3C1CC

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1cC00
4WU9B 5KDMA 4H9PB 3UTBB 1KX5B 4KUDB 3TU4D 3AZGB 2HIOB 4WNNA 3R45B 5B1LD 2F8NB 5CPKA 2YFVB 5B32D 3X1TD 3V9RA 5GT0D 5B2IA 4KGCB 1KX3C 4X23B 3REIB 4J8XC 2AROB 4J8UB 3A6NA 1P3GB 4QLCA 1B67A 3LJAD 3UTAD 3MVDC 2RVQC 1TAFB 4H9RB 4G92B 3AZLD 5CPJA 1P3MB 5F99B 4Z2MG 4WU8C 3VH6W 5JRGA 5B2JB 1ZLAD 5B0YC 3AZHA 4LD9C 3VH5T 2YFWB 3LELD 4WV4B 4J8WC 3W98B 3TU4A 3AZED 1P34D 5DNND 5BT1D 3VH6A 5B31G 3X1SC 1ID3C 5B1LA 3W97D 3WTPB 3LZ0C 3NQUB 5B32A 5GT0A 2HUEB 3MGSB 4J8VC 5GXQA 4WU9C 3WAAA 3UTBC 1KX5C 4KUDC 5G49A 4CAYA 3AN2B 1M18A 5AV6D 3REHA 2HIOC 3LJAA 3UTAA 5JA4A 3AZGC 3B6GB 3RELD 3UT9B 3LZ1B 3REKD 3MNND 4YM6D 4X23C 2AROC 4J8UC 1P3GC 1ZLAA 1M1AB 3O62D 3AFAA 3MVDD 5BS7A 3LELA 1U35B 1P3MC 4G92C 3AZEA 1JFIA 1P34A 5F99C 4XZQA 5AV5B 3AZIB 4R8PB 4WU8D 3W97A 4JJNB 5B2JC 1P3FB 4LD9D 5CPIB 3AV1B 2BYMA 4J8WD 3AZMB 3W98C 3X1SD 5AV6A 1ID3D 3W99B 4H9SA 3NQJB 2LY8A 4H9NA 4CSRA 3WTPC 3RELA 5CP6B 3REKA 1WWSA 3MNNA 5AV8B 2HUEC 4YM6A 3MGSC 4J8VD 4WU9D 5B40B 1H3OA 1KX5D 4KUDD 3MGRA 1A7WA 3X1VD 3AZGD 3O62A 2HIOD 1M19D 1F66A 3MVDA 3C1BA 2F8ND 3B6GC 1BH9A 3UT9C 3LZ1C 4KGCD 4X23D 3REID 1KX3B 1P3AC 1P3GD 1M1AC 2NZDD 4LD9A 5BNVB 3KUYD 4Z66A 5GT3B 4J8WA 4E44A 1U35C 1P3MD 4XUJD 3X1SA 3C1CB 3X1UB 1ID3A 3AZIC 4R8PC 3KWQC 5B2JD 4JJNC 1KX4D 1TZYB 1P3FC 5CPIC 3AV1C 4H9PA 3W98D 4KUDA 3AZMC 2NQBD 3X1VA 2FJ7D 3AZGA 2HIOA 1M19A 1ULYA 3R45A 4H9QB 5E5AB 3B0CT 5CP6C 4KGCA 4ZBJB 5AY8B 5AV8C 4X23A 3KSYA 1HTAA 3MGSD 3REIA 5CHLB 1P3GA 5AV9B 3MGPB 4Z5TC 5BO0A 3B0BA 3AN2D 2NZDA 3B6GD 3KUYA 3LZ1D 1TAFA 3WKJB 2CV5B 4XUJA 3MGQB 1P3KB 4ZUXC 5B2JA 3REJB 1M1AD 1KX4A 3B6FA 3VH5W 1AOID 1U35D 5GT3C 3W98A 1P3PB 2NQBA 4WZSB 2FJ7A 4DRAA 5AV5D 3C1CC 4R8PD 3AZID 3X1UC 5AVBC 5C3IB 4JJND 3KXBB 3VH5A 3W96B 2F8NH 1S32C 1TZYC 1P3FD 3MGSA 3AZJD 5CPID 3AZFB 3AV1D 1P3BD 2PYOA 4G91B 3AZMD 3AV2B 3AN2A 5B33D 3W99D 3WTPE 4H9OB 3WA9D 3B6GA 4YS3C 5E5AC 5KDMB 5CP6D 5AV8D 4ZBJC 5AY8C 3X1TA 3AYWB 4WNNB 1EQZD 5B40D 1WWIA 5AV9C 5B24B 3MGPC 1M1AA 1AOIA 5B0ZB 5B31B 4QLCB 3AZLA 2CV5C 3WKJC 1KX3D 3MGQC 5AV5A 4R8PA 1P3KC 4J8XD 1P3AB 4JJNA 3REJC 5CPJB 2BYKA 1P3FA 1P3LC 3AZJA 5CPIA 3AV1A 5B32G 1P3BA 5GSUC 5JRGB 3AZMA 2RVQD 1P3PC 5B33A 2IO5B 3AZHB 3W99A 5DNNA 3WA9A 3NQJA 3KWQB 5C3IC 1TZYD 3W96C 5AV8A 5B0YD 3KXBC 1EQZC 3B0DB 1EQZA 5B40A 3AZFC 4NE6A 4AWLB 4G91C 3AV2C 5DNMB 5GXQB 3WAAB 3LZ0D 1BH8A 5FUGA 5AY8D 4CAYB 1M18B 1KX3A 3AYWC 3REHB 3LJAB 4NFTA 1KU5A 5JA4B 4J8XA 5AV9D 1B6WA 5B24C 3UTBD 4Z5TB 5B2IC 4UUZA 1ZLAB 5B0ZC 4QLCC 5B31C 3WKJD 3MGQD 3AFAB 1P3KD 4ZUXB 2AROD 4WU8A 3LELB 4J8UD 5B0YA 5CPJC 1JFIB 1P34B 4XZQB 1P3OB 3W97B 4E45A 5JRGC 1P3PD 5F99D 2IO5C 3AZHC 4DRBA 4KHAA 3B0CW 5AVBB 3LZ0A 3KXBD 3W96D 1P3IB 5AY8A 1S32B 5AV6B 3B0DC 3AZFD 5B1LC 4CSRB 4J8VA 4AWLC 4WU9A 3MNNB 3UTBA 1KX5A 4YM6B 5DNMC 5GXQC 3WTPD 3WAAC 4YS3B 2F8NA 3MGRB 2YFVA 3WKJA 3MGQA 3AYWD 3O62B 1M18C 1F66B 3C1BB 3REHC 3LJAC 1N1JB 2AROA 4NE3A 1BH9B 5B24D 4J8UA 5B1MB 5B0ZD 4QLCD 5B31D 3UT9D 1ZLAC 1P3PA 4H9RA 1P3MA 3AFAC 5F99A 1P3AD 4Z66B 3LELC 3W96A 3KXBA 1P34C 5AVCB 4XZQC 5BT1C 1P3LB 3AZKB 1P3OC 3W97C 2YFWA 5BNXB 5GSUB 3KWQD 1R4VA 3WTPA 3NQUA 3X1VB 1P3IC 4HGAB 3AYWA 1M19B 5AV6C 3AZNB 4H9SC 3RELC 1HQ3B 5B24A 3REKC 3MNNC 5DNMD 4YM6C 5GXQD 3WAAD 5B0ZA 5B31A 3UT9A 5BO0B 3LZ1A 3MGRC 1M18D 2NZDB 3O62C 3REHD 1F66C 3C1BC 3KUYB 1P3AA 5CPKB 4Z5TD 4XUJB 3V9RB 5B2IB 2CWEA 5B1MC 1U35A 3A6NB 1KX4B 3AFAD 3B6FB 4ZUXD 3AZIA 3KWQA 4Z66C 2NQBB 2FJ7B 4XZQD 4Z2MH 5AVCC 1P3OD 1Q9CA 3AZKC 5GT3D 3VH6T 5DNMA 3C1CD 3X1UD 2PYOB 5AVBD 1P3ID 5CP6A 3X1VC 1S32D 3TU4B 4HGAC 1M19C 3AZNC 5B1LB 1HQ3C 4Z5TA 4KGCC 5B32B 3X1TB 5GT0B 3REIC 4YS3D 5E5AD 3MGRD 1F66D 3C1BD 5G49B 1AOIB 2NZDC 4ZUXA 3KUYC 3UTAB 5CPKC 3MGPD 3AZLB 4XUJC 5B1MD 1P3OA 5BNVA 5GT3A 2BYKB 1KX4C 3A6NC 4EO5B 2CV5D 3B6FC 3AZJB 3C1CA 2JSSA 3X1UA 1P3BB 4Z66D 5AVBA 3REJD 1P3IA 2NQBC 1S32A 1TZYA 5B33B 3AZEB 5AVCD 2FJ7C 1P3LD 5DNNB 3AZKD 3WA9B 5GSUD 1EQZB 2PYOC 4YS3A 4H9QA 5E5AA 2BYMB 3AN2C 3TU4C 3AZND 1N1JA 1HQ3D 1BH8B 4H9NB 5FUGB 3RELB 5AV9A 3MGPA 3REKB 5B32C 3AV2D 3X1TC 5GT0C 5B1MA 4J8XB 1H3OB 4UUZB 2CV5A 1P3KA 1AOIC 3MVDB 3UTAC 5CPKD 3REJA 5B2ID 4M6BA 3AZLC 5AVCA 5AV5C 1P3LA 3AZKA 2F8NK 4WU8B 5BNXA 5GSUA 1BFMA 3A6ND 5B0YB 3B6FD 4EO5C 3AZJC 4LD9B 1P3BC 4NE5A 5BS7C 4J8WB 5CPJD 5B33C 3AZEC 3X1SB 3W99C 3AZNA 2F8NG 5DNNC 2L5AA 3WA9C 1ID3B 4KHAB 3AZFA 1HQ3A 3LZ0B 5JRGD 1F1EA 3AV2A 3AZHD 2PYOD 4H9OA 5B40C 4J8VB
