5B33A

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33A00
5FUGA 3AV1A 5GT3B 3REKD 1U35B 1Q9CA 2F8ND 2HUEB 1P3MC 1ZLAB 5AV9D 4KGCA 1KX4B 2NQBB 1P3BD 1F66B 4WNNA 1KX5A 5GT0B 4H9RA 1A7WA 3REKB 3AFAD 3X1VA 3AV2C 2F8NB 2FJ7C 5AV9B 3AZFC 3AZHB 2HIOD 1P3BB 2NZDD 1BFMA 3RELB 5AV8A 4WU8D 3R45A 3LZ0A 2AROD 3KXBC 3AFAB 1WWSA 1TZYC 1P3LC 5JRGA 2HIOB 2NZDB 1P3PA 5B0ZC 1P3OA 5B33C 2PYOB 3A6ND 2AROB 5B0ZA 3MNNB 4G92C 1M18A 1P3AB 5CPKC 5B33A 4Z66C 5B1MD 3C1CD 4X23C 4LD9B 4J8WC 1M1AC 3AV1D 3W96C 3C1BB 3V9RA 1M1AA 2YFWA 3C1CB 3W96A 5CPJC 1M19C 3B6GB 2LY8A 5FUGB 3AV1B 4Z5TA 3X1VD 2BYMA 1KX3A 5B24A 4KGCB 2CWEA 4J8XA 4WNNB 3O62C 4H9QA 3AV2D 2FJ7D 1KX5B 1HQ3C 1EQZC 5AV8D 4H9RB 5BNXA 3AZFD 3B0DB 3AZGC 3X1VB 5AVCC 4ZUXC 3B0CT 1HQ3A 3AZGA 1P3PD 3KXBD 1H3OB 3AZNA 3X1UC 5AV8B 3R45B 4WU9A 5GT3C 5AV6C 3LZ0B 1P3LD 2HUEC 5B0ZD 1M18D 1ZLAC 3X1UA 5B33D 2NQBC 5JRGB 4Z2MG 1P3FA 1F66C 5AV6A 1P3PB 4DRBA 1P3OB 5GT0C 4E45A 5CPKD 4H9NA 1P3LB 2F8NK 5B0ZB 1M18B 3AZHC 4X23D 5B33B 4J8WD 1M1AD 3KUYA 5G49A 5B1LA 3RELC 3W96D 1P3IA 3AFAC 1ULYA 1M19D 3V9RB 1M1AB 2NZDC 5AY8A 2YFWB 3AZMA 2PYOC 3W96B 4J8XD 3B6FC 4KUDA 3WAAC 4NE5A 3MNNC 3MVDA 1P3AC 4Z5TB 1KX3B 2BYMB 1WWIA 3B6FA 5B24B 3WAAA 1HQ3D 3W97C 4LD9C 4J8XB 3AZGD 4H9QB 5AVCD 5BNXB 3C1BC 3W97A 4NE6A 4H9SC 5E5AA 5F99A 3C1CC 1HQ3B 3VH6A 3X1UD 3AZIC 5GT3D 3B6GC 5AV6D 3AZGB 3AZNB 1ZLAD 4Z2MH 3AZIA 4WU9B 2NQBD 1F66D 4YM6A 5GT0D 4E44A 4KGCC 3X1UB 2IO5B 5B31A 1P3FB 4AWLC 5AV6B 1ID3C 3KUYD 1KX5C 3VH5T 3AZHD 1P3ID 3B0DC 4H9NB 3LZ1A 1TAFA 3X1VC 3AZKC 1ID3A 3RELD 4XZQA 1P3KC 3AZKA 4NFTA 3KUYB 5G49B 5B1LB 3LELA 1S32A 5AV8C 1P3IB 1P3KA 4CSRA 3LZ0C 2PYOD 5JRGC 3B6FD 3W98C 5GSUA 3AZJA 1F1EA 5BS7A 5AY8B 1P3PC 3VH6W 1P3OC 3WAAD 3MNND 5C3IC 3AZMB 1P3AD 3KSYA 3VH5A 2F8NG 4KUDB 3W98A 5B32A 5AVBA 3MVDB 1M18C 3W97D 4LD9D 4J8UC 3B6FB 3WAAB 5F99D 3C1BD 3KWQC 4J8UA 1BH8A 3AZID 3W97B 5B0YC 3B6GD 4YM6D 3KWQA 5B40A 3MGRA 5F99B 5BNVA 4QLCA 3NQUA 5B31D 3MGSA 5B0YA 4ZBJB 3UTBA 5GXQA 4KGCD 3AZIB 4Z5TC 3LZ1D 1KX3C 5B24C 4YM6B 1ID3D 1KX5D 4XZQD 5B31B 3TU4C 4J8XC 4CAYA 3AZKD 3LELD 5AV5A 1P3KD 3LZ1B 3TU4A 1TAFB 5B2JA 4AWLB 1ID3B 3B0BA 4XZQB 3LZ0D 3AZKB 3AZNC 1S32B 3LELB 1P34C 4WU9C 1P3KB 4CSRB 5JRGD 3W98D 5B32D 3REIA 1P3OD 3REHA 2F8NH 2IO5C 4M6BA 1P34A 1P3FC 3AYWA 2JSSA 5GSUB 1JFIA 3AZJB 2BYKA 5KDMA 3W98B 4J8UD 5B32B 5AVBB 3UT9A 5C3IB 3KWQD 3X1TC 3KUYC 5B1LC 5DNNA 5CHLB 4G91B 4J8VA 1P3IC 3WA9C 5B0YD 5GXQD 4J8UB 3WKJC 3W99A 3X1TA 1BH8B 1KU5A 3WA9A 3MGQA 3KWQB 5AY8C 5B40B 3MGRB 3WKJA 5BNVB 4QLCB 3NQUB 3MGSB 3AZMC 5CPIA 4Z5TD 1KX3D 4KUDC 5B0YB 3UTBB 5GXQB 5B24D 1R4VA 1N1JA 3MVDC 4YS3A 3TU4D 3X1SA 4XUJC 5B2JD 5CP6C 4CAYB 4XUJA 1AOIA 4H9OA 5AV5B 5BO0A 4H9PA 3TU4B 3REJA 5CP6A 5E5AC 5B2JB 3AZND 5F99C 3AN2C 1P34D 4WU9D 4ZBJC 5DNMA 1B67A 3AN2A 1P3FD 1HTAA 4YM6C 3LJAC 3REIB 3REHB 5B31C 1P34B 3AYWB 1JFIB 2BYKB 5KDMB 5DNND 3LJAA 4WU8A 2RVQC 3LZ1C 2AROA 3X1TD 3AZLC 5B1LD 3UTAA 4XZQC 3MGPA 3UT9B 3WA9D 3MGQD 4EO5B 3WKJD 1S32C 3LELC 5DNNB 3AZLA 5CPID 4J8VB 5JA4A 3A6NA 5AY8D 3W99B 3X1TB 4WV4B 3AZMD 5B1MA 3X1SD 3WA9B 3WTPC 3MGQB 5GSUC 4KUDD 3AZJC 5BS7C 1BH9A 3WKJB 3MVDD 5CPIB 3WTPE 4XUJD 3WTPA 1AOID 5B32C 5B2IA 5AVBC 1N1JB 3NQJA 4YS3B 3X1SB 5CP6D 3REJD 4G91C 4R8PC 5DNMD 5E5AD 4XUJB 4HGAB 4H9OB 1P3MA 1AOIB 3AN2D 5BO0B 4H9PB 4R8PA 5CP6B 3REJB 5B40C 3MGRC 4QLCC 3MGSC 1H3OA 3AV2A 2FJ7A 3UTBC 5DNMB 2YFVA 5E5AB 5GXQC 3LJAD 4WZSB 3AZFA 3AN2B 1B6WA 3UTAD 3MGPD 2RVQD 4KHAA 3KXBA 5AV5C 3LJAB 4WU8B 1TZYA 3AZLD 1P3LA 3AZEC 5B2JC 1S32D 3UTAB 3MGPB 3VH5W 3AZEA 1P3GC 3AZLB 5CPKA 5JA4B 4Z66A 3A6NB 3WTPD 5GSUD 3AZJD 5B2ID 4JJNC 3REIC 1P3GA 3REHC 4X23A 5B31G 4J8WA 5B1MB 3AYWC 1BH9B 4JJNA 5AVBD 3WTPB 1P3MD 5B2IB 3NQJB 3UT9C 5CPJA 1M19A 4R8PD 4EO5C 5BT1C 5DNNC 4J8VC 3W99C 5B40D 1P3MB 2L5AA 3MGRD 4QLCD 2CV5C 3MGSD 3MGQC 4R8PB 3O62A 3UTBD 1EQZA 5CPIC 2CV5A 3AV2B 2FJ7B 5AVCA 4ZUXA 2YFVB 5B32G 1TZYD 4YS3C 3AZFB 1U35C 3X1SC 4UUZA 1KX4C 5AV5D 5GT3A 1U35A 4KHAB 3AZED 3KXBB 4NE3A 1AOIC 4HGAC 1ZLAA 1TZYB 1KX4A 2NQBA 4Z66D 3REKC 4DRAA 1F66A 3REJC 1P3GD 5GT0A 5AV9C 1P3BC 3REKA 2F8NA 3AZEB 5DNMC 4JJND 3REID 4G92B 3REHD 5AV9A 3AZHA 5CPKB 4Z66B 1P3BA 3AYWD 1P3GB 3RELA 4X23B 5CPJD 4J8WB 2HIOC 3VH6T 3AFAA 3B0CW 4JJNB 4WU8C 3UT9D 2AROC 2HIOA 2NZDA 5BT1D 3UTAC 3MGPC 4J8VD 5CPJB 1M19B 2PYOA 3O62D 1EQZD 3W99D 3MNNA 2CV5D 1P3AA 3A6NC 4ZUXD 4LD9A 5B1MC 3O62B 1EQZB 4YS3D 3C1BA 2CV5B 1U35D 4H9SA 5AVCB 4ZUXB 5B2IC 3C1CA 3AV1C 1KX4D 3B6GA 4UUZB
