3WKJD

The nucleosome containing human tsh2b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjD00
4X23B 3VH5A 3MGPB 3KWQB 4G91C 4Z66D 3C1BA 3AZHD 4DRBA 1P34B 3AZIA 3UT9C 3X1UC 4J8UB 5DNNC 3WKJA 3O62B 4CSRA 4YS3A 4JJNB 2NQBB 1ZLAD 5AVBB 5GXQA 1P3IB 3WAAB 3REKC 5B32C 1AOIC 5B1LB 4WU9C 1H3OB 3V9RA 4YS3D 1M18C 3MVDA 4XUJC 3W96A 2CV5A 3KXBD 3AZJA 3AZLC 4H9PA 3X1TB 3LZ0B 5BO0A 1EQZA 4QLCB 4ZUXA 5AV8D 3AV2B 3AN2C 2PYOC 3WTPA 1P3MB 1U35A 4KGCD 3NQUB 4Z5TC 4AWLC 3X1VB 4HGAB 3UTAC 4LD9D 3W96D 5CPJA 4Z66B 4KUDC 3AZJD 3AZHB 5B32G 2FJ7D 3VH6A 5F99B 3WA9C 1EQZD 1HQ3B 3A6NB 4H9SA 3WTPD 1U35D 2HIOA 2CWEA 1P3KA 3W99A 4NE6A 3AZNC 3C1BB 1KX3C 1ID3C 4CAYA 4WU8B 2JSSA 3AZIB 2IO5B 3WKJB 3VH5W 2HIOD 4CSRB 4YS3B 5BT1C 2RVQC 3W99D 1P3GA 5GXQB 5B2IA 3REHA 1F66C 3KUYC 5CP6A 5CPIA 3X1SD 3AZKA 3V9RB 1BH9A 3MVDB 2L5AA 3AZEC 1P3BA 2CV5B 3W96B 5E5AC 3AZJB 3REHD 4H9PB 1B67A 5BO0B 1EQZB 4ZUXB 5CP6D 5GT0C 5CPID 3WTPB 3RELA 3MGRA 1U35B 3AZKD 4J8WA 4M6BA 1P3BD 5CPJB 3LJAC 1P3AD 4NE5A 5BS7C 4Z2MG 3C1CD 3MGQC 1P3LD 4R8PA 3LELA 3MGRD 3AZMC 4J8WD 2HIOB 1P3KB 5B0YC 3W99B 1KX4C 4X23D 1P3FA 5AV6C 3MGPD 4CAYB 2BYMA 3LZ1A 3KWQD 3AZGC 2F8NG 4UUZA 5B1MA 4R8PD 3LELD 3TU4A 1P34D 1KU5A 5CPKA 4J8UD 3MGSC 1M19B 1P3GB 5B2IB 4JJND 4Z66C 2NQBD 3REHB 4J8VA 1F1EA 4J8XA 3AZFA 5CP6B 1P3ID 3NQJA 5B33A 5AVCC 5CPIB 3TU4D 2NZDA 3AZKB 1P3OC 1BH9B 1N1JB 1P3BB 1ZLAC 1S32C 5GSUA 4J8VD 3AFAA 5B31A 3RELB 3LZ0D 5F99A 3MGRB 4J8WB 3AV2D 4Z2MH 3X1VD 5AV5C 3KXBC 3W97C 5GSUD 4H9OA 3AFAD 1P3PB 3B6GA 4WZSB 5AV8C 4WU8A 4R8PB 5F99D 3LELB 1HQ3D 4KGCC 3A6ND 1TAFA 4LD9C 5JRGA 3UTBA 4NFTA 1P3FB 4E44A 2HUEC 2BYMB 3LZ1B 2FJ7C 3B6GD 3C1BD 4UUZB 5B1MB 3AYWC 3AV1A 3TU4B 4WU8D 2AROA 3AZID 5CPKB 5DNMA 1KX5A 3WKJD 5JRGD 3REIA 3UTBD 2YFVA 4J8VB 5GXQD 4WNNA 4J8XB 3AZFB 3NQJB 5B33B 3AV1D 3B6FA 1JFIA 5B24C 5B0ZC 3VH5T 2AROD 2NZDB 1HTAA 4ZBJC 4XZQC 5DNMD 3REID 3REJB 5AV9A 5C3IB 3MVDD 5GT3C 1Q9CA 5GSUB 3AFAB 5B31B 2CV5D 3W98B 5BNVA 4ZUXD 3X1SC 3UT9A 3X1UA 5DNNA 4EO5C 4G92B 4H9OB 5CPJD 5B2JC 4YM6C 3MNNB 3B6GB 1M1AB 3REKA 5B32A 3UT9D 3X1UD 1AOIA 4WU9A 1TAFB 5JRGB 3UTBB 5BNXA 1P3KD 1M18A 1P3AC 1M19A 4XUJA 3C1CC 1BFMA 1P3LC 3AV1B 3AZLA 4H9RA 2AROB 5B40C 5B32D 5DNMB 3AN2A 2PYOA 