5B33A

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33A00
5BT1C 2BYKB 3AZIA 3MGRA 4H9SC 5B2ID 4J8XD 3B6FA 3KUYA 5BNXA 5B40D 3WTPC 1P3AB 5GSUB 4NE6A 3UTBB 3MVDD 5AV5C 2YFWA 4H9RB 3LZ0C 2RVQD 5E5AA 1KX3D 5AV6C 5AY8D 1TAFB 3KWQA 1BH8A 5B1LA 4H9NB 3AZJB 3MGSB 4YM6C 4YS3A 3WKJA 1P3LA 3C1BC 4G92B 3B0DC 1ZLAB 5DNNC 1H3OB 5B2JD 4ZUXB 3AN2A 2NZDD 4XZQA 2CV5C 3X1SB 3O62B 5AV9C 5AVBB 3LJAD 3C1CD 3UT9C 1P3MB 3W97C 5FUGA 1U35C 1EQZD 5B33B 3X1TC 2FJ7B 3LELA 1M1AC 1AOIA 2NQBD 5GT3D 3RELA 3W99C 3MGPB 1JFIB 3W98A 2HIOD 1BFMA 2BYMA 1A7WA 3AV1C 3AYWC 5G49B 4H9SA 3AV2C 4Z5TD 4J8WD 4CAYB 3UTAC 2AROB 5B32D 4LD9B 5BS7C 5BO0A 3WA9B 3WTPA 1TZYA 5JA4B 5B0YD 3KXBD 1P3GD 1P3PD 2YFVB 4J8UB 5AV5A 3B6GC 4R8PC 3AZEB 3AZGA 1P3IB 5AV6A 1S32D 4JJND 1R4VA 5KDMB 5B31G 4YM6A 5GT0B 4UUZA 3AZHD 5DNNA 1KX4B 1P3AC 2PYOD 3UT9A 3VH6W 3UTBC 4KUDD 2HUEB 3W97A 4WU8D 3REHA 3X1TA 1P3BB 1KX5B 1M1AA 3AZFD 3W99A 3AZJC 1M18D 4EO5B 3A6NB 3MGSC 3WAAC 3MGQC 1P3OB 3TU4B 1ZLAC 5CP6A 3AZID 3AYWA 3MGRD 2F8NA 4ZUXC 4X23D 3AV2A 5B1MB 3O62C 3X1SC 3B6FD 5AVBC 5AV8A 3KUYD 3UTAA 3V9RA 1P3MC 3REJD 1F66B 5BS7A 3AZMA 5B33C 2FJ7C 4KHAA 3B6GA 3MGPC 4R8PA 1BH9A 5B2IB 4J8XB 3KWQD 4E45A 5B0ZD 5B1LD 5B40B 2BYKA 5DNMD 1P3LD 4QLCD 3MVDB 5AVCD 3NQUA 1ULYA 2AROC 1KX3B 4LD9C 3WA9C 1P3AA 5AY8B 5GXQA 4J8UC 3UTBA 3LZ1D 4H9RA 3AZEC 1P3IC 1P3KD 4NE5A 1AOID 4WU9D 3REKD 3RELD 4H9NA 3AZJA 5C3IB 5B2JB 3W96D 2NZDB 3MGSA 3MGQA 3WAAA 3C1CB 5GT0C 3LJAB 1ZLAA 1EQZB 3X1UD 1KX4C 4H9OB 3X1SA 5GT3B 5AVBA 3O62A 2NQBB 4H9QB 2HUEC 2HIOB 1TZYD 1P3BC 1KX5C 1ID3C 3AZKC 1P3FC 3MGPA 3VH6A 3AZGD 4EO5C 3A6NC 1JFIA 1P3OC 4Z5TB 4J8WB 3TU4C 3AFAD 5B32B 5B0YB 5G49A 3KXBB 1P3GB 1P3PB 5B1MC 2AROA 4LD9A 5CPJD 1F66C 3WA9A 5JA4A 1HQ3D 2YFVA 4J8UA 1S32B 4JJNB 3AZEA 4G91B 5BNVA 3REHD 1P3IA 1N1JA 4J8XC 4M6BA 4WNNB 3AZHB 5CPKA 3VH5T 2CWEA 1P34C 5B40C 2PYOB 4KUDB 3MVDC 5B24C 5CP6D 4WU8B 2RVQC 3AYWD 1KX3C 1KX4A 4J8VD 5AY8C 1Q9CA 3AZFB 5CPIC 5AV8D 2F8NG 1M18B 3AZND 3AZMD 4Z2MG 1ID3A 3AZKA 3AZIB 4R8PD 1P3FA 5F99D 5C3IC 5B2JC 4X23B 3A6NA 3MGRB 2NZDC 1P3OA 1WWSA 4XUJC 4Z66D 3C1CC 3LJAC 3KUYB 3B6FB 3LZ0A 3TU4A 3MNND 3REJB 1EQZC 3AZLD 5B31D 4KGCD 2NQBC 3REID 3C1BA 2HIOC 4H9PA 1F66A 3KWQB 5GXQD 5B0ZB 5B1LB 4DRAA 5GSUC 1M19D 5DNMB 2CV5A 3WKJB 5AV9A 1P3LB 4QLCB 4J8XA 5AVCB 4Z5TC 4J8WC 1U35A 5B32C 1P34A 5B40A 5B0YC 3MGQD 3KXBC 1P3GC 3WAAD 3X1VD 1P3PC 3MVDA 5B24A 3WTPE 5FUGB 3LZ1B 4HGAB 1P3KB 1KX3A 4G92C 4WV4B 5JRGD 1AOIB 4WU9B 3REKB 5CPIA 3KSYA 3RELB 3AV1A 1S32C 3W96B 4G91C 4CSRA 2BYMB 3AZHC 3X1UB 1KU5A 4XUJA 3LJAA 4KUDC 5E5AD 4WU8C 1EQZA 1TZYB 4H9OA 3AZFC 2NQBA 5AV5B 4YS3D 3AZGB 3WKJD 1M18C 2HIOA 3AFAB 3AN2D 4XZQD 5GSUA 4X23C 3B0DB 3B6FC 4Z5TA 3KUYC 4J8WA 5CPKD 3REJC 5CPJB 3LELD 1HQ3B 1TAFA 5B0YA 3KXBA 1P3GA 3W98D 1WWIA 3REHB 3KWQC 5BT1D 5B0ZC 5B1LC 1H3OA 3W99B 4ZUXA 4DRBA 5DNMC 1F1EA 1P3LC 4QLCC 1ID3D 5AVCC 1P3MA 3AZKD 5CP6B 3AZHA 3WTPD 1P3FD 5B33A 2IO5B 3AYWB 2F8NH 2FJ7A 3B0CT 4J8VB 3R45B 5AV5D 5AV8B 1HTAA 3LZ0D 4Z2MH 3LZ1C 4WU8A 5AV6D 4HGAC 4WZSB 3AZNB 3AZMB 1P3KC 4WU9C 3REKC 3RELC 4R8PB 4YM6D 5F99B 3W96C 3NQJB 3C1BD 1M18A 4Z66B 4CAYA 5DNND 1B6WA 3MNNB 3X1UC 3AZLB 2CV5D 4ZBJB 4X23A 5B31B 5AV9D 3UT9D 2LY8A 4KGCB 3W97D 3REIB 1U35D 3NQUB 3X1TD 3REJA 1P34D 5B2IC 5CHLB 1M1AD 1TZYC 5GXQB 3W99D 5B24D 5KDMA 3AZGC 1M19B 5GT0A 3VH5W 5CPID 5B0ZA 3AV1D 2F8ND 3AFAC 3AV2D 3MGQB 5DNMA 3WAAB 3B0BA 4QLCA 3UTAD 2L5AA 3X1VB 5AVCA 1P3BA 5CPJC 5JRGB 4NFTA 1KX5A 1HQ3C 4XUJD 3B6GD 3LZ1A 3REHC 1P3KA 4WU9A 3REKA 5BNXB 4AWLB 3W96A 5B1MA 5GT3C 2YFWB 5E5AB 5CP6C 1P3AD 3X1UA 2IO5C 5GSUD 1BH8B 3UTBD 4J8VC 5AV8C 2F8NK 4YS3B 5B2IA 3AZNC 3AZMC 4E44A 1B67A 5B32G 3AZJD 3AN2B 3MGSD 4XZQB 5BNVB 5F99C 1N1JB 4Z66C 1ZLAD 5CPKB 3AFAA 4ZUXD 3MNNC 3LELB 5AY8A 3AZLC 4ZBJC 3X1SD 5B31C 5AVBD 3O62D 4KGCC 4JJNC 1P3MD 3REIC 3VH6T 3W98B 5B33D 2FJ7D 5CPJA 1HQ3A 5GXQC 3MGPD 5B2JA 2NZDA 1M19C 2PYOC 3C1CA 1ID3B 3AZKB 5BO0B 1P3FB 3WTPB 5GT3A 3X1VC 4H9QA 3LZ0B 2AROD 4LD9D 3VH5A 3WA9D 5AV6B 5JRGC 4J8UD 4J8VA 3R45A 3AZIC 3AZED 1P3ID 3MGRC 4YM6B 3C1BB 4H9PB 3AZNA 4UUZB 5DNNB 5B32A 4NE3A 5F99A 4AWLC 3NQJA 5AV9B 5GT0D 3UT9B 2CV5B 1P3PA 4Z66A 3W97B 1U35B 5E5AC 3X1TB 3MNNA 1P34B 1KX4D 1M1AB 3AZLA 5B31A 4KGCA 1S32A 4JJNA 5B24B 3REIA 4YS3C 3WKJC 1P3BD 1KX5D 4WNNA 5CPIB 3AV1B 2F8NB 3A6ND 3AV2B 3AN2C 1P3OD 4XZQC 1M19A 2PYOA 4CSRB 3UTAB 3V9RB 4KUDA 3TU4D 3B0CW 5CPKC 4KHAB 3LELC 1AOIC 5B1MD 3AZFA 4XUJB 3B6GB 2JSSA 3X1VA 1BH9B 3W98C 1F66D 5JRGA