chains in the Genus database with same CATH superfamily
5FUGA 3AV1A 5GT3B 3REKD 1U35B 1Q9CA 2F8ND 2HUEB 1P3MC 1ZLAB 5AV9D 4KGCA 1KX4B 2NQBB 1P3BD 1F66B 4WNNA 1KX5A 5GT0B 4H9RA 1A7WA 3REKB 3AFAD 3X1VA 3AV2C 2F8NB 2FJ7C 5AV9B 3AZFC 3AZHB 2Y2LA 2HIOD 1P3BB 2NZDD 1BFMA 3RELB 5AV8A 4WU8D 3R45A 3LZ0A 2AROD 2G5HC 3KXBC 3AFAB 1WWSA 1TZYC 1P3LC 5JRGA 2HIOB 2NZDB 1P3PA 5B0ZC 1P3OA 5B33C 2PYOB 2FFFB 3A6ND 2AROB 5B0ZA 3MNNB 2ZM5A 4G92C 1P3AB 5CPKC 1M18A 5B33A 4Z66C 5B1MD 3C1CD 4X23C 4LD9B 4J8WC 1M1AC 3AV1D 3W96C 3C1BB 3V9RA 1M1AA 2YFWA 3C1CB 3W96A 5CPJC 1M19C 3B6GB 2LY8A 5FUGB 3AV1B 4Z5TA 3X1VD 2BYMA 1KX3A 5B24A 4KGCB 2CWEA 2ZY3A 4J8XA 4WNNB 3O62C 4H9QA 3AV2D 2FJ7D 1KX5B 1HQ3C 1EQZC 5AV8D 4H9RB 5BNXA 3AZFD 3B0DB 3EG5B 3AZGC 3X1VB 5AVCC 4ZUXC 3B0CT 1HQ3A 3AZGA 1P3PD 3KXBD 1H3OB 3AZNA 3X1UC 5AV8B 3A1IA 3R45B 4WU9A 5GT3C 2J8PA 5AV6C 3LZ0B 1P3LD 2HUEC 5B0ZD 1M18D 1ZLAC 3X1UA 5B33D 2NQBC 5JRGB 4Z2MG 1P3FA 1F66C 5AV6A 1P3PB 4DRBA 1P3OB 5GT0C 4E45A 5CPKD 4H9NA 1P3LB 2F8NK 5B0ZB 2DQNC 3AZHC 4X23D 1M18B 5B33B 4J8WD 1M1AD 3KUYA 5G49A 5B1LA 3RELC 3W96D 1P3IA 3AFAC 1ULYA 3KFUG 1M19D 3V9RB 1M1AB 2NZDC 5AY8A 2YFWB 3AZMA 2Y2GA 2PYOC 4J8XD 3B6FC 3W96B 4KUDA 3WAAC 4NE5A 3MNNC 3MVDA 1P3AC 4Z5TB 1KX3B 2BYMB 1WWIA 3B6FA 5B24B 3WAAA 1HQ3D 3W97C 4LD9C 4J8XB 3AZGD 3EPJA 4H9QB 5AVCD 5BNXB 3C1BC 3W97A 4NE6A 4H9SC 2F2AC 5E5AA 5F99A 3C1CC 1HQ3B 3H0LC 3VH6A 3X1UD 3AZIC 5GT3D 3B6GC 5AV6D 3AZGB 2XD1A 3AZNB 1ZLAD 4Z2MH 3AZIA 4WU9B 2NQBD 1F66D 4YM6A 1PZRA 5GT0D 4E44A 4KGCC 3X1UB 2IO5B 5B31A 1P3FB 4AWLC 5AV6B 1ID3C 3KUYD 1KX5C 3VH5T 3AZHD 1P3ID 3B0DC 4H9NB 3LZ1A 1TAFA 3X1VC 3AZKC 1ID3A 3RELD 4XZQA 1P3KC 1W2EA 3AZKA 4NFTA 3KUYB 5G49B 5B1LB 3LELA 1S32A 5AV8C 1P3IB 1P3KA 2Y2IA 4CSRA 3LZ0C 2PYOD 5JRGC 3B6FD 3W98C 5GSUA 3AZJA 1F1EA 5BS7A 5AY8B 1P3PC 3VH6W 1P3OC 3WAAD 3MNND 5C3IC 3AZMB 1P3AD 3KSYA 3VH5A 2F8NG 4KUDB 3W98A 5B32A 5AVBA 3MVDB 1M18C 3W97D 4LD9D 4J8UC 3B6FB 3WAAB 5F99D 3C1BD 3KWQC 4J8UA 1BH8A 3AZID 3W97B 2UWXA 5B0YC 3B6GD 4YM6D 3KWQA 5B40A 2Y2NA 3MGRA 5BNVA 4QLCA 3NQUA 5F99B 5B31D 3MGSA 5B0YA 4ZBJB 3UTBA 5GXQA 4KGCD 3AZIB 4Z5TC 3LZ1D 1KX3C 5B24C 4YM6B 1ID3D 1KX5D 2ZY5A 4XZQD 5B31B 3TU4C 4J8XC 4CAYA 3FDDA 3AZKD 3LELD 5AV5A 1P3KD 3LZ1B 3TU4A 1TAFB 3AL0C 5B2JA 4AWLB 1ID3B 3B0BA 4XZQB 2G5IC 3LZ0D 3AZKB 3AZNC 1S32B 3LELB 1P34C 4WU9C 1P3KB 4CSRB 5JRGD 3W98D 5B32D 3REIA 1P3OD 3REHA 2F8NH 2IO5C 4M6BA 1P34A 1P3FC 3AYWA 2JSSA 5GSUB 1JFIA 3AZJB 2BYKA 2Y2MA 5KDMA 3W98B 4J8UD 5B32B 5AVBB 3UT9A 5C3IB 3KWQD 2JCHA 3X1TC 3KUYC 5B1LC 5DNNA 5CHLB 4G91B 4J8VA 1P3IC 3WA9C 5B0YD 5GXQD 4J8UB 3WKJC 3W99A 1T3UA 1BH8B 3X1TA 1KU5A 3WA9A 3MGQA 3KWQB 5AY8C 5B40B 3MGRB 3WKJA 5BNVB 4QLCB 3NQUB 3MGSB 3AZMC 5CPIA 3EPHA 2BG1A 4Z5TD 1KX3D 4KUDC 5B0YB 3UTBB 5GXQB 5B24D 1R4VA 1N1JA 3MVDC 4YS3A 3TU4D 3X1SA 4XUJC 5B2JD 3P5JB 2ZY2A 1Z2CB 5CP6C 4CAYB 4XUJA 1AOIA 4H9OA 5AV5B 5BO0A 4H9PA 3TU4B 3REJA 5CP6A 5E5AC 5B2JB 3AZND 5F99C 2VQRA 3AN2C 1P34D 4WU9D 4ZBJC 5DNMA 1B67A 3AN2A 1P3FD 1HTAA 4YM6C 3LJAC 3REIB 3REHB 2ZY4A 5B31C 1P34B 3AYWB 1JFIB 2BYKB 3EPKA 5KDMB 5DNND 3LJAA 4WU8A 2RVQC 2Y2HA 3IP4C 3LZ1C 2AROA 3X1TD 3AZLC 5B1LD 3UTAA 4XZQC 3MGPA 3UT9B 3WA9D 3MGQD 4EO5B 3WKJD 1S32C 3LELC 5DNNB 3AZLA 5CPID 4J8VB 5JA4A 3A6NA 5AY8D 3W99B 3X1TB 4WV4B 3AZMD 5B1MA 3H0RC 3X1SD 3WA9B 3WTPC 3MGQB 5GSUC 4KUDD 3AZJC 5BS7C 1BH9A 3WKJB 2RIQA 3MVDD 5CPIB 2Y2PA 3WTPE 2XD5A 4XUJD 3WTPA 1AOID 5B32C 5B2IA 5AVBC 1N1JB 3NQJA 4YS3B 3X1SB 5CP6D 3REJD 4G91C 4R8PC 5DNMD 5E5AD 4XUJB 4HGAB 4H9OB 1P3MA 1AOIB 3AN2D 5BO0B 4H9PB 4R8PA 5CP6B 3REJB 5B40C 3MGRC 2Y2OA 4QLCC 3MGSC 1H3OA 3AV2A 2FJ7A 3UTBC 5DNMB 2YFVA 5E5AB 5GXQC 3LJAD 3F6TA 4WZSB 3AZFA 3AN2B 1B6WA 3UTAD 3MGPD 2RVQD 4KHAA 2W8SA 3KXBA 5AV5C 3LJAB 4WU8B 1TZYA 3AZLD 1P3LA 3AZEC 5B2JC 1S32D 3UTAB 3MGPB 3VH5W 3AZEA 1P3GC 3AZLB 5CPKA 5JA4B 4Z66A 3A6NB 3WTPD 5GSUD 3AZJD 5B2ID 4JJNC 3REIC 1P3GA 3REHC 4X23A 5B31G 3EPLA 4J8WA 5B1MB 3AYWC 2DF4C 1BH9B 4JJNA 3H0MC 5AVBD 3WTPB 1P3MD 5B2IB 3NQJB 3UT9C 5CPJA 1M19A 4R8PD 4EO5C 5BT1C 5DNNC 4J8VC 3W99C 5B40D 1P3MB 2L5AA 3MGRD 4QLCD 2CV5C 3MGSD 3MGQC 4R8PB 3O62A 3UTBD 1EQZA 5CPIC 2CV5A 3AV2B 2FJ7B 5AVCA 4ZUXA 2YFVB 5B32G 1TZYD 4YS3C 3AZFB 1U35C 2Y2JA 3X1SC 4UUZA 1KX4C 5AV5D 5GT3A 1U35A 4KHAB 3AZED 3KXBB 2Y2KA 4NE3A 1AOIC 4HGAC 1ZLAA 1TZYB 1KX4A 2NQBA 4Z66D 4DQYB 3REKC 4DRAA 1F66A 3REJC 1P3GD 5GT0A 5AV9C 1P3BC 3REKA 2F8NA 3AZEB 5DNMC 4JJND 3REID 4G92B 3REHD 5AV9A 3AZHA 5CPKB 4WJ3C 4Z66B 1P3BA 3AYWD 1P3GB 3RELA 4X23B 5CPJD 4J8WB 2HIOC 3VH6T 3AFAA 3B0CW 4JJNB 4WU8C 3UT9D 2JE5A 2AROC 2HIOA 2NZDA 5BT1D 3UTAC 3MGPC 4J8VD 5CPJB 1M19B 2PYOA 3O62D 1EQZD 3W99D 3MNNA 2CV5D 1P3AA 3A6NC 4ZUXD 4LD9A 5B1MC 3O62B 1EQZB 4YS3D 3C1BA 2CV5B 1U35D 4H9SA 3A1KA 5AVCB 4ZUXB 5B2IC 3C1CA 3AV1C 1KX4D 4UPKA 2Y2QA 3B6GA 4UUZB
