3WKJD

The nucleosome containing human tsh2b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjD00
3LELB 3MGSD 5AVCD 2NZDD 3MVDD 4JJNA 5JA4A 3X1SB 3MGQA 3A6NA 4H9QB 3KXBD 5GT0A 4G91C 2NQBA 2AROC 5GSUD 5F99A 1M18C 4KGCB 2PYOA 1KX4C 3AZJC 1KX5A 2FJ7A 3LZ0C 1EQZD 4H9PA 5B2JB 4X23B 3MGPD 3WA9A 4UUZB 3TU4C 3AZKA 5B31C 5CPIC 5AVBB 3AYWA 1WWIA 3C1CC 3WKJC 3TU4B 4ZBJC 1Q9CA 4WNNB 1KX4A 3MNND 3MVDA 5AV5C 2F8NK 1S32B 3O62B 3MNNB 3W97D 1TZYC 2CV5C 5KDMB 1P3KD 3B6FD 5B32D 4H9NB 3MGPB 4YS3A 1AOIA 3LJAB 5BT1C 1P3GD 3X1SD 1P34A 5GT3D 5AY8C 4J8VA 4JJNB 3RELB 3AZFC 3W96C 3MGRC 5GSUB 1F66C 3W98B 4KUDC 1BFMA 4H9QA 3W98C 5B1MA 3W97C 3NQUA 3KWQD 1P3PC 5CPID 3AZLC 1EQZA 3REHC 3LZ1D 4NE6A 5AVCB 2BYMB 2HUEC 3AZMC 4Z5TD 5AV9C 4LD9C 1KX3D 5AY8A 4J8VC 3AV1D 4LD9B 3KUYC 3B6GA 1TZYD 2CV5D 5AVBA 5DNMA 3MGQD 5G49A 3A6ND 5JRGB 1P3LB 3O62A 1M19B 5JRGC 1P3LC 4R8PA 5GT3A 3MGSA 2BYKB 1P3FA 4Z5TB 4HGAC 1BH9A 4Z5TC 5AV9D 3UT9A 4YS3D 5BNXB 1HQ3C 5B1LB 3X1UC 3W98D 1P3IC 5DNMC 2HIOC 3WTPD 5B2IC 3AZHC 1P3KA 3B6FA 1HQ3B 4YM6B 3AV2A 5DNNC 3AFAA 3KWQA 3AZHA 5AV8C 5B1MB 5B0ZB 3KXBB 3LJAD 4WU9B 2NZDC 3UT9C 5B1MC 4WU8D 3B0DB 5B0YC 2YFWB 1HQ3D 3AZGA 5AV6A 5JRGD 5CPJD 1P3LD 2LY8A 3AZJB 3AZEB 2JSSA 2YFVB 3AZNC 4YS3C 3AN2C 5B31B 4H9RB 4ZUXD 3VH5W 1M19A 5C3IB 5AV8D 4JJND 5E5AD 1H3OA 1KX5B 2BYKA 3UTAC 5B40D 4J8WD 1B6WA 5B31D 3LELC 1P3FB 4WU8C 1BH9B 5B0YA 4ZUXA 3C1BC 5B33A 1ZLAD 3MNNC 4M6BA 2L5AA 5B1LA 3REJA 3AV2C 3X1SC 1P3KB 3B6FB 5FUGB 1KX3A 3AV2B 5AY8D 4G91B 5CPJA 2PYOD 3REKB 3AZND 5B33C 1P3GC 4WU8A 3REJD 3LZ0B 3MGQB 3LJAA 5B32G 3X1TC 3AZGB 3AZEA 2FJ7B 4NFTA 1P3GA 3REHD 4QLCD 3NQUB 1ID3D 1EQZC 3TU4A 3MGPC 3B0CT 1KX4D 3MNNA 3AZMA 5AV5D 3WAAB 3UTAA 2AROA 1F66B 3W96B 2NQBC 1A7WA 3WTPC 3AZHD 3WAAC 3MGPA 3WA9D 3AZKD 1AOIB 1KX3B 1TAFA 4KHAA 3W97B 1AOIC 1P3IB 4KUDA 5B31G 5B2IB 3VH6T 4J8XD 4Z5TA 1BH8A 5GSUA 5GXQA 1U35D 5GT3C 5GT0D 3UTBA 5B1MD 3X1VB 4YM6A 1P3FD 3AYWC 5BO0B 3KWQC 3AFAB 1P3PD 1M1AC 1M19D 5B24D 3KSYA 5DNNA 3AFAC 4LD9A 2IO5B 5B32B 5GT0B 5CPJC 3KUYD 5B1LC 3R45B 5AV6D 3X1UB 3AZGD 3AZNB 2HIOB 4YM6C 4R8PB 3AZJA 4J8UB 3UTAB 1P3FC 3W96A 1F66A 4R8PC 5CP6B 2RVQD 1U35C 5B0ZC 4WU9C 1BH8B 4NE3A 3B6GC 3LZ1B 3RELD 5B0YB 2HIOD 4XZQC 5B24C 1JFIA 4NE5A 4XZQB 5BNVB 5FUGA 3AZED 1P3AD 1B67A 3B0BA 5B2ID 3REKA 5CHLB 5C3IC 4AWLC 4G92B 3LZ0A 1TZYB 3VH5T 2CV5B 3C1BB 1M1AA 5CPKB 3X1UA 3AZNA 2HIOA 1P3KC 1EQZB 3B6FC 1P3BA 1H3OB 4KUDD 5AY8B 4WV4B 4JJNC 3RELC 4E44A 2NQBD 4EO5B 5B33B 3MGRB 3NQJB 4X23D 4EO5C 4Z66A 1ZLAA 1P3MA 1F66D 3W96D 1P3PB 2NZDA 5B40B 4J8WB 4J8VD 2F8NB 3W99D 5BS7A 3X1TB 4KGCD 5AVCC 3AZMB 1P34D 3AZKC 3WAAA 3LELD 1M18D 2FJ7C 3REHA 4QLCA 3AZLA 5AV9A 3LELA 1TAFB 3W97A 1P3IA 3W99A 1HQ3A 4J8UD 4X23C 3AN2A 1M19C 5JA4B 1P3OD 5GXQB 3A6NC 3UTBC 3KWQB 4Z66D 4HGAB 5GXQC 3AYWD 4ZBJB 5DNMD 1M1AB 1P34C 4WZSB 2IO5C 3O62C 3VH6A 5B32C 2FJ7D 1P3BD 5BO0A 1ID3C 4H9PB 5B2JA 5AV6B 3X1UD 3WTPA 4XUJB 5DNNB 1R4VA 1ID3B 3LJAC 5B1LD 1F1EA 3NQJA 4Z2MH 5AV6C 3REIA 3UT9D 5CP6D 4Z66B 5DNND 1P3OC 4CAYB 5AV5A 1U35B 3X1VC 1S32A 3AZFB 4H9RA 5B31A 5B40A 4J8WA 1P3PA 1KU5A 2NZDB 4KUDB 1ULYA 4J8UA 2RVQC 5B2IA 5AV8A 5E5AA 3B0CW 3REKD 5KDMA 3LZ1C 4ZUXB 4WU9D 5CP6A 5CPKD 5AVBD 3AZLB 3AZEC 3AZID 4ZUXC 5GXQD 3VH5A 5F99C 5B24B 3MGSC 3AV1A 1M18A 4DRAA 5GT0C 4J8VB 3RELA 5CPJB 4J8XB 3AN2B 1P3AB 3V9RB 4J8XC 2F8NH 1N1JB 4E45A 1P3MD 3AV1C 4WU8B 1JFIB 3MVDC 5CP6C 3AFAD 2F8ND 4H9SC 4H9OA 3R45A 3AZIC 1P3ID 4XUJA 3KUYA 3X1SA 3REJC 3B6GB 3REKC 3REIB 5DNMB 3C1BA 1P3GB 1M1AD 5CPKA 2PYOC 3REIC 5B33D 3AZFA 2PYOB 1P3BB 1S32D 4YM6D 3MGRA 3UT9B 4G92C 2AROB 1P3MC 1M18B 4KGCC 4CSRB 1KX4B 5B2JD 4J8XA 3X1TA 4KHAB 1N1JA 4H9NA 3C1CB 3WKJB 4YS3B 3A6NB 3UTBB 3X1VA 1S32C 3AZMD 2NQBB 1KX5C 2YFWA 1P3OA 3AN2D 1KX3C 3WA9C 2F8NG 4J8WC 5B40C 3AZLD 3WA9B 4UUZA 3C1BD 3AZKB 1AOID 1ZLAC 4LD9D 5B32A 1ZLAB 2BYMA 4WNNA 5GSUC 5B2JC 2F8NA 3MGQC 5AVBC 5CPIB 3X1VD 4CAYA 5G49B 3REHB 5AV5B 4QLCB 1U35A 3AZGC 5AV9B 3C1CD 1HTAA 3WKJD 1P34B 4QLCC 1KX5D 3X1TD 3MGSB 4Z2MG 3W99B 5BT1D 3LZ1A 3W99C 3C1CA 3WKJA 3W98A 3AZIA 4J8UC 5BNXA 4XUJC 5B0ZD 3MGRD 5B24A 3AV1B 5B0YD 4XZQA 5BNVA 4Z66C 1P3OB 4R8PD 5AVCA 1P3AA 3O62D 4XZQD 3AZFD 3WTPB 5B0ZA 1ID3A 3WTPE 3REID 3UTBD 1TZYA 2CV5A 3B6GD 2HUEB 3VH6W 3WAAD 5JRGA 4H9OB 1P3LA 4XUJD 5F99B 4KGCA 3KUYB 1P3BC 5GT3B 5AV8B 5CPIA 5E5AB 3KXBC 1WWSA 4X23A 4AWLB 2CWEA 2YFVA 5E5AC 3B0DC 1P3AC 2AROD 3UTAD 3AYWB 1P3MB 3AZJD 5CPKC 3MVDB 3AV2D 5F99D 3TU4D 4DRBA 3AZIB 3V9RA 5BS7C 3REJB 3AZHB 4H9SA 4CSRA 3KXBA 4WU9A 3LZ0D
