 5DNMA 1P3LB 4Z66B 4H9QA 5B33C 1ZLAC 5AV9B 1BH9B 3AFAB 1ID3D 3UTBD 5AV5A 3REHC 3MVDD 4YM6B 1P3BB 3KXBD 1WWIA 4CAYB 5B0ZA 3TU4B 4YS3A 3NQJA 5AY8A 3R45A 3KUYC 2ZY4A 3MGQC 1B67A 3WKJC 4H9OA 3AZMC 2F8NA 4Z5TB 2IO5C 3AZKA 2PYOB 2VQRA 2HIOA 3WTPA 1M19D 3C1BC 4H9SA 5B1MA 4WU8B 3WA9A 1S32D 3W97B 5G49B 3LZ1C 3X1VA 3H0MC 3MGSC 5CP6C 5AV8B 3AZFB 4JJNA 4WU9D 1P3ID 5B2JB 2ZM5A 4KUDD 5AVCB 4NE3A 3B0CW 4XUJD 3REHD 3AZJB 5AVBD 3LELB 4J8VD 1P3PC 1KX5B 3B6FC 3AZGB 1TZYA 4QLCB 4KGCA 5CPID 1P3AB 1EQZB 4KHAB 3MGQD 5DNMB 3WKJD 1R4VA 5DNNC 3B6GD 2CWEA 3AV1D 3A6NA 5AV5B 3AZND 4NFTA 1T3UA 3UT9C 3VH6T 5B0ZB 4G92C 5GSUB 3UTBA 1U35C 3F6TA 4YS3B 5AY8B 3R45B 5CP6D 3MVDA 4H9OB 4X23C 4J8UC 2F8NB 3WAAD 3AZKB 3KXBA 2HIOB 3NQUB 3LZ0C 1M18D 5B31B 3WTPB 5C3IB 3B6FD 3AV2C 4XZQD 1P3GC 5GT3C 1P3FA 4WV4B 2J8PA 4J8WC 4H9PA 1M19A 5B40B 4JJNB 3REKB 3AZHD 3MNNB 1S32A 1HQ3C 4M6BA 4J8XD 1AOIC 5B24C 5B33A 4KGCB 4WU9A 1P3IA 4WJ3C 1U35D 3AYWD 4KUDA 5B32D 3H0RC 2AROD 4XUJA 3REHA 2BYMA 2HUEB 5AVBA 4J8UD 4J8VA 2G5HC 4NE6A 4UUZA 3X1UC 4R8PD 3B0DB 5JRGC 3A6NB 3VH5W 5CPJD 3MGQA 3UTAC 3WKJA 3AV2D 5GT3D 1ID3B 3AZID 3UTBB 3B6GA 3AV1A 4E45A 3W98C 3AZNA 3MVDB 3WA9D 5B1MD 4WZSB 5GT0C 3KXBB 4AWLC 2CV5C 2ZY2A 3X1VD 3C1CC 3MGSA 5JA4B 5CP6A 5AV6D 2RVQC 3WAAA 1KX3D 4H9PB 5E5AC 4ZBJC 1M18A 1M19B 2DF4C 1TZYD 3B6FA 4XZQA 3REIC 3X1UD 5JRGD 1S32B 3W99C 5B1LD 2F8NG 5BT1C 3X1TD 3AN2D 2JE5A 1F66C 4WU9B 1P3IB 3AZHA 1W2EA 4H9RA 3W98D 4KUDB 4XUJB 2F8NK 2BYMB 5AVBB 1KX4D 4J8VB 2BYKA 4J8XA 4UUZB 5CPKC 1B6WA 5CPIB 2RIQA 3AYWA 1U35A 3C1CD 5B32A 2AROA 3O62C 3MGQB 3WKJB 5BS7C 5GXQC 4J8UA 4X23A 2F8NH 2RVQD 4G91C 3X1SD 4R8PA 3B6GB 3AV1B 5E5AD 3MGPC 3AZNB 2Y2PA 5F99D 3RELC 3AZEC 5CPJA 1P3FD 3AV2A 3REID 5GT3A 3W99D 3AZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHL B;  4CSR A;  5BT1 D;  3VH5 T;  1P3K C;  5CP6 B;  3KSY A;  1P3O C;  1P34 C;  4EO5 B;  1P3M C;  3WAA B;  3W96 D;  2NZD D;  5BNX A;  3V9R A;  3MGR D;  1M18 B;  1HQ3 A;  4Z66 C;  5AV6 A;  3B6F B;  5B33 D;  3AFA C;  1ZLA D;  4XZQ B;  1KX3 A;  4YM6 C;  5B0Y C;  1P3B C;  5GXQ D;  3X1U A;  3TU4 C;  4H9R B;  5JRG A;  3AZH B;  5B1L A;  1HTA A;  3KUY D;  3VH5 A;  3AZM D;  3X1T A;  4H9Q B;  2BYK B;  4J8X B;  3AN2 A;  2PYO C;  1U35 B;  3LJA C;  3AYW B;  3W98 A;  5B32 B;  2ARO B;  3KWQ C;  1P3K D;  1P3O D;  1P34 D;  1KX4 A;  1N1J A;  3C1B D;  1ULY A;  5BNV A;  1P3M D;  5GT0 A;  3W97 C;  4R8P B;  3LZ1 D;  3NQJ B;  3MGS D;  3C1C A;  4NE5 A;  3AZF C;  5CPJ B;  3AV2 B;  5GT3 B;  3X1S A;  3AZI B;  3AZJ C;  5E5A A;  4CSR B;  5B0Y D;  3LEL C;  1KX5 C;  3AZG C;  5F99 A;  1P3P D;  4QLC C;  3AZL C;  3WA9 B;  5B1M B;  3REI A;  1P3A C;  1EQZ C;  2L5A A;  5BNX B;  3W99 A;  3V9R B;  3X1V B;  5DNM C;  5AV6 B;  5DNN D;  3W96 A;  1M1A C;  1KX3 B;  2NZD A;  3LJA D;  2NQB C;  3MGR A;  3KWQ D;  1TZY B;  