chains in the Genus database with same CATH superfamily
5BT1C 2BYKB 3AZIA 3MGRA 4H9SC 5B2ID 4J8XD 3B6FA 3KUYA 2DQNC 2J8PA 5BNXA 5B40D 3WTPC 1P3AB 5GSUB 4NE6A 3UTBB 3MVDD 5AV5C 2YFWA 4H9RB 3LZ0C 2RVQD 5E5AA 1KX3D 1T3UA 5AV6C 5AY8D 1TAFB 3KWQA 1BH8A 5B1LA 4H9NB 3AZJB 2Y2LA 4YM6C 3MGSB 4YS3A 3WKJA 1P3LA 3C1BC 4G92B 3B0DC 1ZLAB 5DNNC 1H3OB 5B2JD 4ZUXB 3EPJA 3AN2A 2NZDD 4XZQA 2CV5C 3X1SB 3O62B 5AV9C 5AVBB 3LJAD 3C1CD 3UT9C 2DF4C 1P3MB 3W97C 2RIQA 5FUGA 1U35C 1EQZD 5B33B 3X1TC 2FJ7B 3LELA 1M1AC 1AOIA 2NQBD 5GT3D 3RELA 3W99C 3MGPB 1JFIB 3W98A 2HIOD 1BFMA 2BYMA 1PZRA 3EPLA 1A7WA 3AV1C 3AYWC 5G49B 4H9SA 3AV2C 4Z5TD 4J8WD 4CAYB 3UTAC 2AROB 5B32D 4LD9B 5BS7C 5BO0A 3WA9B 5JA4B 5B0YD 1TZYA 3WTPA 3KXBD 1P3GD 1P3PD 2YFVB 4J8UB 5AV5A 3B6GC 4R8PC 3AZEB 3AZGA 1P3IB 5AV6A 1S32D 4JJND 1R4VA 5KDMB 5B31G 4YM6A 5GT0B 4UUZA 3AZHD 5DNNA 2Y2NA 1KX4B 1P3AC 2PYOD 3UT9A 3VH6W 3UTBC 4KUDD 2HUEB 3W97A 4WU8D 3REHA 3X1TA 1P3BB 1KX5B 1M1AA 3AZFD 3W99A 3AZJC 1M18D 4EO5B 3A6NB 3MGSC 3WAAC 3MGQC 1P3OB 2ZY5A 3P5JB 3TU4B 1ZLAC 5CP6A 3AZID 3H0RC 3AYWA 3MGRD 2F8NA 4ZUXC 4X23D 3AV2A 5B1MB 3O62C 2ZM5A 3X1SC 5AVBC 5AV8A 3A1IA 3KUYD 3V9RA 3UTAA 3B6FD 1P3MC 3REJD 2G5IC 1F66B 5BS7A 3AZMA 5B33C 2FJ7C 4KHAA 3B6GA 3MGPC 4R8PA 1BH9A 2BG1A 5B2IB 4J8XB 3KWQD 4E45A 5B0ZD 5B1LD 5B40B 2BYKA 5DNMD 1P3LD 4QLCD 3MVDB 5AVCD 3NQUA 1ULYA 2AROC 1KX3B 4LD9C 3WA9C 1P3AA 5AY8B 5GXQA 4J8UC 3UTBA 3LZ1D 4H9RA 3AZEC 1P3IC 1P3KD 4NE5A 1AOID 4WU9D 3REKD 3RELD 4H9NA 3AZJA 5C3IB 5B2JB 3W96D 2NZDB 3EG5B 2FFFB 3MGSA 3MGQA 3WAAA 3C1CB 5GT0C 3LJAB 1ZLAA 1EQZB 3X1UD 1KX4C 4H9OB 3X1SA 5GT3B 5AVBA 3O62A 2NQBB 4H9QB 2HUEC 3EPHA 2HIOB 1TZYD 1P3BC 1KX5C 1ID3C 3AZKC 1P3FC 3MGPA 3VH6A 3AZGD 4EO5C 3A6NC 1JFIA 3H0MC 1P3OC 4Z5TB 4J8WB 3TU4C 3AFAD 5B32B 5B0YB 5G49A 3KXBB 1P3GB 1P3PB 5B1MC 3EPKA 2AROA 4LD9A 5CPJD 1F66C 3WA9A 5JA4A 1HQ3D 2YFVA 4J8UA 1S32B 4JJNB 2ZY4A 2Y2JA 3AZEA 4G91B 5BNVA 3REHD 1P3IA 1N1JA 4J8XC 4M6BA 4WNNB 3AZHB 5CPKA 3VH5T 2CWEA 2ZY2A 1P34C 5B40C 2PYOB 4KUDB 3MVDC 5B24C 5CP6D 4WU8B 2RVQC 3AYWD 1KX3C 1KX4A 4J8VD 5AY8C 2F2AC 1Q9CA 3AZFB 5CPIC 5AV8D 2F8NG 1M18B 3AZND 3AZMD 4Z2MG 1ID3A 3AZKA 2JCHA 3AZIB 4R8PD 1P3FA 5F99D 5C3IC 5B2JC 4X23B 3A6NA 3MGRB 2NZDC 1P3OA 1WWSA 4XUJC 4Z66D 3C1CC 3LJAC 3KUYB 3B6FB 3LZ0A 2Y2OA 3TU4A 3MNND 3REJB 1EQZC 3AZLD 5B31D 4KGCD 2NQBC 3REID 2Y2PA 3C1BA 2HIOC 4H9PA 1F66A 3KWQB 5GXQD 5B0ZB 5B1LB 2G5HC 4DRAA 5GSUC 5DNMB 2CV5A 1M19D 5AV9A 1P3LB 4QLCB 3WKJB 4J8XA 5AVCB 4Z5TC 4J8WC 1U35A 5B32C 1P34A 5B40A 5B0YC 3MGQD 3KXBC 1P3GC 3WAAD 3X1VD 1P3PC 3MVDA 5B24A 3WTPE 5FUGB 3LZ1B 4HGAB 1P3KB 1KX3A 4G92C 4WV4B 5JRGD 1AOIB 4WU9B 3REKB 5CPIA 3KSYA 3RELB 3AV1A 1S32C 3W96B 2ZY3A 4G91C 4CSRA 2BYMB 3AZHC 3X1UB 1KU5A 4XUJA 3LJAA 4KUDC 5E5AD 4WU8C 1EQZA 1TZYB 4H9OA 3AZFC 2NQBA 5AV5B 4WJ3C 4YS3D 3AZGB 3WKJD 1M18C 2XD1A 2HIOA 3AFAB 3AN2D 4XZQD 5GSUA 4X23C 2Y2KA 3A1KA 2VQRA 3B0DB 4UPKA 3B6FC 4Z5TA 3KUYC 4J8WA 5CPKD 3REJC 5CPJB 3LELD 1HQ3B 1TAFA 5B0YA 3KXBA 1P3GA 3W98D 1WWIA 3REHB 3KWQC 5BT1D 5B0ZC 3FDDA 5B1LC 1H3OA 3W99B 4ZUXA 4DRBA 5DNMC 1F1EA 1P3LC 1Z2CB 4QLCC 1ID3D 5AVCC 1P3MA 3AZKD 5CP6B 3AZHA 3WTPD 1P3FD 5B33A 2IO5B 3AYWB 2F8NH 2FJ7A 3B0CT 4J8VB 3R45B 5AV5D 5AV8B 1HTAA 3LZ0D 4Z2MH 3LZ1C 4WU8A 5AV6D 4HGAC 4WZSB 3AZNB 3AZMB 1P3KC 3F6TA 3H0LC 3REKC 4WU9C 3RELC 4R8PB 4YM6D 5F99B 3W96C 3NQJB 3C1BD 1M18A 4Z66B 3IP4C 4CAYA 2XD5A 5DNND 1B6WA 3MNNB 3X1UC 3AZLB 2CV5D 4ZBJB 4X23A 5B31B 5AV9D 3UT9D 2LY8A 4KGCB 3W97D 3REIB 1U35D 3NQUB 3X1TD 3REJA 1P34D 5B2IC 5CHLB 1M1AD 1TZYC 5GXQB 3W99D 5B24D 5KDMA 2W8SA 2Y2IA 3AZGC 1M19B 5GT0A 3VH5W 5CPID 5B0ZA 3AV1D 2F8ND 3AFAC 3AV2D 3MGQB 5DNMA 3WAAB 3B0BA 4QLCA 3UTAD 2L5AA 3X1VB 5AVCA 1P3BA 5CPJC 5JRGB 4NFTA 1KX5A 1HQ3C 4XUJD 3B6GD 3LZ1A 3REHC 1P3KA 4WU9A 3REKA 5BNXB 4AWLB 3W96A 5B1MA 5GT3C 2YFWB 5E5AB 5CP6C 3KFUG 1P3AD 3X1UA 2IO5C 5GSUD 1BH8B 3UTBD 4J8VC 5AV8C 2F8NK 4YS3B 5B2IA 3AZNC 3AZMC 4E44A 1B67A 5B32G 2Y2QA 3AZJD 3AN2B 4DQYB 3MGSD 4XZQB 5BNVB 5F99C 1N1JB 4Z66C 1ZLAD 5CPKB 3AFAA 4ZUXD 3MNNC 2JE5A 3LELB 5AY8A 3AZLC 4ZBJC 3X1SD 5B31C 5AVBD 3O62D 4KGCC 4JJNC 1P3MD 3REIC 3VH6T 3W98B 5B33D 2FJ7D 5CPJA 1HQ3A 5GXQC 3MGPD 5B2JA 2NZDA 1M19C 2PYOC 3C1CA 1ID3B 3AZKB 3AL0C 5BO0B 1P3FB 3WTPB 1W2EA 5GT3A 3X1VC 4H9QA 3LZ0B 2AROD 4LD9D 3VH5A 3WA9D 5AV6B 5JRGC 4J8UD 4J8VA 3R45A 3AZIC 3AZED 1P3ID 3MGRC 2UWXA 4YM6B 3C1BB 4H9PB 3AZNA 4UUZB 5DNNB 5B32A 4NE3A 5F99A 4AWLC 3NQJA 5AV9B 5GT0D 3UT9B 2CV5B 1P3PA 4Z66A 3W97B 1U35B 5E5AC 3X1TB 3MNNA 1P34B 1KX4D 1M1AB 3AZLA 5B31A 4KGCA 1S32A 4JJNA 5B24B 3REIA 4YS3C 3WKJC 1P3BD 2Y2GA 1KX5D 4WNNA 5CPIB 3AV1B 2F8NB 3A6ND 3AV2B 3AN2C 1P3OD 4XZQC 1M19A 2PYOA 4CSRB 3UTAB 3V9RB 4KUDA 3TU4D 3B0CW 5CPKC 4KHAB 3LELC 1AOIC 5B1MD 3AZFA 4XUJB 3B6GB 2JSSA 3X1VA 1BH9B 3W98C 2Y2HA 1F66D 2Y2MA 5JRGA