chains in the Genus database with same CATH superfamily
3LELB 3MGSD 5AVCD 2NZDD 2ZY5A 2ZM5A 2Y2MA 3MVDD 4JJNA 5JA4A 3X1SB 3MGQA 3A6NA 4H9QB 3KXBD 5GT0A 4G91C 2NQBA 2AROC 5GSUD 5F99A 1M18C 4KGCB 2PYOA 1KX4C 3AZJC 1KX5A 2FJ7A 3LZ0C 1EQZD 4H9PA 5B2JB 4X23B 3MGPD 3WA9A 4UUZB 3TU4C 3AZKA 5B31C 5CPIC 5AVBB 3AYWA 1WWIA 3C1CC 3WKJC 1W2EA 3TU4B 4ZBJC 1Q9CA 4WNNB 1KX4A 3MNND 3MVDA 5AV5C 2F8NK 1S32B 3O62B 3MNNB 3W97D 3EPLA 1TZYC 2CV5C 5KDMB 1P3KD 3B6FD 4UPKA 5B32D 4H9NB 3MGPB 4YS3A 1AOIA 3LJAB 5BT1C 1P3GD 3X1SD 1P34A 2Y2KA 5GT3D 5AY8C 4J8VA 4JJNB 3RELB 3AZFC 3W96C 3MGRC 5GSUB 1F66C 3W98B 4KUDC 1BFMA 4H9QA 3A1IA 1Z2CB 3W98C 5B1MA 3W97C 3NQUA 3KWQD 1P3PC 5CPID 3AZLC 1EQZA 3REHC 4NE6A 5AVCB 3LZ1D 2BYMB 2HUEC 3AZMC 5AV9C 4Z5TD 4LD9C 1KX3D 5AY8A 4J8VC 3AV1D 4LD9B 3KUYC 3AL0C 3B6GA 1TZYD 2CV5D 5AVBA 5DNMA 3MGQD 5G49A 3A6ND 5JRGB 1P3LB 3O62A 1M19B 3H0MC 5JRGC 1P3LC 4R8PA 5GT3A 3MGSA 2BYKB 1P3FA 4Z5TB 4HGAC 1BH9A 4Z5TC 5AV9D 3UT9A 4YS3D 5BNXB 1HQ3C 5B1LB 3X1UC 3W98D 1P3IC 5DNMC 2HIOC 3WTPD 5B2IC 3AZHC 1P3KA 3B6FA 1HQ3B 4YM6B 3AV2A 5DNNC 3AFAA 3KWQA 3AZHA 5AV8C 5B1MB 5B0ZB 3KXBB 3LJAD 4WU9B 2NZDC 3UT9C 5B1MC 4WU8D 3B0DB 5B0YC 2YFWB 1HQ3D 3AZGA 5AV6A 5JRGD 5CPJD 1P3LD 2LY8A 3AZJB 3AZEB 2FFFB 2JSSA 2YFVB 2XD5A 3AZNC 4YS3C 3AN2C 5B31B 4H9RB 4ZUXD 3VH5W 1M19A 5C3IB 5AV8D 4JJND 5E5AD 1H3OA 1KX5B 2BYKA 3H0RC 5B40D 4J8WD 1B6WA 5B31D 3LELC 3UTAC 1P3FB 4WU8C 1BH9B 5B0YA 4ZUXA 3C1BC 5B33A 1ZLAD 3MNNC 4M6BA 2L5AA 2RIQA 5B1LA 3EPJA 3REJA 3AV2C 3X1SC 2ZY2A 1P3KB 3B6FB 5FUGB 1KX3A 3AV2B 5AY8D 2J8PA 4G91B 5CPJA 2PYOD 3REKB 3AZND 5B33C 1P3GC 4WU8A 3REJD 3LZ0B 3MGQB 3LJAA 2VQRA 5B32G 3X1TC 3AZGB 2Y2QA 3AZEA 2FJ7B 4NFTA 1P3GA 3REHD 4QLCD 3NQUB 1ID3D 1EQZC 3TU4A 3MGPC 3B0CT 1KX4D 3MNNA 3AZMA 5AV5D 3WAAB 3UTAA 2AROA 1F66B 3W96B 2NQBC 1A7WA 3WTPC 3AZHD 3WAAC 3MGPA 3WA9D 3AZKD 1AOIB 1KX3B 1TAFA 4KHAA 3W97B 1AOIC 1P3IB 4KUDA 5B31G 5B2IB 3VH6T 4J8XD 4Z5TA 3KFUG 1BH8A 5GSUA 5GXQA 2Y2PA 1U35D 5GT3C 5GT0D 3UTBA 5B1MD 3X1VB 4YM6A 1P3FD 3EPKA 3AYWC 2W8SA 5BO0B 3KWQC 3AFAB 1P3PD 1M1AC 1M19D 5B24D 3KSYA 5DNNA 3AFAC 4LD9A 2IO5B 5B32B 5GT0B 5CPJC 3KUYD 5B1LC 3R45B 5AV6D 3X1UB 3AZGD 3AZNB 2Y2LA 2HIOB 4YM6C 4R8PB 3AZJA 4J8UB 3UTAB 1P3FC 3W96A 1F66A 4R8PC 1T3UA 5CP6B 2RVQD 1U35C 5B0ZC 4WU9C 1BH8B 4NE3A 3B6GC 3LZ1B 3RELD 5B0YB 2HIOD 4XZQC 5B24C 1JFIA 2BG1A 4NE5A 4XZQB 5BNVB 5FUGA 3AZED 1P3AD 1B67A 3B0BA 5B2ID 3REKA 5CHLB 5C3IC 4AWLC 4G92B 3LZ0A 1TZYB 3VH5T 2CV5B 2ZY3A 3C1BB 1M1AA 2Y2HA 5CPKB 3X1UA 3AZNA 2DQNC 2HIOA 1P3KC 1EQZB 3B6FC 1P3BA 1H3OB 3H0LC 4KUDD 5AY8B 4WV4B 4JJNC 3RELC 4E44A 2NQBD 4EO5B 5B33B 3MGRB 3NQJB 4X23D 4EO5C 4Z66A 1ZLAA 1P3MA 1F66D 3W96D 3F6TA 2DF4C 1P3PB 2NZDA 5B40B 2G5HC 4J8WB 4J8VD 3W99D 5BS7A 3X1TB 2F8NB 4KGCD 5AVCC 3AZMB 1P34D 3AZKC 3WAAA 3LELD 1M18D 1PZRA 2FJ7C 3REHA 4QLCA 2UWXA 3AZLA 5AV9A 3LELA 1TAFB 3W97A 1P3IA 3W99A 1HQ3A 3A1KA 4J8UD 4X23C 3AN2A 1M19C 5JA4B 1P3OD 5GXQB 3A6NC 3UTBC 3KWQB 4Z66D 4HGAB 5GXQC 3AYWD 4ZBJB 5DNMD 1M1AB 1P34C 4WZSB 2IO5C 3O62C 3VH6A 5B32C 2FJ7D 1P3BD 5BO0A 1ID3C 4H9PB 5B2JA 5AV6B 3X1UD 3WTPA 4XUJB 5DNNB 1R4VA 1ID3B 3LJAC 5B1LD 1F1EA 3NQJA 4Z2MH 5AV6C 3REIA 3UT9D 5CP6D 4Z66B 5DNND 1P3OC 4CAYB 5AV5A 1U35B 3X1VC 1S32A 3AZFB 4H9RA 5B31A 5B40A 4J8WA 1P3PA 1KU5A 2NZDB 4KUDB 1ULYA 4J8UA 5AV8A 2RVQC 5B2IA 5E5AA 3B0CW 3EG5B 3REKD 2F2AC 5KDMA 3LZ1C 4ZUXB 4WU9D 5CP6A 5CPKD 5AVBD 3AZLB 3AZEC 3AZID 4ZUXC 5GXQD 3VH5A 5F99C 5B24B 3MGSC 3AV1A 1M18A 4DRAA 5GT0C 4J8VB 3RELA 5CPJB 4J8XB 2Y2JA 3AN2B 1P3AB 3V9RB 4J8XC 2F8NH 1N1JB 4E45A 1P3MD 3AV1C 4WU8B 1JFIB 2Y2NA 3MVDC 5CP6C 3AFAD 2F8ND 4H9SC 4H9OA 3R45A 3AZIC 1P3ID 4XUJA 3KUYA 3X1SA 3REJC 3B6GB 3REKC 3REIB 5DNMB 3C1BA 1P3GB 1M1AD 5CPKA 2PYOC 3P5JB 3REIC 3EPHA 5B33D 3AZFA 2PYOB 1P3BB 3IP4C 1S32D 4YM6D 3MGRA 3UT9B 4G92C 2AROB 1P3MC 1M18B 4KGCC 4CSRB 1KX4B 5B2JD 4J8XA 3X1TA 4KHAB 4WJ3C 1N1JA 2JCHA 4H9NA 3C1CB 3WKJB 4YS3B 2G5IC 3A6NB 3UTBB 3X1VA 1S32C 3AZMD 2NQBB 1KX5C 2YFWA 1P3OA 3AN2D 1KX3C 3WA9C 2F8NG 4J8WC 5B40C 3AZLD 3FDDA 3WA9B 4UUZA 3C1BD 3AZKB 1AOID 1ZLAC 4LD9D 5B32A 1ZLAB 2BYMA 4WNNA 5GSUC 5B2JC 2F8NA 3MGQC 5AVBC 5CPIB 3X1VD 4DQYB 4CAYA 5G49B 3REHB 5AV5B 4QLCB 1U35A 3AZGC 5AV9B 3C1CD 1HTAA 3WKJD 1P34B 2Y2IA 4QLCC 1KX5D 3X1TD 3MGSB 4Z2MG 3W99B 5BT1D 2JE5A 3LZ1A 2XD1A 3W99C 3C1CA 3WKJA 3W98A 3AZIA 2Y2OA 4J8UC 5BNXA 4XUJC 5B0ZD 3MGRD 5B24A 3AV1B 5B0YD 4XZQA 5BNVA 4Z66C 1P3OB 4R8PD 5AVCA 1P3AA 3O62D 4XZQD 3AZFD 3WTPB 5B0ZA 1ID3A 3WTPE 3REID 3UTBD 1TZYA 2CV5A 3B6GD 2HUEB 3VH6W 3WAAD 5JRGA 4H9OB 1P3LA 4XUJD 5F99B 4KGCA 3KUYB 1P3BC 5GT3B 5AV8B 5CPIA 5E5AB 3KXBC 1WWSA 4X23A 4AWLB 2CWEA 2YFVA 5E5AC 3B0DC 2Y2GA 1P3AC 2AROD 3UTAD 3AYWB 1P3MB 3AZJD 5CPKC 3MVDB 3AV2D 5F99D 3TU4D 4DRBA 2ZY4A 3V9RA 3AZIB 5BS7C 3REJB 3AZHB 4H9SA 4CSRA 3KXBA 4WU9A 3LZ0D