chains in the Genus database with same CATH topology
5FUGA 3AV1A 5GT3B 3REKD 1U35B 1Q9CA 2F8ND 2HUEB 1P3MC 1ZLAB 5AV9D 4KGCA 1KX4B 2NQBB 1P3BD 1F66B 4WNNA 1KX5A 5GT0B 4H9RA 1A7WA 3REKB 3AFAD 3X1VA 3AV2C 2F8NB 2FJ7C 5AV9B 3AZFC 3AZHB 2Y2LA 2HIOD 1P3BB 2NZDD 1BFMA 3RELB 5AV8A 4WU8D 3R45A 3LZ0A 2AROD 2G5HC 3KXBC 3AFAB 1WWSA 1TZYC 1P3LC 5JRGA 2HIOB 2NZDB 1P3PA 5B0ZC 1P3OA 5B33C 2PYOB 2FFFB 3A6ND 2AROB 5B0ZA 3MNNB 2ZM5A 4G92C 1P3AB 5CPKC 1M18A 5B33A 4Z66C 5B1MD 3C1CD 4X23C 4LD9B 4J8WC 1M1AC 3AV1D 3W96C 3C1BB 3V9RA 1M1AA 2YFWA 3C1CB 3W96A 5CPJC 1M19C 3B6GB 2LY8A 5FUGB 3AV1B 4Z5TA 3X1VD 2BYMA 1KX3A 5B24A 4KGCB 2CWEA 2ZY3A 4J8XA 4WNNB 3O62C 4H9QA 3AV2D 2FJ7D 1KX5B 1HQ3C 1EQZC 5AV8D 4H9RB 5BNXA 3AZFD 3B0DB 3EG5B 3AZGC 3X1VB 5AVCC 4ZUXC 3B0CT 1HQ3A 3AZGA 1P3PD 3KXBD 1H3OB 3AZNA 3X1UC 5AV8B 3A1IA 3R45B 4WU9A 5GT3C 2J8PA 5AV6C 3LZ0B 1P3LD 2HUEC 5B0ZD 1M18D 1ZLAC 3X1UA 5B33D 2NQBC 5JRGB 4Z2MG 1P3FA 1F66C 5AV6A 1P3PB 4DRBA 1P3OB 5GT0C 4E45A 5CPKD 4H9NA 1P3LB 2F8NK 5B0ZB 2DQNC 3AZHC 4X23D 1M18B 5B33B 4J8WD 1M1AD 3KUYA 5G49A 5B1LA 3RELC 3W96D 1P3IA 3AFAC 1ULYA 3KFUG 1M19D 3V9RB 1M1AB 2NZDC 5AY8A 2YFWB 3AZMA 2Y2GA 2PYOC 4J8XD 3B6FC 3W96B 4KUDA 3WAAC 4NE5A 3MNNC 3MVDA 1P3AC 4Z5TB 1KX3B 2BYMB 1WWIA 3B6FA 5B24B 3WAAA 1HQ3D 3W97C 4LD9C 4J8XB 3AZGD 3EPJA 4H9QB 5AVCD 5BNXB 3C1BC 3W97A 4NE6A 4H9SC 2F2AC 5E5AA 5F99A 3C1CC 1HQ3B 3H0LC 3VH6A 3X1UD 3AZIC 5GT3D 3B6GC 5AV6D 3AZGB 2XD1A 3AZNB 1ZLAD 4Z2MH 3AZIA 4WU9B 2NQBD 1F66D 4YM6A 1PZRA 5GT0D 4E44A 4KGCC 3X1UB 2IO5B 5B31A 1P3FB 4AWLC 5AV6B 1ID3C 3KUYD 1KX5C 3VH5T 3AZHD 1P3ID 3B0DC 4H9NB 3LZ1A 1TAFA 3X1VC 3AZKC 1ID3A 3RELD 4XZQA 1P3KC 1W2EA 3AZKA 4NFTA 3KUYB 5G49B 5B1LB 3LELA 1S32A 5AV8C 1P3IB 1P3KA 2Y2IA 4CSRA 3LZ0C 2PYOD 5JRGC 3B6FD 3W98C 5GSUA 3AZJA 1F1EA 5BS7A 5AY8B 1P3PC 3VH6W 1P3OC 3WAAD 3MNND 5C3IC 3AZMB 1P3AD 3KSYA 3VH5A 2F8NG 4KUDB 3W98A 5B32A 5AVBA 3MVDB 1M18C 3W97D 4LD9D 4J8UC 3B6FB 3WAAB 5F99D 3C1BD 3KWQC 4J8UA 1BH8A 3AZID 3W97B 2UWXA 5B0YC 3B6GD 4YM6D 3KWQA 5B40A 2Y2NA 3MGRA 5BNVA 4QLCA 3NQUA 5F99B 5B31D 3MGSA 5B0YA 4ZBJB 3UTBA 5GXQA 4KGCD 3AZIB 4Z5TC 3LZ1D 1KX3C 5B24C 4YM6B 1ID3D 1KX5D 2ZY5A 4XZQD 5B31B 3TU4C 4J8XC 4CAYA 3FDDA 3AZKD 3LELD 5AV5A 1P3KD 3LZ1B 3TU4A 1TAFB 3AL0C 5B2JA 4AWLB 1ID3B 3B0BA 4XZQB 2G5IC 3LZ0D 3AZKB 3AZNC 1S32B 3LELB 1P34C 4WU9C 1P3KB 4CSRB 5JRGD 3W98D 5B32D 3REIA 1P3OD 3REHA 2F8NH 2IO5C 4M6BA 1P34A 1P3FC 3AYWA 2JSSA 5GSUB 1JFIA 3AZJB 2BYKA 2Y2MA 5KDMA 3W98B 4J8UD 5B32B 5AVBB 3UT9A 5C3IB 3KWQD 2JCHA 3X1TC 3KUYC 5B1LC 5DNNA 5CHLB 4G91B 4J8VA 1P3IC 3WA9C 5B0YD 5GXQD 4J8UB 3WKJC 3W99A 1T3UA 1BH8B 3X1TA 1KU5A 3WA9A 3MGQA 3KWQB 5AY8C 5B40B 3MGRB 3WKJA 5BNVB 4QLCB 3NQUB 3MGSB 3AZMC 5CPIA 3EPHA 2BG1A 4Z5TD 1KX3D 4KUDC 5B0YB 3UTBB 5GXQB 5B24D 1R4VA 1N1JA 3MVDC 4YS3A 3TU4D 3X1SA 4XUJC 5B2JD 3P5JB 2ZY2A 1Z2CB 5CP6C 4CAYB 4XUJA 1AOIA 4H9OA 5AV5B 5BO0A 4H9PA 3TU4B 3REJA 5CP6A 5E5AC 5B2JB 3AZND 5F99C 2VQRA 3AN2C 1P34D 4WU9D 4ZBJC 5DNMA 1B67A 3AN2A 1P3FD 1HTAA 4YM6C 3LJAC 3REIB 3REHB 2ZY4A 5B31C 1P34B 3AYWB 1JFIB 2BYKB 3EPKA 5KDMB 5DNND 3LJAA 4WU8A 2RVQC 2Y2HA 3IP4C 3LZ1C 2AROA 3X1TD 3AZLC 5B1LD 3UTAA 4XZQC 3MGPA 3UT9B 3WA9D 3MGQD 4EO5B 3WKJD 1S32C 3LELC 5DNNB 3AZLA 5CPID 4J8VB 5JA4A 3A6NA 5AY8D 3W99B 3X1TB 4WV4B 3AZMD 5B1MA 3H0RC 3X1SD 3WA9B 3WTPC 3MGQB 5GSUC 4KUDD 3AZJC 5BS7C 1BH9A 3WKJB 2RIQA 3MVDD 5CPIB 2Y2PA 3WTPE 2XD5A 4XUJD 3WTPA 1AOID 5B32C 5B2IA 5AVBC 1N1JB 3NQJA 4YS3B 3X1SB 5CP6D 3REJD 4G91C 4R8PC 5DNMD 5E5AD 4XUJB 4HGAB 4H9OB 1P3MA 1AOIB 3AN2D 5BO0B 4H9PB 4R8PA 5CP6B 3REJB 5B40C 3MGRC 2Y2OA 4QLCC 3MGSC 1H3OA 3AV2A 2FJ7A 3UTBC 5DNMB 2YFVA 5E5AB 5GXQC 3LJAD 3F6TA 4WZSB 3AZFA 3AN2B 1B6WA 3UTAD 3MGPD 2RVQD 4KHAA 2W8SA 3KXBA 5AV5C 3LJAB 4WU8B 1TZYA 3AZLD 1P3LA 3AZEC 5B2JC 1S32D 3UTAB 3MGPB 3VH5W 3AZEA 1P3GC 3AZLB 5CPKA 5JA4B 4Z66A 3A6NB 3WTPD 5GSUD 3AZJD 5B2ID 4JJNC 3REIC 1P3GA 3REHC 