chains in the Genus database with same CATH topology
5BT1C 2BYKB 3AZIA 3MGRA 4H9SC 5B2ID 4J8XD 3B6FA 3KUYA 2DQNC 2J8PA 5BNXA 5B40D 3WTPC 1P3AB 5GSUB 4NE6A 3UTBB 3MVDD 5AV5C 2YFWA 4H9RB 3LZ0C 2RVQD 5E5AA 1KX3D 1T3UA 5AV6C 5AY8D 1TAFB 3KWQA 1BH8A 5B1LA 4H9NB 3AZJB 2Y2LA 4YM6C 3MGSB 4YS3A 3WKJA 1P3LA 3C1BC 4G92B 3B0DC 1ZLAB 5DNNC 1H3OB 5B2JD 4ZUXB 3EPJA 3AN2A 2NZDD 4XZQA 2CV5C 3X1SB 3O62B 5AV9C 5AVBB 3LJAD 3C1CD 3UT9C 2DF4C 1P3MB 3W97C 2RIQA 5FUGA 1U35C 1EQZD 5B33B 3X1TC 2FJ7B 3LELA 1M1AC 1AOIA 2NQBD 5GT3D 3RELA 3W99C 3MGPB 1JFIB 3W98A 2HIOD 1BFMA 2BYMA 1PZRA 3EPLA 1A7WA 3AV1C 3AYWC 5G49B 4H9SA 3AV2C 4Z5TD 4J8WD 4CAYB 3UTAC 2AROB 5B32D 4LD9B 5BS7C 5BO0A 3WA9B 5JA4B 5B0YD 1TZYA 3WTPA 3KXBD 1P3GD 1P3PD 2YFVB 4J8UB 5AV5A 3B6GC 4R8PC 3AZEB 3AZGA 1P3IB 5AV6A 1S32D 4JJND 1R4VA 5KDMB 5B31G 4YM6A 5GT0B 4UUZA 3AZHD 5DNNA 2Y2NA 1KX4B 1P3AC 2PYOD 3UT9A 3VH6W 3UTBC 4KUDD 2HUEB 3W97A 4WU8D 3REHA 3X1TA 1P3BB 1KX5B 1M1AA 3AZFD 3W99A 3AZJC 1M18D 4EO5B 3A6NB 3MGSC 3WAAC 3MGQC 1P3OB 2ZY5A 3P5JB 3TU4B 1ZLAC 5CP6A 3AZID 3H0RC 3AYWA 3MGRD 2F8NA 4ZUXC 4X23D 3AV2A 5B1MB 3O62C 2ZM5A 3X1SC 5AVBC 5AV8A 3A1IA 3KUYD 3V9RA 3UTAA 3B6FD 1P3MC 3REJD 2G5IC 1F66B 5BS7A 3AZMA 5B33C 2FJ7C 4KHAA 3B6GA 3MGPC 4R8PA 1BH9A 2BG1A 5B2IB 4J8XB 3KWQD 4E45A 5B0ZD 5B1LD 5B40B 2BYKA 5DNMD 1P3LD 4QLCD 3MVDB 5AVCD 3NQUA 1ULYA 2AROC 1KX3B 4LD9C 3WA9C 1P3AA 5AY8B 5GXQA 4J8UC 3UTBA 3LZ1D 4H9RA 3AZEC 1P3IC 1P3KD 4NE5A 1AOID 4WU9D 3REKD 3RELD 4H9NA 3AZJA 5C3IB 5B2JB 3W96D 2NZDB 3EG5B 2FFFB 3MGSA 3MGQA 3WAAA 3C1CB 5GT0C 3LJAB 1ZLAA 1EQZB 3X1UD 1KX4C 4H9OB 3X1SA 5GT3B 5AVBA 3O62A 2NQBB 4H9QB 2HUEC 3EPHA 2HIOB 1TZYD 1P3BC 1KX5C 1ID3C 3AZKC 1P3FC 3MGPA 3VH6A 3AZGD 4EO5C 3A6NC 1JFIA 3H0MC 1P3OC 4Z5TB 4J8WB 3TU4C 3AFAD 5B32B 5B0YB 5G49A 3KXBB 1P3GB 1P3PB 5B1MC 3EPKA 2AROA 4LD9A 5CPJD 1F66C 3WA9A 5JA4A 1HQ3D 2YFVA 4J8UA 1S32B 4JJNB 2ZY4A 2Y2JA 3AZEA 4G91B 5BNVA 3REHD 1P3IA 1N1JA 4J8XC 4M6BA 4WNNB 3AZHB 5CPKA 3VH5T 2CWEA 2ZY2A 1P34C 5B40C 2PYOB 4KUDB 3MVDC 5B24C 5CP6D 4WU8B 2RVQC 3AYWD 1KX3C 1KX4A 4J8VD 5AY8C 2F2AC 1Q9CA 3AZFB 5CPIC 5AV8D 2F8NG 1M18B 3AZND 3AZMD 4Z2MG 1ID3A 3AZKA 2JCHA 3AZIB 4R8PD 1P3FA 5F99D 5C3IC 5B2JC 4X23B 3A6NA 3MGRB 2NZDC 1P3OA 1WWSA 4XUJC 4Z66D 3C1CC 3LJAC 3KUYB 3B6FB 3LZ0A 2Y2OA 3TU4A 3MNND 3REJB 1EQZC 3AZLD 5B31D 4KGCD 2NQBC 3REID 2Y2PA 3C1BA 2HIOC 4H9PA 1F66A 3KWQB 5GXQD 5B0ZB 5B1LB 2G5HC 4DRAA 5GSUC 5DNMB 2CV5A 1M19D 5AV9A 1P3LB 4QLCB 3WKJB 4J8XA 5AVCB 4Z5TC 4J8WC 1U35A 5B32C 1P34A 5B40A 5B0YC 3MGQD 3KXBC 1P3GC 3WAAD 3X1VD 1P3PC 3MVDA 5B24A 3WTPE 5FUGB 3LZ1B 4HGAB 1P3KB 1KX3A 4G92C 4WV4B 5JRGD 1AOIB 4WU9B 3REKB 5CPIA 3KSYA 3RELB 3AV1A 1S32C 3W96B 2ZY3A 4G91C 4CSRA 2BYMB 3AZHC 3X1UB 1KU5A 4XUJA 3LJAA 4KUDC 5E5AD 4WU8C 1EQZA 1TZYB 4H9OA 3AZFC 2NQBA 5AV5B 4WJ3C 4YS3D 3AZGB 3WKJD 1M18C 2XD1A 2HIOA 3AFAB 3AN2D 4XZQD 5GSUA 4X23C 2Y2KA 3A1KA 2VQRA 3B0DB 4UPKA 3B6FC 4Z5TA 3KUYC 4J8WA 5CPKD 3REJC 5CPJB 3LELD 1HQ3B 1TAFA 5B0YA 3KXBA 1P3GA 3W98D 1WWIA 3REHB 3KWQC 5BT1D 5B0ZC 3FDDA 5B1LC 1H3OA 3W99B 4ZUXA 4DRBA 5DNMC 1F1EA 1P3LC 1Z2CB 4QLCC 1ID3D 5AVCC 1P3MA 3AZKD 5CP6B 3AZHA 3WTPD 1P3FD 5B33A 2IO5B 3AYWB 2F8NH 2FJ7A 3B0CT 4J8VB 3R45B 5AV5D 5AV8B 1HTAA 3LZ0D 4Z2MH 3LZ1C 4WU8A 5AV6D 4HGAC 4WZSB 3AZNB 3AZMB 1P3KC 3F6TA 3H0LC 3REKC 4WU9C 3RELC 4R8PB 4YM6D 5F99B 3W96C 3NQJB 3C1BD 1M18A 4Z66B 3IP4C 4CAYA 2XD5A 5DNND 1B6WA 3MNNB 3X1UC 3AZLB 2CV5D 4ZBJB 4X23A 5B31B 5AV9D 3UT9D 2LY8A 4KGCB 3W97D 3REIB 1U35D 3NQUB 3X1TD 3REJA 1P34D 5B2IC 5CHLB 1M1AD 1TZYC 5GXQB 3W99D 5B24D 5KDMA 2W8SA 2Y2IA 3AZGC 1M19B 5GT0A 3VH5W 5CPID 5B0ZA 3AV1D 2F8ND 3AFAC 3AV2D 3MGQB 5DNMA 3WAAB 3B0BA 4QLCA 3UTAD 2L5AA 3X1VB 5AVCA 1P3BA 5CPJC 5JRGB 4NFTA 1KX5A 1HQ3C 4XUJD 3B6GD 3LZ1A 3REHC 1P3KA 4WU9A 3REKA 5BNXB 4AWLB 3W96A 5B1MA 5GT3C 2YFWB 5E5AB 5CP6C 3KFUG 1P3AD 3X1UA 2IO5C 5GSUD 1BH8B 3UTBD 4J8VC 5AV8C 2F8NK 