chains in the Genus database with same CATH superfamily
4WU9B 5KDMA 4H9PB 3UTBB 1KX5B 4KUDB 3TU4D 4UPKA 3AZGB 2HIOB 4WNNA 3R45B 5B1LD 2F8NB 5CPKA 2PYOD 2YFVB 5B32D 3X1TD 3V9RA 5GT0D 5B2IA 4KGCB 1KX3C 4WJ3C 2J8PA 4X23B 3REIB 4J8XC 2AROB 4J8UB 3A6NA 1P3GB 4QLCA 1B67A 3LJAD 3UTAD 3MVDC 2RVQC 1TAFB 4H9RB 4G92B 3AZLD 5CPJA 1P3MB 3H0LC 5F99B 4Z2MG 4WU8C 3VH6W 5JRGA 5B2JB 1ZLAD 5B0YC 3AZHA 4LD9C 3VH5T 2YFWB 2G5HC 3EPJA 3LELD 4WV4B 4J8WC 3W98B 3TU4A 3AZED 1P34D 5DNND 5BT1D 3VH6A 5B31G 3X1SC 1ID3C 5B1LA 3W97D 3WTPB 3LZ0C 3NQUB 5B32A 5GT0A 2HUEB 3MGSB 3KFUG 3P5JB 4J8VC 5GXQA 4WU9C 3WAAA 3UTBC 1KX5C 4KUDC 5G49A 4CAYA 3AN2B 1M18A 5AV6D 3REHA 2HIOC 3LJAA 3UTAA 5JA4A 3AZGC 3B6GB 3RELD 3UT9B 3LZ1B 3REKD 3MNND 3A1KA 4YM6D 4X23C 2AROC 4J8UC 1P3GC 1ZLAA 1M1AB 3O62D 3AFAA 2UWXA 3MVDD 5BS7A 3LELA 1U35B 1P3MC 4G92C 3AZEA 1JFIA 1P34A 5F99C 4XZQA 5AV5B 3AZIB 4R8PB 4WU8D 3EPKA 3W97A 4JJNB 5B2JC 3IP4C 1P3FB 4LD9D 5CPIB 3AV1B 2BYMA 2W8SA 4J8WD 3AZMB 3W98C 3X1SD 5AV6A 1ID3D 3W99B 4H9SA 3NQJB 2LY8A 4H9NA 4CSRA 3WTPC 3RELA 5CP6B 3REKA 1WWSA 3MNNA 5AV8B 2HUEC 3H0RC 4YM6A 3MGSC 4J8VD 4WU9D 5B40B 1H3OA 1KX5D 4KUDD 3MGRA 1A7WA 3X1VD 3AZGD 3O62A 2HIOD 1M19D 1F66A 3MVDA 3C1BA 2F8ND 3B6GC 1BH9A 3UT9C 3LZ1C 4KGCD 4X23D 3REID 1KX3B 1P3AC 1P3GD 2Y2IA 1M1AC 2NZDD 4LD9A 5BNVB 3KUYD 4Z66A 5GT3B 4J8WA 4E44A 1U35C 1P3MD 4XUJD 3X1SA 3C1CB 3X1UB 1ID3A 3AZIC 4R8PC 3KWQC 5B2JD 4JJNC 1KX4D 1TZYB 1P3FC 5CPIC 3AV1C 4H9PA 3W98D 4KUDA 3AZMC 2NQBD 3X1VA 2FJ7D 3AZGA 2HIOA 2Y2HA 1M19A 1ULYA 3R45A 4H9QB 2RIQA 2Y2OA 5E5AB 3B0CT 5CP6C 4KGCA 4ZBJB 5AY8B 5AV8C 4X23A 3KSYA 1HTAA 3MGSD 3REIA 5CHLB 1P3GA 5AV9B 3MGPB 4Z5TC 5BO0A 3B0BA 2ZY2A 3AN2D 2NZDA 3B6GD 3KUYA 3LZ1D 1TAFA 3WKJB 2CV5B 4XUJA 3MGQB 1P3KB 4ZUXC 5B2JA 3REJB 1M1AD 1KX4A 3B6FA 2Y2LA 3VH5W 1AOID 1U35D 5GT3C 4DQYB 3W98A 1P3PB 2NQBA 4WZSB 2FJ7A 4DRAA 5AV5D 3C1CC 4R8PD 3AZID 3X1UC 5AVBC 5C3IB 4JJND 3KXBB 3VH5A 3W96B 2Y2KA 2F8NH 1S32C 1TZYC 1P3FD 2Y2NA 3MGSA 3AZJD 5CPID 3AZFB 3AV1D 1P3BD 2PYOA 2ZM5A 4G91B 3AZMD 3AV2B 3AN2A 5B33D 3W99D 3WTPE 4H9OB 3WA9D 3B6GA 3A1IA 4YS3C 5E5AC 5KDMB 5CP6D 5AV8D 4ZBJC 5AY8C 3X1TA 3AYWB 4WNNB 1EQZD 5B40D 2XD5A 1WWIA 5AV9C 5B24B 3MGPC 1M1AA 3AL0C 1AOIA 5B0ZB 5B31B 4QLCB 2Y2JA 3AZLA 2CV5C 3WKJC 1KX3D 3MGQC 5AV5A 4R8PA 1P3KC 4J8XD 1P3AB 4JJNA 3REJC 5CPJB 2BYKA 2F2AC 1P3FA 1P3LC 3AZJA 5CPIA 3AV1A 5B32G 1P3BA 5GSUC 5JRGB 2DF4C 3AZMA 2RVQD 1P3PC 5B33A 2IO5B 3AZHB 3W99A 5DNNA 3WA9A 3NQJA 3KWQB 5C3IC 1TZYD 3W96C 5AV8A 5B0YD 3KXBC 1EQZC 3B0DB 1EQZA 1PZRA 5B40A 3AZFC 2Y2QA 4NE6A 4AWLB 4G91C 1T3UA 3AV2C 5DNMB 5GXQB 3WAAB 3LZ0D 1BH8A 5FUGA 5AY8D 4CAYB 1M18B 1KX3A 3AYWC 3REHB 3LJAB 4NFTA 1KU5A 5JA4B 4J8XA 5AV9D 1B6WA 5B24C 3UTBD 4Z5TB 5B2IC 4UUZA 1ZLAB 5B0ZC 4QLCC 5B31C 3WKJD 3MGQD 3AFAB 1P3KD 4ZUXB 2AROD 4WU8A 3LELB 2Y2PA 4J8UD 5B0YA 5CPJC 1JFIB 1P34B 4XZQB 1P3OB 3W97B 4E45A 5JRGC 1W2EA 1P3PD 5F99D 2IO5C 3AZHC 4DRBA 4KHAA 3B0CW 5AVBB 3LZ0A 3KXBD 3W96D 1P3IB 5AY8A 1S32B 5AV6B 3B0DC 3AZFD 5B1LC 4CSRB 4J8VA 4AWLC 4WU9A 3MNNB 3UTBA 1KX5A 4YM6B 5DNMC 5GXQC 3WAAC 3WTPD 4YS3B 2F8NA 3MGRB 2YFVA 3WKJA 3MGQA 3AYWD 3O62B 2FFFB 1M18C 1F66B 3C1BB 3REHC 3LJAC 1N1JB 2AROA 4NE3A 1BH9B 5B24D 4J8UA 5B1MB 5B0ZD 4QLCD 5B31D 3UT9D 1ZLAC 1P3PA 4H9RA 1P3MA 3AFAC 5F99A 1P3AD 4Z66B 3LELC 3W96A 3KXBA 1P34C 5AVCB 4XZQC 5BT1C 1P3LB 3AZKB 1P3OC 3W97C 2YFWA 5BNXB 1Z2CB 5GSUB 3KWQD 1R4VA 3WTPA 3NQUA 3X1VB 1P3IC 4HGAB 3AYWA 1M19B 5AV6C 3AZNB 4H9SC 3RELC 1HQ3B 5B24A 3REKC 3MNNC 5DNMD 4YM6C 3FDDA 5GXQD 3WAAD 5B0ZA 5B31A 3UT9A 5BO0B 3F6TA 3LZ1A 3MGRC 2BG1A 1M18D 2NZDB 3O62C 3REHD 1F66C 3C1BC 3KUYB 1P3AA 5CPKB 4Z5TD 4XUJB 3V9RB 5B2IB 2CWEA 5B1MC 1U35A 3A6NB 1KX4B 3AFAD 3B6FB 4ZUXD 3AZIA 3KWQA 4Z66C 2NQBB 2FJ7B 4XZQD 4Z2MH 5AVCC 1P3OD 1Q9CA 3AZKC 2Y2MA 5GT3D 2Y2GA 3VH6T 5DNMA 3C1CD 2G5IC 2ZY3A 3X1UD 2PYOB 5AVBD 1P3ID 5CP6A 3X1VC 1S32D 3TU4B 4HGAC 1M19C 3AZNC 5B1LB 1HQ3C 4Z5TA 4KGCC 5B32B 2JCHA 3H0MC 5GT0B 3REIC 3X1TB 4YS3D 5E5AD 3MGRD 2JE5A 1F66D 3C1BD 5G49B 1AOIB 2NZDC 4ZUXA 3KUYC 3UTAB 5CPKC 3MGPD 3AZLB 4XUJC 2VQRA 5B1MD 1P3OA 5BNVA 5GT3A 2BYKB 3EPLA 3A6NC 1KX4C 4EO5B 2CV5D 3B6FC 3AZJB 3C1CA 2JSSA 3X1UA 1P3BB 4Z66D 5AVBA 3REJD 1P3IA 2DQNC 2NQBC 1S32A 1TZYA 5B33B 3AZEB 5AVCD 2ZY4A 1P3LD 2FJ7C 5DNNB 3AZKD 3WA9B 5GSUD 1EQZB 2PYOC 4YS3A 4H9QA 5E5AA 2BYMB 3AN2C 3TU4C 3AZND 1N1JA 1HQ3D 1BH8B 4H9NB 5FUGB 3RELB 5AV9A 3MGPA 3REKB 5B32C 3AV2D 3X1TC 5GT0C 5B1MA 4J8XB 1H3OB 4UUZB 2CV5A 2XD1A 1P3KA 1AOIC 3MVDB 3UTAC 5CPKD 3REJA 5B2ID 4M6BA 3AZLC 5AVCA 5AV5C 1P3LA 3AZKA 2F8NK 4WU8B 5BNXA 5GSUA 1BFMA 3A6ND 5B0YB 3B6FD 3EPHA 4EO5C 3AZJC 4LD9B 1P3BC 4NE5A 5BS7C 4J8WB 5CPJD 5B33C 3AZEC 3X1SB 3W99C 3AZNA 2F8NG 5DNNC 2L5AA 3WA9C 1ID3B 4KHAB 3AZFA 1HQ3A 3LZ0B 5JRGD 3EG5B 1F1EA 3AV2A 3AZHD 2ZY5A 4H9OA 5B40C 4J8VB
