5B33A

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33A00
3AYWA 5CP6A 1P3PB 3WAAB 5AVCC 4X23B 3REIA 2CV5C 3W96C 1P3BD 5F99C 3MGRC 4Z5TB 4NE5A 5B31D 5AVBD 4KGCD 1P3KC 1M19A 3AYWB 5BNVA 1BH8B 4NE6A 4QLCB 1M1AA 1ZLAD 3UTBD 5G49A 1P3FC 5AVCA 5BNXB 4XZQD 5AV8B 5AV6C 3AZMB 1KX5D 3MGRA 1EQZB 3TU4C 1TAFB 4KHAB 3MVDD 1F66A 3KWQD 1Q9CA 4XUJD 4M6BA 4AWLC 2CV5B 3AZFC 3W96B 1P3FA 5F99B 3MGSB 4JJNB 3RELC 4WU9D 5B0YC 3MGRB 4NFTA 3AZLB 4G92C 5B32D 5AV6A 3X1VA 4H9PA 5E5AD 3MGQA 3R45A 3AZEC 2F8NG 1P3KB 5DNNB 5BT1D 3UTAC 3C1BC 3REKA 4YS3C 1KU5A 1JFIA 2FJ7C 4UUZA 1S32A 3AZFA 3REJD 5B1MC 5B0ZC 4Z2MH 3AZKC 3LJAD 5FUGA 5B0YA 3TU4B 1ID3C 3AFAD 3LELC 4J8VC 1P3PD 3WAAD 4X23D 1KX3C 4LD9C 4UUZB 3UTAA 4AWLB 3WTPB 1P3OB 4H9SC 2FJ7A 4Z5TD 3RELB 5B1MA 3O62B 3B6FB 3X1TC 3AZKA 3AYWD 4QLCD 3AZEB 3UT9C 3KXBB 2PYOA 3WKJA 3C1BB 3LELA 2YFVB 4G91B 4J8VA 4YS3B 4LD9A 5AV8D 5AV5C 3AZMD 5B0ZB 4H9SA 1EQZD 4DRAA 3AZIB 5GT3B 2BYKB 4KUDC 1ID3B 3LELB 3X1TA 4R8PC 3UT9A 2CV5D 5GT0C 3W98C 1BH9B 2LY8A 1KX3B 3W96D 1P3GB 5JRGC 5F99D 3MGSD 4JJND 3AZLD 5B40A 3MGRD 3X1UC 5JA4A 5AV5A 4CSRB 5GXQC 1P3KD 5DNND 5CHLB 3AZGA 2CWEA 2AROB 2HUEC 3X1SB 5GT0A 3WA9B 3W98A 4ZUXC 5B33C 4WU8B 2NZDB 4J8XC 5JRGA 2BYMB 5KDMB 3TU4D 3X1UA 5GXQA 4KUDB 5CP6C 3AN2C 4WV4B 3REIC 4R8PB 3WTPD 3C1CA 4H9NA 5B24C 1P3OD 1HTAA 5DNMC 5CPKC 5GSUB 3RELD 1H3OA 5B33A 4ZUXA 3O62D 3X1UB 3B6FD 4J8XA 3AZED 1P3IC 5B2IC 3KXBD 1M1AC 5B31G 3AZNC 3C1BD 1P3LC 2NQBB 4YS3D 3AN2A 1F1EA 3KUYB 1U35C 5B24A 4ZUXB 5B0ZD 5DNMA 5CPKA 3AZID 4J8WC 5GT3D 4WNNA 5CPJC 1ID3D 1F66C 3LELD 5B2JC 1P3IA 3W99C 3NQUA 5CP6B 5B2IA 3VH5A 3AZNA 1KX3D 1N1JA 3REIB 1P3LA 1P3GD 1P3AC 5DNMB 1U35A 3AV2A 3AV1C 3X1VC 3MGQC 4ZBJB 4J8WA 1M19B 3B6GC 5BNVB 5CPJA 3KSYA 1M1AB 5B32G 2AROD 3REKC 5B2JA 3W99A 3X1SD 5G49B 1TZYC 1S32C 4H9RA 3B0CW 5AVCB 3WA9D 2HIOC 3VH5W 4WU8D 2NZDD 4YM6C 4J8UA 1KX4C 1P3AA 4H9QA 3WTPE 3MGPC 1A7WA 3AV1A 1HQ3A 4KUDD 1F66B 5B1LA 4R8PD 3B6GA 4DRBA 5AY8C 3AZJC 3B0CT 5GSUD 1TZYA 3A6NA 1P3FB 3VH5T 4Z66A 2HIOA 3X1UD 4YM6A 1KX4A 2IO5C 5AV6B 3X1VB 4H9PB 3LZ0A 3MGQB 3R45B 3MGPA 2PYOC 3WKJC 2NQBD 1BFMA 3REKB 3AZHC 3KUYD 1JFIB 5AY8A 1S32B 3AZJA 4ZUXD 3MNNC 3AZFB 1P3MC 5CPIC 2L5AA 5BO0A 5FUGB 5B0YB 4G92B 1AOIA 5CP6D 1P34A 3REID 3UTAB 5DNMD 5B31C 3AZHA 5B40C 2FJ7B 4KGCC 3MNNA 1P3MA 5CPIA 5B1MB 3W97A 1M19D 3AZKB 4NE3A 3REHA 3UTBC 1M1AD 1M18A 2PYOB 3WKJB 3AZGC 4J8VB 5AVCD 1P3BA 4LD9B 4HGAC 4EO5C 5B31A 5BS7A 5AVBA 4KGCA 3KWQC 1F66D 1ZLAA 3V9RA 3X1TB 4CAYA 3UTBA 3UT9B 3C1CC 4WU9C 2F8NK 4XZQA 1P3FD 5B40B 5E5AC 5JA4B 1KX5A 5AV5B 5AV6D 3X1VD 5BT1C 3MGQD 3MVDA 3KWQA 4XUJA 3AZGB 3NQJA 3REKD 2F8NH 1S32D 5GT0B 3W98B 3AZFD 4H9OA 4WU9A 3LJAC 5AV9C 5JRGB 3AFAC 5B32A 5B0YD 3WAAC 5E5AA 1B6WA 4X23C 5GXQB 4Z2MG 3UTAD 3LZ1C 3C1CB 4E45A 4H9NB 4Z5TC 2HUEB 3REJA 2FJ7D 3AV2C 2F8NA 1H3OB 5B33B 2RVQC 5B1MD 4QLCC 3LJAA 5AV9A 4J8XB 3AZKD 3AFAA 2PYOD 3WKJD 1P3PA 3WAAA 4X23A 4J8VD 3AN2B 5AV8C 4LD9D 3LZ1A 4J8UC 1EQZC 2F8NB 4Z5TA 5B24B 5AV9B 2YFWA 5CPKB 4WNNB 1HQ3C 1BH8A 4QLCA 3X1TD 1ULYA 5B1LC 1P3IB 3NQUB 5B2IB 3UT9D 3AZNB 1N1JB 3MGSC 3LZ1B 4JJNC 1P3LB 3AZLC 3B0BA 5BNXA 3A6NC 5AV8A 2YFWB 5B40D 4Z66C 3AZMA 1U35B 3AV2B 5AV5D 1EQZA 5DNNC 1TAFA 3LZ0C 4KHAA 4J8WB 5CPJB 3AZGD 2CV5A 3W96A 5B2JB 3W99B 5GT0D 4H9RB 3W98D 5F99A 3MGSA 4JJNA 4J8UB 3AZLA 3B0DC 5JRGD 1P3AB 4H9QB 1P3KA 5DNNA 5GXQD 3AV1B 1HQ3B 1AOIC 3WTPC 1P34C 5B1LB 1P3OC 3B6GB 3C1CD 1WWIA 3O62C 4E44A 1TZYB 3A6NB 3B6FC 4Z66B 2HIOB 5B33D 3KXBC 4YM6B 4J8XD 3W97C 3TU4A 1KX4B 3LZ0B 3REHC 4G91C 3MGPB 1M18C 1R4VA 3AN2D 3WTPA 1P3OA 5AY8B 1P3BC 3AZJB 2F8ND 5B24D 3AZIC 5GT3C 3RELA 5AV9D 5CPKD 3B0DB 3O62A 5BS7C 5AVBC 3B6FA 1B67A 5BO0B 3AZEA 3KXBA 1ZLAC 2IO5B 1P3ID 1AOIB 5B2ID 3C1BA 3AZND 2YFVA 1P34B 1P3GC 3LZ1D 4YS3A 1P3LD 3VH6A 4XZQC 3AZHB 1U35D 5B0ZA 3AV2D 1KX5C 3AZIA 2RVQD 3MNNB 5GT3A 5CPIB 1P3MB 2BYKA 3W97B 1ID3A 3MVDC 4J8WD 2AROC 5CPJD 3REHB 4XUJC 1M18B 3X1SC 3WA9C 1BH9A 1KX3A 5B2JD 3W99D 4WU8C 2NZDC 1P3GA 1P3BB 4J8UD 1P3AD 3VH6W 4CSRA 5B31B 5B32C 5AVBB 4KGCB 3AV1D 1HQ3D 1ZLAB 5B1LD 3V9RB 3B6GD 2AROA 4CAYB 3UTBB 3X1SA 5GSUC 3WA9A 4WU8A 3REJC 1TZYD 5C3IC 4XZQB 3A6ND 2NZDA 4Z66D 2HIOD 2BYMA 5KDMA 4HGAB 4YM6D 2JSSA 1KX4D 4EO5B 3VH6T 1KX5B 3REHD 3LZ0D 3MGPD 4KUDA 3MVDB 1P3PC 2NQBC 3KWQB 4XUJB 4R8PA 3KUYC 3NQJB 5AY8D 3AZJD 5GSUA 4H9OB 4WU9B 5B32B 3AYWC 5E5AB 1AOID 1P34D 2NQBA 3KUYA 1WWSA 3AZHD 4WZSB 3REJB 5C3IB 3AZMC 3MNND 4ZBJC 1P3MD 5CPID 1M19C 3W97D 3LJAB 3AFAB 1M18D