5B0Z C;  1A7W A;  3UT9 D;  5GSU C;  4DRB A;  1ZLA A;  3X1U B;  4YS3 C;  5AY8 C;  5B1L B;  3REJ C;  4X23 D;  3X1T B;  5GXQ A;  3AZK C;  3AN2 B;  1JFI A;  3LZ0 D;  5B31 C;  3WTP C;  3W98 B;  5C3I C;  3B0C T;  3KUY A;  3AZE A;  4H9S C;  3AZL D;  3AZM A;  1KX4 B;  1N1J B;  1P3G D;  5BNV B;  4J8W D;  4ZUX C;  3C1C B;  1P3K A;  5B40 C;  1P3O A;  1P34 A;  3C1B A;  3REK C;  4LD9 C;  3MNN C;  1P3M A;  3X1S B;  1M1A D;  3LZ1 A;  2NQB D;  1HQ3 D;  4ZBJ B;  5F99 B;  1AOI D;  1P3F B;  1BH9 A;  5B24 D;  4HGA B;  5B32 G;  3REI B;  3W99 B;  4YM6 A;  5B0Y A;  3REJ D;  1KU5 A;  1P3P A;  3B0D C;  3A6N C;  3W96 B;  2NZD B;  3MGR B;  3UTA D;  5B33 B;  1ID3 C;  1ZLA B;  5FUG A;  3UTB C;  2FJ7 C;  5DNN A;  4ZUX D;  3MVD C;  3LJA A;  3REH B;  3KWQ A;  5GXQ B;  1JFI B;  3KXB C;  5GT0 D;  4LD9 D;  3MNN D;  3UT9 A;  2CV5 D;  3KUY B;  3AZF A;  3AZM B;  2IO5 B;  4E44 A;  3LZ0 A;  1M19 C;  3AZG A;  1P3K B;  3AZL A;  3VH6 W;  1P34 B;  3C1B B;  1P3O B;  5B2I C;  1P3G A;  1P3A A;  1EQZ A;  4J8W A;  3B0B A;  3LZ1 B;  3MGS B;  1Q9C A;  4WU9 C;  1P3I C;  1F66 D;  2FJ7 D;  5KDM A;  4KUD C;  1M1A A;  4XUJ C;  4WNN A;  5AVB C;  1P3L C;  5B0Y B;  4J8V C;  2NQB A;  5AV9 C;  1P3P B;  1AOI A;  5B24 A;  5GSU A;  5CPI C;  5CPK D;  4Z2M G;  3O62 D;  3REJ A;  1BH8 A;  5FUG B;  3B6G C;  3AV1 C;  3NQU A;  5DNN B;  5B31 A;  3MGP D;  3AZN C;  3LJA B;  3REL D;  3AZE D;  4Z5T C;  3KWQ B;  4H9N A;  3UTA A;  5B2I D;  3UT9 B;  4G92 B;  4ZUX A;  4EO5 C;  4J8U B;  4X23 B;  4WU8 C;  3WAA C;  5B40 A;  4Z2M H;  3REK A;  4LD9 A;  3MNN A;  3LZ0 B;  2CV5 A;  1M18 C;  5AV8 C;  1P3L D;  2YFV A;  4Z66 D;  5AV9 D;  4XZQ C;  3AFA D;  5B2J C;  3AZL B;  1P3G B;  5AVC C;  4J8W B;  4YM6 D;  1P3B D;  3AZH C;  5KDM B;  3TU4 D;  1M1A B;  4WNN B;  2NQB B;  1HQ3 B;  4Z5T D;  4J8X C;  4DRA A;  2PYO D;  3WTP E;  1AOI B;  5B24 B;  1ID3 A;  1F66 A;  2FJ7 A;  5AV5 C;  3AYW C;  5B32 C;  2ARO C;  1H3O A;  1TAF A;  3REJ B;  4WU8 D;  1BH8 B;  4R8P C;  3W97 D;  5CPK A;  5JRG B;  5AV8 D;  5CPJ C;  5BO0 A;  3AZF D;  5JA4 A;  4H9N B;  3O62 A;  3UTA B;  5BS7 A;  5B2J D;  2HIO C;  3AZI C;  5AVC D;  3AZJ D;  4ZUX B;  3LEL D;  3MGP A;  1KX5 D;  3REL A;  3AZG D;  3WA9 C;  5B1M C;  4QLC D;  5GT0 B;  3VH6 A;  5B2I A;  1P3A D;  4AWL B;  1EQZ D;  4LD9 B;  3X1V C;  2CV5 B;  5DNM D;  2YFV B;  1F1E A;  5AV6 C;  4JJN C;  1KX3 C;  2YFW A;  5AV5 D;  5E5A B;  1TZY C;  1P3L A;  4Z66 A;  4KGC C;  1BFM A;  5AV9 A;  5B0Z D;  3AFA A;  5GSU D;  2LY8 A;  5B1L C;  5AY8 D;  4YS3 D;  5CPI A;  2HUE C;  3X1T C;  2F8N D;  1P3B A;  3AN2 C;  3AZK D;  2HIO D;  4CAY A;  1F66 B;  2FJ7 B;  5B31 D;  3TU4 A;  3WTP D;  2JSS A;  1KX4 C;  1H3O B;  1TAF B;  4Z5T A;  2PYO A;  5CPK B;  5BO0 B;  3O62 B;  1WWS A;  5B40 D;  4JJN D;  4WU8 A;  3REK D;  3X1S C;  4G91 B;  3W97 A;  5G49 A;  3MGP