4X23A 5B31G 3EPLA 4J8WA 5B1MB 3AYWC 2DF4C 1BH9B 4JJNA 3H0MC 5AVBD 3WTPB 1P3MD 5B2IB 3NQJB 3UT9C 5CPJA 1M19A 4R8PD 4EO5C 5BT1C 5DNNC 4J8VC 3W99C 5B40D 1P3MB 2L5AA 3MGRD 4QLCD 2CV5C 3MGSD 3MGQC 4R8PB 3O62A 3UTBD 1EQZA 5CPIC 2CV5A 3AV2B 2FJ7B 5AVCA 4ZUXA 2YFVB 5B32G 1TZYD 4YS3C 3AZFB 1U35C 2Y2JA 3X1SC 4UUZA 1KX4C 5AV5D 5GT3A 1U35A 4KHAB 3AZED 3KXBB 2Y2KA 4NE3A 1AOIC 4HGAC 1ZLAA 1TZYB 1KX4A 2NQBA 4Z66D 4DQYB 3REKC 4DRAA 1F66A 3REJC 1P3GD 5GT0A 5AV9C 1P3BC 3REKA 2F8NA 3AZEB 5DNMC 4JJND 3REID 4G92B 3REHD 5AV9A 3AZHA 5CPKB 4WJ3C 4Z66B 1P3BA 3AYWD 1P3GB 3RELA 4X23B 5CPJD 4J8WB 2HIOC 3VH6T 3AFAA 3B0CW 4JJNB 4WU8C 3UT9D 2JE5A 2AROC 2HIOA 2NZDA 5BT1D 3UTAC 3MGPC 4J8VD 5CPJB 1M19B 2PYOA 3O62D 1EQZD 3W99D 3MNNA 2CV5D 1P3AA 3A6NC 4ZUXD 4LD9A 5B1MC 3O62B 1EQZB 4YS3D 3C1BA 2CV5B 1U35D 4H9SA 3A1KA 5AVCB 4ZUXB 5B2IC 3C1CA 3AV1C 1KX4D 4UPKA 2Y2QA 3B6GA 4UUZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG A;  3AV1 A;  5GT3 B;  3REK D;  1U35 B;  1Q9C A;  2F8N D;  2HUE B;  1P3M C;  1ZLA B;  5AV9 D;  4KGC A;  1KX4 B;  2NQB B;  1P3B D;  1F66 B;  4WNN A;  1KX5 A;  5GT0 B;  4H9R A;  1A7W A;  3REK B;  3AFA D;  3X1V A;  3AV2 C;  2F8N B;  2FJ7 C;  5AV9 B;  3AZF C;  3AZH B;  2HIO D;  1P3B B;  2NZD D;  1BFM A;  3REL B;  5AV8 A;  4WU8 D;  3R45 A;  3LZ0 A;  2ARO D;  3KXB C;  3AFA B;  1WWS A;  1TZY C;  1P3L C;  5JRG A;  2HIO B;  2NZD B;  1P3P A;  5B0Z C;  1P3O A;  5B33 C;  2PYO B;  3A6N D;  2ARO B;  5B0Z A;  3MNN B;  4G92 C;  1M18 A;  1P3A B;  5CPK C;  5B33 A;  4Z66 C;  5B1M D;  3C1C D;  4X23 C;  4LD9 B;  4J8W C;  1M1A C;  3AV1 D;  3W96 C;  3C1B B;  3V9R A;  1M1A A;  2YFW A;  3C1C B;  3W96 A;  5CPJ C;  1M19 C;  3B6G B;  2LY8 A;  5FUG B;  3AV1 B;  4Z5T A;  3X1V D;  2BYM A;  1KX3 A;  5B24 A;  4KGC B;  2CWE A;  4J8X A;  4WNN B;  3O62 C;  4H9Q A;  3AV2 D;  2FJ7 D;  1KX5 B;  1HQ3 C;  1EQZ C;  5AV8 D;  4H9R B;  5BNX A;  3AZF D;  3B0D B;  3AZG C;  3X1V B;  5AVC C;  4ZUX C;  3B0C T;  1HQ3 A;  3AZG A;  1P3P D;  3KXB D;  1H3O B;  3AZN A;  3X1U C;  5AV8 B;  3R45 B;  4WU9 A;  5GT3 C;  5AV6 C;  3LZ0 B;  1P3L D;  2HUE C;  5B0Z D;  1M18 D;  1ZLA C;  3X1U A;  5B33 D;  2NQB C;  5JRG B;  4Z2M G;  1P3F A;  1F66 C;  5AV6 A;  1P3P B;  4DRB A;  1P3O B;  5GT0 C;  4E45 A;  5CPK D;  4H9N A;  1P3L B;  2F8N K;  5B0Z B;  1M18 B;  3AZH C;  4X23 D;  5B33 B;  4J8W D;  1M1A D;  3KUY A;  5G49 A;  5B1L A;  3REL C;  3W96 D;  1P3I A;  3AFA C;  1ULY A;  1M19 D;  3V9R B;  1M1A B;  2NZD C;  5AY8 A;  2YFW B;  3AZM A;  2PYO C;  3W96 B;  4J8X D;  3B6F C;  4KUD A;  3WAA C;  4NE5 A;  3MNN C;  3MVD A;  1P3A C;  4Z5T B;  1KX3 B;  2BYM B;  1WWI A;  3B6F A;  5B24 B;  3WAA A;  1HQ3 D;  3W97 C;  4LD9 C;  4J8X B;  3AZG D;  4H9Q B;  5AVC D;  5BNX B;  3C1B C;  3W97 A;  4NE6 A;  4H9S C;  5E5A A;  5F99 A;  3C1C C;  1HQ3 B;  3VH6 A;  3X1U D;  3AZI C;  5GT3 D;  3B6G C;  5AV6 D;  3AZG B;  3AZN B;  1ZLA D;  4Z2M H;  3AZI A;  4WU9 B;  2NQB D;  1F66 D;  4YM6 A;  5GT0 D;  4E44 A;  4KGC C;  3X1U B;  2IO5 B;  5B31 A;  1P3F B;  4AWL C;  5AV6 B;  1ID3 C;  3KUY D;  1KX5 C;  3VH5 T;  3AZH D;  1P3I D;  3B0D C;  4H9N B;  3LZ1 A;  1TAF A;  3X1V C;  3AZK C;  1ID3 A;  3REL D;  4XZQ A;  1P3K C;  3AZK A;  4NFT A;  3KUY B;  5G49 B;  5B1L B;  3LEL A;  1S32 A;  5AV8 C;  1P3I B;  1P3K A;  4CSR A;  3LZ0 C;  2PYO D;  5JRG C;  3B6F D;  3W98 C;  5GSU A;  3AZJ A;  1F1E A;  5BS7 A;  5AY8 B;  1P3P C;  3VH6 W;  1P3O C;  3WAA D;  3MNN D;  5C3I C;  3AZM B;  1P3A D;  3KSY A;  3VH5 A;  2F8N G;  4KUD B;  3W98 A;  5B32 A;  5AVB A;  3MVD B;  1M18 C;  3W97 D;  4LD9 D;  4J8U C;  3B6F B;  3WAA B;  5F99 D;  3C1B D;  3KWQ C;  4J8U A;  1BH8 A;  3AZI D;  3W97 B;  5B0Y C;  3B6G D;  4YM6 D;  3KWQ A;  5B40 A;  3MGR A;  5F99 B;  5BNV A;  4QLC A;  3NQU A;  5B31 D;  3MGS A;  5B0Y A;  4ZBJ B;  3UTB A;  5GXQ A;  4KGC D;  3AZI B;  4Z5T C;  3LZ1 D;  1KX3 C;  5B24 C;  4YM6 B;  1ID3 D;  1KX5 D;  4XZQ D;  5B31 B;  3TU4 C;  4J8X C;  4CAY A;  3AZK D;  3LEL D;  5AV5 A;  1P3K D;  3LZ1 B;  3TU4 A;  1TAF B;  5B2J A;  4AWL B;  1ID3 B;  3B0B A;  4XZQ B;  3LZ0 D;  3AZK B;  3AZN C;  1S32 B;  3LEL B;  1P34 C;  4WU9 C;  1P3K B;  4CSR B;  5JRG D;  3W98 D;  5B32 D;  3REI A;  1P3O D;  3REH A;  2F8N H;  2IO5 C;  4M6B A;  1P34 A;  1P3F C;  3AYW A;  2JSS A;  5GSU B;  1JFI A;  3AZJ B;  2BYK A;  5KDM A;  3W98 B;  4J8U D;  5B32 B;  5AVB B;  3UT9 