chains in the Genus database with same CATH superfamily
2UWXA 3AYWA 5CP6A 1P3PB 3WAAB 5AVCC 4X23B 3REIA 2CV5C 3W96C 1P3BD 5F99C 2ZM5A 3MGRC 4Z5TB 4NE5A 5B31D 3EPLA 5AVBD 4KGCD 1P3KC 1M19A 3AYWB 5BNVA 1BH8B 4NE6A 4QLCB 1M1AA 1ZLAD 3UTBD 5G49A 1P3FC 5AVCA 3A1KA 5BNXB 4XZQD 5AV8B 5AV6C 3AZMB 1KX5D 2Y2IA 3MGRA 3TU4C 1EQZB 1TAFB 4KHAB 3MVDD 1F66A 3KWQD 1Q9CA 4XUJD 4M6BA 4AWLC 2CV5B 3AZFC 3W96B 1P3FA 5F99B 3MGSB 4JJNB 3RELC 4WU9D 5B0YC 3MGRB 4NFTA 3AZLB 4G92C 5B32D 5AV6A 3X1VA 4H9PA 5E5AD 3MGQA 3R45A 3AZEC 2F8NG 1P3KB 5DNNB 5BT1D 3UTAC 3C1BC 3REKA 4YS3C 1KU5A 1JFIA 2FJ7C 4UUZA 1S32A 3AZFA 3REJD 5B1MC 5B0ZC 4Z2MH 3AZKC 2JCHA 3LJAD 5FUGA 5B0YA 3TU4B 1ID3C 3AFAD 2VQRA 3LELC 3KFUG 4J8VC 1P3PD 3WAAD 2DF4C 4X23D 1KX3C 2XD1A 4LD9C 4UUZB 3UTAA 4AWLB 3WTPB 1P3OB 4H9SC 2FJ7A 4Z5TD 3RELB 5B1MA 3O62B 3B6FB 3X1TC 3AZKA 3AYWD 4QLCD 3AZEB 3UT9C 3KXBB 2PYOA 3WKJA 3FDDA 3C1BB 3LELA 2YFVB 4G91B 4J8VA 4YS3B 4WJ3C 4LD9A 5AV8D 5AV5C 3AZMD 5B0ZB 4H9SA 1EQZD 4DRAA 3AZIB 5GT3B 2Y2JA 2BYKB 4KUDC 1ID3B 3LELB 3X1TA 4R8PC 3UT9A 2CV5D 5GT0C 3W98C 1BH9B 2LY8A 2Y2NA 1KX3B 3W96D 1P3GB 5JRGC 5F99D 3MGSD 4JJND 2Y2GA 1PZRA 3AZLD 5B40A 3MGRD 3X1UC 5JA4A 5AV5A 4CSRB 5GXQC 1P3KD 5DNND 2ZY4A 5CHLB 3AZGA 2CWEA 2Y2MA 2AROB 2HUEC 3X1SB 5GT0A 3WA9B 3W98A 4ZUXC 5B33C 4WU8B 2NZDB 4J8XC 5JRGA 2BYMB 5KDMB 3TU4D 3X1UA 5GXQA 4KUDB 5CP6C 3AN2C 4WV4B 3P5JB 3REIC 4R8PB 3WTPD 3C1CA 4H9NA 5B24C 1P3OD 1HTAA 5DNMC 5CPKC 5GSUB 3RELD 1H3OA 5B33A 4ZUXA 3O62D 3X1UB 3B6FD 4J8XA 3AZED 1P3IC 5B2IC 3KXBD 1M1AC 5B31G 3AZNC 3IP4C 3C1BD 1P3LC 2NQBB 4YS3D 3AN2A 1F1EA 3KUYB 1U35C 2ZY2A 2Y2PA 5B24A 4ZUXB 5B0ZD 5DNMA 5CPKA 3AZID 4J8WC 5GT3D 4WNNA 5CPJC 1ID3D 1F66C 3LELD 5B2JC 1P3IA 3W99C 5B2IA 3NQUA 5CP6B 3VH5A 3AZNA 1KX3D 1N1JA 4UPKA 3REIB 3H0RC 1P3LA 1P3GD 1P3AC 5DNMB 1U35A 3AV2A 3AV1C 3F6TA 3X1VC 3MGQC 4ZBJB 4J8WA 1M19B 3B6GC 5BNVB 5CPJA 3KSYA 1M1AB 5B32G 3EPJA 2AROD 3REKC 5B2JA 3W99A 3X1SD 5G49B 1TZYC 1S32C 4H9RA 3B0CW 5AVCB 3WA9D 2HIOC 3VH5W 4WU8D 2NZDD 4YM6C 4J8UA 1KX4C 1P3AA 4H9QA 3WTPE 3MGPC 1A7WA 3AV1A 1HQ3A 4KUDD 1F66B 5B1LA 4R8PD 3B6GA 4DRBA 5AY8C 3AZJC 3B0CT 5GSUD 1TZYA 3A6NA 1P3FB 3VH5T 4Z66A 2HIOA 3X1UD 2J8PA 4YM6A 1KX4A 2IO5C 5AV6B 3X1VB 2DQNC 4H9PB 3LZ0A 3R45B 3MGPA 3MGQB 2PYOC 3WKJC 2NQBD 1BFMA 3REKB 2XD5A 3AZHC 3KUYD 1JFIB 2Y2HA 5AY8A 1S32B 3AZJA 4ZUXD 3MNNC 3AZFB 1P3MC 5CPIC 2L5AA 3H0LC 5BO0A 5FUGB 5B0YB 1Z2CB 4G92B 1AOIA 5CP6D 1P34A 3REID 3UTAB 5DNMD 5B31C 3AZHA 5B40C 2FJ7B 4KGCC 3MNNA 1P3MA 5CPIA 5B1MB 3W97A 1M19D 3AZKB 4NE3A 3REHA 3UTBC 1M1AD 1M18A 2PYOB 3WKJB 3AZGC 2BG1A 4J8VB 5AVCD 1P3BA 4LD9B 4HGAC 4EO5C 5B31A 5BS7A 5AVBA 4KGCA 3KWQC 1F66D 1ZLAA 3V9RA 3X1TB 4CAYA 3UTBA 3UT9B 2Y2LA 3C1CC 3AL0C 4WU9C 2F8NK 4XZQA 1P3FD 5B40B 5E5AC 3EG5B 5JA4B 1KX5A 5AV5B 5AV6D 3X1VD 5BT1C 3MGQD 2Y2KA 3MVDA 3KWQA 4XUJA 1W2EA 3AZGB 3NQJA 3REKD 2F8NH 1S32D 5GT0B 3W98B 3AZFD 4H9OA 4WU9A 3LJAC 5AV9C 5JRGB 3AFAC 5B32A 5B0YD 3WAAC 5E5AA 1B6WA 4X23C 5GXQB 4Z2MG 3UTAD 3LZ1C 3C1CB 4E45A 4H9NB 4Z5TC 2HUEB 3REJA 2FJ7D 3AV2C 2F8NA 1H3OB 5B33B 2RVQC 5B1MD 4QLCC 3LJAA 5AV9A 4J8XB 3AZKD 3AFAA 2PYOD 3WKJD 1P3PA 3WAAA 4X23A 4J8VD 3AN2B 5AV8C 4LD9D 3LZ1A 2ZY3A 4J8UC 1EQZC 2F8NB 4Z5TA 5B24B 2FFFB 5AV9B 2YFWA 5CPKB 4WNNB 1HQ3C 1BH8A 4QLCA 3X1TD 1ULYA 5B1LC 1P3IB 3NQUB 5B2IB 3UT9D 3AZNB 1N1JB 3MGSC 3LZ1B 4JJNC 1P3LB 3AZLC 3B0BA 5BNXA 3A6NC 5AV8A 2YFWB 5B40D 4Z66C 3AZMA 1U35B 3AV2B 5AV5D 1EQZA 5DNNC 1TAFA 3LZ0C 4KHAA 4J8WB 2G5IC 5CPJB 3AZGD 2JE5A 2CV5A 3W96A 5B2JB 3W99B 5GT0D 4H9RB 3W98D 5F99A 3MGSA 4JJNA 4J8UB 3AZLA 3B0DC 5JRGD 1P3AB 4H9QB 1P3KA 5DNNA 5GXQD 3AV1B 1HQ3B 1AOIC 3WTPC 1P34C 5B1LB 1P3OC 3B6GB 3C1CD 1WWIA 3O62C 4E44A 1TZYB 3A6NB 3B6FC 2ZY5A 4Z66B 2HIOB 5B33D 3KXBC 4YM6B 4J8XD 3W97C 3TU4A 1KX4B 3LZ0B 2Y2QA 3REHC 4G91C 3MGPB 1M18C 1R4VA 3AN2D 3WTPA 1T3UA 1P3OA 5AY8B 2F2AC 1P3BC 3AZJB 2F8ND 5B24D 3AZIC 5GT3C 3RELA 5AV9D 5CPKD 3B0DB 3O62A 2RIQA 5BS7C 5AVBC 3B6FA 1B67A 5BO0B 3AZEA 3KXBA 1ZLAC 2IO5B 1P3ID 1AOIB 5B2ID 3C1BA 3AZND 2YFVA 1P34B 1P3GC 3LZ1D 4YS3A 1P3LD 3VH6A 4XZQC 3AZHB 1U35D 5B0ZA 3AV2D 1KX5C 3AZIA 2RVQD 3MNNB 5GT3A 5CPIB 1P3MB 2BYKA 3W97B 1ID3A 3MVDC 4J8WD 2AROC 5CPJD 3REHB 4XUJC 1M18B 3X1SC 3WA9C 1BH9A 1KX3A 5B2JD 3W99D 4WU8C 2NZDC 1P3GA 1P3BB 4J8UD 1P3AD 3VH6W 4CSRA 5B31B 5B32C 5AVBB 4KGCB 3AV1D 1HQ3D 1ZLAB 5B1LD 3V9RB 3B6GD 2AROA 4CAYB 3UTBB 3X1SA 5GSUC 3WA9A 4WU8A 3REJC 1TZYD 5C3IC 4XZQB 3A6ND 2NZDA 4Z66D 2HIOD 2BYMA 5KDMA 4HGAB 4YM6D 2JSSA 2Y2OA 1KX4D 4EO5B 3VH6T 4DQYB 1KX5B 3REHD 3LZ0D 3MGPD 4KUDA 3MVDB 1P3PC 2NQBC 3KWQB 4XUJB 4R8PA 3KUYC 3NQJB 5AY8D 3AZJD 5GSUA 4H9OB 4WU9B 5B32B 3AYWC 5E5AB 1AOID 1P34D 2NQBA 2G5HC 3H0MC 3EPHA 3KUYA 1WWSA 3AZHD 2W8SA 3EPKA 4WZSB 3REJB 5C3IB 3AZMC 3A1IA 4ZBJC 3MNND 5CPID 1P3MD 1M19C 3W97D 3LJAB 3AFAB 1M18D