4YS3B 5B2IA 3AZNC 3AZMC 4E44A 1B67A 5B32G 2Y2QA 3AZJD 3AN2B 4DQYB 3MGSD 4XZQB 5BNVB 5F99C 1N1JB 4Z66C 1ZLAD 5CPKB 3AFAA 4ZUXD 3MNNC 2JE5A 3LELB 5AY8A 3AZLC 4ZBJC 3X1SD 5B31C 5AVBD 3O62D 4KGCC 4JJNC 1P3MD 3REIC 3VH6T 3W98B 5B33D 2FJ7D 5CPJA 1HQ3A 5GXQC 3MGPD 5B2JA 2NZDA 1M19C 2PYOC 3C1CA 1ID3B 3AZKB 3AL0C 5BO0B 1P3FB 3WTPB 1W2EA 5GT3A 3X1VC 4H9QA 3LZ0B 2AROD 4LD9D 3VH5A 3WA9D 5AV6B 5JRGC 4J8UD 4J8VA 3R45A 3AZIC 3AZED 1P3ID 3MGRC 2UWXA 4YM6B 3C1BB 4H9PB 3AZNA 4UUZB 5DNNB 5B32A 4NE3A 5F99A 4AWLC 3NQJA 5AV9B 5GT0D 3UT9B 2CV5B 1P3PA 4Z66A 3W97B 1U35B 5E5AC 3X1TB 3MNNA 1P34B 1KX4D 1M1AB 3AZLA 5B31A 4KGCA 1S32A 4JJNA 5B24B 3REIA 4YS3C 3WKJC 1P3BD 2Y2GA 1KX5D 4WNNA 5CPIB 3AV1B 2F8NB 3A6ND 3AV2B 3AN2C 1P3OD 4XZQC 1M19A 2PYOA 4CSRB 3UTAB 3V9RB 4KUDA 3TU4D 3B0CW 5CPKC 4KHAB 3LELC 1AOIC 5B1MD 3AZFA 4XUJB 3B6GB 2JSSA 3X1VA 1BH9B 3W98C 2Y2HA 1F66D 2Y2MA 5JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT1 C;  2BYK B;  3AZI A;  3MGR A;  4H9S C;  5B2I D;  4J8X D;  3B6F A;  3KUY A;  5BNX A;  5B40 D;  3WTP C;  1P3A B;  5GSU B;  4NE6 A;  3UTB B;  3MVD D;  5AV5 C;  2YFW A;  4H9R B;  3LZ0 C;  2RVQ D;  5E5A A;  1KX3 D;  5AV6 C;  5AY8 D;  1TAF B;  3KWQ A;  1BH8 A;  5B1L A;  4H9N B;  3AZJ B;  3MGS B;  4YM6 C;  4YS3 A;  3WKJ A;  1P3L A;  3C1B C;  4G92 B;  3B0D C;  1ZLA B;  5DNN C;  1H3O B;  5B2J D;  4ZUX B;  3AN2 A;  2NZD D;  4XZQ A;  2CV5 C;  3X1S B;  3O62 B;  5AV9 C;  5AVB B;  3LJA D;  3C1C D;  3UT9 C;  1P3M B;  3W97 C;  5FUG A;  1U35 C;  1EQZ D;  5B33 B;  3X1T C;  2FJ7 B;  3LEL A;  1M1A C;  1AOI A;  2NQB D;  5GT3 D;  3REL A;  3W99 C;  3MGP B;  1JFI B;  3W98 A;  2HIO D;  1BFM A;  2BYM A;  1A7W A;  3AV1 C;  3AYW C;  5G49 B;  4H9S A;  3AV2 C;  4Z5T D;  4J8W D;  4CAY B;  3UTA C;  2ARO B;  5B32 D;  4LD9 B;  5BS7 C;  5BO0 A;  3WA9 B;  3WTP A;  1TZY A;  5JA4 B;  5B0Y D;  3KXB D;  1P3G D;  1P3P D;  2YFV B;  4J8U B;  5AV5 A;  3B6G C;  4R8P C;  3AZE B;  3AZG A;  1P3I B;  5AV6 A;  1S32 D;  4JJN D;  1R4V A;  5KDM B;  5B31 G;  4YM6 A;  5GT0 B;  4UUZ A;  3AZH D;  5DNN A;  1KX4 B;  1P3A C;  2PYO D;  3UT9 A;  3VH6 W;  3UTB C;  4KUD D;  2HUE B;  3W97 A;  4WU8 D;  3REH A;  3X1T A;  1P3B B;  1KX5 B;  1M1A A;  3AZF D;  3W99 A;  3AZJ C;  1M18 D;  4EO5 B;  3A6N B;  3MGS C;  3WAA C;  3MGQ C;  1P3O B;  3TU4 B;  1ZLA C;  5CP6 A;  3AZI D;  3AYW A;  3MGR D;  2F8N A;  4ZUX C;  4X23 D;  3AV2 A;  5B1M B;  3O62 C;  3X1S C;  3B6F D;  5AVB C;  5AV8 A;  3KUY D;  3UTA A;  3V9R A;  1P3M C;  3REJ D;  1F66 B;  5BS7 A;  3AZM A;  5B33 C;  2FJ7 C;  4KHA A;  3B6G A;  3MGP C;  4R8P A;  1BH9 A;  5B2I B;  4J8X B;  3KWQ D;  4E45 A;  5B0Z D;  5B1L D;  5B40 B;  2BYK A;  5DNM D;  1P3L D;  4QLC D;  3MVD B;  5AVC D;  3NQU A;  1ULY A;  2ARO C;  1KX3 B;  4LD9 C;  3WA9 C;  1P3A A;  5AY8 B;  5GXQ A;  4J8U C;  3UTB A;  3LZ1 D;  4H9R A;  3AZE C;  1P3I C;  1P3K D;  4NE5 A;  1AOI D;  4WU9 D;  3REK D;  3REL D;  4H9N A;  3AZJ A;  5C3I B;  5B2J B;  3W96 D;  2NZD B;  3MGS A;  3MGQ A;  3WAA A;  3C1C B;  5GT0 C;  3LJA B;  1ZLA A;  1EQZ B;  3X1U D;  1KX4 C;  4H9O B;  3X1S A;  5GT3 B;  5AVB A;  3O62 A;  2NQB B;  4H9Q B;  2HUE C;  2HIO B;  1TZY D;  1P3B C;  1KX5 C;  1ID3 C;  3AZK C;  1P3F C;  3MGP A;  3VH6 A;  3AZG D;  4EO5 C;  3A6N C;  1JFI A;  1P3O C;  4Z5T B;  4J8W B;  3TU4 C;  3AFA D;  5B32 B;  5B0Y B;  5G49 A;  3KXB B;  1P3G B;  1P3P B;  5B1M C;  2ARO A;  4LD9 A;  5CPJ D;  1F66 C;  3WA9 A;  5JA4 A;  1HQ3 D;  2YFV A;  4J8U A;  1S32 B;  4JJN B;  3AZE A;  4G91 B;  5BNV A;  3REH D;  1P3I A;  1N1J A;  4J8X C;  4M6B A;  4WNN B;  3AZH B;  5CPK A;  3VH5 T;  2CWE A;  1P34 C;  5B40 C;  2PYO B;  4KUD B;  3MVD C;  5B24 C;  5CP6 D;  4WU8 B;  2RVQ C;  3AYW D;  1KX3 C;  1KX4 A;  4J8V D;  5AY8 C;  1Q9C A;  3AZF B;  5CPI C;  5AV8 D;  2F8N G;  1M18 B;  3AZN D;  3AZM D;  4Z2M G;  1ID3 A;  3AZK A;  3AZI B;  4R8P D;  1P3F A;  5F99 D;  5C3I C;  5B2J C;  4X23 B;  3A6N A;  3MGR B;  2NZD C;  1P3O A;  1WWS A;  4XUJ C;  4Z66 D;  3C1C C;  3LJA C;  3KUY B;  3B6F B;  3LZ0 A;  3TU4 A;  3MNN D;  3REJ B;  1EQZ C;  3AZL D;  5B31 D;  4KGC D;  2NQB C;  3REI D;  3C1B A;  2HIO C;  4H9P A;  1F66 A;  3KWQ B;  5GXQ D;  5B0Z B;  5B1L B;  4DRA A;  5GSU C;  1M19 D;  5DNM B;  2CV5 A;  3WKJ B;  5AV9 A;  1P3L B;  4QLC B;  4J8X A;  5AVC B;  4Z5T C;  4J8W C;  1U35 A;  5B32 C;  1P34 A;  5B40 A;  5B0Y C;  3MGQ D;  3KXB