chains in the Genus database with same CATH topology
4WU9B 5KDMA 4H9PB 3UTBB 1KX5B 4KUDB 3TU4D 4UPKA 3AZGB 2HIOB 4WNNA 3R45B 5B1LD 2F8NB 5CPKA 2PYOD 2YFVB 5B32D 3X1TD 3V9RA 5GT0D 5B2IA 4KGCB 1KX3C 4WJ3C 2J8PA 4X23B 3REIB 4J8XC 2AROB 4J8UB 3A6NA 1P3GB 4QLCA 1B67A 3LJAD 3UTAD 3MVDC 2RVQC 1TAFB 4H9RB 4G92B 3AZLD 5CPJA 1P3MB 3H0LC 5F99B 4Z2MG 4WU8C 3VH6W 5JRGA 5B2JB 1ZLAD 5B0YC 3AZHA 4LD9C 3VH5T 2YFWB 2G5HC 3EPJA 3LELD 4WV4B 4J8WC 3W98B 3TU4A 3AZED 1P34D 5DNND 5BT1D 3VH6A 5B31G 3X1SC 1ID3C 5B1LA 3W97D 3WTPB 3LZ0C 3NQUB 5B32A 5GT0A 2HUEB 3MGSB 3KFUG 3P5JB 4J8VC 5GXQA 4WU9C 3WAAA 3UTBC 1KX5C 4KUDC 5G49A 4CAYA 3AN2B 1M18A 5AV6D 3REHA 2HIOC 3LJAA 3UTAA 5JA4A 3AZGC 3B6GB 3RELD 3UT9B 3LZ1B 3REKD 3MNND 3A1KA 4YM6D 4X23C 2AROC 4J8UC 1P3GC 1ZLAA 1M1AB 3O62D 3AFAA 2UWXA 3MVDD 5BS7A 3LELA 1U35B 1P3MC 4G92C 3AZEA 1JFIA 1P34A 5F99C 4XZQA 5AV5B 3AZIB 4R8PB 4WU8D 3EPKA 3W97A 4JJNB 5B2JC 3IP4C 1P3FB 4LD9D 5CPIB 3AV1B 2BYMA 2W8SA 4J8WD 3AZMB 3W98C 3X1SD 5AV6A 1ID3D 3W99B 4H9SA 3NQJB 2LY8A 4H9NA 4CSRA 3WTPC 3RELA 5CP6B 3REKA 1WWSA 3MNNA 5AV8B 2HUEC 3H0RC 4YM6A 3MGSC 4J8VD 4WU9D 5B40B 1H3OA 1KX5D 4KUDD 3MGRA 1A7WA 3X1VD 3AZGD 3O62A 2HIOD 1M19D 1F66A 3MVDA 3C1BA 2F8ND 3B6GC 1BH9A 3UT9C 3LZ1C 4KGCD 4X23D 3REID 1KX3B 1P3AC 1P3GD 2Y2IA 1M1AC 2NZDD 4LD9A 5BNVB 3KUYD 4Z66A 5GT3B 4J8WA 4E44A 1U35C 1P3MD 4XUJD 3X1SA 3C1CB 3X1UB 1ID3A 3AZIC 4R8PC 3KWQC 5B2JD 4JJNC 1KX4D 1TZYB 1P3FC 5CPIC 3AV1C 4H9PA 3W98D 4KUDA 3AZMC 2NQBD 3X1VA 2FJ7D 3AZGA 2HIOA 2Y2HA 1M19A 1ULYA 3R45A 4H9QB 2RIQA 2Y2OA 5E5AB 3B0CT 5CP6C 4KGCA 4ZBJB 5AY8B 5AV8C 4X23A 3KSYA 1HTAA 3MGSD 3REIA 5CHLB 1P3GA 5AV9B 3MGPB 4Z5TC 5BO0A 3B0BA 2ZY2A 3AN2D 2NZDA 3B6GD 3KUYA 3LZ1D 1TAFA 3WKJB 2CV5B 4XUJA 3MGQB 1P3KB 4ZUXC 5B2JA 3REJB 1M1AD 1KX4A 3B6FA 2Y2LA 3VH5W 1AOID 1U35D 5GT3C 4DQYB 3W98A 1P3PB 2NQBA 4WZSB 2FJ7A 4DRAA 5AV5D 3C1CC 4R8PD 3AZID 3X1UC 5AVBC 5C3IB 4JJND 3KXBB 3VH5A 3W96B 2Y2KA 2F8NH 1S32C 1TZYC 1P3FD 2Y2NA 3MGSA 3AZJD 5CPID 3AZFB 3AV1D 1P3BD 2PYOA 2ZM5A 4G91B 3AZMD 3AV2B 3AN2A 5B33D 3W99D 3WTPE 4H9OB 3WA9D 3B6GA 3A1IA 4YS3C 5E5AC 5KDMB 5CP6D 5AV8D 4ZBJC 5AY8C 3X1TA 3AYWB 4WNNB 1EQZD 5B40D 2XD5A 1WWIA 5AV9C 5B24B 3MGPC 1M1AA 3AL0C 1AOIA 5B0ZB 5B31B 4QLCB 2Y2JA 3AZLA 2CV5C 3WKJC 1KX3D 3MGQC 5AV5A 4R8PA 1P3KC 4J8XD 1P3AB 4JJNA 3REJC 5CPJB 2BYKA 2F2AC 1P3FA 1P3LC 3AZJA 5CPIA 3AV1A 5B32G 1P3BA 5GSUC 5JRGB 2DF4C 3AZMA 2RVQD 1P3PC 5B33A 2IO5B 3AZHB 3W99A 5DNNA 3WA9A 3NQJA 3KWQB 5C3IC 1TZYD 3W96C 5AV8A 5B0YD 3KXBC 1EQZC 3B0DB 1EQZA 1PZRA 5B40A 3AZFC 2Y2QA 4NE6A 4AWLB 4G91C 1T3UA 3AV2C 5DNMB 5GXQB 3WAAB 3LZ0D 1BH8A 5FUGA 5AY8D 4CAYB 1M18B 1KX3A 3AYWC 3REHB 3LJAB 4NFTA 1KU5A 5JA4B 4J8XA 5AV9D 1B6WA 5B24C 3UTBD 4Z5TB 5B2IC 4UUZA 1ZLAB 5B0ZC 4QLCC 5B31C 3WKJD 3MGQD 3AFAB 1P3KD 4ZUXB 2AROD 4WU8A 3LELB 2Y2PA 4J8UD 5B0YA 5CPJC 1JFIB 1P34B 4XZQB 1P3OB 3W97B 4E45A 5JRGC 1W2EA 1P3PD 5F99D 2IO5C 3AZHC 4DRBA 4KHAA 3B0CW 5AVBB 3LZ0A 3KXBD 3W96D 1P3IB 5AY8A 1S32B 5AV6B 3B0DC 3AZFD 5B1LC 4CSRB 4J8VA 4AWLC 4WU9A 3MNNB 3UTBA 1KX5A 4YM6B 5DNMC 5GXQC 3WAAC 3WTPD 4YS3B 2F8NA 3MGRB 2YFVA 3WKJA 3MGQA 3AYWD 3O62B 2FFFB 1M18C 1F66B 3C1BB 3REHC 3LJAC 1N1JB 2AROA 4NE3A 1BH9B 5B24D 4J8UA 5B1MB 5B0ZD 4QLCD 5B31D 3UT9D 1ZLAC 1P3PA 4H9RA 1P3MA 3AFAC 5F99A 1P3AD 4Z66B 3LELC 3W96A 3KXBA 1P34C 5AVCB 4XZQC 5BT1C 1P3LB 3AZKB 1P3OC 3W97C 2YFWA 5BNXB 1Z2CB 5GSUB 3KWQD 1R4VA 3WTPA 3NQUA 3X1VB 1P3IC 4HGAB 3AYWA 1M19B 5AV6C 3AZNB 4H9SC 3RELC 1HQ3B 5B24A 3REKC 3MNNC 5DNMD 4YM6C 3FDDA 5GXQD 3WAAD 5B0ZA 5B31A 3UT9A 5BO0B 3F6TA 3LZ1A 3MGRC 2BG1A 1M18D 2NZDB 3O62C 3REHD 1F66C 3C1BC 3KUYB 1P3AA 5CPKB 4Z5TD 4XUJB 3V9RB 5B2IB 2CWEA 5B1MC 1U35A 3A6NB 1KX4B 3AFAD 3B6FB 4ZUXD 3AZIA 3KWQA 4Z66C 2NQBB 2FJ7B 4XZQD 4Z2MH 5AVCC 1P3OD 1Q9CA 3AZKC 2Y2MA 5GT3D 2Y2GA 3VH6T 5DNMA 3C1CD 2G5IC 2ZY3A 3X1UD 2PYOB 5AVBD 1P3ID 5CP6A 3X1VC 1S32D 3TU4B 4HGAC 1M19C 3AZNC 