chains in the Genus database with same CATH topology
2UWXA 3AYWA 5CP6A 1P3PB 3WAAB 5AVCC 4X23B 3REIA 2CV5C 3W96C 1P3BD 5F99C 2ZM5A 3MGRC 4Z5TB 4NE5A 5B31D 3EPLA 5AVBD 4KGCD 1P3KC 1M19A 3AYWB 5BNVA 1BH8B 4NE6A 4QLCB 1M1AA 1ZLAD 3UTBD 5G49A 1P3FC 5AVCA 3A1KA 5BNXB 4XZQD 5AV8B 5AV6C 3AZMB 1KX5D 2Y2IA 3MGRA 3TU4C 1EQZB 1TAFB 4KHAB 3MVDD 1F66A 3KWQD 1Q9CA 4XUJD 4M6BA 4AWLC 2CV5B 3AZFC 3W96B 1P3FA 5F99B 3MGSB 4JJNB 3RELC 4WU9D 5B0YC 3MGRB 4NFTA 3AZLB 4G92C 5B32D 5AV6A 3X1VA 4H9PA 5E5AD 3MGQA 3R45A 3AZEC 2F8NG 1P3KB 5DNNB 5BT1D 3UTAC 3C1BC 3REKA 4YS3C 1KU5A 1JFIA 2FJ7C 4UUZA 1S32A 3AZFA 3REJD 5B1MC 5B0ZC 4Z2MH 3AZKC 2JCHA 3LJAD 5FUGA 5B0YA 3TU4B 1ID3C 3AFAD 2VQRA 3LELC 3KFUG 4J8VC 1P3PD 3WAAD 2DF4C 4X23D 1KX3C 2XD1A 4LD9C 4UUZB 3UTAA 4AWLB 3WTPB 1P3OB 4H9SC 2FJ7A 4Z5TD 3RELB 5B1MA 3O62B 3B6FB 3X1TC 3AZKA 3AYWD 4QLCD 3AZEB 3UT9C 3KXBB 2PYOA 3WKJA 3FDDA 3C1BB 3LELA 2YFVB 4G91B 4J8VA 4YS3B 4WJ3C 4LD9A 5AV8D 5AV5C 3AZMD 5B0ZB 4H9SA 1EQZD 4DRAA 3AZIB 5GT3B 2Y2JA 2BYKB 4KUDC 1ID3B 3LELB 3X1TA 4R8PC 3UT9A 2CV5D 5GT0C 3W98C 1BH9B 2LY8A 2Y2NA 1KX3B 3W96D 1P3GB 5JRGC 5F99D 3MGSD 4JJND 2Y2GA 1PZRA 3AZLD 5B40A 3MGRD 3X1UC 5JA4A 5AV5A 4CSRB 5GXQC 1P3KD 5DNND 2ZY4A 5CHLB 3AZGA 2CWEA 2Y2MA 2AROB 2HUEC 3X1SB 5GT0A 3WA9B 3W98A 4ZUXC 5B33C 4WU8B 2NZDB 4J8XC 5JRGA 2BYMB 5KDMB 3TU4D 3X1UA 5GXQA 4KUDB 5CP6C 3AN2C 4WV4B 3P5JB 3REIC 4R8PB 3WTPD 3C1CA 4H9NA 5B24C 1P3OD 1HTAA 5DNMC 5CPKC 5GSUB 3RELD 1H3OA 5B33A 4ZUXA 3O62D 3X1UB 3B6FD 4J8XA 3AZED 1P3IC 5B2IC 3KXBD 1M1AC 5B31G 3AZNC 3IP4C 3C1BD 1P3LC 2NQBB 4YS3D 3AN2A 1F1EA 3KUYB 1U35C 2ZY2A 2Y2PA 5B24A 4ZUXB 5B0ZD 5DNMA 5CPKA 3AZID 4J8WC 5GT3D 4WNNA 5CPJC 1ID3D 1F66C 3LELD 5B2JC 1P3IA 3W99C 5B2IA 3NQUA 5CP6B 3VH5A 3AZNA 1KX3D 1N1JA 4UPKA 3REIB 3H0RC 1P3LA 1P3GD 1P3AC 5DNMB 1U35A 3AV2A 3AV1C 3F6TA 3X1VC 3MGQC 4ZBJB 4J8WA 1M19B 3B6GC 5BNVB 5CPJA 3KSYA 1M1AB 5B32G 3EPJA 2AROD 3REKC 5B2JA 3W99A 3X1SD 5G49B 1TZYC 1S32C 4H9RA 3B0CW 5AVCB 3WA9D 2HIOC 3VH5W 4WU8D 2NZDD 4YM6C 4J8UA 1KX4C 1P3AA 4H9QA 3WTPE 3MGPC 1A7WA 3AV1A 1HQ3A 4KUDD 1F66B 5B1LA 4R8PD 3B6GA 4DRBA 5AY8C 3AZJC 3B0CT 5GSUD 1TZYA 3A6NA 1P3FB 3VH5T 4Z66A 2HIOA 3X1UD 2J8PA 4YM6A 1KX4A 2IO5C 5AV6B 3X1VB 2DQNC 4H9PB 3LZ0A 3R45B 3MGPA 3MGQB 2PYOC 3WKJC 2NQBD 1BFMA 3REKB 2XD5A 3AZHC 3KUYD 1JFIB 2Y2HA 5AY8A 1S32B 3AZJA 4ZUXD 3MNNC 3AZFB 1P3MC 5CPIC 2L5AA 3H0LC 5BO0A 5FUGB 5B0YB 1Z2CB 4G92B 1AOIA 5CP6D 1P34A 3REID 3UTAB 5DNMD 5B31C 3AZHA 5B40C 2FJ7B 4KGCC 3MNNA 1P3MA 5CPIA 5B1MB 3W97A 1M19D 3AZKB 4NE3A 3REHA 3UTBC 1M1AD 1M18A 2PYOB 3WKJB 3AZGC 2BG1A 4J8VB 5AVCD 1P3BA 4LD9B 4HGAC 4EO5C 5B31A 5BS7A 5AVBA 4KGCA 3KWQC 1F66D 1ZLAA 3V9RA 3X1TB 4CAYA 3UTBA 3UT9B 2Y2LA 3C1CC 3AL0C 4WU9C 2F8NK 4XZQA 1P3FD 5B40B 5E5AC 3EG5B 5JA4B 1KX5A 5AV5B 5AV6D 3X1VD 5BT1C 3MGQD 2Y2KA 3MVDA 3KWQA 4XUJA 1W2EA 3AZGB 3NQJA 3REKD 2F8NH 1S32D 5GT0B 3W98B 3AZFD 4H9OA 4WU9A 3LJAC 5AV9C 5JRGB 3AFAC 5B32A 5B0YD 3WAAC 5E5AA 1B6WA 4X23C 5GXQB 4Z2MG 3UTAD 3LZ1C 3C1CB 4E45A 4H9NB 4Z5TC 2HUEB 3REJA 2FJ7D 3AV2C 2F8NA 1H3OB 5B33B 2RVQC 5B1MD 4QLCC 3LJAA 5AV9A 4J8XB 3AZKD 3AFAA 2PYOD 3WKJD 1P3PA 3WAAA 4X23A 4J8VD 3AN2B 5AV8C 4LD9D 3LZ1A 2ZY3A 4J8UC 1EQZC 2F8NB 4Z5TA 5B24B 2FFFB 5AV9B 2YFWA 5CPKB 4WNNB 1HQ3C 1BH8A 4QLCA 3X1TD 1ULYA 5B1LC 1P3IB 3NQUB 5B2IB 3UT9D 3AZNB 1N1JB 3MGSC 3LZ1B 4JJNC 1P3LB 3AZLC 3B0BA 5BNXA 3A6NC 5AV8A 2YFWB 5B40D 4Z66C 3AZMA 1U35B 3AV2B 5AV5D 1EQZA 5DNNC 1TAFA 3LZ0C 4KHAA 4J8WB 2G5IC 5CPJB 3AZGD 2JE5A 2CV5A 3W96A 5B2JB 3W99B 5GT0D 4H9RB 3W98D 5F99A 3MGSA 4JJNA 4J8UB 3AZLA 3B0DC 5JRGD 1P3AB 4H9QB 1P3KA 5DNNA 5GXQD 3AV1B 1HQ3B 1AOIC 3WTPC 1P34C 5B1LB 1P3OC 3B6GB 3C1CD 1WWIA 3O62C 4E44A 1TZYB 3A6NB 3B6FC 2ZY5A 4Z66B 2HIOB 5B33D 3KXBC 4YM6B 4J8XD 3W97C 3TU4A 1KX4B 3LZ0B 2Y2QA 3REHC 4G91C 3MGPB 1M18C 1R4VA 3AN2D 3WTPA 1T3UA 1P3OA 5AY8B 2F2AC 1P3BC 3AZJB 2F8ND 5B24D 3AZIC 5GT3C 3RELA 5AV9D 