C;  1P3G C;  3WAA D;  3X1V D;  1P3P C;  3MVD A;  5B24 A;  3WTP E;  5FUG B;  3LZ1 B;  4HGA B;  1P3K B;  1KX3 A;  4G92 C;  4WV4 B;  5JRG D;  1AOI B;  4WU9 B;  3REK B;  5CPI A;  3KSY A;  3REL B;  3AV1 A;  1S32 C;  3W96 B;  4G91 C;  4CSR A;  2BYM B;  3AZH C;  3X1U B;  1KU5 A;  4XUJ A;  3LJA A;  4KUD C;  5E5A D;  4WU8 C;  1EQZ A;  1TZY B;  4H9O A;  3AZF C;  2NQB A;  5AV5 B;  4YS3 D;  3AZG B;  3WKJ D;  1M18 C;  2HIO A;  3AFA B;  3AN2 D;  4XZQ D;  5GSU A;  4X23 C;  3B0D B;  3B6F C;  4Z5T A;  3KUY C;  4J8W A;  5CPK D;  3REJ C;  5CPJ B;  3LEL D;  1HQ3 B;  1TAF A;  5B0Y A;  3KXB A;  1P3G A;  3W98 D;  1WWI A;  3REH B;  3KWQ C;  5BT1 D;  5B0Z C;  5B1L C;  1H3O A;  3W99 B;  4ZUX A;  4DRB A;  5DNM C;  1F1E A;  1P3L C;  4QLC C;  1ID3 D;  5AVC C;  1P3M A;  3AZK D;  5CP6 B;  3AZH A;  3WTP D;  1P3F D;  5B33 A;  2IO5 B;  3AYW B;  2F8N H;  2FJ7 A;  3B0C T;  4J8V B;  3R45 B;  5AV5 D;  5AV8 B;  1HTA A;  3LZ0 D;  4Z2M H;  3LZ1 C;  4WU8 A;  5AV6 D;  4HGA C;  4WZS B;  3AZN B;  3AZM B;  1P3K C;  4WU9 C;  3REK C;  3REL C;  4R8P B;  4YM6 D;  5F99 B;  3W96 C;  3NQJ B;  3C1B D;  1M18 A;  4Z66 B;  4CAY A;  5DNN D;  1B6W A;  3MNN B;  3X1U C;  3AZL B;  2CV5 D;  4ZBJ B;  4X23 A;  5B31 B;  5AV9 D;  3UT9 D;  2LY8 A;  4KGC B;  3W97 D;  3REI B;  1U35 D;  3NQU B;  3X1T D;  3REJ A;  1P34 D;  5B2I C;  5CHL B;  1M1A D;  1TZY C;  5GXQ B;  3W99 D;  5B24 D;  5KDM A;  3AZG C;  1M19 B;  5GT0 A;  3VH5 W;  5CPI D;  5B0Z A;  3AV1 D;  2F8N D;  3AFA C;  3AV2 D;  3MGQ B;  5DNM A;  3WAA B;  3B0B A;  4QLC A;  3UTA D;  2L5A A;  3X1V B;  5AVC A;  1P3B A;  5CPJ C;  5JRG B;  4NFT A;  1KX5 A;  1HQ3 C;  4XUJ D;  3B6G D;  3LZ1 A;  3REH C;  1P3K A;  4WU9 A;  3REK A;  5BNX B;  4AWL B;  3W96 A;  5B1M A;  5GT3 C;  2YFW B;  5E5A B;  5CP6 C;  1P3A D;  3X1U A;  2IO5 C;  5GSU D;  1BH8 B;  3UTB D;  4J8V C;  5AV8 C;  2F8N K;  4YS3 B;  5B2I A;  3AZN C;  3AZM C;  4E44 A;  1B67 A;  5B32 G;  3AZJ D;  3AN2 B;  3MGS D;  4XZQ B;  5BNV B;  5F99 C;  1N1J B;  4Z66 C;  1ZLA D;  5CPK B;  3AFA A;  4ZUX D;  3MNN C;  3LEL B;  5AY8 A;  3AZL C;  4ZBJ C;  3X1S D;  5B31 C;  5AVB D;  3O62 D;  4KGC C;  4JJN C;  1P3M D;  3REI C;  3VH6 T;  3W98 B;  5B33 D;  2FJ7 D;  5CPJ A;  1HQ3 A;  5GXQ C;  3MGP D;  5B2J A;  2NZD A;  1M19 C;  2PYO C;  3C1C A;  1ID3 B;  3AZK B;  5BO0 B;  1P3F B;  3WTP B;  5GT3 A;  3X1V C;  4H9Q A;  3LZ0 B;  2ARO D;  4LD9 D;  3VH5 A;  3WA9 D;  5AV6 B;  5JRG C;  4J8U D;  4J8V A;  3R45 A;  3AZI C;  3AZE D;  1P3I D;  3MGR C;  4YM6 B;  3C1B B;  4H9P B;  3AZN A;  4UUZ B;  5DNN B;  5B32 A;  4NE3 A;  5F99 A;  4AWL C;  3NQJ A;  5AV9 B;  5GT0 D;  3UT9 B;  2CV5 B;  1P3P A;  4Z66 A;  3W97 B;  1U35 B;  5E5A C;  3X1T B;  3MNN A;  1P34 B;  1KX4 D;  1M1A B;  3AZL A;  5B31 A;  4KGC A;  1S32 A;  4JJN A;  5B24 B;  3REI A;  4YS3 C;  3WKJ C;  1P3B D;  1KX5 D;  4WNN A;  5CPI B;  3AV1 B;  2F8N B;  3A6N D;  3AV2 B;  3AN2 C;  1P3O D;  4XZQ C;  1M19 A;  2PYO A;  4CSR B;  3UTA B;  3V9R B;  4KUD A;  3TU4 D;  3B0C W;  5CPK C;  4KHA B;  3LEL C;  1AOI C;  5B1M D;  3AZF A;  4XUJ B;  3B6G B;  2JSS A;  3X1V A;  1BH9 B;  3W98 C;  1F66 D;  5JRG A; 
#chains in the Genus database with same CATH topology
 5BT1 C;  2BYK B;  3AZI A;  3MGR A;  4H9S C;  5B2I D;  4J8X D;  3B6F A;  3KUY A;  2DQN C;  2J8P A;  5BNX A;  5B40 D;  3WTP C;  1P3A B;  5GSU B;  4NE6 A;  3UTB B;  3MVD D;  5AV5 C;  2YFW A;  4H9R B;  3LZ0 C;  2RVQ D;  5E5A A;  1KX3 D;  1T3U A;  5AV6 C;  5AY8 D;  1TAF B;  3KWQ A;  1BH8 A;  5B1L A;  4H9N B;  3AZJ B;  2Y2L A;  4YM6 C;  3MGS B;  4YS3 A;  3WKJ A;  1P3L A;  3C1B C;  4G92 B;  3B0D C;  1ZLA B;  5DNN C;  1H3O B;  5B2J D;  4ZUX B;  3EPJ A;  3AN2 A;  2NZD D;  4XZQ A;  2CV5 C;  3X1S B;  3O62 B;  5AV9 C;  5AVB B;  3LJA D;  3C1C D;  3UT9 C;  2DF4 C;  1P3M B;  3W97 C;  2RIQ A;  5FUG A;  1U35 C;  1EQZ D;  5B33 B;  3X1T C;  2FJ7 B;  3LEL A;  1M1A C;  1AOI A;  2NQB D;  5GT3 D;  3REL A;  3W99 C;  3MGP B;  1JFI B;  3W98 A;  2HIO D;  1BFM A;  2BYM A;  1PZR A;  3EPL A;  1A7W A;  3AV1 C;  3AYW C;  5G49 B;  4H9S A;  3AV2 C;  4Z5T D;  4J8W D;  4CAY B;  3UTA C;  2ARO B;  5B32 D;  4LD9 B;  5BS7 C;  5BO0 A;  3WA9 B;  5JA4 B;  5B0Y D;  1TZY A;  3WTP A;  3KXB D;  1P3G D;  1P3P D;  2YFV B;  4J8U B;  5AV5 A;  3B6G C;  4R8P C;  3AZE B;  3AZG A;  1P3I B;  5AV6 A;  1S32 D;  4JJN D;  1R4V A;  5KDM B;  5B31 G;  4YM6 A;  