A;  5C3I B;  3KWQ D;  3X1T C;  3KUY C;  5B1L C;  5DNN A;  5CHL B;  4G91 B;  4J8V A;  1P3I C;  3WA9 C;  5B0Y D;  5GXQ D;  4J8U B;  3WKJ C;  3W99 A;  3X1T A;  1BH8 B;  1KU5 A;  3WA9 A;  3MGQ A;  3KWQ B;  5AY8 C;  5B40 B;  3MGR B;  3WKJ A;  5BNV B;  4QLC B;  3NQU B;  3MGS B;  3AZM C;  5CPI A;  4Z5T D;  1KX3 D;  4KUD C;  5B0Y B;  3UTB B;  5GXQ B;  5B24 D;  1R4V A;  1N1J A;  3MVD C;  4YS3 A;  3TU4 D;  3X1S A;  4XUJ C;  5B2J D;  5CP6 C;  4CAY B;  4XUJ A;  1AOI A;  4H9O A;  5AV5 B;  5BO0 A;  4H9P A;  3TU4 B;  3REJ A;  5CP6 A;  5E5A C;  5B2J B;  3AZN D;  5F99 C;  3AN2 C;  1P34 D;  4WU9 D;  4ZBJ C;  5DNM A;  1B67 A;  3AN2 A;  1P3F D;  1HTA A;  4YM6 C;  3LJA C;  3REI B;  3REH B;  5B31 C;  1P34 B;  3AYW B;  1JFI B;  2BYK B;  5KDM B;  5DNN D;  3LJA A;  4WU8 A;  2RVQ C;  3LZ1 C;  2ARO A;  3X1T D;  3AZL C;  5B1L D;  3UTA A;  4XZQ C;  3MGP A;  3UT9 B;  3WA9 D;  3MGQ D;  4EO5 B;  3WKJ D;  1S32 C;  3LEL C;  5DNN B;  3AZL A;  5CPI D;  4J8V B;  5JA4 A;  3A6N A;  5AY8 D;  3W99 B;  3X1T B;  4WV4 B;  3AZM D;  5B1M A;  3X1S D;  3WA9 B;  3WTP C;  3MGQ B;  5GSU C;  4KUD D;  3AZJ C;  5BS7 C;  1BH9 A;  3WKJ B;  3MVD D;  5CPI B;  3WTP E;  4XUJ D;  3WTP A;  1AOI D;  5B32 C;  5B2I A;  5AVB C;  1N1J B;  3NQJ A;  4YS3 B;  3X1S B;  5CP6 D;  3REJ D;  4G91 C;  4R8P C;  5DNM D;  5E5A D;  4XUJ B;  4HGA B;  4H9O B;  1P3M A;  1AOI B;  3AN2 D;  5BO0 B;  4H9P B;  4R8P A;  5CP6 B;  3REJ B;  5B40 C;  3MGR C;  4QLC C;  3MGS C;  1H3O A;  3AV2 A;  2FJ7 A;  3UTB C;  5DNM B;  2YFV A;  5E5A B;  5GXQ C;  3LJA D;  4WZS B;  3AZF A;  3AN2 B;  1B6W A;  3UTA D;  3MGP D;  2RVQ D;  4KHA A;  3KXB A;  5AV5 C;  3LJA B;  4WU8 B;  1TZY A;  3AZL D;  1P3L A;  3AZE C;  5B2J C;  1S32 D;  3UTA B;  3MGP B;  3VH5 W;  3AZE A;  1P3G C;  3AZL B;  5CPK A;  5JA4 B;  4Z66 A;  3A6N B;  3WTP D;  5GSU D;  3AZJ D;  5B2I D;  4JJN C;  3REI C;  1P3G A;  3REH C;  4X23 A;  5B31 G;  4J8W A;  5B1M B;  3AYW C;  1BH9 B;  4JJN A;  5AVB D;  3WTP B;  1P3M D;  5B2I B;  3NQJ B;  3UT9 C;  5CPJ A;  1M19 A;  4R8P D;  4EO5 C;  5BT1 C;  5DNN C;  4J8V C;  3W99 C;  5B40 D;  1P3M B;  2L5A A;  3MGR D;  4QLC D;  2CV5 C;  3MGS D;  3MGQ C;  4R8P B;  3O62 A;  3UTB D;  1EQZ A;  5CPI C;  2CV5 A;  3AV2 B;  2FJ7 B;  5AVC A;  4ZUX A;  2YFV B;  5B32 G;  1TZY D;  4YS3 C;  3AZF B;  1U35 C;  3X1S C;  4UUZ A;  1KX4 C;  5AV5 D;  5GT3 A;  1U35 A;  4KHA B;  3AZE D;  3KXB B;  4NE3 A;  1AOI C;  4HGA C;  1ZLA A;  1TZY B;  1KX4 A;  2NQB A;  4Z66 D;  3REK C;  4DRA A;  1F66 A;  3REJ C;  1P3G D;  5GT0 A;  5AV9 C;  1P3B C;  3REK A;  2F8N A;  3AZE B;  5DNM C;  4JJN D;  3REI D;  4G92 B;  3REH D;  5AV9 A;  3AZH A;  5CPK B;  4Z66 B;  1P3B A;  3AYW D;  1P3G B;  3REL A;  4X23 B;  5CPJ D;  4J8W B;  2HIO C;  3VH6 T;  3AFA A;  3B0C W;  4JJN B;  4WU8 C;  3UT9 D;  2ARO C;  2HIO A;  2NZD A;  5BT1 D;  3UTA C;  3MGP C;  4J8V D;  5CPJ B;  1M19 B;  2PYO A;  3O62 D;  1EQZ D;  3W99 D;  3MNN A;  2CV5 D;  1P3A A;  3A6N C;  4ZUX D;  4LD9 A;  5B1M C;  3O62 B;  1EQZ B;  4YS3 D;  3C1B A;  2CV5 B;  1U35 D;  4H9S A;  5AVC B;  4ZUX B;  5B2I C;  3C1C A;  3AV1 C;  1KX4 D;  3B6G A;  4UUZ B; 
#chains in the Genus database with same CATH topology
 5FUG A;  3AV1 A;  5GT3 B;  3REK D;  1U35 B;  1Q9C A;  2F8N D;  2HUE B;  1P3M C;  1ZLA B;  5AV9 D;  4KGC A;  1KX4 B;  2NQB B;  1P3B D;  1F66 B;  4WNN A;  1KX5 A;  5GT0 B;  4H9R A;  1A7W A;  3REK B;  3AFA D;  3X1V A;  3AV2 C;  2F8N B;  2FJ7 C;  5AV9 B;  3AZF C;  3AZH B;  2Y2L A;  2HIO D;  1P3B B;  2NZD D;  1BFM A;  3REL B;  5AV8 A;  4WU8 D;  3R45 A;  3LZ0 A;  2ARO D;  2G5H C;  3KXB C;  3AFA B;  1WWS A;  1TZY C;  1P3L C;  5JRG A;  2HIO B;  2NZD B;  1P3P A;  5B0Z C;  1P3O A;  5B33 C;  2PYO B;  2FFF B;  3A6N D;  2ARO B;  5B0Z A;  3MNN B;  2ZM5 A;  4G92 C;  1P3A B;  5CPK C;  1M18 A;  5B33 A;  4Z66 C;  5B1M D;  3C1C D;  4X23 C;  4LD9 B;  4J8W C;  1M1A C;  3AV1 D;  3W96 C;  3C1B B;  3V9R A;  1M1A A;  2YFW A;  3C1C B;  3W96 A;  5CPJ C;  1M19 C;  3B6G B;  2LY8 A;  5FUG B;  3AV1 B;  4Z5T A;  3X1V D;  2BYM A;  1KX3 A;  5B24 A;  4KGC B;  2CWE A;  2ZY3 A;  4J8X A;  4WNN B;  3O62 C;  4H9Q A;  3AV2 D;  2FJ7 D;  1KX5 B;  1HQ3 C;  1EQZ C;  5AV8 D;  4H9R B;  5BNX A;  3AZF D;  3B0D B;  3EG5 B;  3AZG C;  3X1V B;  5AVC C;  4ZUX C;  3B0C T;  1HQ3 A;  3AZG A;  1P3P D;  3KXB D;  1H3O B;  3AZN A;  3X1U C;  5AV8 B;  3A1I A;  