1KX5B 5AY8C 3REIB 4Z5TA 3VH6T 2YFVB 4X23C 3B0DB 3UTAA 1M19D 1N1JA 4XUJD 4NE3A 3MGPC 4WNNB 3KWQC 1P3GD 5B2ID 4KUDA 3AZLD 1JFIB 3B6FB 1P34C 3WA9A 3AN2D 4J8UC 5AV9B 3O62C 3UTAD 4JJNC 2NQBC 3AZNA 5AVBC 4G91B 4KUDD 5BNVB 1P3IC 1KX3A 5CHLB 3WAAC 1ID3A 1P3PA 3WA9D 3UT9B 3X1UB 1WWIA 3RELD 5B1LC 5DNNB 3REKB 1F66A 3X1TC 5B32B 3LZ0C 1P3PD 4QLCC 1AOIB 3AV2C 1A7WA 2BYKA 4WU9B 1P3MC 3X1VC 5BNXB 1M18B 4HGAC 5G49A 3AZEA 4XUJB 2RVQD 1P3FD 5E5AA 3AZLB 4H9RB 3AZHC 3LZ1D 1F66D 5F99C 4H9NA 1HQ3C 5B1MD 5GT0A 3A6NC 3AN2B 2PYOB 4Z5TB 4AWLB 5CPKD 3UTAB 3AZED 3REJA 1B6WA 5E5AD 3LJAA 4KUDB 3C1BC 5BS7A 3B0CW 4J8XD 3AZFD 3MGQA 4WU8C 3AZIC 3WA9B 5B33D 3W98A 1R4VA 2NZDD 3AZMA 2IO5C 3WKJC 5KDMA 5JRGC 3UTBC 4YS3C 5B0YA 3REJD 3AZNB 5GXQC 1KX4A 1KX3B 1ID3B 5AV6A 5B31D 3MNNA 3MGQD 3AZGA 3W98D 1M1AA 5DNMC 3AZMD 3MVDC 2F8NK 3MGSA 5B0YD 2F8NH 3W96C 2CV5C 3AZJC 5AV6D 1F66B 3KUYB 3MNND 1EQZC 4ZUXC 1M1AD 5AVCA 2BYKB 3WTPC 3R45B 1U35C 1P3OA 1TZYA 5G49B 3MGSD 3AZEB 1ULYA 5CPJC 1ZLAA 5E5AB 1S32A 4H9NB 5GT0B 5AVCD 4H9SC 2F8NB 1P3OD 1TZYD 2HIOC 1KX5D 1P3KC 3W99C 5AV5A 3LJAB 1S32D 3KXBA 3W97A 4WV4B 3MGQB 3B6FD 5AV8A 3AZMB 4H9QA 5KDMB 4KGCA 5B0YB 4LD9A 5AV9D 1M19C 5AV5D 1P3GC 1KX4B 5B2IC 3W97D 5AV6B 3REHC 3AZGB 2FJ7A 5CP6C 1WWSA 5CPIC 3AYWA 3AZKC 5DNND 5JA4A 3MGSB 1P3BC 3B0BA 5FUGA 1BH8A 5AVCB 3REKD 5B24A 5B0ZA 3RELC 3AYWD 3MGRC 4J8WC 1P3OB 1AOID 1TZYB 4XZQA 4WU9D 1ZLAB 1M18D 1S32B 5GT3A 2YFWA 1P3PC 5B24D 5B0ZD 4R8PC 3LELC 3X1SA 4XZQD 2PYOD 3KSYA 4Z5TD 5AV5B 1P3FC 5GT3D 3KXBB 3W97B 3LZ1C 4YM6A 5B2JA 5AV8B 5B1MC 3TU4C 4H9QB 4KGCB 5CPKC 4LD9B 4KHAA 3B0CT 2HUEB 2LY8A 4J8VC 1P3AA 3AZND 4YM6D 5B2JD 3C1CA 4J8XC 3AZFC 2FJ7B 1KX3D 1P3LA 5B33C 1ID3D 3AYWB 3KUYA 2NZDC 5B40A 5JA4B 3R45A 5AY8A 3REJC 5FUGB 5C3IC 4X23A 3WTPE 5BT1D 5GSUC 1BH8B 3AFAC 5B31C 3MGPA 3KWQA 3W98C 5B24B 5B0ZB 3KUYD 5B40D 1P34A 4ZBJB 4XZQB 2F8NA 4J8UA 5AY8D 5GT3B 3O62A 4G92C 2YFWB 3VH6W 4JJNA 2NQBA 4E45A 5AVBA 3MNNC 3B6GC 1M1AC 1P3IA 3WAAA 3X1SB 5GT0D 2F8ND 5B1LA 1H3OA 4EO5B 3O62D 5B31G 4YM6B 5B2JB 3LJAD 5AVBD 3AV1C 3WAAD 2AROC 3X1TA 3LZ0A 4QLCA 3AV2A 1TZYC 5B1LD 4DRAA 1KX5C 1P3MA 4KHAB 3REIC 3NQUA 3X1VA 3B0DC 1P3AB 3C1CB 1KX4D 4Z66A 1P3LB 3B6FC 3AZHA 5B40B 3AZGD 3X1TD 4QLCD 1HQ3A 3A6NA 1P3MD 5AY8B 5AV9C