5B1LB 1HQ3C 4Z5TA 4KGCC 5B32B 2JCHA 3H0MC 5GT0B 3REIC 3X1TB 4YS3D 5E5AD 3MGRD 2JE5A 1F66D 3C1BD 5G49B 1AOIB 2NZDC 4ZUXA 3KUYC 3UTAB 5CPKC 3MGPD 3AZLB 4XUJC 2VQRA 5B1MD 1P3OA 5BNVA 5GT3A 2BYKB 3EPLA 3A6NC 1KX4C 4EO5B 2CV5D 3B6FC 3AZJB 3C1CA 2JSSA 3X1UA 1P3BB 4Z66D 5AVBA 3REJD 1P3IA 2DQNC 2NQBC 1S32A 1TZYA 5B33B 3AZEB 5AVCD 2ZY4A 1P3LD 2FJ7C 5DNNB 3AZKD 3WA9B 5GSUD 1EQZB 2PYOC 4YS3A 4H9QA 5E5AA 2BYMB 3AN2C 3TU4C 3AZND 1N1JA 1HQ3D 1BH8B 4H9NB 5FUGB 3RELB 5AV9A 3MGPA 3REKB 5B32C 3AV2D 3X1TC 5GT0C 5B1MA 4J8XB 1H3OB 4UUZB 2CV5A 2XD1A 1P3KA 1AOIC 3MVDB 3UTAC 5CPKD 3REJA 5B2ID 4M6BA 3AZLC 5AVCA 5AV5C 1P3LA 3AZKA 2F8NK 4WU8B 5BNXA 5GSUA 1BFMA 3A6ND 5B0YB 3B6FD 3EPHA 4EO5C 3AZJC 4LD9B 1P3BC 4NE5A 5BS7C 4J8WB 5CPJD 5B33C 3AZEC 3X1SB 3W99C 3AZNA 2F8NG 5DNNC 2L5AA 3WA9C 1ID3B 4KHAB 3AZFA 1HQ3A 3LZ0B 5JRGD 3EG5B 1F1EA 3AV2A 3AZHD 2ZY5A 4H9OA 5B40C 4J8VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU9 B;  5KDM A;  4H9P B;  3UTB B;  1KX5 B;  4KUD B;  3TU4 D;  3AZG B;  2HIO B;  4WNN A;  3R45 B;  5B1L D;  2F8N B;  5CPK A;  2YFV B;  5B32 D;  3X1T D;  3V9R A;  5GT0 D;  5B2I A;  4KGC B;  1KX3 C;  4X23 B;  3REI B;  4J8X C;  2ARO B;  4J8U B;  3A6N A;  1P3G B;  4QLC A;  1B67 A;  3LJA D;  3UTA D;  3MVD C;  2RVQ C;  1TAF B;  4H9R B;  4G92 B;  3AZL D;  5CPJ A;  1P3M B;  5F99 B;  4Z2M G;  4WU8 C;  3VH6 W;  5JRG A;  5B2J B;  1ZLA D;  5B0Y C;  3AZH A;  4LD9 C;  3VH5 T;  2YFW B;  3LEL D;  4WV4 B;  4J8W C;  3W98 B;  3TU4 A;  3AZE D;  1P34 D;  5DNN D;  5BT1 D;  3VH6 A;  5B31 G;  3X1S C;  1ID3 C;  5B1L A;  3W97 D;  3WTP B;  3LZ0 C;  3NQU B;  5B32 A;  5GT0 A;  2HUE B;  3MGS B;  4J8V C;  5GXQ A;  4WU9 C;  3WAA A;  3UTB C;  1KX5 C;  4KUD C;  5G49 A;  4CAY A;  3AN2 B;  1M18 A;  5AV6 D;  3REH A;  2HIO C;  3LJA A;  3UTA A;  5JA4 A;  3AZG C;  3B6G B;  3REL D;  3UT9 B;  3LZ1 B;  3REK D;  3MNN D;  4YM6 D;  4X23 C;  2ARO C;  4J8U C;  1P3G C;  1ZLA A;  1M1A B;  3O62 D;  3AFA A;  3MVD D;  5BS7 A;  3LEL A;  1U35 B;  1P3M C;  4G92 C;  3AZE A;  1JFI A;  1P34 A;  5F99 C;  4XZQ A;  5AV5 B;  3AZI B;  4R8P B;  4WU8 D;  3W97 A;  4JJN B;  5B2J C;  1P3F B;  4LD9 D;  5CPI B;  3AV1 B;  2BYM A;  4J8W D;  3AZM B;  3W98 C;  3X1S D;  5AV6 A;  1ID3 D;  3W99 B;  4H9S A;  3NQJ B;  2LY8 A;  4H9N A;  4CSR A;  3WTP C;  3REL A;  5CP6 B;  3REK A;  1WWS A;  3MNN A;  5AV8 B;  2HUE C;  4YM6 A;  3MGS C;  4J8V D;  4WU9 D;  5B40 B;  1H3O A;  1KX5 D;  4KUD D;  3MGR A;  1A7W A;  3X1V D;  3AZG D;  3O62 A;  2HIO D;  1M19 D;  1F66 A;  3MVD A;  3C1B A;  2F8N D;  3B6G C;  1BH9 A;  3UT9 C;  3LZ1 C;  4KGC D;  4X23 D;  3REI D;  1KX3 B;  1P3A C;  1P3G D;  1M1A C;  2NZD D;  4LD9 A;  5BNV B;  3KUY D;  4Z66 A;  5GT3 B;  4J8W A;  4E44 A;  1U35 C;  1P3M D;  4XUJ D;  3X1S A;  3C1C B;  3X1U B;  1ID3 A;  3AZI C;  4R8P C;  3KWQ C;  5B2J D;  4JJN C;  1KX4 D;  1TZY B;  1P3F C;  5CPI C;  3AV1 C;  4H9P A;  3W98 D;  4KUD A;  3AZM C;  2NQB D;  3X1V A;  2FJ7 D;  3AZG A;  2HIO A;  1M19 A;  1ULY A;  3R45 A;  4H9Q B;  5E5A B;  3B0C T;  5CP6 C;  4KGC A;  4ZBJ B;  5AY8 B;  5AV8 C;  4X23 A;  3KSY A;  1HTA A;  3MGS D;  3REI A;  5CHL B;  1P3G A;  5AV9 B;  3MGP B;  4Z5T C;  5BO0 A;  3B0B A;  3AN2 D;  2NZD A;  3B6G D;  3KUY A;  3LZ1 D;  1TAF A;  3WKJ B;  2CV5 B;  4XUJ A;  3MGQ B;  1P3K B;  4ZUX C;  5B2J A;  3REJ B;  1M1A D;  1KX4 A;  3B6F A;  3VH5 W;  1AOI D;  1U35 D;  5GT3 C;  3W98 A;  1P3P B;  2NQB A;  4WZS B;  2FJ7 A;  4DRA A;  5AV5 D;  3C1C C;  4R8P D;  3AZI D;  3X1U C;  5AVB C;  5C3I B;  4JJN D;  3KXB B;  3VH5 A;  3W96 B;  2F8N H;  1S32 C;  1TZY C;  1P3F D;  3MGS A;  3AZJ D;  5CPI D;  3AZF B;  3AV1 D;  1P3B D;  2PYO A;  4G91 B;  3AZM D;  3AV2 B;  3AN2 A;  5B33 D;  3W99 D;  3WTP E;  4H9O B;  3WA9 D;  3B6G A;  4YS3 C;  5E5A C;  5KDM B;  5CP6 D;  5AV8 D;  4ZBJ C;  5AY8 C;  3X1T A;  3AYW B;  4WNN B;  1EQZ D;  5B40 D;  1WWI A;  5AV9 C;  5B24 B;  3MGP C;  1M1A A;  1AOI A;  5B0Z B;  5B31 B;  4QLC B;  3AZL A;  2CV5 C;  3WKJ C;  1KX3 D;  3MGQ C;  5AV5 A;  4R8P A;  1P3K C;  4J8X D;  1P3A B;  4JJN A;  3REJ C;  5CPJ B;  2BYK A;  1P3F A;  1P3L C;  3AZJ A;  5CPI A;  3AV1 A;  5B32 G;  1P3B A;  5GSU C;  5JRG B;  3AZM A;  2RVQ D;  1P3P C;  5B33 A;  2IO5 B;  3AZH B;  3W99 A;  5DNN A;  3WA9 A;  3NQJ A;  3KWQ B;  5C3I C;  1TZY D;  3W96 C;  5AV8 A;  5B0Y D;  3KXB C;  1EQZ C;  3B0D B;  1EQZ A;  5B40 A;  3AZF