B;  5F99 C;  5AV8 A;  3REL B;  3AZE B;  1P3F C;  4KGC D;  4HGA C;  5B2J A;  5B2I B;  5AVC A;  3AZJ A;  3LEL A;  1KX5 A;  4QLC A;  5B31 G;  3W96 C;  1S32 C;  1P3M B;  2YFW B;  3A6N D;  2NZD C;  3MGR C;  4KHA A;  5DNM A;  1P3L B;  4Z66 B;  4H9Q A;  5B33 C;  1ZLA C;  5AV9 B;  1BH9 B;  3AFA B;  1ID3 D;  3UTB D;  5AV5 A;  3REH C;  3MVD D;  4YM6 B;  1P3B B;  3KXB D;  1WWI A;  4CAY B;  5B0Z A;  3TU4 B;  4YS3 A;  3NQJ A;  5AY8 A;  3R45 A;  3KUY C;  3MGQ C;  1B67 A;  3WKJ C;  4H9O A;  3AZM C;  2F8N A;  4Z5T B;  2IO5 C;  3AZK A;  2PYO B;  2HIO A;  3WTP A;  1M19 D;  3C1B C;  4H9S A;  5B1M A;  4WU8 B;  3WA9 A;  1S32 D;  3W97 B;  5G49 B;  3LZ1 C;  3X1V A;  3MGS C;  5CP6 C;  5AV8 B;  3AZF B;  4JJN A;  4WU9 D;  1P3I D;  5B2J B;  4KUD D;  5AVC B;  4NE3 A;  3B0C W;  4XUJ D;  3REH D;  3AZJ B;  5AVB D;  3LEL B;  4J8V D;  1P3P C;  1KX5 B;  3B6F C;  3AZG B;  1TZY A;  4QLC B;  4KGC A;  5CPI D;  1P3A B;  1EQZ B;  4KHA B;  3MGQ D;  5DNM B;  3WKJ D;  1R4V A;  5DNN C;  3B6G D;  2CWE A;  3AV1 D;  3A6N A;  5AV5 B;  3AZN D;  4NFT A;  3UT9 C;  3VH6 T;  5B0Z B;  4G92 C;  5GSU B;  3UTB A;  1U35 C;  4YS3 B;  5AY8 B;  3R45 B;  5CP6 D;  3MVD A;  4H9O B;  4X23 C;  4J8U C;  2F8N B;  3WAA D;  3AZK B;  3KXB A;  2HIO B;  3NQU B;  3LZ0 C;  1M18 D;  5B31 B;  3WTP B;  5C3I B;  3B6F D;  3AV2 C;  4XZQ D;  1P3G C;  5GT3 C;  1P3F A;  4WV4 B;  4J8W C;  4H9P A;  1M19 A;  5B40 B;  4JJN B;  3REK B;  3AZH D;  3MNN B;  1S32 A;  1HQ3 C;  4M6B A;  4J8X D;  1AOI C;  5B24 C;  5B33 A;  4KGC B;  4WU9 A;  1P3I A;  1U35 D;  3AYW D;  4KUD A;  5B32 D;  2ARO D;  4XUJ A;  3REH A;  2BYM A;  2HUE B;  5AVB A;  4J8U D;  4J8V A;  4NE6 A;  4UUZ A;  3X1U C;  4R8P D;  3B0D B;  5JRG C;  3A6N B;  3VH5 W;  5CPJ D;  3MGQ A;  3UTA C;  3WKJ A;  3AV2 D;  5GT3 D;  1ID3 B;  3AZI D;  3UTB B;  3B6G A;  3AV1 A;  4E45 A;  3W98 C;  3AZN A;  3MVD B;  3WA9 D;  5B1M D;  4WZS B;  5GT0 C;  3KXB B;  4AWL C;  2CV5 C;  3X1V D;  3C1C C;  3MGS A;  5JA4 B;  5CP6 A;  5AV6 D;  2RVQ C;  3WAA A;  1KX3 D;  4H9P B;  5E5A C;  4ZBJ C;  1M18 A;  1M19 B;  1TZY D;  3B6F A;  4XZQ A;  3REI C;  3X1U D;  5JRG D;  1S32 B;  3W99 C;  5B1L D;  2F8N G;  5BT1 C;  3X1T D;  3AN2 D;  1F66 C;  4WU9 B;  1P3I B;  3AZH A;  4H9R A;  3W98 D;  4KUD B;  4XUJ B;  2F8N K;  2BYM B;  5AVB B;  1KX4 D;  4J8V B;  2BYK A;  4J8X A;  4UUZ B;  5CPK C;  1B6W A;  5CPI B;  1U35 A;  3AYW A;  3C1C D;  5B32 A;  2ARO A;  3O62 C;  3MGQ B;  3WKJ B;  5BS7 C;  5GXQ C;  4J8U A;  4X23 A;  2F8N H;  2RVQ D;  4G91 C;  3X1S D;  4R8P A;  3B6G B;  3AV1 B;  5E5A D;  3MGP C;  3AZN B;  3REL C;  5F99 D;  3AZE C;  5CPJ A;  1P3F D;  3AV2 A;  3REI D;  5GT3 A;  3W99 D;  3AZI A; 
#chains in the Genus database with same CATH topology