5GT0 B;  4UUZ A;  3AZH D;  5DNN A;  2Y2N A;  1KX4 B;  1P3A C;  2PYO D;  3UT9 A;  3VH6 W;  3UTB C;  4KUD D;  2HUE B;  3W97 A;  4WU8 D;  3REH A;  3X1T A;  1P3B B;  1KX5 B;  1M1A A;  3AZF D;  3W99 A;  3AZJ C;  1M18 D;  4EO5 B;  3A6N B;  3MGS C;  3WAA C;  3MGQ C;  1P3O B;  2ZY5 A;  3P5J B;  3TU4 B;  1ZLA C;  5CP6 A;  3AZI D;  3H0R C;  3AYW A;  3MGR D;  2F8N A;  4ZUX C;  4X23 D;  3AV2 A;  5B1M B;  3O62 C;  2ZM5 A;  3X1S C;  5AVB C;  5AV8 A;  3A1I A;  3KUY D;  3V9R A;  3UTA A;  3B6F D;  1P3M C;  3REJ D;  2G5I C;  1F66 B;  5BS7 A;  3AZM A;  5B33 C;  2FJ7 C;  4KHA A;  3B6G A;  3MGP C;  4R8P A;  1BH9 A;  2BG1 A;  5B2I B;  4J8X B;  3KWQ D;  4E45 A;  5B0Z D;  5B1L D;  5B40 B;  2BYK A;  5DNM D;  1P3L D;  4QLC D;  3MVD B;  5AVC D;  3NQU A;  1ULY A;  2ARO C;  1KX3 B;  4LD9 C;  3WA9 C;  1P3A A;  5AY8 B;  5GXQ A;  4J8U C;  3UTB A;  3LZ1 D;  4H9R A;  3AZE C;  1P3I C;  1P3K D;  4NE5 A;  1AOI D;  4WU9 D;  3REK D;  3REL D;  4H9N A;  3AZJ A;  5C3I B;  5B2J B;  3W96 D;  2NZD B;  3EG5 B;  2FFF B;  3MGS A;  3MGQ A;  3WAA A;  3C1C B;  5GT0 C;  3LJA B;  1ZLA A;  1EQZ B;  3X1U D;  1KX4 C;  4H9O B;  3X1S A;  5GT3 B;  5AVB A;  3O62 A;  2NQB B;  4H9Q B;  2HUE C;  3EPH A;  2HIO B;  1TZY D;  1P3B C;  1KX5 C;  1ID3 C;  3AZK C;  1P3F C;  3MGP A;  3VH6 A;  3AZG D;  4EO5 C;  3A6N C;  1JFI A;  3H0M C;  1P3O C;  4Z5T B;  4J8W B;  3TU4 C;  3AFA D;  5B32 B;  5B0Y B;  5G49 A;  3KXB B;  1P3G B;  1P3P B;  5B1M C;  3EPK A;  2ARO A;  4LD9 A;  5CPJ D;  1F66 C;  3WA9 A;  5JA4 A;  1HQ3 D;  2YFV A;  4J8U A;  1S32 B;  4JJN B;  2ZY4 A;  2Y2J A;  3AZE A;  4G91 B;  5BNV A;  3REH D;  1P3I A;  1N1J A;  4J8X C;  4M6B A;  4WNN B;  3AZH B;  5CPK A;  3VH5 T;  2CWE A;  2ZY2 A;  1P34 C;  5B40 C;  2PYO B;  4KUD B;  3MVD C;  5B24 C;  5CP6 D;  4WU8 B;  2RVQ C;  3AYW D;  1KX3 C;  1KX4 A;  4J8V D;  5AY8 C;  2F2A C;  1Q9C A;  3AZF B;  5CPI C;  5AV8 D;  2F8N G;  1M18 B;  3AZN D;  3AZM D;  4Z2M G;  1ID3 A;  3AZK A;  2JCH A;  3AZI B;  4R8P D;  1P3F A;  5F99 D;  5C3I C;  5B2J C;  4X23 B;  3A6N A;  3MGR B;  2NZD C;  1P3O A;  1WWS A;  4XUJ C;  4Z66 D;  3C1C C;  3LJA C;  3KUY B;  3B6F B;  3LZ0 A;  2Y2O A;  3TU4 A;  3MNN D;  3REJ B;  1EQZ C;  3AZL D;  5B31 D;  4KGC D;  2NQB C;  3REI D;  2Y2P A;  3C1B A;  2HIO C;  4H9P A;  1F66 A;  3KWQ B;  5GXQ D;  5B0Z B;  5B1L B;  2G5H C;  4DRA A;  5GSU C;  5DNM B;  2CV5 A;  1M19 D;  5AV9 A;  1P3L B;  4QLC B;  3WKJ B;  4J8X A;  5AVC B;  4Z5T C;  4J8W C;  1U35 A;  5B32 C;  1P34 A;  5B40 A;  5B0Y C;  3MGQ D;  3KXB C;  1P3G C;  3WAA D;  3X1V D;  1P3P C;  3MVD A;  5B24 A;  3WTP E;  5FUG B;  3LZ1 B;  4HGA B;  1P3K B;  1KX3 A;  4G92 C;  4WV4 B;  5JRG D;  1AOI B;  4WU9 B;  3REK B;  5CPI A;  3KSY A;  3REL B;  3AV1 A;  1S32 C;  3W96 B;  2ZY3 A;  4G91 C;  4CSR A;  2BYM B;  3AZH C;  3X1U B;  1KU5 A;  4XUJ A;  3LJA A;  4KUD C;  5E5A D;  4WU8 C;  1EQZ A;  1TZY B;  4H9O A;  3AZF C;  2NQB A;  5AV5 B;  4WJ3 C;  4YS3 D;  3AZG B;  3WKJ D;  1M18 C;  2XD1 A;  2HIO A;  3AFA B;  3AN2 D;  4XZQ D;  5GSU A;  4X23 C;  2Y2K A;  3A1K A;  2VQR A;  3B0D B;  4UPK A;  3B6F C;  4Z5T A;  3KUY C;  4J8W A;  5CPK D;  3REJ C;  5CPJ B;  3LEL D;  1HQ3 B;  1TAF A;  5B0Y A;  3KXB A;  1P3G A;  3W98 D;  1WWI A;  3REH B;  3KWQ C;  5BT1 D;  5B0Z C;  3FDD A;  5B1L C;  1H3O A;  3W99 B;  4ZUX A;  4DRB A;  5DNM C;  1F1E A;  1P3L C;  1Z2C B;  4QLC C;  1ID3 D;  5AVC C;  1P3M A;  3AZK D;  5CP6 B;  3AZH A;  3WTP D;  1P3F D;  5B33 A;  2IO5 B;  3AYW B;  2F8N H;  2FJ7 A;  3B0C T;  4J8V B;  3R45 B;  5AV5 D;  5AV8 B;  1HTA A;  3LZ0 D;  4Z2M H;  3LZ1 C;  4WU8 A;  5AV6 D;  4HGA C;  4WZS B;  3AZN B;  3AZM B;  1P3K C;  3F6T A;  3H0L C;  3REK C;  4WU9 C;  3REL C;  4R8P B;  4YM6 D;  5F99 B;  3W96 C;  3NQJ B;  3C1B D;  1M18 A;  4Z66 B;  3IP4 C;  4CAY A;  2XD5 A;  5DNN D;  1B6W A;  3MNN B;  3X1U C;  3AZL B;  2CV5 D;  4ZBJ B;  4X23 A;  5B31 B;  5AV9 D;  3UT9 D;  2LY8 A;  4KGC B;  3W97 D;  3REI B;  1U35 D;  3NQU B;  3X1T D;  3REJ A;  1P34 D;  5B2I C;  5CHL B;  1M1A D;  1TZY C;  5GXQ B;  3W99 D;  5B24 D;  5KDM A;  2W8S A;  2Y2I A;  3AZG C;  1M19 B;  5GT0 A;  3VH5 W;  5CPI D;  5B0Z A;  3AV1 D;  2F8N D;  3AFA C;  3AV2 D;  3MGQ B;  5DNM A;  3WAA B;  3B0B A;  4QLC A;  3UTA D;  2L5A A;  3X1V B;  5AVC A;  1P3B A;  5CPJ C;  5JRG B;  4NFT A;  1KX5 A;  1HQ3 C;  4XUJ D;  3B6G D;  3LZ1 A;  3REH C;  1P3K