5CPKD 3B0DB 3O62A 2RIQA 5BS7C 5AVBC 3B6FA 1B67A 5BO0B 3AZEA 3KXBA 1ZLAC 2IO5B 1P3ID 1AOIB 5B2ID 3C1BA 3AZND 2YFVA 1P34B 1P3GC 3LZ1D 4YS3A 1P3LD 3VH6A 4XZQC 3AZHB 1U35D 5B0ZA 3AV2D 1KX5C 3AZIA 2RVQD 3MNNB 5GT3A 5CPIB 1P3MB 2BYKA 3W97B 1ID3A 3MVDC 4J8WD 2AROC 5CPJD 3REHB 4XUJC 1M18B 3X1SC 3WA9C 1BH9A 1KX3A 5B2JD 3W99D 4WU8C 2NZDC 1P3GA 1P3BB 4J8UD 1P3AD 3VH6W 4CSRA 5B31B 5B32C 5AVBB 4KGCB 3AV1D 1HQ3D 1ZLAB 5B1LD 3V9RB 3B6GD 2AROA 4CAYB 3UTBB 3X1SA 5GSUC 3WA9A 4WU8A 3REJC 1TZYD 5C3IC 4XZQB 3A6ND 2NZDA 4Z66D 2HIOD 2BYMA 5KDMA 4HGAB 4YM6D 2JSSA 2Y2OA 1KX4D 4EO5B 3VH6T 4DQYB 1KX5B 3REHD 3LZ0D 3MGPD 4KUDA 3MVDB 1P3PC 2NQBC 3KWQB 4XUJB 4R8PA 3KUYC 3NQJB 5AY8D 3AZJD 5GSUA 4H9OB 4WU9B 5B32B 3AYWC 5E5AB 1AOID 1P34D 2NQBA 2G5HC 3H0MC 3EPHA 3KUYA 1WWSA 3AZHD 2W8SA 3EPKA 4WZSB 3REJB 5C3IB 3AZMC 3A1IA 4ZBJC 3MNND 5CPID 1P3MD 1M19C 3W97D 3LJAB 3AFAB 1M18D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW A;  5CP6 A;  1P3P B;  3WAA B;  5AVC C;  4X23 B;  3REI A;  2CV5 C;  3W96 C;  1P3B D;  5F99 C;  3MGR C;  4Z5T B;  4NE5 A;  5B31 D;  5AVB D;  4KGC D;  1P3K C;  1M19 A;  3AYW B;  5BNV A;  1BH8 B;  4NE6 A;  4QLC B;  1M1A A;  1ZLA D;  3UTB D;  5G49 A;  1P3F C;  5AVC A;  5BNX B;  4XZQ D;  5AV8 B;  5AV6 C;  3AZM B;  1KX5 D;  3MGR A;  1EQZ B;  3TU4 C;  1TAF B;  4KHA B;  3MVD D;  1F66 A;  3KWQ D;  1Q9C A;  4XUJ D;  4M6B A;  4AWL C;  2CV5 B;  3AZF C;  3W96 B;  1P3F A;  5F99 B;  3MGS B;  4JJN B;  3REL C;  4WU9 D;  5B0Y C;  3MGR B;  4NFT A;  3AZL B;  4G92 C;  5B32 D;  5AV6 A;  3X1V A;  4H9P A;  5E5A D;  3MGQ A;  3R45 A;  3AZE C;  2F8N G;  1P3K B;  5DNN B;  5BT1 D;  3UTA C;  3C1B C;  3REK A;  4YS3 C;  1KU5 A;  1JFI A;  2FJ7 C;  4UUZ A;  1S32 A;  3AZF A;  3REJ D;  5B1M C;  5B0Z C;  4Z2M H;  3AZK C;  3LJA D;  5FUG A;  5B0Y A;  3TU4 B;  1ID3 C;  3AFA D;  3LEL C;  4J8V C;  1P3P D;  3WAA D;  4X23 D;  1KX3 C;  4LD9 C;  4UUZ B;  3UTA A;  4AWL B;  3WTP B;  1P3O B;  4H9S C;  2FJ7 A;  4Z5T D;  3REL B;  5B1M A;  3O62 B;  3B6F B;  3X1T C;  3AZK A;  3AYW D;  4QLC D;  3AZE B;  3UT9 C;  3KXB B;  2PYO A;  3WKJ A;  3C1B B;  3LEL A;  2YFV B;  4G91 B;  4J8V A;  4YS3 B;  4LD9 A;  5AV8 D;  5AV5 C;  3AZM D;  5B0Z B;  4H9S A;  1EQZ D;  4DRA A;  3AZI B;  5GT3 B;  2BYK B;  4KUD C;  1ID3 B;  3LEL B;  3X1T A;  4R8P C;  3UT9 A;  2CV5 D;  5GT0 C;  3W98 C;  1BH9 B;  2LY8 A;  1KX3 B;  3W96 D;  1P3G B;  5JRG C;  5F99 D;  3MGS D;  4JJN D;  3AZL D;  5B40 A;  3MGR D;  3X1U C;  5JA4 A;  5AV5 A;  4CSR B;  5GXQ C;  1P3K D;  5DNN D;  5CHL B;  3AZG A;  2CWE A;  2ARO B;  2HUE C;  3X1S B;  5GT0 A;  3WA9 B;  3W98 A;  4ZUX C;  5B33 C;  4WU8 B;  2NZD B;  4J8X C;  5JRG A;  2BYM B;  5KDM B;  3TU4 D;  3X1U A;  5GXQ A;  4KUD B;  5CP6 C;  3AN2 C;  4WV4 B;  3REI C;  4R8P B;  3WTP D;  3C1C A;  4H9N A;  5B24 C;  1P3O D;  1HTA A;  5DNM C;  5CPK C;  5GSU B;  3REL D;  1H3O A;  5B33 A;  4ZUX A;  3O62 D;  3X1U B;  3B6F D;  4J8X A;  3AZE D;  1P3I C;  5B2I C;  3KXB D;  1M1A C;  5B31 G;  3AZN C;  3C1B D;  1P3L C;  2NQB B;  4YS3 D;  3AN2 A;  1F1E A;  3KUY B;  1U35 C;  5B24 A;  4ZUX B;  5B0Z D;  5DNM A;  5CPK A;  3AZI D;  4J8W C;  5GT3 D;  4WNN A;  5CPJ C;  1ID3 D;  1F66 C;  3LEL D;  5B2J C;  1P3I A;  3W99 C;  3NQU A;  5CP6 B;  5B2I A;  3VH5 A;  3AZN A;  1KX3 D;  1N1J A;  3REI B;  1P3L A;  1P3G D;  1P3A C;  5DNM B;  1U35 A;  3AV2 A;  3AV1 C;  3X1V C;  3MGQ C;  4ZBJ B;  4J8W A;  1M19 B;  3B6G C;  5BNV B;  5CPJ A;  3KSY A;  1M1A B;  5B32 G;  2ARO D;  3REK C;  5B2J A;  3W99 A;  3X1S D;  5G49 B;  1TZY C;  1S32 C;  4H9R A;  3B0C W;  5AVC B;  3WA9 D;  2HIO C;  3VH5 W;  4WU8 D;  2NZD D;  4YM6 C;  4J8U A;  1KX4 C;  1P3A A;  4H9Q A;  3WTP E;  3MGP C;  1A7W A;  3AV1 A;  1HQ3 A;  4KUD D;  1F66 B;  5B1L A;  4R8P D;  3B6G A;  4DRB A;  5AY8 C;  3AZJ C;  3B0C T;  5GSU D;  1TZY A;  3A6N A;  1P3F B;  3VH5 T;  4Z66 A;  2HIO A;  3X1U D;  4YM6 A;  1KX4 A;  2IO5 C;  5AV6 B;  3X1V B;  4H9P B;  3LZ0 A;  3MGQ B;  3R45 B;  3MGP A;  2PYO C;  3WKJ C;  2NQB D;  1BFM A;  3REK B;  3AZH C;  3KUY D;  1JFI B;  5AY8 A;  1S32 B;  3AZJ A;  4ZUX D;  3MNN C;  3AZF B;  1P3M C;  5CPI C;  2L5A A;  5BO0 A;  5FUG B;  5B0Y B;  4G92 B;  1AOI A;  5CP6 D;  1P34 A;  3REI D;  3UTA B;  5DNM D;  5B31 C;  3AZH A;  5B40 C;  2FJ7 B;  4KGC C;  3MNN A;  1P3M A;  5CPI A;  5B1M B;  3W97 A;  1M19 D;  3AZK B;  4NE3 A;  3REH A;  3UTB