chains in the Genus database with same CATH superfamily
4X23B 3VH5A 3MGPB 3KWQB 4G91C 4Z66D 3C1BA 3AZHD 4DRBA 1P34B 3AZIA 3UT9C 3X1UC 2XD5A 4J8UB 5DNNC 3WKJA 3O62B 4CSRA 4YS3A 4JJNB 2NQBB 1ZLAD 5AVBB 5GXQA 1P3IB 2G5HC 3WAAB 3REKC 5B32C 1AOIC 5B1LB 4WU9C 1H3OB 3V9RA 4YS3D 1M18C 3MVDA 4XUJC 3W96A 2CV5A 3KXBD 2W8SA 3AZJA 3AZLC 4H9PA 3X1TB 3LZ0B 5BO0A 1EQZA 4QLCB 4ZUXA 5AV8D 3AV2B 3AN2C 3H0RC 2PYOC 3WTPA 1P3MB 1U35A 4KGCD 3NQUB 4Z5TC 4AWLC 3X1VB 4HGAB 3UTAC 4LD9D 3W96D 5CPJA 3EG5B 4Z66B 4KUDC 3AZJD 3AZHB 5B32G 2FJ7D 3VH6A 5F99B 3WA9C 1EQZD 1HQ3B 3A6NB 4H9SA 3WTPD 1U35D 2HIOA 2CWEA 1P3KA 3W99A 4NE6A 3AZNC 3C1BB 1KX3C 1ID3C 4CAYA 4WU8B 2JSSA 3AZIB 2IO5B 3WKJB 3VH5W 2HIOD 4CSRB 4YS3B 5BT1C 2RVQC 3W99D 1P3GA 5GXQB 5B2IA 3EPKA 3REHA 1F66C 3KUYC 2Y2GA 5CP6A 5CPIA 3X1SD 3AZKA 2ZY5A 3V9RB 1BH9A 3MVDB 2L5AA 3AZEC 1P3BA 2CV5B 3W96B 5E5AC 3AZJB 3REHD 4H9PB 1B67A 5BO0B 1EQZB 4ZUXB 5CP6D 5GT0C 5CPID 3WTPB 3RELA 3MGRA 1U35B 3AZKD 4J8WA 4M6BA 1P3BD 5CPJB 3LJAC 2BG1A 4NE5A 5BS7C 1P3AD 4Z2MG 3C1CD 1Z2CB 3MGQC 1P3LD 2Y2IA 4R8PA 3LELA 3MGRD 3AZMC 4J8WD 2HIOB 3H0LC 1P3KB 5B0YC 3W99B 1KX4C 4X23D 1P3FA 5AV6C 3MGPD 4CAYB 2BYMA 3LZ1A 3KWQD 3AZGC 2F8NG 4UUZA 5B1MA 4R8PD 3LELD 3TU4A 1P34D 1KU5A 5CPKA 4J8UD 3MGSC 1M19B 1P3GB 4WJ3C 5B2IB 4JJND 4Z66C 2NQBD 3REHB 4J8VA 1F1EA 2XD1A 4J8XA 3AZFA 2F2AC 5CP6B 2Y2PA 3NQJA 5B33A 5AVCC 5CPIB 1P3ID 3TU4D 2NZDA 3AZKB 1P3OC 1BH9B 1N1JB 1P3BB 1ZLAC 1S32C 5GSUA 4J8VD 3AFAA 5B31A 2G5IC 3RELB 3LZ0D 5F99A 3MGRB 4J8WB 3AV2D 4Z2MH 3X1VD 5AV5C 3KXBC 3W97C 5GSUD 4H9OA 3AFAD 1P3PB 3B6GA 4WZSB 5AV8C 4WU8A 4R8PB 5F99D 3LELB 1HQ3D 4KGCC 3A6ND 1TAFA 4LD9C 5JRGA 3UTBA 4NFTA 1P3FB 4E44A 2HUEC 2BYMB 3LZ1B 2FJ7C 3B6GD 3C1BD 4UUZB 5B1MB 3AYWC 3AV1A 3TU4B 4WU8D 2AROA 3A1IA 3AZID 5CPKB 5DNMA 1KX5A 3WKJD 5JRGD 3REIA 3UTBD 2YFVA 4J8VB 5GXQD 4WNNA 4J8XB 3AZFB 3NQJB 5B33B 3AV1D 3B6FA 1JFIA 5B24C 5B0ZC 3VH5T 2AROD 2NZDB 1HTAA 4ZBJC 4XZQC 5DNMD 3REID 3REJB 5AV9A 3FDDA 2FFFB 5C3IB 3MVDD 5GT3C 2ZM5A 1Q9CA 5GSUB 3AFAB 5B31B 2CV5D 3W98B 5BNVA 4ZUXD 3X1SC 3UT9A 3X1UA 2JCHA 5DNNA 4EO5C 4G92B 4H9OB 5CPJD 5B2JC 4YM6C 3MNNB 3B6GB 1M1AB 3REKA 3IP4C 5B32A 1T3UA 3UT9D 