3R45 B;  4WU9 A;  5GT3 C;  2J8P A;  5AV6 C;  3LZ0 B;  1P3L D;  2HUE C;  5B0Z D;  1M18 D;  1ZLA C;  3X1U A;  5B33 D;  2NQB C;  5JRG B;  4Z2M G;  1P3F A;  1F66 C;  5AV6 A;  1P3P B;  4DRB A;  1P3O B;  5GT0 C;  4E45 A;  5CPK D;  4H9N A;  1P3L B;  2F8N K;  5B0Z B;  2DQN C;  3AZH C;  4X23 D;  1M18 B;  5B33 B;  4J8W D;  1M1A D;  3KUY A;  5G49 A;  5B1L A;  3REL C;  3W96 D;  1P3I A;  3AFA C;  1ULY A;  3KFU G;  1M19 D;  3V9R B;  1M1A B;  2NZD C;  5AY8 A;  2YFW B;  3AZM A;  2Y2G A;  2PYO C;  4J8X D;  3B6F C;  3W96 B;  4KUD A;  3WAA C;  4NE5 A;  3MNN C;  3MVD A;  1P3A C;  4Z5T B;  1KX3 B;  2BYM B;  1WWI A;  3B6F A;  5B24 B;  3WAA A;  1HQ3 D;  3W97 C;  4LD9 C;  4J8X B;  3AZG D;  3EPJ A;  4H9Q B;  5AVC D;  5BNX B;  3C1B C;  3W97 A;  4NE6 A;  4H9S C;  2F2A C;  5E5A A;  5F99 A;  3C1C C;  1HQ3 B;  3H0L C;  3VH6 A;  3X1U D;  3AZI C;  5GT3 D;  3B6G C;  5AV6 D;  3AZG B;  2XD1 A;  3AZN B;  1ZLA D;  4Z2M H;  3AZI A;  4WU9 B;  2NQB D;  1F66 D;  4YM6 A;  1PZR A;  5GT0 D;  4E44 A;  4KGC C;  3X1U B;  2IO5 B;  5B31 A;  1P3F B;  4AWL C;  5AV6 B;  1ID3 C;  3KUY D;  1KX5 C;  3VH5 T;  3AZH D;  1P3I D;  3B0D C;  4H9N B;  3LZ1 A;  1TAF A;  3X1V C;  3AZK C;  1ID3 A;  3REL D;  4XZQ A;  1P3K C;  1W2E A;  3AZK A;  4NFT A;  3KUY B;  5G49 B;  5B1L B;  3LEL A;  1S32 A;  5AV8 C;  1P3I B;  1P3K A;  2Y2I A;  4CSR A;  3LZ0 C;  2PYO D;  5JRG C;  3B6F D;  3W98 C;  5GSU A;  3AZJ A;  1F1E A;  5BS7 A;  5AY8 B;  1P3P C;  3VH6 W;  1P3O C;  3WAA D;  3MNN D;  5C3I C;  3AZM B;  1P3A D;  3KSY A;  3VH5 A;  2F8N G;  4KUD B;  3W98 A;  5B32 A;  5AVB A;  3MVD B;  1M18 C;  3W97 D;  4LD9 D;  4J8U C;  3B6F B;  3WAA B;  5F99 D;  3C1B D;  3KWQ C;  4J8U A;  1BH8 A;  3AZI D;  3W97 B;  2UWX A;  5B0Y C;  3B6G D;  4YM6 D;  3KWQ A;  5B40 A;  2Y2N A;  3MGR A;  5BNV A;  4QLC A;  3NQU A;  5F99 B;  5B31 D;  3MGS A;  5B0Y A;  4ZBJ B;  3UTB A;  5GXQ A;  4KGC D;  3AZI B;  4Z5T C;  3LZ1 D;  1KX3 C;  5B24 C;  4YM6 B;  1ID3 D;  1KX5 D;  2ZY5 A;  4XZQ D;  5B31 B;  3TU4 C;  4J8X C;  4CAY A;  3FDD A;  3AZK D;  3LEL D;  5AV5 A;  1P3K D;  3LZ1 B;  3TU4 A;  1TAF B;  3AL0 C;  5B2J A;  4AWL B;  1ID3 B;  3B0B A;  4XZQ B;  2G5I C;  3LZ0 D;  3AZK B;  3AZN C;  1S32 B;  3LEL B;  1P34 C;  4WU9 C;  1P3K B;  4CSR B;  5JRG D;  3W98 D;  5B32 D;  3REI A;  1P3O D;  3REH A;  2F8N H;  2IO5 C;  4M6B A;  1P34 A;  1P3F C;  3AYW A;  2JSS A;  5GSU B;  1JFI A;  3AZJ B;  2BYK A;  2Y2M A;  5KDM A;  3W98 B;  4J8U D;  5B32 B;  5AVB B;  3UT9 A;  5C3I B;  3KWQ D;  2JCH A;  3X1T C;  3KUY C;  5B1L C;  5DNN A;  5CHL B;  4G91 B;  4J8V A;  1P3I C;  3WA9 C;  5B0Y D;  5GXQ D;  4J8U B;  3WKJ C;  3W99 A;  1T3U A;  1BH8 B;  3X1T A;  1KU5 A;  3WA9 A;  3MGQ A;  3KWQ B;  5AY8 C;  5B40 B;  3MGR B;  3WKJ A;  5BNV B;  4QLC B;  3NQU B;  3MGS B;  3AZM C;  5CPI A;  3EPH A;  2BG1 A;  4Z5T D;  1KX3 D;  4KUD C;  5B0Y B;  3UTB B;  5GXQ B;  5B24 D;  1R4V A;  1N1J A;  3MVD C;  4YS3 A;  3TU4 D;  3X1S A;  4XUJ C;  5B2J D;  3P5J B;  2ZY2 A;  1Z2C B;  5CP6 C;  4CAY B;  4XUJ A;  1AOI A;  4H9O A;  5AV5 B;  5BO0 A;  4H9P A;  3TU4 B;  3REJ A;  5CP6 A;  5E5A C;  5B2J B;  3AZN D;  5F99 C;  2VQR A;  3AN2 C;  1P34 D;  4WU9 D;  4ZBJ C;  5DNM A;  1B67 A;  3AN2 A;  1P3F D;  1HTA A;  4YM6 C;  3LJA C;  3REI B;  3REH B;  2ZY4 A;  5B31 C;  1P34 B;  3AYW B;  1JFI B;  2BYK B;  3EPK A;  5KDM B;  5DNN D;  3LJA A;  4WU8 A;  2RVQ C;  2Y2H A;  3IP4 C;  3LZ1 C;  2ARO A;  3X1T D;  3AZL C;  5B1L D;  3UTA A;  4XZQ C;  3MGP A;  3UT9 B;  3WA9 D;  3MGQ D;  4EO5 B;  3WKJ D;  1S32 C;  3LEL C;  5DNN B;  3AZL A;  5CPI D;  4J8V B;  5JA4 A;  3A6N A;  5AY8 D;  3W99 B;  3X1T B;  4WV4 B;  3AZM D;  5B1M A;  3H0R C;  3X1S D;  3WA9 B;  3WTP C;  3MGQ B;  5GSU C;  4KUD D;  3AZJ C;  5BS7 C;  1BH9 A;  3WKJ B;  2RIQ A;  3MVD D;  5CPI B;  2Y2P A;  3WTP E;  2XD5 A;  4XUJ D;  3WTP A;  1AOI D;  5B32 C;  5B2I A;  5AVB C;  1N1J B;  3NQJ A;  4YS3 B;  3X1S B;  5CP6 D;  3REJ D;  4G91 C;  4R8P C;  5DNM D;  5E5A D;  4XUJ B;  4HGA B;  4H9O B;  1P3M A;  1AOI B;  3AN2 D;  5BO0 B;  4H9P B;  4R8P A;  5CP6 B;  3REJ B;  5B40 C;  3MGR C;  2Y2O A;  4QLC C;  3MGS C;  1H3O A;  3AV2 A;  2FJ7 A;  3UTB C;  5DNM B;  2YFV A;  5E5A B;  5GXQ C;  3LJA D;  3F6T A;  4WZS B;  3AZF A;  3AN2 B;  1B6W A;  3UTA D;  3MGP D;  2RVQ D;  4KHA A;  2W8S A;  3KXB A;  5AV5 C;  3LJA B;  4WU8 B;  1TZY A;  3AZL D;  1P3L