C;  1M1A D;  1M18 A;  2PYO B;  3WKJ B;  3AZG C;  4J8V B;  5AVC D;  1P3B A;  4LD9 B;  4HGA C;  4EO5 C;  5B31 A;  5BS7 A;  5AVB A;  4KGC A;  3KWQ C;  1F66 D;  1ZLA A;  3V9R A;  3X1T B;  4CAY A;  3UTB A;  3UT9 B;  3C1C C;  4WU9 C;  2F8N K;  4XZQ A;  1P3F D;  5B40 B;  5E5A C;  5JA4 B;  1KX5 A;  5AV5 B;  5AV6 D;  3X1V D;  5BT1 C;  3MGQ D;  3MVD A;  3KWQ A;  4XUJ A;  3AZG B;  3NQJ A;  3REK D;  2F8N H;  1S32 D;  5GT0 B;  3W98 B;  3AZF D;  4H9O A;  4WU9 A;  3LJA C;  5AV9 C;  5JRG B;  3AFA C;  5B32 A;  5B0Y D;  3WAA C;  5E5A A;  1B6W A;  4X23 C;  5GXQ B;  4Z2M G;  3UTA D;  3LZ1 C;  3C1C B;  4E45 A;  4H9N B;  4Z5T C;  2HUE B;  3REJ A;  2FJ7 D;  3AV2 C;  2F8N A;  1H3O B;  5B33 B;  2RVQ C;  5B1M D;  4QLC C;  3LJA A;  5AV9 A;  4J8X B;  3AZK D;  3AFA A;  2PYO D;  3WKJ D;  1P3P A;  3WAA A;  4X23 A;  4J8V D;  3AN2 B;  5AV8 C;  4LD9 D;  3LZ1 A;  4J8U C;  1EQZ C;  2F8N B;  4Z5T A;  5B24 B;  5AV9 B;  2YFW A;  5CPK B;  4WNN B;  1HQ3 C;  1BH8 A;  4QLC A;  3X1T D;  1ULY A;  5B1L C;  1P3I B;  3NQU B;  5B2I B;  3UT9 D;  3AZN B;  1N1J B;  3MGS C;  3LZ1 B;  4JJN C;  1P3L B;  3AZL C;  3B0B A;  5BNX A;  3A6N C;  5AV8 A;  2YFW B;  5B40 D;  4Z66 C;  3AZM A;  1U35 B;  3AV2 B;  5AV5 D;  1EQZ A;  5DNN C;  1TAF A;  3LZ0 C;  4KHA A;  4J8W B;  5CPJ B;  3AZG D;  2CV5 A;  3W96 A;  5B2J B;  3W99 B;  5GT0 D;  4H9R B;  3W98 D;  5F99 A;  3MGS A;  4JJN A;  4J8U B;  3AZL A;  3B0D C;  5JRG D;  1P3A B;  4H9Q B;  1P3K A;  5DNN A;  5GXQ D;  3AV1 B;  1HQ3 B;  1AOI C;  3WTP C;  1P34 C;  5B1L B;  1P3O C;  3B6G B;  3C1C D;  1WWI A;  3O62 C;  4E44 A;  1TZY B;  3A6N B;  3B6F C;  4Z66 B;  2HIO B;  5B33 D;  3KXB C;  4YM6 B;  4J8X D;  3W97 C;  3TU4 A;  1KX4 B;  3LZ0 B;  3REH C;  4G91 C;  3MGP B;  1M18 C;  1R4V A;  3AN2 D;  3WTP A;  1P3O A;  5AY8 B;  1P3B C;  3AZJ B;  2F8N D;  5B24 D;  3AZI C;  5GT3 C;  3REL A;  5AV9 D;  5CPK D;  3B0D B;  3O62 A;  5BS7 C;  5AVB C;  3B6F A;  1B67 A;  5BO0 B;  3AZE A;  3KXB A;  1ZLA C;  2IO5 B;  1P3I D;  1AOI B;  5B2I D;  3C1B A;  3AZN D;  2YFV A;  1P34 B;  1P3G C;  3LZ1 D;  4YS3 A;  1P3L D;  3VH6 A;  4XZQ C;  3AZH B;  1U35 D;  5B0Z A;  3AV2 D;  1KX5 C;  3AZI A;  2RVQ D;  3MNN B;  5GT3 A;  5CPI B;  1P3M B;  2BYK A;  3W97 B;  1ID3 A;  3MVD C;  4J8W D;  2ARO C;  5CPJ D;  3REH B;  4XUJ C;  1M18 B;  3X1S C;  3WA9 C;  1BH9 A;  1KX3 A;  5B2J D;  3W99 D;  4WU8 C;  2NZD C;  1P3G A;  1P3B B;  4J8U D;  1P3A D;  3VH6 W;  4CSR A;  5B31 B;  5B32 C;  5AVB B;  4KGC B;  3AV1 D;  1HQ3 D;  1ZLA B;  5B1L D;  3V9R B;  3B6G D;  2ARO A;  4CAY B;  3UTB B;  3X1S A;  5GSU C;  3WA9 A;  4WU8 A;  3REJ C;  1TZY D;  5C3I C;  4XZQ B;  3A6N D;  2NZD A;  4Z66 D;  2HIO D;  2BYM A;  5KDM A;  4HGA B;  4YM6 D;  2JSS A;  1KX4 D;  4EO5 B;  3VH6 T;  1KX5 B;  3REH D;  3LZ0 D;  3MGP D;  4KUD A;  3MVD B;  1P3P C;  2NQB C;  3KWQ B;  4XUJ B;  4R8P A;  3KUY C;  3NQJ B;  5AY8 D;  3AZJ D;  5GSU A;  4H9O B;  4WU9 B;  5B32 B;  3AYW C;  5E5A B;  1AOI D;  1P34 D;  2NQB A;  3KUY A;  1WWS A;  3AZH D;  4WZS B;  3REJ B;  5C3I B;  3AZM C;  3MNN D;  4ZBJ C;  1P3M D;  5CPI D;  1M19 C;  3W97 D;  3LJA B;  3AFA B;  1M18 D; 
#chains in the Genus database with same CATH topology
 2UWX A;  3AYW A;  5CP6 A;  1P3P B;  3WAA B;  5AVC C;  4X23 B;  3REI A;  2CV5 C;  3W96 C;  1P3B D;  5F99 C;  2ZM5 A;  3MGR C;  4Z5T B;  4NE5 A;  5B31 D;  3EPL A;  5AVB D;  4KGC D;  1P3K C;  1M19 A;  3AYW B;  5BNV A;  1BH8 B;  4NE6 A;  4QLC B;  1M1A A;  1ZLA D;  3UTB D;  5G49 A;  1P3F C;  5AVC A;  3A1K A;  5BNX B;  4XZQ D;  5AV8 B;  5AV6 C;  3AZM B;  1KX5 D;  2Y2I A;  3MGR A;  3TU4 C;  1EQZ B;  1TAF B;  4KHA B;  3MVD D;  1F66 A;  3KWQ D;  1Q9C A;  4XUJ D;  4M6B A;  4AWL C;  2CV5 B;  3AZF C;  3W96 B;  1P3F A;  5F99 B;  3MGS B;  4JJN B;  3REL C;  4WU9 D;  5B0Y C;  3MGR B;  4NFT A;  3AZL B;  4G92 C;  5B32 D;  5AV6 A;  3X1V A;  4H9P A;  5E5A D;  3MGQ A;  3R45 A;  3AZE C;  2F8N G;  1P3K B;  5DNN B;  5BT1 D;  3UTA C;  3C1B C;  3REK A;  4YS3 C;  1KU5 A;  1JFI A;  2FJ7 C;  4UUZ A;  1S32 A;  3AZF A;  3REJ D;  5B1M C;  5B0Z C;  4Z2M H;  3AZK C;  2JCH A;  3LJA D;  5FUG A;  5B0Y A;  3TU4 B;  1ID3 C;  3AFA D;  2VQR A;  3LEL C;  3KFU G;  4J8V C;  1P3P D;  3WAA D;  2DF4 C;  4X23 D;  1KX3 C;  2XD1 A;  4LD9 C;  4UUZ B;  3UTA A;  4AWL B;  3WTP B;  1P3O B;  4H9S C;  2FJ7 A;  4Z5T D;  3REL B;  5B1M A;  3O62 B;  3B6F B;  