3X1UD 1AOIA 4WU9A 1TAFB 5JRGB 3UTBB 5BNXA 1P3KD 1M18A 2J8PA 1P3AC 1M19A 4XUJA 3C1CC 1W2EA 1BFMA 1P3LC 3AV1B 3AZLA 4H9RA 2AROB 5B40C 5B32D 2ZY2A 5DNMB 3AN2A 2PYOA 1KX5B 5AY8C 3REIB 4Z5TA 3VH6T 2YFVB 4X23C 3B0DB 3UTAA 1M19D 1N1JA 4XUJD 4NE3A 3MGPC 4WNNB 3KWQC 1P3GD 5B2ID 2ZY3A 4KUDA 3AZLD 1JFIB 3B6FB 1P34C 3WA9A 3KFUG 3AN2D 4J8UC 2UWXA 5AV9B 2Y2OA 3O62C 3UTAD 4JJNC 2NQBC 3AZNA 5AVBC 4G91B 4KUDD 5BNVB 1P3IC 1KX3A 5CHLB 3WAAC 1ID3A 1P3PA 3WA9D 3UT9B 3X1UB 1WWIA 3RELD 5B1LC 5DNNB 3P5JB 2Y2KA 3REKB 1F66A 3AL0C 3X1TC 5B32B 3LZ0C 1P3PD 4QLCC 1AOIB 3AV2C 1A7WA 2BYKA 4WU9B 1P3MC 3X1VC 5BNXB 1M18B 4HGAC 5G49A 3AZEA 4XUJB 2RVQD 1P3FD 5E5AA 3AZLB 4H9RB 3AZHC 3LZ1D 1F66D 5F99C 4H9NA 1HQ3C 5B1MD 5GT0A 3A6NC 3AN2B 2PYOB 4Z5TB 4AWLB 5CPKD 3EPJA 3UTAB 3AZED 3REJA 1B6WA 5E5AD 3LJAA 4KUDB 2ZY4A 5BS7A 3C1BC 3B0CW 4J8XD 3AZFD 3MGQA 4WU8C 3AZIC 3WA9B 5B33D 3W98A 1R4VA 2NZDD 3AZMA 2IO5C 3WKJC 5KDMA 5JRGC 3UTBC 4YS3C 5B0YA 3REJD 3AZNB 5GXQC 1KX4A 1KX3B 1ID3B 5AV6A 5B31D 3MNNA 3MGQD 3AZGA 3W98D 1M1AA 5DNMC 3AZMD 1PZRA 3MVDC 2F8NK 3MGSA 5B0YD 2F8NH 3W96C 2CV5C 3AZJC 5AV6D 1F66B 3KUYB 3H0MC 3MNND 1EQZC 4ZUXC 1M1AD 5AVCA 2BYKB 3WTPC 3R45B 1U35C 1P3OA 1TZYA 5G49B 3MGSD 3AZEB 1ULYA 5CPJC 1ZLAA 5E5AB 1S32A 4H9NB 5GT0B 5AVCD 4H9SC 2F8NB 2Y2NA 1P3OD 1TZYD 2HIOC 1KX5D 1P3KC 3W99C 5AV5A 3LJAB 1S32D 3KXBA 3W97A 4WV4B 3MGQB 3B6FD 5AV8A 3AZMB 4H9QA 5KDMB 4KGCA 3A1KA 5B0YB 4LD9A 5AV9D 1M19C 5AV5D 1P3GC 1KX4B 5B2IC 3W97D 5AV6B 3REHC 3AZGB 2FJ7A 5CP6C 1WWSA 5CPIC 3AYWA 3AZKC 5DNND 5JA4A 3MGSB 1P3BC 3B0BA 5FUGA 2Y2MA 1BH8A 5AVCB 2DQNC 3REKD 5B24A 5B0ZA 3RELC 3AYWD 3MGRC 4J8WC 1P3OB 3F6TA 1AOID 1TZYB 4XZQA 4WU9D 1ZLAB 1M18D 1S32B 5GT3A 2YFWA 1P3PC 2RIQA 5B24D 5B0ZD 4R8PC 2DF4C 3LELC 3X1SA 4XZQD 2PYOD 3KSYA 4Z5TD 5AV5B 1P3FC 5GT3D 3KXBB 4UPKA 3W97B 3LZ1C 4YM6A 5B2JA 5AV8B 5B1MC 3TU4C 4H9QB 3EPLA 4KGCB 5CPKC 4LD9B 4KHAA 3EPHA 3B0CT 2HUEB 2LY8A 4J8VC 1P3AA 3AZND 4YM6D 5B2JD 3C1CA 4J8XC 3AZFC 2FJ7B 1KX3D 1P3LA 5B33C 1ID3D 3AYWB 3KUYA 2NZDC 5B40A 5JA4B 3R45A 5AY8A 3REJC 5FUGB 5C3IC 4X23A 5BT1D 3WTPE 5GSUC 1BH8B 3AFAC 5B31C 3MGPA 3KWQA 3W98C 2VQRA 5B24B 5B0ZB 3KUYD 5B40D 1P34A 4ZBJB 2Y2JA 4XZQB 2F8NA 4J8UA 5AY8D 5GT3B 3O62A 4G92C 