C;  4NE6 A;  4AWL B;  4G91 C;  3AV2 C;  5DNM B;  5GXQ B;  3WAA B;  3LZ0 D;  1BH8 A;  5FUG A;  5AY8 D;  4CAY B;  1M18 B;  1KX3 A;  3AYW C;  3REH B;  3LJA B;  4NFT A;  1KU5 A;  5JA4 B;  4J8X A;  5AV9 D;  1B6W A;  5B24 C;  3UTB D;  4Z5T B;  5B2I C;  4UUZ A;  1ZLA B;  5B0Z C;  4QLC C;  5B31 C;  3WKJ D;  3MGQ D;  3AFA B;  1P3K D;  4ZUX B;  2ARO D;  4WU8 A;  3LEL B;  4J8U D;  5B0Y A;  5CPJ C;  1JFI B;  1P34 B;  4XZQ B;  1P3O B;  3W97 B;  4E45 A;  5JRG C;  1P3P D;  5F99 D;  2IO5 C;  3AZH C;  4DRB A;  4KHA A;  3B0C W;  5AVB B;  3LZ0 A;  3KXB D;  3W96 D;  1P3I B;  5AY8 A;  1S32 B;  5AV6 B;  3B0D C;  3AZF D;  5B1L C;  4CSR B;  4J8V A;  4AWL C;  4WU9 A;  3MNN B;  3UTB A;  1KX5 A;  4YM6 B;  5DNM C;  5GXQ C;  3WTP D;  3WAA C;  4YS3 B;  2F8N A;  3MGR B;  2YFV A;  3WKJ A;  3MGQ A;  3AYW D;  3O62 B;  1M18 C;  1F66 B;  3C1B B;  3REH C;  3LJA C;  1N1J B;  2ARO A;  4NE3 A;  1BH9 B;  5B24 D;  4J8U A;  5B1M B;  5B0Z D;  4QLC D;  5B31 D;  3UT9 D;  1ZLA C;  1P3P A;  4H9R A;  1P3M A;  3AFA C;  5F99 A;  1P3A D;  4Z66 B;  3LEL C;  3W96 A;  3KXB A;  1P34 C;  5AVC B;  4XZQ C;  5BT1 C;  1P3L B;  3AZK B;  1P3O C;  3W97 C;  2YFW A;  5BNX B;  5GSU B;  3KWQ D;  1R4V A;  3WTP A;  3NQU A;  3X1V B;  1P3I C;  4HGA B;  3AYW A;  1M19 B;  5AV6 C;  3AZN B;  4H9S C;  3REL C;  1HQ3 B;  5B24 A;  3REK C;  3MNN C;  5DNM D;  4YM6 C;  5GXQ D;  3WAA D;  5B0Z A;  5B31 A;  3UT9 A;  5BO0 B;  3LZ1 A;  3MGR C;  1M18 D;  2NZD B;  3O62 C;  3REH D;  1F66 C;  3C1B C;  3KUY B;  1P3A A;  5CPK B;  4Z5T D;  4XUJ B;  3V9R B;  5B2I B;  2CWE A;  5B1M C;  1U35 A;  3A6N B;  1KX4 B;  3AFA D;  3B6F B;  4ZUX D;  3AZI A;  3KWQ A;  4Z66 C;  2NQB B;  2FJ7 B;  4XZQ D;  4Z2M H;  5AVC C;  1P3O D;  1Q9C A;  3AZK C;  5GT3 D;  3VH6 T;  5DNM A;  3C1C D;  3X1U D;  2PYO B;  5AVB D;  1P3I D;  5CP6 A;  3X1V C;  1S32 D;  3TU4 B;  4HGA C;  1M19 C;  3AZN C;  5B1L B;  1HQ3 C;  4Z5T A;  4KGC C;  5B32 B;  3X1T B;  5GT0 B;  3REI C;  4YS3 D;  5E5A D;  3MGR D;  1F66 D;  3C1B D;  5G49 B;  1AOI B;  2NZD C;  4ZUX A;  3KUY C;  3UTA B;  5CPK C;  3MGP D;  3AZL B;  4XUJ C;  5B1M D;  1P3O A;  5BNV A;  5GT3 A;  2BYK B;  1KX4 C;  3A6N C;  4EO5 B;  2CV5 D;  3B6F C;  3AZJ B;  3C1C A;  2JSS A;  3X1U A;  1P3B B;  4Z66 D;  5AVB A;  3REJ D;  1P3I A;  2NQB C;  1S32 A;  1TZY A;  5B33 B;  3AZE B;  5AVC D;  2FJ7 C;  1P3L D;  5DNN B;  3AZK D;  3WA9 B;  5GSU D;  1EQZ B;  2PYO C;  4YS3 A;  4H9Q A;  5E5A A;  2BYM B;  3AN2 C;  3TU4 C;  3AZN D;  1N1J A;  1HQ3 D;  1BH8 B;  4H9N B;  5FUG B;  3REL B;  5AV9 A;  3MGP A;  3REK B;  5B32 C;  3AV2 D;  3X1T C;  5GT0 C;  5B1M A;  4J8X B;  1H3O B;  4UUZ B;  2CV5 A;  1P3K A;  1AOI C;  3MVD B;  3UTA C;  5CPK D;  3REJ A;  5B2I D;  4M6B A;  3AZL C;  5AVC A;  5AV5 C;  1P3L A;  3AZK A;  2F8N K;  4WU8 B;  5BNX A;  5GSU A;  1BFM A;  3A6N D;  5B0Y B;  3B6F D;  4EO5 C;  3AZJ C;  4LD9 B;  1P3B C;  4NE5 A;  5BS7 C;  4J8W B;  5CPJ D;  5B33 C;  3AZE C;  3X1S B;  3W99 C;  3AZN A;  2F8N G;  5DNN C;  2L5A A;  3WA9 C;  1ID3 B;  4KHA B;  3AZF A;  1HQ3 A;  3LZ0 B;  5JRG D;  1F1E A;  3AV2 A;  3AZH D;  2PYO D;  4H9O A;  5B40 C;  4J8V B; 
#chains in the Genus database with same CATH topology
 4WU9 B;  5KDM A;  4H9P B;  3UTB B;  1KX5 B;  4KUD B;  3TU4 D;  4UPK A;  3AZG B;  2HIO B;  4WNN A;  3R45 B;  5B1L D;  2F8N B;  5CPK A;  2PYO D;  2YFV B;  5B32 D;  3X1T D;  3V9R A;  5GT0 D;  5B2I A;  4KGC B;  1KX3 C;  4WJ3 C;  2J8P A;  4X23 B;  3REI B;  4J8X C;  2ARO B;  4J8U B;  3A6N A;  1P3G B;  4QLC A;  1B67 A;  3LJA D;  3UTA D;  3MVD C;  2RVQ C;  1TAF B;  4H9R B;  4G92 B;  3AZL D;  5CPJ A;  1P3M B;  3H0L C;  5F99 B;  4Z2M G;  4WU8 C;  3VH6 W;  5JRG A;  5B2J B;  1ZLA D;  5B0Y C;  3AZH A;  4LD9 C;  3VH5 T;  2YFW B;  2G5H C;  3EPJ A;  3LEL D;  4WV4 B;  4J8W C;  3W98 B;  3TU4 A;  3AZE D;  1P34 D;  5DNN D;  5BT1 D;  3VH6 A;  5B31 G;  3X1S C;  1ID3 C;  5B1L A;  3W97 D;  3WTP B;  3LZ0 C;  3NQU B;  5B32 A;  5GT0 A;  2HUE B;  3MGS B;  3KFU G;  3P5J B;  4J8V C;  5GXQ A;  4WU9 C;  3WAA A;  3UTB C;  1KX5 C;  4KUD C;  5G49 A;  4CAY A;  3AN2 B;  1M18 A;  5AV6 D;  3REH A;  2HIO C;  3LJA A;  3UTA A;  5JA4 A;  3AZG C;  3B6G B;  3REL D;  3UT9 B;  3LZ1 B;  3REK D;  3MNN D;  3A1K A;  4YM6 D;  4X23 C;  2ARO C;  4J8U C;  1P3G C;  1ZLA A;  1M1A B;  3O62 D;  3AFA A;  2UWX A;  3MVD D;  5BS7 A;  3LEL A;  1U35 B;  1P3M C;  