 5CHL B;  4CSR A;  5BT1 D;  3VH5 T;  1P3K C;  5CP6 B;  3KSY A;  1P3O C;  1P34 C;  2G5I C;  4EO5 B;  2Y2K A;  1P3M C;  3WAA B;  3W96 D;  2NZD D;  5BNX A;  3V9R A;  3MGR D;  1M18 B;  1HQ3 A;  4Z66 C;  5AV6 A;  3B6F B;  5B33 D;  3AFA C;  1ZLA D;  4XZQ B;  1KX3 A;  3EG5 B;  4YM6 C;  5B0Y C;  1P3B C;  5GXQ D;  3X1U A;  3TU4 C;  4H9R B;  5JRG A;  3AZH B;  5B1L A;  1HTA A;  3KUY D;  3VH5 A;  3AZM D;  3X1T A;  4H9Q B;  2BYK B;  4J8X B;  3AN2 A;  2PYO C;  1U35 B;  3LJA C;  3AYW B;  3W98 A;  5B32 B;  2ARO B;  3KWQ C;  1P3K D;  1P3O D;  1P34 D;  1KX4 A;  1N1J A;  3C1B D;  1ULY A;  5BNV A;  1P3M D;  5GT0 A;  3W97 C;  4R8P B;  3LZ1 D;  3NQJ B;  3MGS D;  3C1C A;  4NE5 A;  3AZF C;  5CPJ B;  3AV2 B;  5GT3 B;  3X1S A;  3AZI B;  3AZJ C;  5E5A A;  4CSR B;  5B0Y D;  3LEL C;  1KX5 C;  3AZG C;  5F99 A;  1P3P D;  4QLC C;  3AZL C;  3WA9 B;  5B1M B;  3REI A;  1P3A C;  1EQZ C;  2L5A A;  5BNX B;  3W99 A;  3V9R B;  3X1V B;  5DNM C;  5AV6 B;  5DNN D;  3W96 A;  1M1A C;  1KX3 B;  2NZD A;  3LJA D;  2NQB C;  3MGR A;  3KWQ D;  1TZY B;  1PZR A;  1A7W A;  5B0Z C;  5GSU C;  4DRB A;  3UT9 D;  1ZLA A;  3X1U B;  4YS3 C;  5AY8 C;  5B1L B;  3REJ C;  4X23 D;  3X1T B;  5GXQ A;  3AZK C;  3AN2 B;  1JFI A;  3LZ0 D;  5B31 C;  3WTP C;  3W98 B;  5C3I C;  3B0C T;  3KUY A;  2Y2J A;  3AZE A;  4H9S C;  3AZL D;  3AZM A;  1KX4 B;  1N1J B;  1P3G D;  5BNV B;  4J8W D;  4ZUX C;  3C1C B;  1P3K A;  5B40 C;  1P3O A;  1P34 A;  3C1B A;  3REK C;  4LD9 C;  3MNN C;  1P3M A;  3X1S B;  1M1A D;  3LZ1 A;  2NQB D;  1HQ3 D;  4ZBJ B;  5F99 B;  1AOI D;  1P3F B;  1BH9 A;  5B24 D;  4HGA B;  5B32 G;  3REI B;  3W99 B;  4YM6 A;  3A1I A;  5B0Y A;  3REJ D;  1KU5 A;  1P3P A;  4UPK A;  3B0D C;  3A6N C;  3W96 B;  3KFU G;  2NZD B;  2ZY5 A;  3MGR B;  3UTA D;  2FFF B;  5B33 B;  1ID3 C;  1ZLA B;  5FUG A;  3UTB C;  2FJ7 C;  5DNN A;  4ZUX D;  3MVD C;  3LJA A;  3REH B;  3KWQ A;  5GXQ B;  1JFI B;  3KXB C;  5GT0 D;  4LD9 D;  3MNN D;  3UT9 A;  2CV5 D;  3KUY B;  3AZF A;  3AZM B;  2IO5 B;  3EPL A;  4E44 A;  3LZ0 A;  1M19 C;  3AZG A;  1P3K B;  3AZL A;  3VH6 W;  1P34 B;  3C1B B;  1P3O B;  5B2I C;  1P3G A;  1P3A A;  1EQZ A;  4J8W A;  3FDD A;  3B0B A;  2Y2G A;  3LZ1 B;  3MGS B;  3EPH A;  1Q9C A;  4WU9 C;  1P3I C;  1F66 D;  2FJ7 D;  5KDM A;  4KUD C;  1M1A A;  4XUJ C;  4WNN A;  2BG1 A;  5AVB C;  1P3L C;  5B0Y B;  4J8V C;  2NQB A;  5AV9 C;  1P3P B;  2ZY3 A;  1AOI A;  5B24 A;  5GSU A;  5CPI C;  5CPK D;  2Y2O A;  4Z2M G;  3O62 D;  3REJ A;  1BH8 A;  5FUG B;  3B6G C;  3AV1 C;  3NQU A;  5DNN B;  5B31 A;  3MGP D;  3AZN C;  3LJA B;  2W8S A;  3REL D;  3AZE D;  4Z5T C;  3KWQ B;  4H9N A;  3UTA A;  2Y2H A;  2XD1 A;  5B2I D;  3UT9 B;  4G92 B;  4ZUX A;  4EO5 C;  4J8U B;  4X23 B;  4WU8 C;  3WAA C;  3A1K A;  5B40 A;  4Z2M H;  2Y2I A;  3REK A;  4LD9 A;  3MNN A;  3LZ0 B;  2CV5 A;  1M18 C;  2JCH A;  5AV8 C;  1P3L D;  2YFV A;  4Z66 D;  5AV9 D;  4XZQ C;  3AFA D;  