A;  4WU9 A;  3REK A;  5BNX B;  4AWL B;  3W96 A;  5B1M A;  5GT3 C;  2YFW B;  5E5A B;  5CP6 C;  3KFU G;  1P3A D;  3X1U A;  2IO5 C;  5GSU D;  1BH8 B;  3UTB D;  4J8V C;  5AV8 C;  2F8N K;  4YS3 B;  5B2I A;  3AZN C;  3AZM C;  4E44 A;  1B67 A;  5B32 G;  2Y2Q A;  3AZJ D;  3AN2 B;  4DQY B;  3MGS D;  4XZQ B;  5BNV B;  5F99 C;  1N1J B;  4Z66 C;  1ZLA D;  5CPK B;  3AFA A;  4ZUX D;  3MNN C;  2JE5 A;  3LEL B;  5AY8 A;  3AZL C;  4ZBJ C;  3X1S D;  5B31 C;  5AVB D;  3O62 D;  4KGC C;  4JJN C;  1P3M D;  3REI C;  3VH6 T;  3W98 B;  5B33 D;  2FJ7 D;  5CPJ A;  1HQ3 A;  5GXQ C;  3MGP D;  5B2J A;  2NZD A;  1M19 C;  2PYO C;  3C1C A;  1ID3 B;  3AZK B;  3AL0 C;  5BO0 B;  1P3F B;  3WTP B;  1W2E A;  5GT3 A;  3X1V C;  4H9Q A;  3LZ0 B;  2ARO D;  4LD9 D;  3VH5 A;  3WA9 D;  5AV6 B;  5JRG C;  4J8U D;  4J8V A;  3R45 A;  3AZI C;  3AZE D;  1P3I D;  3MGR C;  2UWX A;  4YM6 B;  3C1B B;  4H9P B;  3AZN A;  4UUZ B;  5DNN B;  5B32 A;  4NE3 A;  5F99 A;  4AWL C;  3NQJ A;  5AV9 B;  5GT0 D;  3UT9 B;  2CV5 B;  1P3P A;  4Z66 A;  3W97 B;  1U35 B;  5E5A C;  3X1T B;  3MNN A;  1P34 B;  1KX4 D;  1M1A B;  3AZL A;  5B31 A;  4KGC A;  1S32 A;  4JJN A;  5B24 B;  3REI A;  4YS3 C;  3WKJ C;  1P3B D;  2Y2G A;  1KX5 D;  4WNN A;  5CPI B;  3AV1 B;  2F8N B;  3A6N D;  3AV2 B;  3AN2 C;  1P3O D;  4XZQ C;  1M19 A;  2PYO A;  4CSR B;  3UTA B;  3V9R B;  4KUD A;  3TU4 D;  3B0C W;  5CPK C;  4KHA B;  3LEL C;  1AOI C;  5B1M D;  3AZF A;  4XUJ B;  3B6G B;  2JSS A;  3X1V A;  1BH9 B;  3W98 C;  2Y2H A;  1F66 D;  2Y2M A;  5JRG A; 
#chains in the Genus database with same CATH homology
 5BT1 C;  2BYK B;  3AZI A;  3MGR A;  4H9S C;  5B2I D;  4J8X D;  3B6F A;  3KUY A;  2DQN C;  2J8P A;  5BNX A;  5B40 D;  3WTP C;  1P3A B;  5GSU B;  4NE6 A;  3UTB B;  3MVD D;  5AV5 C;  2YFW A;  4H9R B;  3LZ0 C;  2RVQ D;  5E5A A;  1KX3 D;  1T3U A;  5AV6 C;  5AY8 D;  1TAF B;  3KWQ A;  1BH8 A;  5B1L A;  4H9N B;  3AZJ B;  2Y2L A;  4YM6 C;  3MGS B;  4YS3 A;  3WKJ A;  1P3L A;  3C1B C;  4G92 B;  3B0D C;  1ZLA B;  5DNN C;  1H3O B;  5B2J D;  4ZUX B;  3EPJ A;  3AN2 A;  2NZD D;  4XZQ A;  2CV5 C;  3X1S B;  3O62 B;  5AV9 C;  5AVB B;  3LJA D;  3C1C D;  3UT9 C;  2DF4 C;  1P3M B;  3W97 C;  2RIQ A;  5FUG A;  1U35 C;  1EQZ D;  5B33 B;  3X1T C;  2FJ7 B;  3LEL A;  1M1A C;  1AOI A;  2NQB D;  5GT3 D;  3REL A;  3W99 C;  3MGP B;  1JFI B;  3W98 A;  2HIO D;  1BFM A;  2BYM A;  1PZR A;  3EPL A;  1A7W A;  3AV1 C;  3AYW C;  5G49 B;  4H9S A;  3AV2 C;  4Z5T D;  4J8W D;  4CAY B;  3UTA C;  2ARO B;  5B32 D;  4LD9 B;  5BS7 C;  5BO0 A;  3WA9 B;  5JA4 B;  5B0Y D;  1TZY A;  3WTP A;  3KXB D;  1P3G D;  1P3P D;  2YFV B;  4J8U B;  5AV5 A;  3B6G C;  4R8P C;  3AZE B;  3AZG A;  1P3I B;  5AV6 A;  1S32 D;  4JJN D;  1R4V A;  5KDM B;  5B31 G;  4YM6 A;  5GT0 B;  4UUZ A;  3AZH D;  5DNN A;  2Y2N A;  1KX4 B;  1P3A C;  2PYO D;  3UT9 A;  3VH6 W;  3UTB C;  4KUD D;  2HUE B;  3W97 A;  4WU8 D;  3REH A;  3X1T A;  1P3B B;  1KX5 B;  1M1A A;  3AZF D;  3W99 A;  3AZJ C;  1M18 D;  4EO5 B;  3A6N B;  3MGS C;  3WAA C;  3MGQ C;  1P3O B;  2ZY5 A;  3P5J B;  3TU4 B;  1ZLA C;  5CP6 A;  3AZI D;  3H0R C;  3AYW A;  3MGR D;  2F8N A;  4ZUX C;  4X23 D;  3AV2 A;  5B1M B;  3O62 C;  2ZM5 A;  3X1S C;  5AVB C;  5AV8 A;  3A1I A;  3KUY D;  3V9R A;  3UTA A;  3B6F D;  1P3M C;  3REJ D;  2G5I C;  1F66 B;  5BS7 A;  3AZM A;  5B33 C;  2FJ7 C;  4KHA A;  3B6G A;  3MGP C;  4R8P A;  1BH9 A;  2BG1 A;  5B2I B;  4J8X B;  3KWQ D;  4E45 A;  5B0Z D;  5B1L D;  5B40 B;  2BYK A;  5DNM D;  1P3L D;  4QLC D;  3MVD B;  5AVC D;  3NQU A;  1ULY A;  2ARO C;  1KX3 B;  4LD9 C;  3WA9 C;  1P3A A;  5AY8 B;  5GXQ A;  4J8U C;  3UTB A;  3LZ1 D;  4H9R A;  3AZE C;  1P3I C;  1P3K D;  4NE5 A;  1AOI D;  4WU9 D;  3REK D;  3REL D;  4H9N A;  3AZJ A;  5C3I B;  5B2J B;  3W96 D;  2NZD B;  3EG5 B;  2FFF B;  3MGS A;  3MGQ A;  3WAA A;  3C1C B;  5GT0 C;  3LJA B;  1ZLA A;  1EQZ B;  3X1U D;  1KX4 C;  4H9O B;  3X1S A;  5GT3 B;  5AVB A;  3O62 A;  2NQB B;  4H9Q B;  2HUE C;  3EPH A;  2HIO B;  1TZY D;  1P3B C;  1KX5 C;  1ID3 C;  3AZK C;  1P3F C;  3MGP A;  3VH6 A;  3AZG D;  4EO5 C;  3A6N C;  1JFI A;  3H0M C;  1P3O C;  4Z5T B;  4J8W B;  3TU4 C;  3AFA D;  5B32 B;  5B0Y B;  5G49 A;  3KXB B;  1P3G B;  1P3P B;  5B1M C;  3EPK A;  2ARO A;  4LD9 A;  5CPJ D;  1F66 C;  3WA9 A;  5JA4 A;  1HQ3 D;  2YFV A;  4J8U A;  1S32 B;  4JJN B;  2ZY4 A;  2Y2J A;  