chains in the Genus database with same CATH topology
3LELB 3MGSD 5AVCD 2NZDD 2ZY5A 2ZM5A 2Y2MA 3MVDD 4JJNA 5JA4A 3X1SB 3MGQA 3A6NA 4H9QB 3KXBD 5GT0A 4G91C 2NQBA 2AROC 5GSUD 5F99A 1M18C 4KGCB 2PYOA 1KX4C 3AZJC 1KX5A 2FJ7A 3LZ0C 1EQZD 4H9PA 5B2JB 4X23B 3MGPD 3WA9A 4UUZB 3TU4C 3AZKA 5B31C 5CPIC 5AVBB 3AYWA 1WWIA 3C1CC 3WKJC 1W2EA 3TU4B 4ZBJC 1Q9CA 4WNNB 1KX4A 3MNND 3MVDA 5AV5C 2F8NK 1S32B 3O62B 3MNNB 3W97D 3EPLA 1TZYC 2CV5C 5KDMB 1P3KD 3B6FD 4UPKA 5B32D 4H9NB 3MGPB 4YS3A 1AOIA 3LJAB 5BT1C 1P3GD 3X1SD 1P34A 2Y2KA 5GT3D 5AY8C 4J8VA 4JJNB 3RELB 3AZFC 3W96C 3MGRC 5GSUB 1F66C 3W98B 4KUDC 1BFMA 4H9QA 3A1IA 1Z2CB 3W98C 5B1MA 3W97C 3NQUA 3KWQD 1P3PC 5CPID 3AZLC 1EQZA 3REHC 4NE6A 5AVCB 3LZ1D 2BYMB 2HUEC 3AZMC 5AV9C 4Z5TD 4LD9C 1KX3D 5AY8A 4J8VC 3AV1D 4LD9B 3KUYC 3AL0C 3B6GA 1TZYD 2CV5D 5AVBA 5DNMA 3MGQD 5G49A 3A6ND 5JRGB 1P3LB 3O62A 1M19B 3H0MC 5JRGC 1P3LC 4R8PA 5GT3A 3MGSA 2BYKB 1P3FA 4Z5TB 4HGAC 1BH9A 4Z5TC 5AV9D 3UT9A 4YS3D 5BNXB 1HQ3C 5B1LB 3X1UC 3W98D 1P3IC 5DNMC 2HIOC 3WTPD 5B2IC 3AZHC 1P3KA 3B6FA 1HQ3B 4YM6B 3AV2A 5DNNC 3AFAA 3KWQA 3AZHA 5AV8C 5B1MB 5B0ZB 3KXBB 3LJAD 4WU9B 2NZDC 3UT9C 5B1MC 4WU8D 3B0DB 5B0YC 2YFWB 1HQ3D 3AZGA 5AV6A 5JRGD 5CPJD 1P3LD 2LY8A 3AZJB 3AZEB 2FFFB 2JSSA 2YFVB 2XD5A 3AZNC 4YS3C 3AN2C 5B31B 4H9RB 4ZUXD 3VH5W 1M19A 5C3IB 5AV8D 4JJND 5E5AD 1H3OA 1KX5B 2BYKA 3H0RC 5B40D 4J8WD 1B6WA 5B31D 3LELC 3UTAC 1P3FB 4WU8C 1BH9B 5B0YA 4ZUXA 3C1BC 5B33A 1ZLAD 3MNNC 4M6BA 2L5AA 2RIQA 5B1LA 3EPJA 3REJA 3AV2C 3X1SC 2ZY2A 1P3KB 3B6FB 5FUGB 1KX3A 3AV2B 5AY8D 2J8PA 4G91B 5CPJA 2PYOD 3REKB 3AZND 5B33C 1P3GC 4WU8A 3REJD 3LZ0B 3MGQB 3LJAA 2VQRA 5B32G 3X1TC 3AZGB 2Y2QA 3AZEA 2FJ7B 4NFTA 1P3GA 3REHD 4QLCD 3NQUB 1ID3D 1EQZC 3TU4A 3MGPC 3B0CT 1KX4D 3MNNA 3AZMA 5AV5D 3WAAB 3UTAA 2AROA 1F66B 3W96B 2NQBC 1A7WA 3WTPC 3AZHD 3WAAC 3MGPA 3WA9D 3AZKD 1AOIB 1KX3B 1TAFA 4KHAA 3W97B 1AOIC 1P3IB 4KUDA 5B31G 5B2IB 3VH6T 4J8XD 4Z5TA 3KFUG 1BH8A 5GSUA 5GXQA 2Y2PA 1U35D 5GT3C 5GT0D 3UTBA 5B1MD 3X1VB 4YM6A 1P3FD 3EPKA 3AYWC 2W8SA 5BO0B 3KWQC 3AFAB 1P3PD 1M1AC 1M19D 5B24D 3KSYA 5DNNA 3AFAC 4LD9A 2IO5B 5B32B 5GT0B 5CPJC 3KUYD 5B1LC 3R45B 5AV6D 3X1UB 3AZGD 3AZNB 2Y2LA 2HIOB 4YM6C 4R8PB 3AZJA 4J8UB 3UTAB 1P3FC 3W96A 1F66A 4R8PC 1T3UA 5CP6B 2RVQD 1U35C 5B0ZC 4WU9C 1BH8B 4NE3A 3B6GC 3LZ1B 3RELD 5B0YB 2HIOD 4XZQC 5B24C 1JFIA 2BG1A 4NE5A 4XZQB 5BNVB 5FUGA 3AZED 1P3AD 1B67A 3B0BA 5B2ID 3REKA 5CHLB 5C3IC 4AWLC 4G92B 3LZ0A 1TZYB 3VH5T 2CV5B 2ZY3A 3C1BB 1M1AA 2Y2HA 5CPKB 3X1UA 3AZNA 2DQNC 2HIOA 1P3KC 1EQZB 3B6FC 1P3BA 1H3OB 3H0LC 4KUDD 5AY8B 4WV4B 4JJNC 3RELC 4E44A 2NQBD 4EO5B 5B33B 3MGRB 3NQJB 4X23D 4EO5C 4Z66A 1ZLAA 1P3MA 1F66D 3W96D 3F6TA 2DF4C 1P3PB 2NZDA 5B40B 2G5HC 4J8WB 4J8VD 3W99D 5BS7A 3X1TB 2F8NB 4KGCD 5AVCC 3AZMB 1P34D 3AZKC 3WAAA 3LELD 1M18D 1PZRA 2FJ7C 3REHA 4QLCA 2UWXA 3AZLA 5AV9A 3LELA 1TAFB 3W97A 1P3IA 3W99A 1HQ3A 3A1KA 4J8UD 4X23C 3AN2A 1M19C 5JA4B 1P3OD 5GXQB 3A6NC 3UTBC 3KWQB 4Z66D 4HGAB 5GXQC 3AYWD 4ZBJB 5DNMD 1M1AB 1P34C 4WZSB 2IO5C 3O62C 3VH6A 5B32C 2FJ7D 1P3BD 5BO0A 1ID3C 4H9PB 5B2JA 5AV6B 3X1UD 3WTPA 4XUJB 5DNNB 1R4VA 1ID3B 3LJAC 5B1LD 1F1EA 3NQJA 4Z2MH 5AV6C 3REIA 3UT9D 5CP6D 4Z66B 5DNND 1P3OC 4CAYB 5AV5A 1U35B 3X1VC 1S32A 3AZFB 4H9RA 5B31A 5B40A 4J8WA 1P3PA 1KU5A 2NZDB 4KUDB 1ULYA 4J8UA 5AV8A 2RVQC 5B2IA 5E5AA 3B0CW 3EG5B 3REKD 2F2AC 5KDMA 3LZ1C 4ZUXB 4WU9D 5CP6A 5CPKD 5AVBD 3AZLB 3AZEC 3AZID 4ZUXC 5GXQD 3VH5A 5F99C 5B24B 3MGSC 3AV1A 1M18A 4DRAA 5GT0C 4J8VB 3RELA 5CPJB 4J8XB 2Y2JA 3AN2B 1P3AB 3V9RB 4J8XC 2F8NH 1N1JB 4E45A 1P3MD 3AV1C 4WU8B 1JFIB 2Y2NA 3MVDC 5CP6C 3AFAD 2F8ND 4H9SC 4H9OA 3R45A 3AZIC 1P3ID 4XUJA 3KUYA 3X1SA 3REJC 3B6GB 3REKC 3REIB 5DNMB 3C1BA 1P3GB 1M1AD 5CPKA 2PYOC 3P5JB 3REIC 3EPHA 5B33D 3AZFA 2PYOB 1P3BB 3IP4C 1S32D 4YM6D 3MGRA 3UT9B 4G92C 2AROB 1P3MC 1M18B 4KGCC 4CSRB 1KX4B 5B2JD 4J8XA 3X1TA 4KHAB 4WJ3C 