A;  3AZE C;  5B2J C;  1S32 D;  3UTA B;  3MGP B;  3VH5 W;  3AZE A;  1P3G C;  3AZL B;  5CPK A;  5JA4 B;  4Z66 A;  3A6N B;  3WTP D;  5GSU D;  3AZJ D;  5B2I D;  4JJN C;  3REI C;  1P3G A;  3REH C;  4X23 A;  5B31 G;  3EPL A;  4J8W A;  5B1M B;  3AYW C;  2DF4 C;  1BH9 B;  4JJN A;  3H0M C;  5AVB D;  3WTP B;  1P3M D;  5B2I B;  3NQJ B;  3UT9 C;  5CPJ A;  1M19 A;  4R8P D;  4EO5 C;  5BT1 C;  5DNN C;  4J8V C;  3W99 C;  5B40 D;  1P3M B;  2L5A A;  3MGR D;  4QLC D;  2CV5 C;  3MGS D;  3MGQ C;  4R8P B;  3O62 A;  3UTB D;  1EQZ A;  5CPI C;  2CV5 A;  3AV2 B;  2FJ7 B;  5AVC A;  4ZUX A;  2YFV B;  5B32 G;  1TZY D;  4YS3 C;  3AZF B;  1U35 C;  2Y2J A;  3X1S C;  4UUZ A;  1KX4 C;  5AV5 D;  5GT3 A;  1U35 A;  4KHA B;  3AZE D;  3KXB B;  2Y2K A;  4NE3 A;  1AOI C;  4HGA C;  1ZLA A;  1TZY B;  1KX4 A;  2NQB A;  4Z66 D;  4DQY B;  3REK C;  4DRA A;  1F66 A;  3REJ C;  1P3G D;  5GT0 A;  5AV9 C;  1P3B C;  3REK A;  2F8N A;  3AZE B;  5DNM C;  4JJN D;  3REI D;  4G92 B;  3REH D;  5AV9 A;  3AZH A;  5CPK B;  4WJ3 C;  4Z66 B;  1P3B A;  3AYW D;  1P3G B;  3REL A;  4X23 B;  5CPJ D;  4J8W B;  2HIO C;  3VH6 T;  3AFA A;  3B0C W;  4JJN B;  4WU8 C;  3UT9 D;  2JE5 A;  2ARO C;  2HIO A;  2NZD A;  5BT1 D;  3UTA C;  3MGP C;  4J8V D;  5CPJ B;  1M19 B;  2PYO A;  3O62 D;  1EQZ D;  3W99 D;  3MNN A;  2CV5 D;  1P3A A;  3A6N C;  4ZUX D;  4LD9 A;  5B1M C;  3O62 B;  1EQZ B;  4YS3 D;  3C1B A;  2CV5 B;  1U35 D;  4H9S A;  3A1K A;  5AVC B;  4ZUX B;  5B2I C;  3C1C A;  3AV1 C;  1KX4 D;  4UPK A;  2Y2Q A;  3B6G A;  4UUZ B; 
#chains in the Genus database with same CATH homology
 5FUG A;  3AV1 A;  5GT3 B;  3REK D;  1U35 B;  1Q9C A;  2F8N D;  2HUE B;  1P3M C;  1ZLA B;  5AV9 D;  4KGC A;  1KX4 B;  2NQB B;  1P3B D;  1F66 B;  4WNN A;  1KX5 A;  5GT0 B;  4H9R A;  1A7W A;  3REK B;  3AFA D;  3X1V A;  3AV2 C;  2F8N B;  2FJ7 C;  5AV9 B;  3AZF C;  3AZH B;  2Y2L A;  2HIO D;  1P3B B;  2NZD D;  1BFM A;  3REL B;  5AV8 A;  4WU8 D;  3R45 A;  3LZ0 A;  2ARO D;  2G5H C;  3KXB C;  3AFA B;  1WWS A;  1TZY C;  1P3L C;  5JRG A;  2HIO B;  2NZD B;  1P3P A;  5B0Z C;  1P3O A;  5B33 C;  2PYO B;  2FFF B;  3A6N D;  2ARO B;  5B0Z A;  3MNN B;  2ZM5 A;  4G92 C;  1P3A B;  5CPK C;  1M18 A;  5B33 A;  4Z66 C;  5B1M D;  3C1C D;  4X23 C;  4LD9 B;  4J8W C;  1M1A C;  3AV1 D;  3W96 C;  3C1B B;  3V9R A;  1M1A A;  2YFW A;  3C1C B;  3W96 A;  5CPJ C;  1M19 C;  3B6G B;  2LY8 A;  5FUG B;  3AV1 B;  4Z5T A;  3X1V D;  2BYM A;  1KX3 A;  5B24 A;  4KGC B;  2CWE A;  2ZY3 A;  4J8X A;  4WNN B;  3O62 C;  4H9Q A;  3AV2 D;  2FJ7 D;  1KX5 B;  1HQ3 C;  1EQZ C;  5AV8 D;  4H9R B;  5BNX A;  3AZF D;  3B0D B;  3EG5 B;  3AZG C;  3X1V B;  5AVC C;  4ZUX C;  3B0C T;  1HQ3 A;  3AZG A;  1P3P D;  3KXB D;  1H3O B;  3AZN A;  3X1U C;  5AV8 B;  3A1I A;  3R45 B;  4WU9 A;  5GT3 C;  2J8P A;  5AV6 C;  3LZ0 B;  1P3L D;  2HUE C;  5B0Z D;  1M18 D;  1ZLA C;  3X1U A;  5B33 D;  2NQB C;  5JRG B;  4Z2M G;  1P3F A;  1F66 C;  5AV6 A;  1P3P B;  4DRB A;  1P3O B;  5GT0 C;  4E45 A;  5CPK D;  4H9N A;  1P3L B;  2F8N K;  5B0Z B;  2DQN C;  3AZH C;  4X23 D;  1M18 B;  5B33 B;  4J8W D;  1M1A D;  3KUY A;  5G49 A;  5B1L A;  3REL C;  3W96 D;  1P3I A;  3AFA C;  1ULY A;  3KFU G;  1M19 D;  3V9R B;  1M1A B;  2NZD C;  5AY8 A;  2YFW B;  3AZM A;  2Y2G A;  2PYO C;  4J8X D;  3B6F C;  3W96 B;  4KUD A;  3WAA C;  4NE5 A;  3MNN C;  3MVD A;  1P3A C;  4Z5T B;  1KX3 B;  2BYM B;  1WWI A;  3B6F A;  5B24 B;  3WAA A;  1HQ3 D;  3W97 C;  4LD9 C;  4J8X B;  3AZG D;  3EPJ A;  4H9Q B;  5AVC D;  5BNX B;  3C1B C;  3W97 A;  4NE6 A;  4H9S C;  2F2A C;  5E5A A;  5F99 A;  3C1C C;  1HQ3 B;  3H0L C;  3VH6 A;  3X1U D;  3AZI C;  5GT3 D;  3B6G C;  5AV6 D;  3AZG B;  2XD1 A;  3AZN B;  1ZLA D;  4Z2M H;  3AZI A;  4WU9 B;  2NQB D;  1F66 D;  4YM6 A;  1PZR A;  5GT0 D;  4E44 A;  4KGC C;  3X1U B;  2IO5 B;  5B31 A;  1P3F B;  4AWL C;  5AV6 B;  1ID3 C;  3KUY D;  1KX5 C;  3VH5 T;  3AZH D;  1P3I D;  3B0D C;  4H9N B;  3LZ1 A;  1TAF A;  3X1V C;  3AZK C;  1ID3 A;  3REL D;  4XZQ A;  1P3K C;  1W2E A;  3AZK A;  4NFT A;  3KUY B;  5G49 B;  5B1L B;  3LEL A;  1S32 A;  5AV8 C;  1P3I B;  1P3K A;  2Y2I A;  4CSR A;  3LZ0 C;  2PYO D;  5JRG C;  3B6F D;  3W98 C;  5GSU A;  3AZJ A;  1F1E A;  5BS7 A;  5AY8 B;  1P3P C;  3VH6 W;  1P3O C;  3WAA D;  3MNN D;  5C3I C;  3AZM B;  1P3A D;  3KSY A;  3VH5 A;  2F8N G;  4KUD B;  3W98 A;  5B32 A;  5AVB A;  