3AZE A;  4G91 B;  5BNV A;  3REH D;  1P3I A;  1N1J A;  4J8X C;  4M6B A;  4WNN B;  3AZH B;  5CPK A;  3VH5 T;  2CWE A;  2ZY2 A;  1P34 C;  5B40 C;  2PYO B;  4KUD B;  3MVD C;  5B24 C;  5CP6 D;  4WU8 B;  2RVQ C;  3AYW D;  1KX3 C;  1KX4 A;  4J8V D;  5AY8 C;  2F2A C;  1Q9C A;  3AZF B;  5CPI C;  5AV8 D;  2F8N G;  1M18 B;  3AZN D;  3AZM D;  4Z2M G;  1ID3 A;  3AZK A;  2JCH A;  3AZI B;  4R8P D;  1P3F A;  5F99 D;  5C3I C;  5B2J C;  4X23 B;  3A6N A;  3MGR B;  2NZD C;  1P3O A;  1WWS A;  4XUJ C;  4Z66 D;  3C1C C;  3LJA C;  3KUY B;  3B6F B;  3LZ0 A;  2Y2O A;  3TU4 A;  3MNN D;  3REJ B;  1EQZ C;  3AZL D;  5B31 D;  4KGC D;  2NQB C;  3REI D;  2Y2P A;  3C1B A;  2HIO C;  4H9P A;  1F66 A;  3KWQ B;  5GXQ D;  5B0Z B;  5B1L B;  2G5H C;  4DRA A;  5GSU C;  5DNM B;  2CV5 A;  1M19 D;  5AV9 A;  1P3L B;  4QLC B;  3WKJ B;  4J8X A;  5AVC B;  4Z5T C;  4J8W C;  1U35 A;  5B32 C;  1P34 A;  5B40 A;  5B0Y C;  3MGQ D;  3KXB C;  1P3G C;  3WAA D;  3X1V D;  1P3P C;  3MVD A;  5B24 A;  3WTP E;  5FUG B;  3LZ1 B;  4HGA B;  1P3K B;  1KX3 A;  4G92 C;  4WV4 B;  5JRG D;  1AOI B;  4WU9 B;  3REK B;  5CPI A;  3KSY A;  3REL B;  3AV1 A;  1S32 C;  3W96 B;  2ZY3 A;  4G91 C;  4CSR A;  2BYM B;  3AZH C;  3X1U B;  1KU5 A;  4XUJ A;  3LJA A;  4KUD C;  5E5A D;  4WU8 C;  1EQZ A;  1TZY B;  4H9O A;  3AZF C;  2NQB A;  5AV5 B;  4WJ3 C;  4YS3 D;  3AZG B;  3WKJ D;  1M18 C;  2XD1 A;  2HIO A;  3AFA B;  3AN2 D;  4XZQ D;  5GSU A;  4X23 C;  2Y2K A;  3A1K A;  2VQR A;  3B0D B;  4UPK A;  3B6F C;  4Z5T A;  3KUY C;  4J8W A;  5CPK D;  3REJ C;  5CPJ B;  3LEL D;  1HQ3 B;  1TAF A;  5B0Y A;  3KXB A;  1P3G A;  3W98 D;  1WWI A;  3REH B;  3KWQ C;  5BT1 D;  5B0Z C;  3FDD A;  5B1L C;  1H3O A;  3W99 B;  4ZUX A;  4DRB A;  5DNM C;  1F1E A;  1P3L C;  1Z2C B;  4QLC C;  1ID3 D;  5AVC C;  1P3M A;  3AZK D;  5CP6 B;  3AZH A;  3WTP D;  1P3F D;  5B33 A;  2IO5 B;  3AYW B;  2F8N H;  2FJ7 A;  3B0C T;  4J8V B;  3R45 B;  5AV5 D;  5AV8 B;  1HTA A;  3LZ0 D;  4Z2M H;  3LZ1 C;  4WU8 A;  5AV6 D;  4HGA C;  4WZS B;  3AZN B;  3AZM B;  1P3K C;  3F6T A;  3H0L C;  3REK C;  4WU9 C;  3REL C;  4R8P B;  4YM6 D;  5F99 B;  3W96 C;  3NQJ B;  3C1B D;  1M18 A;  4Z66 B;  3IP4 C;  4CAY A;  2XD5 A;  5DNN D;  1B6W A;  3MNN B;  3X1U C;  3AZL B;  2CV5 D;  4ZBJ B;  4X23 A;  5B31 B;  5AV9 D;  3UT9 D;  2LY8 A;  4KGC B;  3W97 D;  3REI B;  1U35 D;  3NQU B;  3X1T D;  3REJ A;  1P34 D;  5B2I C;  5CHL B;  1M1A D;  1TZY C;  5GXQ B;  3W99 D;  5B24 D;  5KDM A;  2W8S A;  2Y2I A;  3AZG C;  1M19 B;  5GT0 A;  3VH5 W;  5CPI D;  5B0Z A;  3AV1 D;  2F8N D;  3AFA C;  3AV2 D;  3MGQ B;  5DNM A;  3WAA B;  3B0B A;  4QLC A;  3UTA D;  2L5A A;  3X1V B;  5AVC A;  1P3B A;  5CPJ C;  5JRG B;  4NFT A;  1KX5 A;  1HQ3 C;  4XUJ D;  3B6G D;  3LZ1 A;  3REH C;  1P3K A;  4WU9 A;  3REK A;  5BNX B;  4AWL B;  3W96 A;  5B1M A;  5GT3 C;  2YFW B;  5E5A B;  5CP6 C;  3KFU G;  1P3A D;  3X1U A;  2IO5 C;  5GSU D;  1BH8 B;  3UTB D;  4J8V C;  5AV8 C;  2F8N K;  4YS3 B;  5B2I A;  3AZN C;  3AZM C;  4E44 A;  1B67 A;  5B32 G;  2Y2Q A;  3AZJ D;  3AN2 B;  4DQY B;  3MGS D;  4XZQ B;  5BNV B;  5F99 C;  1N1J B;  4Z66 C;  1ZLA D;  5CPK B;  3AFA A;  4ZUX D;  3MNN C;  2JE5 A;  3LEL B;  5AY8 A;  3AZL C;  4ZBJ C;  3X1S D;  5B31 C;  5AVB D;  3O62 D;  4KGC C;  4JJN C;  1P3M D;  3REI C;  3VH6 T;  3W98 B;  5B33 D;  2FJ7 D;  5CPJ A;  1HQ3 A;  5GXQ C;  3MGP D;  5B2J A;  2NZD A;  1M19 C;  2PYO C;  3C1C A;  1ID3 B;  3AZK B;  3AL0 C;  5BO0 B;  1P3F B;  3WTP B;  1W2E A;  5GT3 A;  3X1V C;  4H9Q A;  3LZ0 B;  2ARO D;  4LD9 D;  3VH5 A;  3WA9 D;  5AV6 B;  5JRG C;  4J8U D;  4J8V A;  3R45 A;  3AZI C;  3AZE D;  1P3I D;  3MGR C;  2UWX A;  4YM6 B;  3C1B B;  4H9P B;  3AZN A;  4UUZ B;  5DNN B;  5B32 A;  4NE3 A;  5F99 A;  4AWL C;  3NQJ A;  5AV9 B;  5GT0 D;  3UT9 B;  2CV5 B;  1P3P A;  4Z66 A;  3W97 B;  1U35 B;  5E5A C;  3X1T B;  3MNN A;  1P34 B;  1KX4 D;  1M1A B;  3AZL A;  5B31 A;  4KGC A;  1S32 A;  4JJN A;  5B24 B;  3REI A;  4YS3 C;  3WKJ C;  1P3B D;  2Y2G A;  1KX5 D;  4WNN A;  5CPI B;  3AV1 B;  2F8N B;  3A6N D;  3AV2 B;  3AN2 C;  1P3O D;  4XZQ C;  1M19 A;  2PYO A;  4CSR B;  3UTA B;  3V9R B;  4KUD A;  3TU4 D;  3B0C W;  5CPK C;  4KHA B;  3LEL C;  1AOI C;  5B1M D;  3AZF A;  4XUJ B;  3B6G B;  2JSS A;  3X1V A;  1BH9 B;  3W98 C;  2Y2H A;  1F66 D;  2Y2M A;  5JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...