5B2J C;  3AZL B;  1P3G B;  5AVC C;  4J8W B;  4YM6 D;  1P3B D;  2Y2Q A;  3AZH C;  5KDM B;  3TU4 D;  1M1A B;  4WNN B;  2NQB B;  1HQ3 B;  4Z5T D;  4J8X C;  4DRA A;  2PYO D;  3WTP E;  1AOI B;  5B24 B;  1ID3 A;  1F66 A;  2FJ7 A;  5AV5 C;  3AYW C;  3H0L C;  5B32 C;  2ARO C;  1H3O A;  1TAF A;  3REJ B;  4WU8 D;  1BH8 B;  4R8P C;  3W97 D;  5CPK A;  5JRG B;  3IP4 C;  5AV8 D;  5CPJ C;  5BO0 A;  3AZF D;  5JA4 A;  4H9N B;  3O62 A;  3UTA B;  5BS7 A;  5B2J D;  2HIO C;  2DQN C;  3AZI C;  5AVC D;  3AZJ D;  4ZUX B;  3LEL D;  2Y2M A;  3MGP A;  1KX5 D;  3REL A;  3AZG D;  3WA9 C;  5B1M C;  4QLC D;  2XD5 A;  5GT0 B;  3VH6 A;  5B2I A;  1P3A D;  4AWL B;  1EQZ D;  4LD9 B;  3X1V C;  2CV5 B;  3AL0 C;  5DNM D;  2YFV B;  1F1E A;  5AV6 C;  4JJN C;  3EPK A;  1KX3 C;  2YFW A;  5AV5 D;  5E5A B;  1Z2C B;  1TZY C;  1P3L A;  4Z66 A;  4KGC C;  1BFM A;  5AV9 A;  2F2A C;  5B0Z D;  3AFA A;  5GSU D;  2LY8 A;  5B1L C;  5AY8 D;  4YS3 D;  5CPI A;  2HUE C;  3X1T C;  2F8N D;  1P3B A;  3AN2 C;  3AZK D;  2HIO D;  4CAY A;  1F66 B;  2FJ7 B;  5B31 D;  3TU4 A;  3WTP D;  2JSS A;  2Y2L A;  1KX4 C;  1H3O B;  1TAF B;  4Z5T A;  3EPJ A;  2PYO A;  5CPK B;  5BO0 B;  3O62 B;  1WWS A;  5B40 D;  4JJN D;  4WU8 A;  3REK D;  3X1S C;  4G91 B;  2UWX A;  3W97 A;  5G49 A;  3MGP B;  5F99 C;  5AV8 A;  3REL B;  3AZE B;  1P3F C;  4KGC D;  4HGA C;  5B2J A;  5B2I B;  5AVC A;  3P5J B;  4DQY B;  3AZJ A;  3LEL A;  1KX5 A;  2Y2N A;  4QLC A;  5B31 G;  3W96 C;  1S32 C;  1P3M B;  2YFW B;  3A6N D;  2NZD C;  3MGR C;  4KHA A;  5DNM A;  1P3L B;  4Z66 B;  4H9Q A;  5B33 C;  1ZLA C;  5AV9 B;  1BH9 B;  3AFA B;  1ID3 D;  3UTB D;  5AV5 A;  3REH C;  3MVD D;  4YM6 B;  1P3B B;  3KXB D;  1WWI A;  4CAY B;  5B0Z A;  3TU4 B;  4YS3 A;  3NQJ A;  5AY8 A;  3R45 A;  3KUY C;  2ZY4 A;  3MGQ C;  1B67 A;  3WKJ C;  4H9O A;  3AZM C;  2F8N A;  4Z5T B;  2IO5 C;  3AZK A;  2PYO B;  2VQR A;  2HIO A;  3WTP A;  1M19 D;  3C1B C;  4H9S A;  5B1M A;  4WU8 B;  3WA9 A;  1S32 D;  3W97 B;  5G49 B;  3LZ1 C;  3X1V A;  3H0M C;  3MGS C;  5CP6 C;  5AV8 B;  3AZF B;  4JJN A;  4WU9 D;  1P3I D;  5B2J B;  2ZM5 A;  4KUD D;  5AVC B;  4NE3 A;  3B0C W;  4XUJ D;  3REH D;  3AZJ B;  5AVB D;  3LEL B;  4J8V D;  1P3P C;  1KX5 B;  3B6F C;  3AZG B;  1TZY A;  4QLC B;  4KGC A;  5CPI D;  1P3A B;  1EQZ B;  4KHA B;  3MGQ D;  5DNM B;  3WKJ D;  1R4V A;  5DNN C;  3B6G D;  2CWE A;  3AV1 D;  3A6N A;  5AV5 B;  3AZN D;  4NFT A;  1T3U A;  3UT9 C;  3VH6 T;  5B0Z B;  4G92 C;  5GSU B;  3UTB A;  1U35 C;  3F6T A;  4YS3 B;  5AY8 B;  3R45 B;  5CP6 D;  3MVD A;  4H9O B;  4X23 C;  4J8U C;  2F8N B;  3WAA D;  3AZK B;  3KXB A;  2HIO B;  3NQU B;  3LZ0 C;  1M18 D;  5B31 B;  3WTP B;  5C3I B;  3B6F D;  3AV2 C;  4XZQ D;  1P3G C;  5GT3 C;  1P3F A;  4WV4 B;  2J8P A;  4J8W C;  4H9P A;  1M19 A;  5B40 B;  4JJN B;  3REK B;  3AZH D;  3MNN