2YFWB 3VH6W 4JJNA 2NQBA 4E45A 5AVBA 3MNNC 3B6GC 1M1AC 2Y2QA 1P3IA 3WAAA 3X1SB 5GT0D 4DQYB 2F8ND 5B1LA 1H3OA 4EO5B 2Y2HA 3O62D 5B31G 4YM6B 5B2JB 3LJAD 5AVBD 2Y2LA 3AV1C 3WAAD 2AROC 3X1TA 3LZ0A 4QLCA 2JE5A 3AV2A 1TZYC 5B1LD 4DRAA 1KX5C 1P3MA 4KHAB 3REIC 3NQUA 3X1VA 3B0DC 1P3AB 3C1CB 1KX4D 4Z66A 1P3LB 3B6FC 3AZHA 5B40B 3AZGD 3X1TD 4QLCD 1HQ3A 3A6NA 1P3MD 5AY8B 5AV9C
chains in the Genus database with same CATH topology
4X23B 3VH5A 3MGPB 3KWQB 4G91C 4Z66D 3C1BA 3AZHD 4DRBA 1P34B 3AZIA 3UT9C 3X1UC 2XD5A 4J8UB 5DNNC 3WKJA 3O62B 4CSRA 4YS3A 4JJNB 2NQBB 1ZLAD 5AVBB 5GXQA 1P3IB 2G5HC 3WAAB 3REKC 5B32C 1AOIC 5B1LB 4WU9C 1H3OB 3V9RA 4YS3D 1M18C 3MVDA 4XUJC 3W96A 2CV5A 3KXBD 2W8SA 3AZJA 3AZLC 4H9PA 3X1TB 3LZ0B 5BO0A 1EQZA 4QLCB 4ZUXA 5AV8D 3AV2B 3AN2C 3H0RC 2PYOC 3WTPA 1P3MB 1U35A 4KGCD 3NQUB 4Z5TC 4AWLC 3X1VB 4HGAB 3UTAC 4LD9D 3W96D 5CPJA 3EG5B 4Z66B 4KUDC 3AZJD 3AZHB 5B32G 2FJ7D 3VH6A 5F99B 3WA9C 1EQZD 1HQ3B 3A6NB 4H9SA 3WTPD 1U35D 2HIOA 2CWEA 1P3KA 3W99A 4NE6A 3AZNC 3C1BB 1KX3C 1ID3C 4CAYA 4WU8B 2JSSA 3AZIB 2IO5B 3WKJB 3VH5W 2HIOD 4CSRB 4YS3B 5BT1C 2RVQC 3W99D 1P3GA 5GXQB 5B2IA 3EPKA 3REHA 1F66C 3KUYC 2Y2GA 5CP6A 5CPIA 3X1SD 3AZKA 2ZY5A 3V9RB 1BH9A 3MVDB 2L5AA 3AZEC 1P3BA 2CV5B 3W96B 5E5AC 3AZJB 3REHD 4H9PB 1B67A 5BO0B 1EQZB 4ZUXB 5CP6D 5GT0C 5CPID 3WTPB 3RELA 3MGRA 1U35B 3AZKD 4J8WA 4M6BA 1P3BD 5CPJB 3LJAC 2BG1A 4NE5A 5BS7C 1P3AD 4Z2MG 3C1CD 1Z2CB 3MGQC 1P3LD 2Y2IA 4R8PA 3LELA 3MGRD 3AZMC 4J8WD 2HIOB 3H0LC 1P3KB 5B0YC 3W99B 1KX4C 4X23D 1P3FA 5AV6C 3MGPD 4CAYB 2BYMA 3LZ1A 3KWQD 3AZGC 2F8NG 4UUZA 5B1MA 4R8PD 3LELD 3TU4A 1P34D 1KU5A 5CPKA 4J8UD 3MGSC 1M19B 1P3GB 4WJ3C 5B2IB 4JJND 4Z66C 2NQBD 3REHB 4J8VA 1F1EA 2XD1A 4J8XA 3AZFA 2F2AC 5CP6B 2Y2PA 3NQJA 5B33A 5AVCC 5CPIB 1P3ID 3TU4D 2NZDA 3AZKB 1P3OC 1BH9B 1N1JB 1P3BB 1ZLAC 1S32C 5GSUA 4J8VD 3AFAA 5B31A 2G5IC 3RELB 3LZ0D 5F99A 3MGRB 4J8WB 3AV2D 4Z2MH 3X1VD 5AV5C 3KXBC 3W97C 5GSUD 4H9OA 3AFAD 1P3PB 3B6GA 4WZSB 5AV8C 4WU8A 4R8PB 5F99D 3LELB 1HQ3D 4KGCC 3A6ND 1TAFA 4LD9C 5JRGA 3UTBA 4NFTA 1P3FB 4E44A 2HUEC 2BYMB 3LZ1B 2FJ7C 3B6GD 3C1BD 4UUZB 5B1MB 3AYWC 3AV1A 3TU4B 4WU8D 2AROA 3A1IA 3AZID 5CPKB 5DNMA 1KX5A 3WKJD 5JRGD 3REIA 3UTBD 2YFVA 4J8VB 5GXQD 