1N1JA 2JCHA 4H9NA 3C1CB 3WKJB 4YS3B 2G5IC 3A6NB 3UTBB 3X1VA 1S32C 3AZMD 2NQBB 1KX5C 2YFWA 1P3OA 3AN2D 1KX3C 3WA9C 2F8NG 4J8WC 5B40C 3AZLD 3FDDA 3WA9B 4UUZA 3C1BD 3AZKB 1AOID 1ZLAC 4LD9D 5B32A 1ZLAB 2BYMA 4WNNA 5GSUC 5B2JC 2F8NA 3MGQC 5AVBC 5CPIB 3X1VD 4DQYB 4CAYA 5G49B 3REHB 5AV5B 4QLCB 1U35A 3AZGC 5AV9B 3C1CD 1HTAA 3WKJD 1P34B 2Y2IA 4QLCC 1KX5D 3X1TD 3MGSB 4Z2MG 3W99B 5BT1D 2JE5A 3LZ1A 2XD1A 3W99C 3C1CA 3WKJA 3W98A 3AZIA 2Y2OA 4J8UC 5BNXA 4XUJC 5B0ZD 3MGRD 5B24A 3AV1B 5B0YD 4XZQA 5BNVA 4Z66C 1P3OB 4R8PD 5AVCA 1P3AA 3O62D 4XZQD 3AZFD 3WTPB 5B0ZA 1ID3A 3WTPE 3REID 3UTBD 1TZYA 2CV5A 3B6GD 2HUEB 3VH6W 3WAAD 5JRGA 4H9OB 1P3LA 4XUJD 5F99B 4KGCA 3KUYB 1P3BC 5GT3B 5AV8B 5CPIA 5E5AB 3KXBC 1WWSA 4X23A 4AWLB 2CWEA 2YFVA 5E5AC 3B0DC 2Y2GA 1P3AC 2AROD 3UTAD 3AYWB 1P3MB 3AZJD 5CPKC 3MVDB 3AV2D 5F99D 3TU4D 4DRBA 2ZY4A 3V9RA 3AZIB 5BS7C 3REJB 3AZHB 4H9SA 4CSRA 3KXBA 4WU9A 3LZ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL B;  3MGS D;  5AVC D;  2NZD D;  3MVD D;  4JJN A;  5JA4 A;  3X1S B;  3MGQ A;  3A6N A;  4H9Q B;  3KXB D;  5GT0 A;  4G91 C;  2NQB A;  2ARO C;  5GSU D;  5F99 A;  1M18 C;  4KGC B;  2PYO A;  1KX4 C;  3AZJ C;  1KX5 A;  2FJ7 A;  3LZ0 C;  1EQZ D;  4H9P A;  5B2J B;  4X23 B;  3MGP D;  3WA9 A;  4UUZ B;  3TU4 C;  3AZK A;  5B31 C;  5CPI C;  5AVB B;  3AYW A;  1WWI A;  3C1C C;  3WKJ C;  3TU4 B;  4ZBJ C;  1Q9C A;  4WNN B;  1KX4 A;  3MNN D;  3MVD A;  5AV5 C;  2F8N K;  1S32 B;  3O62 B;  3MNN B;  3W97 D;  1TZY C;  2CV5 C;  5KDM B;  1P3K D;  3B6F D;  5B32 D;  4H9N B;  3MGP B;  4YS3 A;  1AOI A;  3LJA B;  5BT1 C;  1P3G D;  3X1S D;  1P34 A;  5GT3 D;  5AY8 C;  4J8V A;  4JJN B;  3REL B;  3AZF C;  3W96 C;  3MGR C;  5GSU B;  1F66 C;  3W98 B;  4KUD C;  1BFM A;  4H9Q A;  3W98 C;  5B1M A;  3W97 C;  3NQU A;  3KWQ D;  1P3P C;  5CPI D;  3AZL C;  1EQZ A;  3REH C;  3LZ1 D;  4NE6 A;  5AVC B;  2BYM B;  2HUE C;  3AZM C;  4Z5T D;  5AV9 C;  4LD9 C;  1KX3 D;  5AY8 A;  4J8V C;  3AV1 D;  4LD9 B;  3KUY C;  3B6G A;  1TZY D;  2CV5 D;  5AVB A;  5DNM A;  3MGQ D;  5G49 A;  3A6N D;  5JRG B;  1P3L B;  3O62 A;  1M19 B;  5JRG C;  1P3L C;  4R8P A;  5GT3 A;  3MGS A;  2BYK B;  1P3F A;  4Z5T B;  4HGA C;  1BH9 A;  4Z5T C;  5AV9 D;  3UT9 A;  4YS3 D;  5BNX B;  1HQ3 C;  5B1L B;  3X1U C;  3W98 D;  1P3I C;  5DNM C;  2HIO C;  3WTP D;  5B2I C;  3AZH C;  1P3K A;  3B6F A;  1HQ3 B;  4YM6 B;  3AV2 A;  5DNN C;  3AFA A;  3KWQ A;  3AZH A;  5AV8 C;  5B1M B;  5B0Z B;  3KXB B;  3LJA D;  4WU9 B;  2NZD C;  3UT9 C;  5B1M C;  4WU8 D;  3B0D B;  5B0Y C;  2YFW B;  1HQ3 D;  3AZG A;  5AV6 A;  5JRG D;  5CPJ D;  1P3L D;  2LY8 A;  3AZJ B;  3AZE B;  2JSS A;  2YFV B;  3AZN C;  4YS3 C;  3AN2 C;  5B31 B;  4H9R B;  4ZUX D;  3VH5 W;  1M19 A;  5C3I B;  5AV8 D;  4JJN D;  5E5A D;  1H3O A;  1KX5 B;  2BYK A;  3UTA C;  5B40 D;  4J8W D;  1B6W A;  5B31 D;  3LEL C;  1P3F B;  4WU8 C;  1BH9 B;  5B0Y A;  4ZUX A;  3C1B C;  5B33 A;  1ZLA D;  3MNN C;  4M6B A;  2L5A A;  5B1L A;  3REJ A;  3AV2 C;  3X1S C;  1P3K B;  3B6F B;  5FUG B;  1KX3 A;  3AV2 B;  5AY8 D;  4G91 B;  5CPJ A;  2PYO D;  3REK B;  3AZN D;  5B33 C;  1P3G C;  4WU8 A;  3REJ D;  3LZ0 B;  3MGQ B;  3LJA A;  5B32 G;  3X1T C;  3AZG B;  3AZE A;  2FJ7 B;  4NFT A;  1P3G A;  3REH D;  4QLC D;  3NQU B;  1ID3 D;  1EQZ C;  3TU4 A;  3MGP C;  3B0C T;  1KX4 D;  3MNN A;  3AZM A;  5AV5 D;  3WAA B;  3UTA A;  2ARO A;  1F66 B;  3W96 B;  2NQB C;  1A7W A;  3WTP C;  3AZH D;  3WAA C;  3MGP A;  3WA9 D;  3AZK D;  1AOI B;  1KX3 B;  1TAF A;  4KHA A;  3W97 B;  1AOI C;  1P3I B;  4KUD A;  5B31 G;  5B2I B;  3VH6 T;  4J8X D;  4Z5T A;  1BH8 A;  5GSU A;  5GXQ A;  1U35 D;  5GT3 C;  5GT0 D;  3UTB A;  5B1M D;  3X1V B;  4YM6 A;  1P3F D;  3AYW C;  5BO0 B;  3KWQ C;  3AFA B;  1P3P D;  1M1A C;  1M19 D;  5B24 D;  3KSY A;  5DNN A;  3AFA C;  4LD9 A;  2IO5 B;  5B32 B;  5GT0 B;  5CPJ C;  3KUY D;  5B1L C;  3R45 B;  5AV6 D;  3X1U B;  3AZG D;  3AZN B;  2HIO B;  4YM6 C;  4R8P B;  3AZJ A;  4J8U B;  3UTA B;  1P3F C;  3W96 A;  1F66 A;  4R8P C;  5CP6 B;  2RVQ D;  1U35 C;  5B0Z C;  4WU9 C;  1BH8 B;  4NE3 A;  3B6G C;  3LZ1 B;  3REL D;  5B0Y B;  2HIO D;  4XZQ C;  5B24 C;  1JFI A;  4NE5 A;  4XZQ B;  5BNV B;  5FUG A;  3AZE D;  1P3A D;  1B67 A;  3B0B A;  5B2I D;  3REK A;  5CHL B;  5C3I C;  4AWL C;  4G92 B;  3LZ0 A;  1TZY B;  3VH5 T;  2CV5 B;  3C1B B;  1M1A A;  5CPK B;  3X1U A;  3AZN A;  2HIO