B;  1S32 A;  1HQ3 C;  4M6B A;  4J8X D;  1AOI C;  5B24 C;  5B33 A;  4KGC B;  4WU9 A;  1P3I A;  4WJ3 C;  1U35 D;  3AYW D;  4KUD A;  5B32 D;  3H0R C;  2ARO D;  4XUJ A;  3REH A;  2BYM A;  2HUE B;  5AVB A;  4J8U D;  4J8V A;  2G5H C;  4NE6 A;  4UUZ A;  3X1U C;  4R8P D;  3B0D B;  5JRG C;  3A6N B;  3VH5 W;  5CPJ D;  3MGQ A;  3UTA C;  3WKJ A;  3AV2 D;  5GT3 D;  1ID3 B;  3AZI D;  3UTB B;  3B6G A;  3AV1 A;  4E45 A;  3W98 C;  3AZN A;  3MVD B;  3WA9 D;  5B1M D;  4WZS B;  5GT0 C;  3KXB B;  4AWL C;  2CV5 C;  2ZY2 A;  3X1V D;  3C1C C;  3MGS A;  5JA4 B;  5CP6 A;  5AV6 D;  2RVQ C;  3WAA A;  1KX3 D;  4H9P B;  5E5A C;  4ZBJ C;  1M18 A;  1M19 B;  2DF4 C;  1TZY D;  3B6F A;  4XZQ A;  3REI C;  3X1U D;  5JRG D;  1S32 B;  3W99 C;  5B1L D;  2F8N G;  5BT1 C;  3X1T D;  3AN2 D;  2JE5 A;  1F66 C;  4WU9 B;  1P3I B;  3AZH A;  1W2E A;  4H9R A;  3W98 D;  4KUD B;  4XUJ B;  2F8N K;  2BYM B;  5AVB B;  1KX4 D;  4J8V B;  2BYK A;  4J8X A;  4UUZ B;  5CPK C;  1B6W A;  5CPI B;  2RIQ A;  3AYW A;  1U35 A;  3C1C D;  5B32 A;  2ARO A;  3O62 C;  3MGQ B;  3WKJ B;  5BS7 C;  5GXQ C;  4J8U A;  4X23 A;  2F8N H;  2RVQ D;  4G91 C;  3X1S D;  4R8P A;  3B6G B;  3AV1 B;  5E5A D;  3MGP C;  3AZN B;  2Y2P A;  5F99 D;  3REL C;  3AZE C;  5CPJ A;  1P3F D;  3AV2 A;  3REI D;  5GT3 A;  3W99 D;  3AZI A; 
#chains in the Genus database with same CATH homology
 5CHL B;  4CSR A;  5BT1 D;  3VH5 T;  1P3K C;  5CP6 B;  3KSY A;  1P3O C;  1P34 C;  2G5I C;  4EO5 B;  2Y2K A;  1P3M C;  3WAA B;  3W96 D;  2NZD D;  5BNX A;  3V9R A;  3MGR D;  1M18 B;  1HQ3 A;  4Z66 C;  5AV6 A;  3B6F B;  5B33 D;  3AFA C;  1ZLA D;  4XZQ B;  1KX3 A;  3EG5 B;  4YM6 C;  5B0Y C;  1P3B C;  5GXQ D;  3X1U A;  3TU4 C;  4H9R B;  5JRG A;  3AZH B;  5B1L A;  1HTA A;  3KUY D;  3VH5 A;  3AZM D;  3X1T A;  4H9Q B;  2BYK B;  4J8X B;  3AN2 A;  2PYO C;  1U35 B;  3LJA C;  3AYW B;  3W98 A;  5B32 B;  2ARO B;  3KWQ C;  1P3K D;  1P3O D;  1P34 D;  1KX4 A;  1N1J A;  3C1B D;  1ULY A;  5BNV A;  1P3M D;  5GT0 A;  3W97 C;  4R8P B;  3LZ1 D;  3NQJ B;  3MGS D;  3C1C A;  4NE5 A;  3AZF C;  5CPJ B;  3AV2 B;  5GT3 B;  3X1S A;  3AZI B;  3AZJ C;  5E5A A;  4CSR B;  5B0Y D;  3LEL C;  1KX5 C;  3AZG C;  5F99 A;  1P3P D;  4QLC C;  3AZL C;  3WA9 B;  5B1M B;  3REI A;  1P3A C;  1EQZ C;  2L5A A;  5BNX B;  3W99 A;  3V9R B;  3X1V B;  5DNM C;  5AV6 B;  5DNN D;  3W96 A;  1M1A C;  1KX3 B;  2NZD A;  3LJA D;  2NQB C;  3MGR A;  3KWQ D;  1TZY B;  1PZR A;  1A7W A;  5B0Z C;  5GSU C;  4DRB A;  3UT9 D;  1ZLA A;  3X1U B;  4YS3 C;  5AY8 C;  5B1L B;  3REJ C;  4X23 D;  3X1T B;  5GXQ A;  3AZK C;  3AN2 B;  1JFI A;  3LZ0 D;  5B31 C;  3WTP C;  3W98 B;  5C3I C;  3B0C T;  3KUY A;  2Y2J A;  3AZE A;  4H9S C;  3AZL D;  3AZM A;  1KX4 B;  1N1J B;  1P3G D;  5BNV B;  4J8W D;  4ZUX C;  3C1C B;  1P3K A;  5B40 C;  1P3O A;  1P34 A;  3C1B A;  