4G92 C;  3AZE A;  1JFI A;  1P34 A;  5F99 C;  4XZQ A;  5AV5 B;  3AZI B;  4R8P B;  4WU8 D;  3EPK A;  3W97 A;  4JJN B;  5B2J C;  3IP4 C;  1P3F B;  4LD9 D;  5CPI B;  3AV1 B;  2BYM A;  2W8S A;  4J8W D;  3AZM B;  3W98 C;  3X1S D;  5AV6 A;  1ID3 D;  3W99 B;  4H9S A;  3NQJ B;  2LY8 A;  4H9N A;  4CSR A;  3WTP C;  3REL A;  5CP6 B;  3REK A;  1WWS A;  3MNN A;  5AV8 B;  2HUE C;  3H0R C;  4YM6 A;  3MGS C;  4J8V D;  4WU9 D;  5B40 B;  1H3O A;  1KX5 D;  4KUD D;  3MGR A;  1A7W A;  3X1V D;  3AZG D;  3O62 A;  2HIO D;  1M19 D;  1F66 A;  3MVD A;  3C1B A;  2F8N D;  3B6G C;  1BH9 A;  3UT9 C;  3LZ1 C;  4KGC D;  4X23 D;  3REI D;  1KX3 B;  1P3A C;  1P3G D;  2Y2I A;  1M1A C;  2NZD D;  4LD9 A;  5BNV B;  3KUY D;  4Z66 A;  5GT3 B;  4J8W A;  4E44 A;  1U35 C;  1P3M D;  4XUJ D;  3X1S A;  3C1C B;  3X1U B;  1ID3 A;  3AZI C;  4R8P C;  3KWQ C;  5B2J D;  4JJN C;  1KX4 D;  1TZY B;  1P3F C;  5CPI C;  3AV1 C;  4H9P A;  3W98 D;  4KUD A;  3AZM C;  2NQB D;  3X1V A;  2FJ7 D;  3AZG A;  2HIO A;  2Y2H A;  1M19 A;  1ULY A;  3R45 A;  4H9Q B;  2RIQ A;  2Y2O A;  5E5A B;  3B0C T;  5CP6 C;  4KGC A;  4ZBJ B;  5AY8 B;  5AV8 C;  4X23 A;  3KSY A;  1HTA A;  3MGS D;  3REI A;  5CHL B;  1P3G A;  5AV9 B;  3MGP B;  4Z5T C;  5BO0 A;  3B0B A;  2ZY2 A;  3AN2 D;  2NZD A;  3B6G D;  3KUY A;  3LZ1 D;  1TAF A;  3WKJ B;  2CV5 B;  4XUJ A;  3MGQ B;  1P3K B;  4ZUX C;  5B2J A;  3REJ B;  1M1A D;  1KX4 A;  3B6F A;  2Y2L A;  3VH5 W;  1AOI D;  1U35 D;  5GT3 C;  4DQY B;  3W98 A;  1P3P B;  2NQB A;  4WZS B;  2FJ7 A;  4DRA A;  5AV5 D;  3C1C C;  4R8P D;  3AZI D;  3X1U C;  5AVB C;  5C3I B;  4JJN D;  3KXB B;  3VH5 A;  3W96 B;  2Y2K A;  2F8N H;  1S32 C;  1TZY C;  1P3F D;  2Y2N A;  3MGS A;  3AZJ D;  5CPI D;  3AZF B;  3AV1 D;  1P3B D;  2PYO A;  2ZM5 A;  4G91 B;  3AZM D;  3AV2 B;  3AN2 A;  5B33 D;  3W99 D;  3WTP E;  4H9O B;  3WA9 D;  3B6G A;  3A1I A;  4YS3 C;  5E5A C;  5KDM B;  5CP6 D;  5AV8 D;  4ZBJ C;  5AY8 C;  3X1T A;  3AYW B;  4WNN B;  1EQZ D;  5B40 D;  2XD5 A;  1WWI A;  5AV9 C;  5B24 B;  3MGP C;  1M1A A;  3AL0 C;  1AOI A;  5B0Z B;  5B31 B;  4QLC B;  2Y2J A;  3AZL A;  2CV5 C;  3WKJ C;  1KX3 D;  3MGQ C;  5AV5 A;  4R8P A;  1P3K C;  4J8X D;  1P3A B;  4JJN A;  3REJ C;  5CPJ B;  2BYK A;  2F2A C;  1P3F A;  1P3L C;  3AZJ A;  5CPI A;  3AV1 A;  5B32 G;  1P3B A;  5GSU C;  5JRG B;  2DF4 C;  3AZM A;  2RVQ D;  1P3P C;  5B33 A;  2IO5 B;  3AZH B;  3W99 A;  5DNN A;  3WA9 A;  3NQJ A;  3KWQ B;  5C3I C;  1TZY D;  3W96 C;  5AV8 A;  5B0Y D;  3KXB C;  1EQZ C;  3B0D B;  1EQZ A;  1PZR A;  5B40 A;  3AZF C;  2Y2Q A;  4NE6 A;  4AWL B;  4G91 C;  1T3U A;  3AV2 C;  5DNM B;  5GXQ B;  3WAA B;  3LZ0 D;  1BH8 A;  5FUG A;  5AY8 D;  4CAY B;  1M18 B;  1KX3 A;  3AYW C;  3REH B;  3LJA B;  4NFT A;  1KU5 A;  5JA4 B;  4J8X A;  5AV9 D;  1B6W A;  5B24 C;  3UTB D;  4Z5T B;  5B2I C;  4UUZ A;  1ZLA B;  5B0Z C;  4QLC C;  5B31 C;  3WKJ D;  3MGQ D;  3AFA B;  1P3K D;  4ZUX B;  2ARO D;  4WU8 A;  3LEL B;  2Y2P A;  4J8U D;  5B0Y A;  5CPJ C;  1JFI B;  1P34 B;  4XZQ B;  1P3O B;  3W97 B;  4E45 A;  5JRG C;  1W2E A;  1P3P D;  5F99 D;  2IO5 C;  3AZH C;  4DRB A;  4KHA A;  3B0C W;  5AVB B;  3LZ0 A;  3KXB D;  3W96 D;  1P3I B;  5AY8 A;  1S32 B;  5AV6 B;  3B0D C;  3AZF D;  5B1L C;  4CSR B;  4J8V A;  4AWL C;  4WU9 A;  3MNN B;  3UTB A;  1KX5 A;  4YM6 B;  5DNM C;  5GXQ C;  3WAA C;  3WTP D;  4YS3 B;  2F8N A;  3MGR B;  2YFV A;  3WKJ A;  3MGQ A;  3AYW D;  3O62 B;  2FFF B;  1M18 C;  1F66 B;  3C1B B;  3REH C;  3LJA C;  1N1J B;  2ARO A;  4NE3 A;  1BH9 B;  5B24 D;  4J8U A;  5B1M B;  5B0Z D;  4QLC D;  5B31 D;  3UT9 D;  1ZLA C;  1P3P A;  4H9R A;  1P3M A;  3AFA C;  5F99 A;  1P3A D;  4Z66 B;  3LEL C;  3W96 A;  3KXB A;  1P34 C;  5AVC B;  4XZQ C;  5BT1 C;  1P3L B;  3AZK B;  1P3O C;  3W97 C;  2YFW A;  5BNX B;  1Z2C B;  5GSU B;  3KWQ D;  1R4V A;  3WTP A;  3NQU A;  3X1V B;  1P3I C;  4HGA B;  3AYW A;  1M19 B;  5AV6 C;  3AZN B;  4H9S C;  3REL C;  1HQ3 B;  5B24 A;  3REK C;  3MNN C;  5DNM D;  4YM6 C;  3FDD A;  5GXQ D;  3WAA D;  5B0Z A;  5B31 A;  3UT9 A;  5BO0 B;  3F6T A;  3LZ1 A;  3MGR C;  2BG1 A;  1M18 D;  2NZD B;  3O62 C;  3REH D;  1F66 C;  3C1B C;  3KUY B;  1P3A A;  5CPK B;  4Z5T D;  4XUJ B;  3V9R B;  5B2I B;  2CWE A;  5B1M C;  1U35 A;  3A6N B;  1KX4 B;  3AFA D;  3B6F B;  4ZUX D;  3AZI A;  3KWQ A;  4Z66 C;  2NQB B;  2FJ7 B;  4XZQ D;  4Z2M H;  5AVC C;  1P3O