A;  1P3K C;  1EQZ B;  3B6F C;  1P3B A;  1H3O B;  4KUD D;  5AY8 B;  4WV4 B;  4JJN C;  3REL C;  4E44 A;  2NQB D;  4EO5 B;  5B33 B;  3MGR B;  3NQJ B;  4X23 D;  4EO5 C;  4Z66 A;  1ZLA A;  1P3M A;  1F66 D;  3W96 D;  1P3P B;  2NZD A;  5B40 B;  4J8W B;  4J8V D;  2F8N B;  3W99 D;  5BS7 A;  3X1T B;  4KGC D;  5AVC C;  3AZM B;  1P34 D;  3AZK C;  3WAA A;  3LEL D;  1M18 D;  2FJ7 C;  3REH A;  4QLC A;  3AZL A;  5AV9 A;  3LEL A;  1TAF B;  3W97 A;  1P3I A;  3W99 A;  1HQ3 A;  4J8U D;  4X23 C;  3AN2 A;  1M19 C;  5JA4 B;  1P3O D;  5GXQ B;  3A6N C;  3UTB C;  3KWQ B;  4Z66 D;  4HGA B;  5GXQ C;  3AYW D;  4ZBJ B;  5DNM D;  1M1A B;  1P34 C;  4WZS B;  2IO5 C;  3O62 C;  3VH6 A;  5B32 C;  2FJ7 D;  1P3B D;  5BO0 A;  1ID3 C;  4H9P B;  5B2J A;  5AV6 B;  3X1U D;  3WTP A;  4XUJ B;  5DNN B;  1R4V A;  1ID3 B;  3LJA C;  5B1L D;  1F1E A;  3NQJ A;  4Z2M H;  5AV6 C;  3REI A;  3UT9 D;  5CP6 D;  4Z66 B;  5DNN D;  1P3O C;  4CAY B;  5AV5 A;  1U35 B;  3X1V C;  1S32 A;  3AZF B;  4H9R A;  5B31 A;  5B40 A;  4J8W A;  1P3P A;  1KU5 A;  2NZD B;  4KUD B;  1ULY A;  4J8U A;  2RVQ C;  5B2I A;  5AV8 A;  5E5A A;  3B0C W;  3REK D;  5KDM A;  3LZ1 C;  4ZUX B;  4WU9 D;  5CP6 A;  5CPK D;  5AVB D;  3AZL B;  3AZE C;  3AZI D;  4ZUX C;  5GXQ D;  3VH5 A;  5F99 C;  5B24 B;  3MGS C;  3AV1 A;  1M18 A;  4DRA A;  5GT0 C;  4J8V B;  3REL A;  5CPJ B;  4J8X B;  3AN2 B;  1P3A B;  3V9R B;  4J8X C;  2F8N H;  1N1J B;  4E45 A;  1P3M D;  3AV1 C;  4WU8 B;  1JFI B;  3MVD C;  5CP6 C;  3AFA D;  2F8N D;  4H9S C;  4H9O A;  3R45 A;  3AZI C;  1P3I D;  4XUJ A;  3KUY A;  3X1S A;  3REJ C;  3B6G B;  3REK C;  3REI B;  5DNM B;  3C1B A;  1P3G B;  1M1A D;  5CPK A;  2PYO C;  3REI C;  5B33 D;  3AZF A;  2PYO B;  1P3B B;  1S32 D;  4YM6 D;  3MGR A;  3UT9 B;  4G92 C;  2ARO B;  1P3M C;  1M18 B;  4KGC C;  4CSR B;  1KX4 B;  5B2J D;  4J8X A;  3X1T A;  4KHA B;  1N1J A;  4H9N A;  3C1C B;  3WKJ B;  4YS3 B;  3A6N B;  3UTB B;  3X1V A;  1S32 C;  3AZM D;  2NQB B;  1KX5 C;  2YFW A;  1P3O A;  3AN2 D;  1KX3 C;  3WA9 C;  2F8N G;  4J8W C;  5B40 C;  3AZL D;  3WA9 B;  4UUZ A;  3C1B D;  3AZK B;  1AOI D;  1ZLA C;  4LD9 D;  5B32 A;  1ZLA B;  2BYM A;  4WNN A;  5GSU C;  5B2J C;  2F8N A;  3MGQ C;  5AVB C;  5CPI B;  3X1V D;  4CAY A;  5G49 B;  3REH B;  5AV5 B;  4QLC B;  1U35 A;  3AZG C;  5AV9 B;  3C1C D;  1HTA A;  3WKJ D;  1P34 B;  4QLC C;  1KX5 D;  3X1T D;  3MGS B;  4Z2M G;  3W99 B;  5BT1 D;  3LZ1 A;  3W99 C;  3C1C A;  3WKJ A;  3W98 A;  3AZI A;  4J8U C;  5BNX A;  4XUJ C;  5B0Z D;  3MGR D;  5B24 A;  3AV1 B;  5B0Y D;  4XZQ A;  5BNV A;  4Z66 C;  1P3O B;  4R8P D;  5AVC A;  1P3A A;  3O62 D;  4XZQ D;  3AZF D;  3WTP B;  5B0Z A;  1ID3 A;  3WTP E;  3REI D;  3UTB D;  1TZY A;  2CV5 A;  3B6G D;  2HUE B;  3VH6 W;  3WAA D;  5JRG A;  4H9O B;  1P3L A;  4XUJ D;  5F99 B;  4KGC A;  3KUY B;  1P3B C;  5GT3 B;  5AV8 B;  5CPI A;  5E5A B;  3KXB C;  1WWS A;  4X23 A;  4AWL B;  2CWE A;  2YFV A;  5E5A C;  3B0D C;  1P3A C;  2ARO D;  3UTA D;  3AYW B;  1P3M B;  3AZJ D;  5CPK C;  3MVD B;  3AV2 D;  5F99 D;  3TU4 D;  4DRB A;  3AZI B;  3V9R A;  5BS7 C;  3REJ B;  3AZH B;  4H9S A;  4CSR A;  3KXB A;  4WU9 A;  3LZ0 D; 
#chains in the Genus database with same CATH topology
 3LEL B;  3MGS D;  5AVC D;  2NZD D;  2ZY5 A;  2ZM5 A;  2Y2M A;  3MVD D;  4JJN A;  5JA4 A;  3X1S B;  3MGQ A;  3A6N A;  4H9Q B;  3KXB D;  5GT0 A;  4G91 C;  2NQB A;  2ARO C;  5GSU D;  5F99 A;  1M18 C;  4KGC B;  2PYO A;  1KX4 C;  3AZJ C;  1KX5 A;  2FJ7 A;  3LZ0 C;  1EQZ D;  4H9P A;  5B2J B;  4X23 B;  3MGP D;  3WA9 A;  4UUZ B;  3TU4 C;  3AZK A;  5B31 C;  5CPI C;  5AVB B;  3AYW A;  1WWI A;  3C1C C;  3WKJ C;  1W2E A;  3TU4 B;  4ZBJ C;  1Q9C A;  4WNN B;  1KX4 A;  3MNN D;  3MVD A;  5AV5 C;  2F8N K;  1S32 B;  3O62 B;  3MNN B;  3W97 D;  3EPL A;  1TZY C;  2CV5 C;  5KDM B;  1P3K D;  3B6F D;  4UPK A;  5B32 D;  4H9N B;  3MGP B;  4YS3 A;  1AOI A;  3LJA B;  5BT1 C;  1P3G D;  3X1S D;  1P34 A;  2Y2K A;  5GT3 D;  5AY8 C;  4J8V A;  4JJN B;  3REL B;  3AZF C;  3W96 C;  3MGR C;  5GSU B;  1F66 C;  3W98 B;  4KUD C;  1BFM A;  4H9Q A;  3A1I A;  1Z2C B;  3W98 C;  5B1M A;  3W97 C;  3NQU A;  3KWQ D;  1P3P C;  5CPI D;  3AZL C;  1EQZ A;  3REH C;  4NE6 A;  5AVC B;  3LZ1 D;  2BYM B;  2HUE C;  3AZM C;  5AV9 C;  4Z5T D;  4LD9 C;  1KX3 D;  5AY8 A;  4J8V C;  3AV1 D;  4LD9 B;  3KUY C;  3AL0 C;  3B6G A;  1TZY D;  2CV5 D;  5AVB