4WNNA 4J8XB 3AZFB 3NQJB 5B33B 3AV1D 3B6FA 1JFIA 5B24C 5B0ZC 3VH5T 2AROD 2NZDB 1HTAA 4ZBJC 4XZQC 5DNMD 3REID 3REJB 5AV9A 3FDDA 2FFFB 5C3IB 3MVDD 5GT3C 2ZM5A 1Q9CA 5GSUB 3AFAB 5B31B 2CV5D 3W98B 5BNVA 4ZUXD 3X1SC 3UT9A 3X1UA 2JCHA 5DNNA 4EO5C 4G92B 4H9OB 5CPJD 5B2JC 4YM6C 3MNNB 3B6GB 1M1AB 3REKA 3IP4C 5B32A 1T3UA 3UT9D 3X1UD 1AOIA 4WU9A 1TAFB 5JRGB 3UTBB 5BNXA 1P3KD 1M18A 2J8PA 1P3AC 1M19A 4XUJA 3C1CC 1W2EA 1BFMA 1P3LC 3AV1B 3AZLA 4H9RA 2AROB 5B40C 5B32D 2ZY2A 5DNMB 3AN2A 2PYOA 1KX5B 5AY8C 3REIB 4Z5TA 3VH6T 2YFVB 4X23C 3B0DB 3UTAA 1M19D 1N1JA 4XUJD 4NE3A 3MGPC 4WNNB 3KWQC 1P3GD 5B2ID 2ZY3A 4KUDA 3AZLD 1JFIB 3B6FB 1P34C 3WA9A 3KFUG 3AN2D 4J8UC 2UWXA 5AV9B 2Y2OA 3O62C 3UTAD 4JJNC 2NQBC 3AZNA 5AVBC 4G91B 4KUDD 5BNVB 1P3IC 1KX3A 5CHLB 3WAAC 1ID3A 1P3PA 3WA9D 3UT9B 3X1UB 1WWIA 3RELD 5B1LC 5DNNB 3P5JB 2Y2KA 3REKB 1F66A 3AL0C 3X1TC 5B32B 3LZ0C 1P3PD 4QLCC 1AOIB 3AV2C 1A7WA 2BYKA 4WU9B 1P3MC 3X1VC 5BNXB 1M18B 4HGAC 5G49A 3AZEA 4XUJB 2RVQD 1P3FD 5E5AA 3AZLB 4H9RB 3AZHC 3LZ1D 1F66D 5F99C 4H9NA 1HQ3C 5B1MD 5GT0A 3A6NC 3AN2B 2PYOB 4Z5TB 4AWLB 5CPKD 3EPJA 3UTAB 3AZED 3REJA 1B6WA 5E5AD 3LJAA 4KUDB 2ZY4A 5BS7A 3C1BC 3B0CW 4J8XD 3AZFD 3MGQA 4WU8C 3AZIC 3WA9B 5B33D 3W98A 1R4VA 2NZDD 3AZMA 2IO5C 3WKJC 5KDMA 5JRGC 3UTBC 4YS3C 5B0YA 3REJD 3AZNB 5GXQC 1KX4A 1KX3B 1ID3B 5AV6A 5B31D 3MNNA 3MGQD 3AZGA 3W98D 1M1AA 5DNMC 3AZMD 1PZRA 3MVDC 2F8NK 3MGSA 5B0YD 2F8NH 3W96C 2CV5C 3AZJC 5AV6D 1F66B 3KUYB 3H0MC 3MNND 1EQZC 4ZUXC 1M1AD 5AVCA 2BYKB 3WTPC 3R45B 1U35C 1P3OA 1TZYA 5G49B 3MGSD 3AZEB 1ULYA 5CPJC 1ZLAA 5E5AB 1S32A 4H9NB 5GT0B 5AVCD 4H9SC 2F8NB 2Y2NA 1P3OD 1TZYD 2HIOC 1KX5D 1P3KC 3W99C 5AV5A 3LJAB 1S32D 3KXBA 3W97A 4WV4B 3MGQB 3B6FD 5AV8A 3AZMB 4H9QA 5KDMB 4KGCA 3A1KA 5B0YB 4LD9A 5AV9D 1M19C 5AV5D 1P3GC 1KX4B 5B2IC 3W97D 5AV6B 3REHC 3AZGB 2FJ7A 5CP6C 1WWSA 5CPIC 3AYWA 3AZKC 5DNND 5JA4A 3MGSB 1P3BC 3B0BA 5FUGA 2Y2MA 1BH8A 5AVCB 2DQNC 3REKD 5B24A 5B0ZA 3RELC 3AYWD 3MGRC 4J8WC 1P3OB 3F6TA 1AOID 1TZYB 4XZQA 4WU9D 1ZLAB 1M18D 1S32B 5GT3A 2YFWA 1P3PC 2RIQA 5B24D 5B0ZD 4R8PC 2DF4C 3LELC 3X1SA 4XZQD 2PYOD 3KSYA 4Z5TD 5AV5B 1P3FC 5GT3D 3KXBB 4UPKA 3W97B 3LZ1C 4YM6A 5B2JA 5AV8B 5B1MC 3TU4C 4H9QB 3EPLA 4KGCB 5CPKC 