3REK C;  4LD9 C;  3MNN C;  1P3M A;  3X1S B;  1M1A D;  3LZ1 A;  2NQB D;  1HQ3 D;  4ZBJ B;  5F99 B;  1AOI D;  1P3F B;  1BH9 A;  5B24 D;  4HGA B;  5B32 G;  3REI B;  3W99 B;  4YM6 A;  3A1I A;  5B0Y A;  3REJ D;  1KU5 A;  1P3P A;  4UPK A;  3B0D C;  3A6N C;  3W96 B;  3KFU G;  2NZD B;  2ZY5 A;  3MGR B;  3UTA D;  2FFF B;  5B33 B;  1ID3 C;  1ZLA B;  5FUG A;  3UTB C;  2FJ7 C;  5DNN A;  4ZUX D;  3MVD C;  3LJA A;  3REH B;  3KWQ A;  5GXQ B;  1JFI B;  3KXB C;  5GT0 D;  4LD9 D;  3MNN D;  3UT9 A;  2CV5 D;  3KUY B;  3AZF A;  3AZM B;  2IO5 B;  3EPL A;  4E44 A;  3LZ0 A;  1M19 C;  3AZG A;  1P3K B;  3AZL A;  3VH6 W;  1P34 B;  3C1B B;  1P3O B;  5B2I C;  1P3G A;  1P3A A;  1EQZ A;  4J8W A;  3FDD A;  3B0B A;  2Y2G A;  3LZ1 B;  3MGS B;  3EPH A;  1Q9C A;  4WU9 C;  1P3I C;  1F66 D;  2FJ7 D;  5KDM A;  4KUD C;  1M1A A;  4XUJ C;  4WNN A;  2BG1 A;  5AVB C;  1P3L C;  5B0Y B;  4J8V C;  2NQB A;  5AV9 C;  1P3P B;  2ZY3 A;  1AOI A;  5B24 A;  5GSU A;  5CPI C;  5CPK D;  2Y2O A;  4Z2M G;  3O62 D;  3REJ A;  1BH8 A;  5FUG B;  3B6G C;  3AV1 C;  3NQU A;  5DNN B;  5B31 A;  3MGP D;  3AZN C;  3LJA B;  2W8S A;  3REL D;  3AZE D;  4Z5T C;  3KWQ B;  4H9N A;  3UTA A;  2Y2H A;  2XD1 A;  5B2I D;  3UT9 B;  4G92 B;  4ZUX A;  4EO5 C;  4J8U B;  4X23 B;  4WU8 C;  3WAA C;  3A1K A;  5B40 A;  4Z2M H;  2Y2I A;  3REK A;  4LD9 A;  3MNN A;  3LZ0 B;  2CV5 A;  1M18 C;  2JCH A;  5AV8 C;  1P3L D;  2YFV A;  4Z66 D;  5AV9 D;  4XZQ C;  3AFA D;  5B2J C;  3AZL B;  1P3G B;  5AVC C;  4J8W B;  4YM6 D;  1P3B D;  2Y2Q A;  3AZH C;  5KDM B;  3TU4 D;  1M1A B;  4WNN B;  2NQB B;  1HQ3 B;  4Z5T D;  4J8X C;  4DRA A;  2PYO D;  3WTP E;  1AOI B;  5B24 B;  1ID3 A;  1F66 A;  2FJ7 A;  5AV5 C;  3AYW C;  3H0L C;  5B32 C;  2ARO C;  1H3O A;  1TAF A;  3REJ B;  4WU8 D;  1BH8 B;  4R8P C;  3W97 D;  5CPK A;  5JRG B;  3IP4 C;  5AV8 D;  5CPJ C;  5BO0 A;  3AZF D;  5JA4 A;  4H9N B;  3O62 A;  3UTA B;  5BS7 A;  5B2J D;  2HIO C;  2DQN C;  3AZI C;  5AVC D;  3AZJ D;  4ZUX B;  3LEL D;  2Y2M A;  3MGP A;  1KX5 D;  3REL A;  3AZG D;  3WA9 C;  5B1M C;  4QLC D;  2XD5 A;  5GT0 B;  3VH6 A;  5B2I A;  1P3A D;  4AWL B;  1EQZ D;  4LD9 B;  3X1V C;  2CV5 B;  3AL0 C;  5DNM D;  2YFV B;  1F1E A;  5AV6 C;  4JJN C;  3EPK A;  1KX3 C;  2YFW A;  5AV5 D;  5E5A B;  1Z2C B;  1TZY C;  1P3L A;  4Z66 A;  4KGC C;  1BFM A;  5AV9 A;  2F2A C;  5B0Z D;  3AFA A;  5GSU D;  2LY8 A;  5B1L C;  5AY8 D;  4YS3 D;  5CPI A;  2HUE C;  3X1T C;  2F8N D;  1P3B A;  3AN2 C;  3AZK D;  2HIO D;  4CAY A;  1F66 B;  2FJ7 B;  5B31 D;  3TU4 A;  3WTP D;  2JSS A;  2Y2L A;  1KX4 C;  1H3O B;  1TAF B;  4Z5T A;  3EPJ A;  2PYO A;  5CPK B;  5BO0 B;  3O62 B;  1WWS A;  5B40 D;  4JJN D;  4WU8 A;  3REK D;  3X1S C;  4G91 B;  2UWX A;  3W97 A;  5G49 A;  3MGP B;  5F99 C;  5AV8 A;  3REL B;  3AZE B;  1P3F C;  4KGC D;  4HGA C;  5B2J A;  