A;  5DNM A;  3MGQ D;  5G49 A;  3A6N D;  5JRG B;  1P3L B;  3O62 A;  1M19 B;  3H0M C;  5JRG C;  1P3L C;  4R8P A;  5GT3 A;  3MGS A;  2BYK B;  1P3F A;  4Z5T B;  4HGA C;  1BH9 A;  4Z5T C;  5AV9 D;  3UT9 A;  4YS3 D;  5BNX B;  1HQ3 C;  5B1L B;  3X1U C;  3W98 D;  1P3I C;  5DNM C;  2HIO C;  3WTP D;  5B2I C;  3AZH C;  1P3K A;  3B6F A;  1HQ3 B;  4YM6 B;  3AV2 A;  5DNN C;  3AFA A;  3KWQ A;  3AZH A;  5AV8 C;  5B1M B;  5B0Z B;  3KXB B;  3LJA D;  4WU9 B;  2NZD C;  3UT9 C;  5B1M C;  4WU8 D;  3B0D B;  5B0Y C;  2YFW B;  1HQ3 D;  3AZG A;  5AV6 A;  5JRG D;  5CPJ D;  1P3L D;  2LY8 A;  3AZJ B;  3AZE B;  2FFF B;  2JSS A;  2YFV B;  2XD5 A;  3AZN C;  4YS3 C;  3AN2 C;  5B31 B;  4H9R B;  4ZUX D;  3VH5 W;  1M19 A;  5C3I B;  5AV8 D;  4JJN D;  5E5A D;  1H3O A;  1KX5 B;  2BYK A;  3H0R C;  5B40 D;  4J8W D;  1B6W A;  5B31 D;  3LEL C;  3UTA C;  1P3F B;  4WU8 C;  1BH9 B;  5B0Y A;  4ZUX A;  3C1B C;  5B33 A;  1ZLA D;  3MNN C;  4M6B A;  2L5A A;  2RIQ A;  5B1L A;  3EPJ A;  3REJ A;  3AV2 C;  3X1S C;  2ZY2 A;  1P3K B;  3B6F B;  5FUG B;  1KX3 A;  3AV2 B;  5AY8 D;  2J8P A;  4G91 B;  5CPJ A;  2PYO D;  3REK B;  3AZN D;  5B33 C;  1P3G C;  4WU8 A;  3REJ D;  3LZ0 B;  3MGQ B;  3LJA A;  2VQR A;  5B32 G;  3X1T C;  3AZG B;  2Y2Q A;  3AZE A;  2FJ7 B;  4NFT A;  1P3G A;  3REH D;  4QLC D;  3NQU B;  1ID3 D;  1EQZ C;  3TU4 A;  3MGP C;  3B0C T;  1KX4 D;  3MNN A;  3AZM A;  5AV5 D;  3WAA B;  3UTA A;  2ARO A;  1F66 B;  3W96 B;  2NQB C;  1A7W A;  3WTP C;  3AZH D;  3WAA C;  3MGP A;  3WA9 D;  3AZK D;  1AOI B;  1KX3 B;  1TAF A;  4KHA A;  3W97 B;  1AOI C;  1P3I B;  4KUD A;  5B31 G;  5B2I B;  3VH6 T;  4J8X D;  4Z5T A;  3KFU G;  1BH8 A;  5GSU A;  5GXQ A;  2Y2P A;  1U35 D;  5GT3 C;  5GT0 D;  3UTB A;  5B1M D;  3X1V B;  4YM6 A;  1P3F D;  3EPK A;  3AYW C;  2W8S A;  5BO0 B;  3KWQ C;  3AFA B;  1P3P D;  1M1A C;  1M19 D;  5B24 D;  3KSY A;  5DNN A;  3AFA C;  4LD9 A;  2IO5 B;  5B32 B;  5GT0 B;  5CPJ C;  3KUY D;  5B1L C;  3R45 B;  5AV6 D;  3X1U B;  3AZG D;  3AZN B;  2Y2L A;  2HIO B;  4YM6 C;  4R8P B;  3AZJ A;  4J8U B;  3UTA B;  1P3F C;  3W96 A;  1F66 A;  4R8P C;  1T3U A;  5CP6 B;  2RVQ D;  1U35 C;  5B0Z C;  4WU9 C;  1BH8 B;  4NE3 A;  3B6G C;  3LZ1 B;  3REL D;  5B0Y B;  2HIO D;  4XZQ C;  5B24 C;  1JFI A;  2BG1 A;  4NE5 A;  4XZQ B;  5BNV B;  5FUG A;  3AZE D;  1P3A D;  1B67 A;  3B0B A;  5B2I D;  3REK A;  5CHL B;  5C3I C;  4AWL C;  4G92 B;  3LZ0 A;  1TZY B;  3VH5 T;  2CV5 B;  2ZY3 A;  3C1B B;  1M1A A;  2Y2H A;  5CPK B;  3X1U A;  3AZN A;  2DQN C;  2HIO A;  1P3K C;  1EQZ B;  3B6F C;  1P3B A;  1H3O B;  3H0L C;  4KUD D;  5AY8 B;  4WV4 B;  4JJN C;  3REL C;  4E44 A;  2NQB D;  4EO5 B;  5B33 B;  3MGR B;  3NQJ B;  4X23 D;  4EO5 C;  4Z66 A;  1ZLA A;  1P3M A;  1F66 D;  3W96 D;  3F6T A;  2DF4 C;  1P3P B;  2NZD A;  5B40 B;  2G5H C;  4J8W B;  4J8V D;  3W99 D;  5BS7 A;  3X1T B;  2F8N B;  4KGC D;  5AVC C;  3AZM B;  1P34 D;  3AZK C;  3WAA A;  3LEL D;  1M18 D;  1PZR A;  2FJ7 C;  3REH A;  4QLC A;  2UWX A;  3AZL A;  5AV9 A;  3LEL A;  1TAF B;  3W97 A;  1P3I A;  3W99 A;  1HQ3 A;  3A1K A;  4J8U D;  4X23 C;  3AN2 A;  1M19 C;  5JA4 B;  1P3O D;  5GXQ B;  3A6N C;  3UTB C;  3KWQ B;  4Z66 D;  4HGA B;  5GXQ C;  3AYW D;  4ZBJ B;  5DNM D;  1M1A B;  1P34 C;  4WZS B;  2IO5 C;  3O62 C;  3VH6 A;  5B32 C;  2FJ7 D;  1P3B D;  5BO0 A;  1ID3 C;  4H9P B;  5B2J A;  5AV6 B;  3X1U D;  3WTP A;  4XUJ B;  5DNN B;  1R4V A;  1ID3 B;  3LJA C;  5B1L D;  1F1E A;  3NQJ A;  4Z2M H;  5AV6 C;  3REI A;  3UT9 D;  5CP6 D;  4Z66 B;  5DNN D;  1P3O C;  4CAY B;  5AV5 A;  1U35 B;  3X1V C;  1S32 A;  3AZF B;  4H9R A;  5B31 A;  5B40 A;  4J8W A;  1P3P A;  1KU5 A;  2NZD B;  4KUD B;  1ULY A;  4J8U A;  5AV8 A;  2RVQ C;  5B2I A;  5E5A A;  3B0C W;  3EG5 B;  3REK D;  2F2A C;  5KDM A;  3LZ1 C;  4ZUX B;  4WU9 D;  5CP6 A;  5CPK D;  5AVB D;  3AZL B;  3AZE C;  3AZI D;  4ZUX C;  5GXQ D;  3VH5 A;  5F99 C;  5B24 B;  3MGS C;  3AV1 A;  1M18 A;  4DRA A;  5GT0 C;  4J8V B;  3REL A;  5CPJ B;  4J8X B;  2Y2J A;  3AN2 B;  1P3A B;  3V9R B;  4J8X C;  2F8N H;  1N1J B;  4E45 A;  1P3M D;  3AV1 C;  4WU8 B;  1JFI B;  2Y2N A;  3MVD C;  5CP6 C;  3AFA D;  2F8N D;  4H9S C;  4H9O A;  3R45 A;  3AZI C;  1P3I D;  4XUJ A;  3KUY A;  3X1S A;  3REJ C;  3B6G B;  3REK C;  3REI B;  5DNM B;  3C1B A;  1P3G B;  1M1A D;  5CPK A;  2PYO C;  3P5J B;  3REI C;  3EPH A;  5B33 D;  3AZF A;  2PYO