4LD9B 4KHAA 3EPHA 3B0CT 2HUEB 2LY8A 4J8VC 1P3AA 3AZND 4YM6D 5B2JD 3C1CA 4J8XC 3AZFC 2FJ7B 1KX3D 1P3LA 5B33C 1ID3D 3AYWB 3KUYA 2NZDC 5B40A 5JA4B 3R45A 5AY8A 3REJC 5FUGB 5C3IC 4X23A 5BT1D 3WTPE 5GSUC 1BH8B 3AFAC 5B31C 3MGPA 3KWQA 3W98C 2VQRA 5B24B 5B0ZB 3KUYD 5B40D 1P34A 4ZBJB 2Y2JA 4XZQB 2F8NA 4J8UA 5AY8D 5GT3B 3O62A 4G92C 2YFWB 3VH6W 4JJNA 2NQBA 4E45A 5AVBA 3MNNC 3B6GC 1M1AC 2Y2QA 1P3IA 3WAAA 3X1SB 5GT0D 4DQYB 2F8ND 5B1LA 1H3OA 4EO5B 2Y2HA 3O62D 5B31G 4YM6B 5B2JB 3LJAD 5AVBD 2Y2LA 3AV1C 3WAAD 2AROC 3X1TA 3LZ0A 4QLCA 2JE5A 3AV2A 1TZYC 5B1LD 4DRAA 1KX5C 1P3MA 4KHAB 3REIC 3NQUA 3X1VA 3B0DC 1P3AB 3C1CB 1KX4D 4Z66A 1P3LB 3B6FC 3AZHA 5B40B 3AZGD 3X1TD 4QLCD 1HQ3A 3A6NA 1P3MD 5AY8B 5AV9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 B;  3VH5 A;  3MGP B;  3KWQ B;  4G91 C;  4Z66 D;  3C1B A;  3AZH D;  4DRB A;  1P34 B;  3AZI A;  3UT9 C;  3X1U C;  4J8U B;  5DNN C;  3WKJ A;  3O62 B;  4CSR A;  4YS3 A;  4JJN B;  2NQB B;  1ZLA D;  5AVB B;  5GXQ A;  1P3I B;  3WAA B;  3REK C;  5B32 C;  1AOI C;  5B1L B;  4WU9 C;  1H3O B;  3V9R A;  4YS3 D;  1M18 C;  3MVD A;  4XUJ C;  3W96 A;  2CV5 A;  3KXB D;  3AZJ A;  3AZL C;  4H9P A;  3X1T B;  3LZ0 B;  5BO0 A;  1EQZ A;  4QLC B;  4ZUX A;  5AV8 D;  3AV2 B;  3AN2 C;  2PYO C;  3WTP A;  1P3M B;  1U35 A;  4KGC D;  3NQU B;  4Z5T C;  4AWL C;  3X1V B;  4HGA B;  3UTA C;  4LD9 D;  3W96 D;  5CPJ A;  4Z66 B;  4KUD C;  3AZJ D;  3AZH B;  5B32 G;  2FJ7 D;  3VH6 A;  5F99 B;  3WA9 C;  1EQZ D;  1HQ3 B;  3A6N B;  4H9S A;  3WTP D;  1U35 D;  2HIO A;  2CWE A;  1P3K A;  3W99 A;  4NE6 A;  3AZN C;  3C1B B;  1KX3 C;  1ID3 C;  4CAY A;  4WU8 B;  2JSS A;  3AZI B;  2IO5 B;  3WKJ B;  3VH5 W;  2HIO D;  4CSR B;  4YS3 B;  5BT1 C;  2RVQ C;  3W99 D;  1P3G A;  5GXQ B;  5B2I A;  3REH A;  1F66 C;  3KUY C;  5CP6 A;  5CPI A;  3X1S D;  3AZK A;  3V9R B;  1BH9 A;  3MVD B;  2L5A A;  3AZE C;  1P3B A;  2CV5 B;  3W96 B;  5E5A C;  3AZJ B;  3REH D;  4H9P B;  1B67 A;  5BO0 B;  1EQZ B;  4ZUX B;  5CP6 D;  5GT0 C;  5CPI D;  3WTP B;  3REL A;  3MGR A;  1U35 B;  3AZK D;  4J8W A;  4M6B A;  1P3B D;  5CPJ B;  3LJA C;  1P3A D;  4NE5 A;  5BS7 C;  4Z2M G;  3C1C D;  3MGQ C;  1P3L D;  4R8P A;  3LEL A;  3MGR D;  3AZM C;  4J8W