5B2I B;  5AVC A;  3P5J B;  4DQY B;  3AZJ A;  3LEL A;  1KX5 A;  2Y2N A;  4QLC A;  5B31 G;  3W96 C;  1S32 C;  1P3M B;  2YFW B;  3A6N D;  2NZD C;  3MGR C;  4KHA A;  5DNM A;  1P3L B;  4Z66 B;  4H9Q A;  5B33 C;  1ZLA C;  5AV9 B;  1BH9 B;  3AFA B;  1ID3 D;  3UTB D;  5AV5 A;  3REH C;  3MVD D;  4YM6 B;  1P3B B;  3KXB D;  1WWI A;  4CAY B;  5B0Z A;  3TU4 B;  4YS3 A;  3NQJ A;  5AY8 A;  3R45 A;  3KUY C;  2ZY4 A;  3MGQ C;  1B67 A;  3WKJ C;  4H9O A;  3AZM C;  2F8N A;  4Z5T B;  2IO5 C;  3AZK A;  2PYO B;  2VQR A;  2HIO A;  3WTP A;  1M19 D;  3C1B C;  4H9S A;  5B1M A;  4WU8 B;  3WA9 A;  1S32 D;  3W97 B;  5G49 B;  3LZ1 C;  3X1V A;  3H0M C;  3MGS C;  5CP6 C;  5AV8 B;  3AZF B;  4JJN A;  4WU9 D;  1P3I D;  5B2J B;  2ZM5 A;  4KUD D;  5AVC B;  4NE3 A;  3B0C W;  4XUJ D;  3REH D;  3AZJ B;  5AVB D;  3LEL B;  4J8V D;  1P3P C;  1KX5 B;  3B6F C;  3AZG B;  1TZY A;  4QLC B;  4KGC A;  5CPI D;  1P3A B;  1EQZ B;  4KHA B;  3MGQ D;  5DNM B;  3WKJ D;  1R4V A;  5DNN C;  3B6G D;  2CWE A;  3AV1 D;  3A6N A;  5AV5 B;  3AZN D;  4NFT A;  1T3U A;  3UT9 C;  3VH6 T;  5B0Z B;  4G92 C;  5GSU B;  3UTB A;  1U35 C;  3F6T A;  4YS3 B;  5AY8 B;  3R45 B;  5CP6 D;  3MVD A;  4H9O B;  4X23 C;  4J8U C;  2F8N B;  3WAA D;  3AZK B;  3KXB A;  2HIO B;  3NQU B;  3LZ0 C;  1M18 D;  5B31 B;  3WTP B;  5C3I B;  3B6F D;  3AV2 C;  4XZQ D;  1P3G C;  5GT3 C;  1P3F A;  4WV4 B;  2J8P A;  4J8W C;  4H9P A;  1M19 A;  5B40 B;  4JJN B;  3REK B;  3AZH D;  3MNN B;  1S32 A;  1HQ3 C;  4M6B A;  4J8X D;  1AOI C;  5B24 C;  5B33 A;  4KGC B;  4WU9 A;  1P3I A;  4WJ3 C;  1U35 D;  3AYW D;  4KUD A;  5B32 D;  3H0R C;  2ARO D;  4XUJ A;  3REH A;  2BYM A;  2HUE B;  5AVB A;  4J8U D;  4J8V A;  2G5H C;  4NE6 A;  4UUZ A;  3X1U C;  4R8P D;  3B0D B;  5JRG C;  3A6N B;  3VH5 W;  5CPJ D;  3MGQ A;  3UTA C;  3WKJ A;  3AV2 D;  5GT3 D;  1ID3 B;  3AZI D;  3UTB B;  3B6G A;  3AV1 A;  4E45 A;  3W98 C;  3AZN A;  3MVD B;  3WA9 D;  5B1M D;  4WZS B;  5GT0 C;  3KXB B;  4AWL C;  2CV5 C;  2ZY2 A;  3X1V D;  3C1C C;  3MGS A;  5JA4 B;  5CP6 A;  5AV6 D;  2RVQ C;  3WAA A;  1KX3 D;  4H9P B;  5E5A C;  4ZBJ C;  1M18 A;  1M19 B;  2DF4 C;  1TZY D;  3B6F A;  4XZQ A;  3REI C;  3X1U D;  5JRG D;  1S32 B;  3W99 C;  5B1L D;  2F8N G;  5BT1 C;  3X1T D;  3AN2 D;  2JE5 A;  1F66 C;  4WU9 B;  1P3I B;  3AZH A;  1W2E A;  4H9R A;  3W98 D;  4KUD B;  4XUJ B;  2F8N K;  2BYM B;  5AVB B;  1KX4 D;  4J8V B;  2BYK A;  4J8X A;  4UUZ B;  5CPK C;  1B6W A;  5CPI B;  2RIQ A;  3AYW A;  1U35 A;  3C1C D;  5B32 A;  2ARO A;  3O62 C;  3MGQ B;  3WKJ B;  5BS7 C;  5GXQ C;  4J8U A;  4X23 A;  2F8N H;  2RVQ D;  4G91 C;  3X1S D;  4R8P A;  3B6G B;  3AV1 B;  5E5A D;  3MGP C;  3AZN B;  2Y2P A;  5F99 D;  3REL C;  3AZE C;  5CPJ A;  1P3F D;  3AV2 A;  3REI D;  5GT3 A;  3W99 D;  3AZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...