B;  1P3B B;  3IP4 C;  1S32 D;  4YM6 D;  3MGR A;  3UT9 B;  4G92 C;  2ARO B;  1P3M C;  1M18 B;  4KGC C;  4CSR B;  1KX4 B;  5B2J D;  4J8X A;  3X1T A;  4KHA B;  4WJ3 C;  1N1J A;  2JCH A;  4H9N A;  3C1C B;  3WKJ B;  4YS3 B;  2G5I C;  3A6N B;  3UTB B;  3X1V A;  1S32 C;  3AZM D;  2NQB B;  1KX5 C;  2YFW A;  1P3O A;  3AN2 D;  1KX3 C;  3WA9 C;  2F8N G;  4J8W C;  5B40 C;  3AZL D;  3FDD A;  3WA9 B;  4UUZ A;  3C1B D;  3AZK B;  1AOI D;  1ZLA C;  4LD9 D;  5B32 A;  1ZLA B;  2BYM A;  4WNN A;  5GSU C;  5B2J C;  2F8N A;  3MGQ C;  5AVB C;  5CPI B;  3X1V D;  4DQY B;  4CAY A;  5G49 B;  3REH B;  5AV5 B;  4QLC B;  1U35 A;  3AZG C;  5AV9 B;  3C1C D;  1HTA A;  3WKJ D;  1P34 B;  2Y2I A;  4QLC C;  1KX5 D;  3X1T D;  3MGS B;  4Z2M G;  3W99 B;  5BT1 D;  2JE5 A;  3LZ1 A;  2XD1 A;  3W99 C;  3C1C A;  3WKJ A;  3W98 A;  3AZI A;  2Y2O A;  4J8U C;  5BNX A;  4XUJ C;  5B0Z D;  3MGR D;  5B24 A;  3AV1 B;  5B0Y D;  4XZQ A;  5BNV A;  4Z66 C;  1P3O B;  4R8P D;  5AVC A;  1P3A A;  3O62 D;  4XZQ D;  3AZF D;  3WTP B;  5B0Z A;  1ID3 A;  3WTP E;  3REI D;  3UTB D;  1TZY A;  2CV5 A;  3B6G D;  2HUE B;  3VH6 W;  3WAA D;  5JRG A;  4H9O B;  1P3L A;  4XUJ D;  5F99 B;  4KGC A;  3KUY B;  1P3B C;  5GT3 B;  5AV8 B;  5CPI A;  5E5A B;  3KXB C;  1WWS A;  4X23 A;  4AWL B;  2CWE A;  2YFV A;  5E5A C;  3B0D C;  2Y2G A;  1P3A C;  2ARO D;  3UTA D;  3AYW B;  1P3M B;  3AZJ D;  5CPK C;  3MVD B;  3AV2 D;  5F99 D;  3TU4 D;  4DRB A;  2ZY4 A;  3V9R A;  3AZI B;  5BS7 C;  3REJ B;  3AZH B;  4H9S A;  4CSR A;  3KXB A;  4WU9 A;  3LZ0 D; 
#chains in the Genus database with same CATH homology
 3LEL B;  3MGS D;  5AVC D;  2NZD D;  2ZY5 A;  2ZM5 A;  2Y2M A;  3MVD D;  4JJN A;  5JA4 A;  3X1S B;  3MGQ A;  3A6N A;  4H9Q B;  3KXB D;  5GT0 A;  4G91 C;  2NQB A;  2ARO C;  5GSU D;  5F99 A;  1M18 C;  4KGC B;  2PYO A;  1KX4 C;  3AZJ C;  1KX5 A;  2FJ7 A;  3LZ0 C;  1EQZ D;  4H9P A;  5B2J B;  4X23 B;  3MGP D;  3WA9 A;  4UUZ B;  3TU4 C;  3AZK A;  5B31 C;  5CPI C;  5AVB B;  3AYW A;  1WWI A;  3C1C C;  3WKJ C;  1W2E A;  3TU4 B;  4ZBJ C;  1Q9C A;  4WNN B;  1KX4 A;  3MNN D;  3MVD A;  5AV5 C;  2F8N K;  1S32 B;  3O62 B;  3MNN B;  3W97 D;  3EPL A;  1TZY C;  2CV5 C;  5KDM B;  1P3K D;  3B6F D;  4UPK A;  5B32 D;  4H9N B;  3MGP B;  4YS3 A;  1AOI A;  3LJA B;  5BT1 C;  1P3G D;  3X1S D;  1P34 A;  2Y2K A;  5GT3 D;  5AY8 C;  4J8V A;  4JJN B;  3REL B;  3AZF C;  3W96 C;  3MGR C;  5GSU B;  1F66 C;  3W98 B;  4KUD C;  1BFM A;  4H9Q A;  3A1I A;  1Z2C B;  3W98 C;  5B1M A;  3W97 C;  3NQU A;  3KWQ D;  1P3P C;  5CPI D;  3AZL C;  1EQZ A;  3REH C;  4NE6 A;  5AVC B;  3LZ1 D;  2BYM B;  2HUE C;  3AZM C;  5AV9 C;  4Z5T D;  4LD9 C;  1KX3 D;  5AY8 A;  4J8V C;  3AV1 D;  4LD9 B;  3KUY C;  3AL0 C;  3B6G A;  1TZY D;  2CV5 D;  5AVB A;  5DNM A;  3MGQ D;  5G49 A;  3A6N D;  5JRG B;  1P3L B;  3O62 A;  1M19 B;  3H0M C;  5JRG C;  1P3L C;  4R8P A;  5GT3 A;  3MGS A;  2BYK B;  1P3F A;  4Z5T B;  4HGA C;  1BH9 A;  4Z5T C;  5AV9 D;  3UT9 A;  4YS3 D;  5BNX B;  1HQ3 C;  5B1L B;  3X1U C;  3W98 D;  1P3I C;  5DNM C;  2HIO C;  3WTP D;  5B2I C;  3AZH C;  1P3K A;  3B6F A;  1HQ3 B;  4YM6 B;  3AV2 A;  5DNN C;  3AFA A;  3KWQ A;  3AZH A;  5AV8 C;  5B1M B;  5B0Z B;  3KXB B;  3LJA D;  4WU9 B;  2NZD C;  3UT9 C;  5B1M C;  4WU8 D;  3B0D B;  5B0Y C;  2YFW B;  1HQ3 D;  3AZG A;  5AV6 A;  5JRG D;  5CPJ D;  1P3L D;  2LY8 A;  3AZJ B;  3AZE B;  2FFF B;  2JSS A;  2YFV B;  2XD5 A;  3AZN C;  4YS3 C;  3AN2 C;  5B31 B;  4H9R B;  4ZUX D;  3VH5 W;  1M19 A;  5C3I B;  5AV8 D;  4JJN D;  5E5A D;  1H3O A;  1KX5 B;  2BYK A;  3H0R C;  5B40 D;  4J8W D;  1B6W A;  5B31 D;  3LEL C;  3UTA C;  1P3F B;  4WU8 C;  1BH9 B;  5B0Y A;  4ZUX A;  3C1B C;  5B33 A;  1ZLA D;  3MNN C;  4M6B A;  2L5A A;  2RIQ A;  5B1L A;  3EPJ A;  3REJ A;  3AV2 C;  3X1S C;  2ZY2 A;  1P3K B;  3B6F B;  5FUG B;  1KX3 A;  3AV2 B;  5AY8 D;  2J8P A;  4G91 B;  5CPJ A;  2PYO D;  3REK B;  3AZN D;  5B33 C;  1P3G C;  4WU8 A;  3REJ D;  3LZ0 B;  3MGQ B;  3LJA A;  2VQR A;  5B32 G;  3X1T C;  3AZG B;  2Y2Q A;  3AZE A;  2FJ7 B;  4NFT A;  1P3G A;  3REH D;  4QLC D;  3NQU B;  1ID3 D;  1EQZ C;  3TU4 A;  3MGP C;  3B0C T;  1KX4 D;  3MNN A;  3AZM A;  5AV5 D;  3WAA B;  3UTA A;  2ARO A;  1F66 B;  3W96 B;  2NQB C;  1A7W A;  3WTP C;  3AZH D;  3WAA C;  3MGP A;  3WA9 D;  3AZK D;  1AOI B;  1KX3 B;  1TAF A;  4KHA A;  3W97 B;  1AOI C;  1P3I B;  4KUD