3X1T C;  3AZK A;  3AYW D;  4QLC D;  3AZE B;  3UT9 C;  3KXB B;  2PYO A;  3WKJ A;  3FDD A;  3C1B B;  3LEL A;  2YFV B;  4G91 B;  4J8V A;  4YS3 B;  4WJ3 C;  4LD9 A;  5AV8 D;  5AV5 C;  3AZM D;  5B0Z B;  4H9S A;  1EQZ D;  4DRA A;  3AZI B;  5GT3 B;  2Y2J A;  2BYK B;  4KUD C;  1ID3 B;  3LEL B;  3X1T A;  4R8P C;  3UT9 A;  2CV5 D;  5GT0 C;  3W98 C;  1BH9 B;  2LY8 A;  2Y2N A;  1KX3 B;  3W96 D;  1P3G B;  5JRG C;  5F99 D;  3MGS D;  4JJN D;  2Y2G A;  1PZR A;  3AZL D;  5B40 A;  3MGR D;  3X1U C;  5JA4 A;  5AV5 A;  4CSR B;  5GXQ C;  1P3K D;  5DNN D;  2ZY4 A;  5CHL B;  3AZG A;  2CWE A;  2Y2M A;  2ARO B;  2HUE C;  3X1S B;  5GT0 A;  3WA9 B;  3W98 A;  4ZUX C;  5B33 C;  4WU8 B;  2NZD B;  4J8X C;  5JRG A;  2BYM B;  5KDM B;  3TU4 D;  3X1U A;  5GXQ A;  4KUD B;  5CP6 C;  3AN2 C;  4WV4 B;  3P5J B;  3REI C;  4R8P B;  3WTP D;  3C1C A;  4H9N A;  5B24 C;  1P3O D;  1HTA A;  5DNM C;  5CPK C;  5GSU B;  3REL D;  1H3O A;  5B33 A;  4ZUX A;  3O62 D;  3X1U B;  3B6F D;  4J8X A;  3AZE D;  1P3I C;  5B2I C;  3KXB D;  1M1A C;  5B31 G;  3AZN C;  3IP4 C;  3C1B D;  1P3L C;  2NQB B;  4YS3 D;  3AN2 A;  1F1E A;  3KUY B;  1U35 C;  2ZY2 A;  2Y2P A;  5B24 A;  4ZUX B;  5B0Z D;  5DNM A;  5CPK A;  3AZI D;  4J8W C;  5GT3 D;  4WNN A;  5CPJ C;  1ID3 D;  1F66 C;  3LEL D;  5B2J C;  1P3I A;  3W99 C;  5B2I A;  3NQU A;  5CP6 B;  3VH5 A;  3AZN A;  1KX3 D;  1N1J A;  4UPK A;  3REI B;  3H0R C;  1P3L A;  1P3G D;  1P3A C;  5DNM B;  1U35 A;  3AV2 A;  3AV1 C;  3F6T A;  3X1V C;  3MGQ C;  4ZBJ B;  4J8W A;  1M19 B;  3B6G C;  5BNV B;  5CPJ A;  3KSY A;  1M1A B;  5B32 G;  3EPJ A;  2ARO D;  3REK C;  5B2J A;  3W99 A;  3X1S D;  5G49 B;  1TZY C;  1S32 C;  4H9R A;  3B0C W;  5AVC B;  3WA9 D;  2HIO C;  3VH5 W;  4WU8 D;  2NZD D;  4YM6 C;  4J8U A;  1KX4 C;  1P3A A;  4H9Q A;  3WTP E;  3MGP C;  1A7W A;  3AV1 A;  1HQ3 A;  4KUD D;  1F66 B;  5B1L A;  4R8P D;  3B6G A;  4DRB A;  5AY8 C;  3AZJ C;  3B0C T;  5GSU D;  1TZY A;  3A6N A;  1P3F B;  3VH5 T;  4Z66 A;  2HIO A;  3X1U D;  2J8P A;  4YM6 A;  1KX4 A;  2IO5 C;  5AV6 B;  3X1V B;  2DQN C;  4H9P B;  3LZ0 A;  3R45 B;  3MGP A;  3MGQ B;  2PYO C;  3WKJ C;  2NQB D;  1BFM A;  3REK B;  2XD5 A;  3AZH C;  3KUY D;  1JFI B;  2Y2H A;  5AY8 A;  1S32 B;  3AZJ A;  4ZUX D;  3MNN C;  3AZF B;  1P3M C;  5CPI C;  2L5A A;  3H0L C;  5BO0 A;  5FUG B;  5B0Y B;  1Z2C B;  4G92 B;  1AOI A;  5CP6 D;  1P34 A;  3REI D;  3UTA B;  5DNM D;  5B31 C;  3AZH A;  5B40 C;  2FJ7 B;  4KGC C;  3MNN A;  1P3M A;  5CPI A;  5B1M B;  3W97 A;  1M19 D;  3AZK B;  4NE3 A;  3REH A;  3UTB C;  1M1A D;  1M18 A;  2PYO B;  3WKJ B;  3AZG C;  2BG1 A;  4J8V B;  5AVC D;  1P3B A;  4LD9 B;  4HGA C;  4EO5 C;  5B31 A;  5BS7 A;  5AVB A;  4KGC A;  3KWQ C;  1F66 D;  1ZLA A;  3V9R A;  3X1T B;  4CAY A;  3UTB A;  3UT9 B;  2Y2L A;  3C1C C;  3AL0 C;  4WU9 C;  2F8N K;  4XZQ A;  1P3F D;  5B40 B;  5E5A C;  3EG5 B;  5JA4 B;  1KX5 A;  5AV5 B;  5AV6 D;  3X1V D;  5BT1 C;  3MGQ D;  2Y2K A;  3MVD A;  3KWQ A;  4XUJ A;  1W2E A;  3AZG B;  3NQJ A;  3REK D;  2F8N H;  1S32 D;  5GT0 B;  3W98 B;  3AZF D;  4H9O A;  4WU9 A;  3LJA C;  5AV9 C;  5JRG B;  3AFA C;  5B32 A;  5B0Y D;  3WAA C;  5E5A A;  1B6W A;  4X23 C;  5GXQ B;  4Z2M G;  3UTA D;  3LZ1 C;  3C1C B;  4E45 A;  4H9N B;  4Z5T C;  2HUE B;  3REJ A;  2FJ7 D;  3AV2 C;  2F8N A;  1H3O B;  5B33 B;  2RVQ C;  5B1M D;  4QLC C;  3LJA A;  5AV9 A;  4J8X B;  3AZK D;  3AFA A;  2PYO D;  3WKJ D;  1P3P A;  3WAA A;  4X23 A;  4J8V D;  3AN2 B;  5AV8 C;  4LD9 D;  3LZ1 A;  2ZY3 A;  4J8U C;  1EQZ C;  2F8N B;  4Z5T A;  5B24 B;  2FFF B;  5AV9 B;  2YFW A;  5CPK B;  4WNN B;  1HQ3 C;  1BH8 A;  4QLC A;  3X1T D;  1ULY A;  5B1L C;  1P3I B;  3NQU B;  5B2I B;  3UT9 D;  3AZN B;  1N1J B;  3MGS C;  3LZ1 B;  4JJN C;  1P3L B;  3AZL C;  3B0B A;  5BNX A;  3A6N C;  5AV8 A;  2YFW B;  5B40 D;  4Z66 C;  3AZM A;  1U35 B;  3AV2 B;  5AV5 D;  1EQZ A;  5DNN C;  1TAF A;  3LZ0 C;  4KHA A;  4J8W B;  2G5I C;  5CPJ B;  3AZG D;  2JE5 A;  2CV5 A;  3W96 A;  5B2J B;  3W99 B;  5GT0 D;  4H9R B;  3W98 D;  5F99 A;  3MGS A;  4JJN A;  4J8U B;  3AZL A;  3B0D C;  5JRG D;  1P3A B;  4H9Q B;  1P3K A;  5DNN A;  5GXQ D;  3AV1 B;  1HQ3 B;  1AOI C;  3WTP C;  1P34 C;  5B1L B;  1P3O C;  3B6G B;  3C1C D;  1WWI A;  3O62 C;  4E44 A;  1TZY B;  3A6N B;  3B6F C;  2ZY5 A;  4Z66 B;  2HIO B;  5B33 D;  3KXB C;  4YM6 B;  4J8X D;  3W97 C;  3TU4 A;  1KX4 