D;  1Q9C A;  3AZK C;  2Y2M A;  5GT3 D;  2Y2G A;  3VH6 T;  5DNM A;  3C1C D;  2G5I C;  2ZY3 A;  3X1U D;  2PYO B;  5AVB D;  1P3I D;  5CP6 A;  3X1V C;  1S32 D;  3TU4 B;  4HGA C;  1M19 C;  3AZN C;  5B1L B;  1HQ3 C;  4Z5T A;  4KGC C;  5B32 B;  2JCH A;  3H0M C;  5GT0 B;  3REI C;  3X1T B;  4YS3 D;  5E5A D;  3MGR D;  2JE5 A;  1F66 D;  3C1B D;  5G49 B;  1AOI B;  2NZD C;  4ZUX A;  3KUY C;  3UTA B;  5CPK C;  3MGP D;  3AZL B;  4XUJ C;  2VQR A;  5B1M D;  1P3O A;  5BNV A;  5GT3 A;  2BYK B;  3EPL A;  3A6N C;  1KX4 C;  4EO5 B;  2CV5 D;  3B6F C;  3AZJ B;  3C1C A;  2JSS A;  3X1U A;  1P3B B;  4Z66 D;  5AVB A;  3REJ D;  1P3I A;  2DQN C;  2NQB C;  1S32 A;  1TZY A;  5B33 B;  3AZE B;  5AVC D;  2ZY4 A;  1P3L D;  2FJ7 C;  5DNN B;  3AZK D;  3WA9 B;  5GSU D;  1EQZ B;  2PYO C;  4YS3 A;  4H9Q A;  5E5A A;  2BYM B;  3AN2 C;  3TU4 C;  3AZN D;  1N1J A;  1HQ3 D;  1BH8 B;  4H9N B;  5FUG B;  3REL B;  5AV9 A;  3MGP A;  3REK B;  5B32 C;  3AV2 D;  3X1T C;  5GT0 C;  5B1M A;  4J8X B;  1H3O B;  4UUZ B;  2CV5 A;  2XD1 A;  1P3K A;  1AOI C;  3MVD B;  3UTA C;  5CPK D;  3REJ A;  5B2I D;  4M6B A;  3AZL C;  5AVC A;  5AV5 C;  1P3L A;  3AZK A;  2F8N K;  4WU8 B;  5BNX A;  5GSU A;  1BFM A;  3A6N D;  5B0Y B;  3B6F D;  3EPH A;  4EO5 C;  3AZJ C;  4LD9 B;  1P3B C;  4NE5 A;  5BS7 C;  4J8W B;  5CPJ D;  5B33 C;  3AZE C;  3X1S B;  3W99 C;  3AZN A;  2F8N G;  5DNN C;  2L5A A;  3WA9 C;  1ID3 B;  4KHA B;  3AZF A;  1HQ3 A;  3LZ0 B;  5JRG D;  3EG5 B;  1F1E A;  3AV2 A;  3AZH D;  2ZY5 A;  4H9O A;  5B40 C;  4J8V B; 
#chains in the Genus database with same CATH homology
 4WU9 B;  5KDM A;  4H9P B;  3UTB B;  1KX5 B;  4KUD B;  3TU4 D;  4UPK A;  3AZG B;  2HIO B;  4WNN A;  3R45 B;  5B1L D;  2F8N B;  5CPK A;  2PYO D;  2YFV B;  5B32 D;  3X1T D;  3V9R A;  5GT0 D;  5B2I A;  4KGC B;  1KX3 C;  4WJ3 C;  2J8P A;  4X23 B;  3REI B;  4J8X C;  2ARO B;  4J8U B;  3A6N A;  1P3G B;  4QLC A;  1B67 A;  3LJA D;  3UTA D;  3MVD C;  2RVQ C;  1TAF B;  4H9R B;  4G92 B;  3AZL D;  5CPJ A;  1P3M B;  3H0L C;  5F99 B;  4Z2M G;  4WU8 C;  3VH6 W;  5JRG A;  5B2J B;  1ZLA D;  5B0Y C;  3AZH A;  4LD9 C;  3VH5 T;  2YFW B;  2G5H C;  3EPJ A;  3LEL D;  4WV4 B;  4J8W C;  3W98 B;  3TU4 A;  3AZE D;  1P34 D;  5DNN D;  5BT1 D;  3VH6 A;  5B31 G;  3X1S C;  1ID3 C;  5B1L A;  3W97 D;  3WTP B;  3LZ0 C;  3NQU B;  5B32 A;  5GT0 A;  2HUE B;  3MGS B;  3KFU G;  3P5J B;  4J8V C;  5GXQ A;  4WU9 C;  3WAA A;  3UTB C;  1KX5 C;  4KUD C;  5G49 A;  4CAY A;  3AN2 B;  1M18 A;  5AV6 D;  3REH A;  2HIO C;  3LJA A;  3UTA A;  5JA4 A;  3AZG C;  3B6G B;  3REL D;  3UT9 B;  3LZ1 B;  3REK D;  3MNN D;  3A1K A;  4YM6 D;  4X23 C;  2ARO C;  4J8U C;  1P3G C;  1ZLA A;  1M1A B;  3O62 D;  3AFA A;  2UWX A;  3MVD D;  5BS7 A;  3LEL A;  1U35 B;  1P3M C;  4G92 C;  3AZE A;  1JFI A;  1P34 A;  5F99 C;  4XZQ A;  5AV5 B;  3AZI B;  4R8P B;  4WU8 D;  3EPK A;  3W97 A;  4JJN B;  5B2J C;  3IP4 C;  1P3F B;  4LD9 D;  5CPI B;  3AV1 B;  2BYM A;  2W8S A;  4J8W D;  3AZM B;  3W98 C;  3X1S D;  5AV6 A;  1ID3 D;  3W99 B;  4H9S A;  3NQJ B;  2LY8 A;  4H9N A;  4CSR A;  3WTP C;  3REL A;  5CP6 B;  3REK A;  1WWS A;  3MNN A;  5AV8 B;  2HUE C;  3H0R C;  4YM6 A;  3MGS C;  4J8V D;  4WU9 D;  5B40 B;  1H3O A;  1KX5 D;  4KUD D;  3MGR A;  1A7W A;  3X1V D;  3AZG D;  3O62 A;  2HIO D;  1M19 D;  1F66 A;  3MVD A;  3C1B A;  2F8N D;  3B6G C;  1BH9 A;  3UT9 C;  3LZ1 C;  4KGC D;  4X23 D;  3REI D;  1KX3 B;  1P3A C;  1P3G D;  2Y2I A;  1M1A C;  2NZD D;  4LD9 A;  5BNV B;  3KUY D;  4Z66 A;  5GT3 B;  4J8W A;  4E44 A;  1U35 C;  1P3M D;  4XUJ D;  3X1S A;  3C1C B;  3X1U B;  1ID3 A;  3AZI C;  4R8P C;  3KWQ C;  5B2J D;  4JJN C;  1KX4 D;  1TZY B;  1P3F C;  5CPI C;  3AV1 C;  4H9P A;  3W98 D;  4KUD A;  3AZM C;  2NQB D;  3X1V A;  2FJ7 D;  3AZG A;  2HIO A;  2Y2H A;  1M19 A;  1ULY A;  3R45 A;  4H9Q B;  2RIQ A;  2Y2O A;  5E5A B;  3B0C T;  5CP6 C;  4KGC A;  4ZBJ B;  5AY8 B;  5AV8 C;  4X23 A;  3KSY A;  1HTA A;  3MGS D;  3REI A;  5CHL B;  1P3G A;  5AV9 B;  3MGP B;  4Z5T C;  5BO0 A;  3B0B A;  2ZY2 A;  3AN2 D;  2NZD A;  3B6G D;  3KUY A;  3LZ1 D;  1TAF A;  3WKJ B;  2CV5 B;  4XUJ A;  3MGQ B;  1P3K B;  4ZUX C;  5B2J A;  3REJ B;  1M1A D;  1KX4 A;  3B6F A;  2Y2L A;  3VH5 W;  1AOI D;  1U35 D;  5GT3 C;  4DQY B;  3W98 A;  1P3P B;  2NQB A;  4WZS B;  2FJ7 A;  4DRA A;  5AV5 D;  3C1C C;  4R8P D;  3AZI D;  3X1U C;  5AVB C;  