A;  5B31 G;  5B2I B;  3VH6 T;  4J8X D;  4Z5T A;  3KFU G;  1BH8 A;  5GSU A;  5GXQ A;  2Y2P A;  1U35 D;  5GT3 C;  5GT0 D;  3UTB A;  5B1M D;  3X1V B;  4YM6 A;  1P3F D;  3EPK A;  3AYW C;  2W8S A;  5BO0 B;  3KWQ C;  3AFA B;  1P3P D;  1M1A C;  1M19 D;  5B24 D;  3KSY A;  5DNN A;  3AFA C;  4LD9 A;  2IO5 B;  5B32 B;  5GT0 B;  5CPJ C;  3KUY D;  5B1L C;  3R45 B;  5AV6 D;  3X1U B;  3AZG D;  3AZN B;  2Y2L A;  2HIO B;  4YM6 C;  4R8P B;  3AZJ A;  4J8U B;  3UTA B;  1P3F C;  3W96 A;  1F66 A;  4R8P C;  1T3U A;  5CP6 B;  2RVQ D;  1U35 C;  5B0Z C;  4WU9 C;  1BH8 B;  4NE3 A;  3B6G C;  3LZ1 B;  3REL D;  5B0Y B;  2HIO D;  4XZQ C;  5B24 C;  1JFI A;  2BG1 A;  4NE5 A;  4XZQ B;  5BNV B;  5FUG A;  3AZE D;  1P3A D;  1B67 A;  3B0B A;  5B2I D;  3REK A;  5CHL B;  5C3I C;  4AWL C;  4G92 B;  3LZ0 A;  1TZY B;  3VH5 T;  2CV5 B;  2ZY3 A;  3C1B B;  1M1A A;  2Y2H A;  5CPK B;  3X1U A;  3AZN A;  2DQN C;  2HIO A;  1P3K C;  1EQZ B;  3B6F C;  1P3B A;  1H3O B;  3H0L C;  4KUD D;  5AY8 B;  4WV4 B;  4JJN C;  3REL C;  4E44 A;  2NQB D;  4EO5 B;  5B33 B;  3MGR B;  3NQJ B;  4X23 D;  4EO5 C;  4Z66 A;  1ZLA A;  1P3M A;  1F66 D;  3W96 D;  3F6T A;  2DF4 C;  1P3P B;  2NZD A;  5B40 B;  2G5H C;  4J8W B;  4J8V D;  3W99 D;  5BS7 A;  3X1T B;  2F8N B;  4KGC D;  5AVC C;  3AZM B;  1P34 D;  3AZK C;  3WAA A;  3LEL D;  1M18 D;  1PZR A;  2FJ7 C;  3REH A;  4QLC A;  2UWX A;  3AZL A;  5AV9 A;  3LEL A;  1TAF B;  3W97 A;  1P3I A;  3W99 A;  1HQ3 A;  3A1K A;  4J8U D;  4X23 C;  3AN2 A;  1M19 C;  5JA4 B;  1P3O D;  5GXQ B;  3A6N C;  3UTB C;  3KWQ B;  4Z66 D;  4HGA B;  5GXQ C;  3AYW D;  4ZBJ B;  5DNM D;  1M1A B;  1P34 C;  4WZS B;  2IO5 C;  3O62 C;  3VH6 A;  5B32 C;  2FJ7 D;  1P3B D;  5BO0 A;  1ID3 C;  4H9P B;  5B2J A;  5AV6 B;  3X1U D;  3WTP A;  4XUJ B;  5DNN B;  1R4V A;  1ID3 B;  3LJA C;  5B1L D;  1F1E A;  3NQJ A;  4Z2M H;  5AV6 C;  3REI A;  3UT9 D;  5CP6 D;  4Z66 B;  5DNN D;  1P3O C;  4CAY B;  5AV5 A;  1U35 B;  3X1V C;  1S32 A;  3AZF B;  4H9R A;  5B31 A;  5B40 A;  4J8W A;  1P3P A;  1KU5 A;  2NZD B;  4KUD B;  1ULY A;  4J8U A;  5AV8 A;  2RVQ C;  5B2I A;  5E5A A;  3B0C W;  3EG5 B;  3REK D;  2F2A C;  5KDM A;  3LZ1 C;  4ZUX B;  4WU9 D;  5CP6 A;  5CPK D;  5AVB D;  3AZL B;  3AZE C;  3AZI D;  4ZUX C;  5GXQ D;  3VH5 A;  5F99 C;  5B24 B;  3MGS C;  3AV1 A;  1M18 A;  4DRA A;  5GT0 C;  4J8V B;  3REL A;  5CPJ B;  4J8X B;  2Y2J A;  3AN2 B;  1P3A B;  3V9R B;  4J8X C;  2F8N H;  1N1J B;  4E45 A;  1P3M D;  3AV1 C;  4WU8 B;  1JFI B;  2Y2N A;  3MVD C;  5CP6 C;  3AFA D;  2F8N D;  4H9S C;  4H9O A;  3R45 A;  3AZI C;  1P3I D;  4XUJ A;  3KUY A;  3X1S A;  3REJ C;  3B6G B;  3REK C;  3REI B;  5DNM B;  3C1B A;  1P3G B;  1M1A D;  5CPK A;  2PYO C;  3P5J B;  3REI C;  3EPH A;  5B33 D;  3AZF A;  2PYO B;  1P3B B;  3IP4 C;  1S32 D;  4YM6 D;  3MGR A;  3UT9 B;  4G92 C;  2ARO B;  1P3M C;  1M18 B;  4KGC C;  4CSR B;  1KX4 B;  5B2J D;  4J8X A;  3X1T A;  4KHA B;  4WJ3 C;  1N1J A;  2JCH A;  4H9N A;  3C1C B;  3WKJ B;  4YS3 B;  2G5I C;  3A6N B;  3UTB B;  3X1V A;  1S32 C;  3AZM D;  2NQB B;  1KX5 C;  2YFW A;  1P3O A;  3AN2 D;  1KX3 C;  3WA9 C;  2F8N G;  4J8W C;  5B40 C;  3AZL D;  3FDD A;  3WA9 B;  4UUZ A;  3C1B D;  3AZK B;  1AOI D;  1ZLA C;  4LD9 D;  5B32 A;  1ZLA B;  2BYM A;  4WNN A;  5GSU C;  5B2J C;  2F8N A;  3MGQ C;  5AVB C;  5CPI B;  3X1V D;  4DQY B;  4CAY A;  5G49 B;  3REH B;  5AV5 B;  4QLC B;  1U35 A;  3AZG C;  5AV9 B;  3C1C D;  1HTA A;  3WKJ D;  1P34 B;  2Y2I A;  4QLC C;  1KX5 D;  3X1T D;  3MGS B;  4Z2M G;  3W99 B;  5BT1 D;  2JE5 A;  3LZ1 A;  2XD1 A;  3W99 C;  3C1C A;  3WKJ A;  3W98 A;  3AZI A;  2Y2O A;  4J8U C;  5BNX A;  4XUJ C;  5B0Z D;  3MGR D;  5B24 A;  3AV1 B;  5B0Y D;  4XZQ A;  5BNV A;  4Z66 C;  1P3O B;  4R8P D;  5AVC A;  1P3A A;  3O62 D;  4XZQ D;  3AZF D;  3WTP B;  5B0Z A;  1ID3 A;  3WTP E;  3REI D;  3UTB D;  1TZY A;  2CV5 A;  3B6G D;  2HUE B;  3VH6 W;  3WAA D;  5JRG A;  4H9O B;  1P3L A;  4XUJ D;  5F99 B;  4KGC A;  3KUY B;  1P3B C;  5GT3 B;  5AV8 B;  5CPI A;  5E5A B;  3KXB C;  1WWS A;  4X23 A;  4AWL B;  2CWE A;  2YFV A;  5E5A C;  3B0D C;  2Y2G A;  1P3A C;  2ARO D;  3UTA D;  3AYW B;  1P3M B;  3AZJ D;  5CPK C;  3MVD B;  3AV2 D;  5F99 D;  3TU4 D;  4DRB A;  2ZY4 A;  3V9R A;  3AZI B;  5BS7 C;  3REJ B;  3AZH B;  4H9S A;  4CSR A;  3KXB A;  4WU9 A;  3LZ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...