B;  3LZ0 B;  2Y2Q A;  3REH C;  4G91 C;  3MGP B;  1M18 C;  1R4V A;  3AN2 D;  3WTP A;  1T3U A;  1P3O A;  5AY8 B;  2F2A C;  1P3B C;  3AZJ B;  2F8N D;  5B24 D;  3AZI C;  5GT3 C;  3REL A;  5AV9 D;  5CPK D;  3B0D B;  3O62 A;  2RIQ A;  5BS7 C;  5AVB C;  3B6F A;  1B67 A;  5BO0 B;  3AZE A;  3KXB A;  1ZLA C;  2IO5 B;  1P3I D;  1AOI B;  5B2I D;  3C1B A;  3AZN D;  2YFV A;  1P34 B;  1P3G C;  3LZ1 D;  4YS3 A;  1P3L D;  3VH6 A;  4XZQ C;  3AZH B;  1U35 D;  5B0Z A;  3AV2 D;  1KX5 C;  3AZI A;  2RVQ D;  3MNN B;  5GT3 A;  5CPI B;  1P3M B;  2BYK A;  3W97 B;  1ID3 A;  3MVD C;  4J8W D;  2ARO C;  5CPJ D;  3REH B;  4XUJ C;  1M18 B;  3X1S C;  3WA9 C;  1BH9 A;  1KX3 A;  5B2J D;  3W99 D;  4WU8 C;  2NZD C;  1P3G A;  1P3B B;  4J8U D;  1P3A D;  3VH6 W;  4CSR A;  5B31 B;  5B32 C;  5AVB B;  4KGC B;  3AV1 D;  1HQ3 D;  1ZLA B;  5B1L D;  3V9R B;  3B6G D;  2ARO A;  4CAY B;  3UTB B;  3X1S A;  5GSU C;  3WA9 A;  4WU8 A;  3REJ C;  1TZY D;  5C3I C;  4XZQ B;  3A6N D;  2NZD A;  4Z66 D;  2HIO D;  2BYM A;  5KDM A;  4HGA B;  4YM6 D;  2JSS A;  2Y2O A;  1KX4 D;  4EO5 B;  3VH6 T;  4DQY B;  1KX5 B;  3REH D;  3LZ0 D;  3MGP D;  4KUD A;  3MVD B;  1P3P C;  2NQB C;  3KWQ B;  4XUJ B;  4R8P A;  3KUY C;  3NQJ B;  5AY8 D;  3AZJ D;  5GSU A;  4H9O B;  4WU9 B;  5B32 B;  3AYW C;  5E5A B;  1AOI D;  1P34 D;  2NQB A;  2G5H C;  3H0M C;  3EPH A;  3KUY A;  1WWS A;  3AZH D;  2W8S A;  3EPK A;  4WZS B;  3REJ B;  5C3I B;  3AZM C;  3A1I A;  4ZBJ C;  3MNN D;  5CPI D;  1P3M D;  1M19 C;  3W97 D;  3LJA B;  3AFA B;  1M18 D; 
#chains in the Genus database with same CATH homology
 2UWX A;  3AYW A;  5CP6 A;  1P3P B;  3WAA B;  5AVC C;  4X23 B;  3REI A;  2CV5 C;  3W96 C;  1P3B D;  5F99 C;  2ZM5 A;  3MGR C;  4Z5T B;  4NE5 A;  5B31 D;  3EPL A;  5AVB D;  4KGC D;  1P3K C;  1M19 A;  3AYW B;  5BNV A;  1BH8 B;  4NE6 A;  4QLC B;  1M1A A;  1ZLA D;  3UTB D;  5G49 A;  1P3F C;  5AVC A;  3A1K A;  5BNX B;  4XZQ D;  5AV8 B;  5AV6 C;  3AZM B;  1KX5 D;  2Y2I A;  3MGR A;  3TU4 C;  1EQZ B;  1TAF B;  4KHA B;  3MVD D;  1F66 A;  3KWQ D;  1Q9C A;  4XUJ D;  4M6B A;  4AWL C;  2CV5 B;  3AZF C;  3W96 B;  1P3F A;  5F99 B;  3MGS B;  4JJN B;  3REL C;  4WU9 D;  5B0Y C;  3MGR B;  4NFT A;  3AZL B;  4G92 C;  5B32 D;  5AV6 A;  3X1V A;  4H9P A;  5E5A D;  3MGQ A;  3R45 A;  3AZE C;  2F8N G;  1P3K B;  5DNN B;  5BT1 D;  3UTA C;  3C1B C;  3REK A;  4YS3 C;  1KU5 A;  1JFI A;  2FJ7 C;  4UUZ A;  1S32 A;  3AZF A;  3REJ D;  5B1M C;  5B0Z C;  4Z2M H;  3AZK C;  2JCH A;  3LJA D;  5FUG A;  5B0Y A;  3TU4 B;  1ID3 C;  3AFA D;  2VQR A;  3LEL C;  3KFU G;  4J8V C;  1P3P D;  3WAA D;  2DF4 C;  4X23 D;  1KX3 C;  2XD1 A;  4LD9 C;  4UUZ B;  3UTA A;  4AWL B;  3WTP B;  1P3O B;  4H9S C;  2FJ7 A;  4Z5T D;  3REL B;  5B1M A;  3O62 B;  3B6F B;  3X1T C;  3AZK A;  3AYW D;  4QLC D;  3AZE B;  3UT9 C;  3KXB B;  2PYO A;  3WKJ A;  3FDD A;  3C1B B;  3LEL A;  2YFV B;  4G91 B;  4J8V A;  4YS3 B;  4WJ3 C;  4LD9 A;  5AV8 D;  5AV5 C;  3AZM D;  5B0Z B;  4H9S A;  1EQZ D;  4DRA A;  3AZI B;  5GT3 B;  2Y2J A;  2BYK B;  4KUD C;  1ID3 B;  3LEL B;  3X1T A;  4R8P C;  3UT9 A;  2CV5 D;  5GT0 C;  3W98 C;  1BH9 B;  2LY8 A;  2Y2N A;  1KX3 B;  3W96 D;  1P3G B;  5JRG C;  5F99 D;  3MGS D;  4JJN D;  2Y2G A;  1PZR A;  3AZL D;  5B40 A;  3MGR D;  3X1U C;  5JA4 A;  5AV5 A;  4CSR B;  5GXQ C;  1P3K D;  5DNN D;  2ZY4 A;  5CHL B;  3AZG A;  2CWE A;  2Y2M A;  2ARO B;  2HUE C;  3X1S B;  5GT0 A;  3WA9 B;  3W98 A;  4ZUX C;  5B33 C;  4WU8 B;  2NZD B;  4J8X C;  5JRG A;  2BYM B;  5KDM B;  3TU4 D;  3X1U A;  5GXQ A;  4KUD B;  5CP6 C;  3AN2 C;  4WV4 B;  3P5J B;  3REI C;  4R8P B;  3WTP D;  3C1C A;  4H9N A;  5B24 C;  1P3O D;  1HTA A;  5DNM C;  5CPK C;  5GSU B;  3REL D;  1H3O A;  5B33 A;  4ZUX A;  3O62 D;  3X1U B;  3B6F D;  4J8X A;  3AZE D;  1P3I C;  5B2I C;  3KXB D;  1M1A C;  5B31 G;  3AZN C;  3IP4 C;  3C1B D;  1P3L C;  2NQB B;  4YS3 D;  3AN2 A;  1F1E A;  3KUY B;  1U35 C;  2ZY2 A;  2Y2P A;  5B24 A;  4ZUX B;  5B0Z D;  5DNM A;  5CPK A;  3AZI D;  4J8W C;  5GT3 D;  4WNN A;  5CPJ C;  1ID3 D;  1F66 C;  3LEL D;  5B2J C;  1P3I A;  3W99 C;  5B2I A;  3NQU A;  5CP6 B;  3VH5 A;  3AZN A;  1KX3 D;  1N1J A;  4UPK A;  3REI B;  3H0R C;  1P3L A;  1P3G D;  1P3A C;  5DNM B;  1U35 A;  3AV2 A;  3AV1 C;  3F6T A;  3X1V C;  3MGQ C;  4ZBJ B;  4J8W A;  1M19 B;  3B6G C;  5BNV B;  5CPJ A;  3KSY A;  1M1A B;  5B32 G;  