3MVD B;  1M18 C;  3W97 D;  4LD9 D;  4J8U C;  3B6F B;  3WAA B;  5F99 D;  3C1B D;  3KWQ C;  4J8U A;  1BH8 A;  3AZI D;  3W97 B;  2UWX A;  5B0Y C;  3B6G D;  4YM6 D;  3KWQ A;  5B40 A;  2Y2N A;  3MGR A;  5BNV A;  4QLC A;  3NQU A;  5F99 B;  5B31 D;  3MGS A;  5B0Y A;  4ZBJ B;  3UTB A;  5GXQ A;  4KGC D;  3AZI B;  4Z5T C;  3LZ1 D;  1KX3 C;  5B24 C;  4YM6 B;  1ID3 D;  1KX5 D;  2ZY5 A;  4XZQ D;  5B31 B;  3TU4 C;  4J8X C;  4CAY A;  3FDD A;  3AZK D;  3LEL D;  5AV5 A;  1P3K D;  3LZ1 B;  3TU4 A;  1TAF B;  3AL0 C;  5B2J A;  4AWL B;  1ID3 B;  3B0B A;  4XZQ B;  2G5I C;  3LZ0 D;  3AZK B;  3AZN C;  1S32 B;  3LEL B;  1P34 C;  4WU9 C;  1P3K B;  4CSR B;  5JRG D;  3W98 D;  5B32 D;  3REI A;  1P3O D;  3REH A;  2F8N H;  2IO5 C;  4M6B A;  1P34 A;  1P3F C;  3AYW A;  2JSS A;  5GSU B;  1JFI A;  3AZJ B;  2BYK A;  2Y2M A;  5KDM A;  3W98 B;  4J8U D;  5B32 B;  5AVB B;  3UT9 A;  5C3I B;  3KWQ D;  2JCH A;  3X1T C;  3KUY C;  5B1L C;  5DNN A;  5CHL B;  4G91 B;  4J8V A;  1P3I C;  3WA9 C;  5B0Y D;  5GXQ D;  4J8U B;  3WKJ C;  3W99 A;  1T3U A;  1BH8 B;  3X1T A;  1KU5 A;  3WA9 A;  3MGQ A;  3KWQ B;  5AY8 C;  5B40 B;  3MGR B;  3WKJ A;  5BNV B;  4QLC B;  3NQU B;  3MGS B;  3AZM C;  5CPI A;  3EPH A;  2BG1 A;  4Z5T D;  1KX3 D;  4KUD C;  5B0Y B;  3UTB B;  5GXQ B;  5B24 D;  1R4V A;  1N1J A;  3MVD C;  4YS3 A;  3TU4 D;  3X1S A;  4XUJ C;  5B2J D;  3P5J B;  2ZY2 A;  1Z2C B;  5CP6 C;  4CAY B;  4XUJ A;  1AOI A;  4H9O A;  5AV5 B;  5BO0 A;  4H9P A;  3TU4 B;  3REJ A;  5CP6 A;  5E5A C;  5B2J B;  3AZN D;  5F99 C;  2VQR A;  3AN2 C;  1P34 D;  4WU9 D;  4ZBJ C;  5DNM A;  1B67 A;  3AN2 A;  1P3F D;  1HTA A;  4YM6 C;  3LJA C;  3REI B;  3REH B;  2ZY4 A;  5B31 C;  1P34 B;  3AYW B;  1JFI B;  2BYK B;  3EPK A;  5KDM B;  5DNN D;  3LJA A;  4WU8 A;  2RVQ C;  2Y2H A;  3IP4 C;  3LZ1 C;  2ARO A;  3X1T D;  3AZL C;  5B1L D;  3UTA A;  4XZQ C;  3MGP A;  3UT9 B;  3WA9 D;  3MGQ D;  4EO5 B;  3WKJ D;  1S32 C;  3LEL C;  5DNN B;  3AZL A;  5CPI D;  4J8V B;  5JA4 A;  3A6N A;  5AY8 D;  3W99 B;  3X1T B;  4WV4 B;  3AZM D;  5B1M A;  3H0R C;  3X1S D;  3WA9 B;  3WTP C;  3MGQ B;  5GSU C;  4KUD D;  3AZJ C;  5BS7 C;  1BH9 A;  3WKJ B;  2RIQ A;  3MVD D;  5CPI B;  2Y2P A;  3WTP E;  2XD5 A;  4XUJ D;  3WTP A;  1AOI D;  5B32 C;  5B2I A;  5AVB C;  1N1J B;  3NQJ A;  4YS3 B;  3X1S B;  5CP6 D;  3REJ D;  4G91 C;  4R8P C;  5DNM D;  5E5A D;  4XUJ B;  4HGA B;  4H9O B;  1P3M A;  1AOI B;  3AN2 D;  5BO0 B;  4H9P B;  4R8P A;  5CP6 B;  3REJ B;  5B40 C;  3MGR C;  2Y2O A;  4QLC C;  3MGS C;  1H3O A;  3AV2 A;  2FJ7 A;  3UTB C;  5DNM B;  2YFV A;  5E5A B;  5GXQ C;  3LJA D;  3F6T A;  4WZS B;  3AZF A;  3AN2 B;  1B6W A;  3UTA D;  3MGP D;  2RVQ D;  4KHA A;  2W8S A;  3KXB A;  5AV5 C;  3LJA B;  4WU8 B;  1TZY A;  3AZL D;  1P3L A;  3AZE C;  5B2J C;  1S32 D;  3UTA B;  3MGP B;  3VH5 W;  3AZE A;  1P3G C;  3AZL B;  5CPK A;  5JA4 B;  4Z66 A;  3A6N B;  3WTP D;  5GSU D;  3AZJ D;  5B2I D;  4JJN C;  3REI C;  1P3G A;  3REH C;  4X23 A;  5B31 G;  3EPL A;  4J8W A;  5B1M B;  3AYW C;  2DF4 C;  1BH9 B;  4JJN A;  3H0M C;  5AVB D;  3WTP B;  1P3M D;  5B2I B;  3NQJ B;  3UT9 C;  5CPJ A;  1M19 A;  4R8P D;  4EO5 C;  5BT1 C;  5DNN C;  4J8V C;  3W99 C;  5B40 D;  1P3M B;  2L5A A;  3MGR D;  4QLC D;  2CV5 C;  3MGS D;  3MGQ C;  4R8P B;  3O62 A;  3UTB D;  1EQZ A;  5CPI C;  2CV5 A;  3AV2 B;  2FJ7 B;  5AVC A;  4ZUX A;  2YFV B;  5B32 G;  1TZY D;  4YS3 C;  3AZF B;  1U35 C;  2Y2J A;  3X1S C;  4UUZ A;  1KX4 C;  5AV5 D;  5GT3 A;  1U35 A;  4KHA B;  3AZE D;  3KXB B;  2Y2K A;  4NE3 A;  1AOI C;  4HGA C;  1ZLA A;  1TZY B;  1KX4 A;  2NQB A;  4Z66 D;  4DQY B;  3REK C;  4DRA A;  1F66 A;  3REJ C;  1P3G D;  5GT0 A;  5AV9 C;  1P3B C;  3REK A;  2F8N A;  3AZE B;  5DNM C;  4JJN D;  3REI D;  4G92 B;  3REH D;  5AV9 A;  3AZH A;  5CPK B;  4WJ3 C;  4Z66 B;  1P3B A;  3AYW D;  1P3G B;  3REL A;  4X23 B;  5CPJ D;  4J8W B;  2HIO C;  3VH6 T;  3AFA A;  3B0C W;  4JJN B;  4WU8 C;  3UT9 D;  2JE5 A;  2ARO C;  2HIO A;  2NZD A;  5BT1 D;  3UTA C;  3MGP C;  4J8V D;  5CPJ B;  1M19 B;  2PYO A;  3O62 D;  1EQZ D;  3W99 D;  3MNN A;  2CV5 D;  1P3A A;  3A6N C;  4ZUX D;  4LD9 A;  5B1M C;  3O62 B;  1EQZ B;  4YS3 D;  3C1B A;  2CV5 B;  1U35 D;  4H9S A;  3A1K A;  5AVC B;  4ZUX B;  5B2I C;  3C1C A;  3AV1 C;  1KX4 D;  4UPK A;  2Y2Q A;  3B6G A;  4UUZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...