5C3I B;  4JJN D;  3KXB B;  3VH5 A;  3W96 B;  2Y2K A;  2F8N H;  1S32 C;  1TZY C;  1P3F D;  2Y2N A;  3MGS A;  3AZJ D;  5CPI D;  3AZF B;  3AV1 D;  1P3B D;  2PYO A;  2ZM5 A;  4G91 B;  3AZM D;  3AV2 B;  3AN2 A;  5B33 D;  3W99 D;  3WTP E;  4H9O B;  3WA9 D;  3B6G A;  3A1I A;  4YS3 C;  5E5A C;  5KDM B;  5CP6 D;  5AV8 D;  4ZBJ C;  5AY8 C;  3X1T A;  3AYW B;  4WNN B;  1EQZ D;  5B40 D;  2XD5 A;  1WWI A;  5AV9 C;  5B24 B;  3MGP C;  1M1A A;  3AL0 C;  1AOI A;  5B0Z B;  5B31 B;  4QLC B;  2Y2J A;  3AZL A;  2CV5 C;  3WKJ C;  1KX3 D;  3MGQ C;  5AV5 A;  4R8P A;  1P3K C;  4J8X D;  1P3A B;  4JJN A;  3REJ C;  5CPJ B;  2BYK A;  2F2A C;  1P3F A;  1P3L C;  3AZJ A;  5CPI A;  3AV1 A;  5B32 G;  1P3B A;  5GSU C;  5JRG B;  2DF4 C;  3AZM A;  2RVQ D;  1P3P C;  5B33 A;  2IO5 B;  3AZH B;  3W99 A;  5DNN A;  3WA9 A;  3NQJ A;  3KWQ B;  5C3I C;  1TZY D;  3W96 C;  5AV8 A;  5B0Y D;  3KXB C;  1EQZ C;  3B0D B;  1EQZ A;  1PZR A;  5B40 A;  3AZF C;  2Y2Q A;  4NE6 A;  4AWL B;  4G91 C;  1T3U A;  3AV2 C;  5DNM B;  5GXQ B;  3WAA B;  3LZ0 D;  1BH8 A;  5FUG A;  5AY8 D;  4CAY B;  1M18 B;  1KX3 A;  3AYW C;  3REH B;  3LJA B;  4NFT A;  1KU5 A;  5JA4 B;  4J8X A;  5AV9 D;  1B6W A;  5B24 C;  3UTB D;  4Z5T B;  5B2I C;  4UUZ A;  1ZLA B;  5B0Z C;  4QLC C;  5B31 C;  3WKJ D;  3MGQ D;  3AFA B;  1P3K D;  4ZUX B;  2ARO D;  4WU8 A;  3LEL B;  2Y2P A;  4J8U D;  5B0Y A;  5CPJ C;  1JFI B;  1P34 B;  4XZQ B;  1P3O B;  3W97 B;  4E45 A;  5JRG C;  1W2E A;  1P3P D;  5F99 D;  2IO5 C;  3AZH C;  4DRB A;  4KHA A;  3B0C W;  5AVB B;  3LZ0 A;  3KXB D;  3W96 D;  1P3I B;  5AY8 A;  1S32 B;  5AV6 B;  3B0D C;  3AZF D;  5B1L C;  4CSR B;  4J8V A;  4AWL C;  4WU9 A;  3MNN B;  3UTB A;  1KX5 A;  4YM6 B;  5DNM C;  5GXQ C;  3WAA C;  3WTP D;  4YS3 B;  2F8N A;  3MGR B;  2YFV A;  3WKJ A;  3MGQ A;  3AYW D;  3O62 B;  2FFF B;  1M18 C;  1F66 B;  3C1B B;  3REH C;  3LJA C;  1N1J B;  2ARO A;  4NE3 A;  1BH9 B;  5B24 D;  4J8U A;  5B1M B;  5B0Z D;  4QLC D;  5B31 D;  3UT9 D;  1ZLA C;  1P3P A;  4H9R A;  1P3M A;  3AFA C;  5F99 A;  1P3A D;  4Z66 B;  3LEL C;  3W96 A;  3KXB A;  1P34 C;  5AVC B;  4XZQ C;  5BT1 C;  1P3L B;  3AZK B;  1P3O C;  3W97 C;  2YFW A;  5BNX B;  1Z2C B;  5GSU B;  3KWQ D;  1R4V A;  3WTP A;  3NQU A;  3X1V B;  1P3I C;  4HGA B;  3AYW A;  1M19 B;  5AV6 C;  3AZN B;  4H9S C;  3REL C;  1HQ3 B;  5B24 A;  3REK C;  3MNN C;  5DNM D;  4YM6 C;  3FDD A;  5GXQ D;  3WAA D;  5B0Z A;  5B31 A;  3UT9 A;  5BO0 B;  3F6T A;  3LZ1 A;  3MGR C;  2BG1 A;  1M18 D;  2NZD B;  3O62 C;  3REH D;  1F66 C;  3C1B C;  3KUY B;  1P3A A;  5CPK B;  4Z5T D;  4XUJ B;  3V9R B;  5B2I B;  2CWE A;  5B1M C;  1U35 A;  3A6N B;  1KX4 B;  3AFA D;  3B6F B;  4ZUX D;  3AZI A;  3KWQ A;  4Z66 C;  2NQB B;  2FJ7 B;  4XZQ D;  4Z2M H;  5AVC C;  1P3O D;  1Q9C A;  3AZK C;  2Y2M A;  5GT3 D;  2Y2G A;  3VH6 T;  5DNM A;  3C1C D;  2G5I C;  2ZY3 A;  3X1U D;  2PYO B;  5AVB D;  1P3I D;  5CP6 A;  3X1V C;  1S32 D;  3TU4 B;  4HGA C;  1M19 C;  3AZN C;  5B1L B;  1HQ3 C;  4Z5T A;  4KGC C;  5B32 B;  2JCH A;  3H0M C;  5GT0 B;  3REI C;  3X1T B;  4YS3 D;  5E5A D;  3MGR D;  2JE5 A;  1F66 D;  3C1B D;  5G49 B;  1AOI B;  2NZD C;  4ZUX A;  3KUY C;  3UTA B;  5CPK C;  3MGP D;  3AZL B;  4XUJ C;  2VQR A;  5B1M D;  1P3O A;  5BNV A;  5GT3 A;  2BYK B;  3EPL A;  3A6N C;  1KX4 C;  4EO5 B;  2CV5 D;  3B6F C;  3AZJ B;  3C1C A;  2JSS A;  3X1U A;  1P3B B;  4Z66 D;  5AVB A;  3REJ D;  1P3I A;  2DQN C;  2NQB C;  1S32 A;  1TZY A;  5B33 B;  3AZE B;  5AVC D;  2ZY4 A;  1P3L D;  2FJ7 C;  5DNN B;  3AZK D;  3WA9 B;  5GSU D;  1EQZ B;  2PYO C;  4YS3 A;  4H9Q A;  5E5A A;  2BYM B;  3AN2 C;  3TU4 C;  3AZN D;  1N1J A;  1HQ3 D;  1BH8 B;  4H9N B;  5FUG B;  3REL B;  5AV9 A;  3MGP A;  3REK B;  5B32 C;  3AV2 D;  3X1T C;  5GT0 C;  5B1M A;  4J8X B;  1H3O B;  4UUZ B;  2CV5 A;  2XD1 A;  1P3K A;  1AOI C;  3MVD B;  3UTA C;  5CPK D;  3REJ A;  5B2I D;  4M6B A;  3AZL C;  5AVC A;  5AV5 C;  1P3L A;  3AZK A;  2F8N K;  4WU8 B;  5BNX A;  5GSU A;  1BFM A;  3A6N D;  5B0Y B;  3B6F D;  3EPH A;  4EO5 C;  3AZJ C;  4LD9 B;  1P3B C;  4NE5 A;  5BS7 C;  4J8W B;  5CPJ D;  5B33 C;  3AZE C;  3X1S B;  3W99 C;  3AZN A;  2F8N G;  5DNN C;  2L5A A;  3WA9 C;  1ID3 B;  4KHA B;  3AZF A;  1HQ3 A;  3LZ0 B;  5JRG D;  3EG5 B;  1F1E A;  3AV2 A;  3AZH D;  2ZY5 A;  4H9O A;  5B40 C;  4J8V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...