3EPJ A;  2ARO D;  3REK C;  5B2J A;  3W99 A;  3X1S D;  5G49 B;  1TZY C;  1S32 C;  4H9R A;  3B0C W;  5AVC B;  3WA9 D;  2HIO C;  3VH5 W;  4WU8 D;  2NZD D;  4YM6 C;  4J8U A;  1KX4 C;  1P3A A;  4H9Q A;  3WTP E;  3MGP C;  1A7W A;  3AV1 A;  1HQ3 A;  4KUD D;  1F66 B;  5B1L A;  4R8P D;  3B6G A;  4DRB A;  5AY8 C;  3AZJ C;  3B0C T;  5GSU D;  1TZY A;  3A6N A;  1P3F B;  3VH5 T;  4Z66 A;  2HIO A;  3X1U D;  2J8P A;  4YM6 A;  1KX4 A;  2IO5 C;  5AV6 B;  3X1V B;  2DQN C;  4H9P B;  3LZ0 A;  3R45 B;  3MGP A;  3MGQ B;  2PYO C;  3WKJ C;  2NQB D;  1BFM A;  3REK B;  2XD5 A;  3AZH C;  3KUY D;  1JFI B;  2Y2H A;  5AY8 A;  1S32 B;  3AZJ A;  4ZUX D;  3MNN C;  3AZF B;  1P3M C;  5CPI C;  2L5A A;  3H0L C;  5BO0 A;  5FUG B;  5B0Y B;  1Z2C B;  4G92 B;  1AOI A;  5CP6 D;  1P34 A;  3REI D;  3UTA B;  5DNM D;  5B31 C;  3AZH A;  5B40 C;  2FJ7 B;  4KGC C;  3MNN A;  1P3M A;  5CPI A;  5B1M B;  3W97 A;  1M19 D;  3AZK B;  4NE3 A;  3REH A;  3UTB C;  1M1A D;  1M18 A;  2PYO B;  3WKJ B;  3AZG C;  2BG1 A;  4J8V B;  5AVC D;  1P3B A;  4LD9 B;  4HGA C;  4EO5 C;  5B31 A;  5BS7 A;  5AVB A;  4KGC A;  3KWQ C;  1F66 D;  1ZLA A;  3V9R A;  3X1T B;  4CAY A;  3UTB A;  3UT9 B;  2Y2L A;  3C1C C;  3AL0 C;  4WU9 C;  2F8N K;  4XZQ A;  1P3F D;  5B40 B;  5E5A C;  3EG5 B;  5JA4 B;  1KX5 A;  5AV5 B;  5AV6 D;  3X1V D;  5BT1 C;  3MGQ D;  2Y2K A;  3MVD A;  3KWQ A;  4XUJ A;  1W2E A;  3AZG B;  3NQJ A;  3REK D;  2F8N H;  1S32 D;  5GT0 B;  3W98 B;  3AZF D;  4H9O A;  4WU9 A;  3LJA C;  5AV9 C;  5JRG B;  3AFA C;  5B32 A;  5B0Y D;  3WAA C;  5E5A A;  1B6W A;  4X23 C;  5GXQ B;  4Z2M G;  3UTA D;  3LZ1 C;  3C1C B;  4E45 A;  4H9N B;  4Z5T C;  2HUE B;  3REJ A;  2FJ7 D;  3AV2 C;  2F8N A;  1H3O B;  5B33 B;  2RVQ C;  5B1M D;  4QLC C;  3LJA A;  5AV9 A;  4J8X B;  3AZK D;  3AFA A;  2PYO D;  3WKJ D;  1P3P A;  3WAA A;  4X23 A;  4J8V D;  3AN2 B;  5AV8 C;  4LD9 D;  3LZ1 A;  2ZY3 A;  4J8U C;  1EQZ C;  2F8N B;  4Z5T A;  5B24 B;  2FFF B;  5AV9 B;  2YFW A;  5CPK B;  4WNN B;  1HQ3 C;  1BH8 A;  4QLC A;  3X1T D;  1ULY A;  5B1L C;  1P3I B;  3NQU B;  5B2I B;  3UT9 D;  3AZN B;  1N1J B;  3MGS C;  3LZ1 B;  4JJN C;  1P3L B;  3AZL C;  3B0B A;  5BNX A;  3A6N C;  5AV8 A;  2YFW B;  5B40 D;  4Z66 C;  3AZM A;  1U35 B;  3AV2 B;  5AV5 D;  1EQZ A;  5DNN C;  1TAF A;  3LZ0 C;  4KHA A;  4J8W B;  2G5I C;  5CPJ B;  3AZG D;  2JE5 A;  2CV5 A;  3W96 A;  5B2J B;  3W99 B;  5GT0 D;  4H9R B;  3W98 D;  5F99 A;  3MGS A;  4JJN A;  4J8U B;  3AZL A;  3B0D C;  5JRG D;  1P3A B;  4H9Q B;  1P3K A;  5DNN A;  5GXQ D;  3AV1 B;  1HQ3 B;  1AOI C;  3WTP C;  1P34 C;  5B1L B;  1P3O C;  3B6G B;  3C1C D;  1WWI A;  3O62 C;  4E44 A;  1TZY B;  3A6N B;  3B6F C;  2ZY5 A;  4Z66 B;  2HIO B;  5B33 D;  3KXB C;  4YM6 B;  4J8X D;  3W97 C;  3TU4 A;  1KX4 B;  3LZ0 B;  2Y2Q A;  3REH C;  4G91 C;  3MGP B;  1M18 C;  1R4V A;  3AN2 D;  3WTP A;  1T3U A;  1P3O A;  5AY8 B;  2F2A C;  1P3B C;  3AZJ B;  2F8N D;  5B24 D;  3AZI C;  5GT3 C;  3REL A;  5AV9 D;  5CPK D;  3B0D B;  3O62 A;  2RIQ A;  5BS7 C;  5AVB C;  3B6F A;  1B67 A;  5BO0 B;  3AZE A;  3KXB A;  1ZLA C;  2IO5 B;  1P3I D;  1AOI B;  5B2I D;  3C1B A;  3AZN D;  2YFV A;  1P34 B;  1P3G C;  3LZ1 D;  4YS3 A;  1P3L D;  3VH6 A;  4XZQ C;  3AZH B;  1U35 D;  5B0Z A;  3AV2 D;  1KX5 C;  3AZI A;  2RVQ D;  3MNN B;  5GT3 A;  5CPI B;  1P3M B;  2BYK A;  3W97 B;  1ID3 A;  3MVD C;  4J8W D;  2ARO C;  5CPJ D;  3REH B;  4XUJ C;  1M18 B;  3X1S C;  3WA9 C;  1BH9 A;  1KX3 A;  5B2J D;  3W99 D;  4WU8 C;  2NZD C;  1P3G A;  1P3B B;  4J8U D;  1P3A D;  3VH6 W;  4CSR A;  5B31 B;  5B32 C;  5AVB B;  4KGC B;  3AV1 D;  1HQ3 D;  1ZLA B;  5B1L D;  3V9R B;  3B6G D;  2ARO A;  4CAY B;  3UTB B;  3X1S A;  5GSU C;  3WA9 A;  4WU8 A;  3REJ C;  1TZY D;  5C3I C;  4XZQ B;  3A6N D;  2NZD A;  4Z66 D;  2HIO D;  2BYM A;  5KDM A;  4HGA B;  4YM6 D;  2JSS A;  2Y2O A;  1KX4 D;  4EO5 B;  3VH6 T;  4DQY B;  1KX5 B;  3REH D;  3LZ0 D;  3MGP D;  4KUD A;  3MVD B;  1P3P C;  2NQB C;  3KWQ B;  4XUJ B;  4R8P A;  3KUY C;  3NQJ B;  5AY8 D;  3AZJ D;  5GSU A;  4H9O B;  4WU9 B;  5B32 B;  3AYW C;  5E5A B;  1AOI D;  1P34 D;  2NQB A;  2G5H C;  3H0M C;  3EPH A;  3KUY A;  1WWS A;  3AZH D;  2W8S A;  3EPK A;  4WZS B;  3REJ B;  5C3I B;  3AZM C;  3A1I A;  4ZBJ C;  3MNN D;  5CPI D;  1P3M D;  1M19 C;  3W97 D;  3LJA B;  3AFA B;  1M18 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...