D;  2HIO B;  1P3K B;  5B0Y C;  3W99 B;  1KX4 C;  4X23 D;  1P3F A;  5AV6 C;  3MGP D;  4CAY B;  2BYM A;  3LZ1 A;  3KWQ D;  3AZG C;  2F8N G;  4UUZ A;  5B1M A;  4R8P D;  3LEL D;  3TU4 A;  1P34 D;  1KU5 A;  5CPK A;  4J8U D;  3MGS C;  1M19 B;  1P3G B;  5B2I B;  4JJN D;  4Z66 C;  2NQB D;  3REH B;  4J8V A;  1F1E A;  4J8X A;  3AZF A;  5CP6 B;  1P3I D;  3NQJ A;  5B33 A;  5AVC C;  5CPI B;  3TU4 D;  2NZD A;  3AZK B;  1P3O C;  1BH9 B;  1N1J B;  1P3B B;  1ZLA C;  1S32 C;  5GSU A;  4J8V D;  3AFA A;  5B31 A;  3REL B;  3LZ0 D;  5F99 A;  3MGR B;  4J8W B;  3AV2 D;  4Z2M H;  3X1V D;  5AV5 C;  3KXB C;  3W97 C;  5GSU D;  4H9O A;  3AFA D;  1P3P B;  3B6G A;  4WZS B;  5AV8 C;  4WU8 A;  4R8P B;  5F99 D;  3LEL B;  1HQ3 D;  4KGC C;  3A6N D;  1TAF A;  4LD9 C;  5JRG A;  3UTB A;  4NFT A;  1P3F B;  4E44 A;  2HUE C;  2BYM B;  3LZ1 B;  2FJ7 C;  3B6G D;  3C1B D;  4UUZ B;  5B1M B;  3AYW C;  3AV1 A;  3TU4 B;  4WU8 D;  2ARO A;  3AZI D;  5CPK B;  5DNM A;  1KX5 A;  3WKJ D;  5JRG D;  3REI A;  3UTB D;  2YFV A;  4J8V B;  5GXQ D;  4WNN A;  4J8X B;  3AZF B;  3NQJ B;  5B33 B;  3AV1 D;  3B6F A;  1JFI A;  5B24 C;  5B0Z C;  3VH5 T;  2ARO D;  2NZD B;  1HTA A;  4ZBJ C;  4XZQ C;  5DNM D;  3REI D;  3REJ B;  5AV9 A;  5C3I B;  3MVD D;  5GT3 C;  1Q9C A;  5GSU B;  3AFA B;  5B31 B;  2CV5 D;  3W98 B;  5BNV A;  4ZUX D;  3X1S C;  3UT9 A;  3X1U A;  5DNN A;  4EO5 C;  4G92 B;  4H9O B;  5CPJ D;  5B2J C;  4YM6 C;  3MNN B;  3B6G B;  1M1A B;  3REK A;  5B32 A;  3UT9 D;  3X1U D;  1AOI A;  4WU9 A;  1TAF B;  5JRG B;  3UTB B;  5BNX A;  1P3K D;  1M18 A;  1P3A C;  1M19 A;  4XUJ A;  3C1C C;  1BFM A;  1P3L C;  3AV1 B;  3AZL A;  4H9R A;  2ARO B;  5B40 C;  5B32 D;  5DNM B;  3AN2 A;  2PYO A;  1KX5 B;  5AY8 C;  3REI B;  4Z5T A;  3VH6 T;  2YFV B;  4X23 C;  3B0D B;  3UTA A;  1M19 D;  1N1J A;  4XUJ D;  4NE3 A;  3MGP C;  4WNN B;  3KWQ C;  1P3G D;  5B2I D;  4KUD A;  3AZL D;  1JFI B;  3B6F B;  1P34 C;  3WA9 A;  3AN2 D;  4J8U C;  5AV9 B;  3O62 C;  3UTA D;  4JJN C;  2NQB C;  3AZN A;  5AVB C;  4G91 B;  4KUD D;  5BNV B;  1P3I C;  1KX3 A;  5CHL B;  3WAA C;  1ID3 A;  1P3P A;  3WA9 D;  3UT9 B;  3X1U B;  1WWI A;  3REL D;  5B1L C;  5DNN B;  3REK B;  1F66 A;  3X1T C;  5B32 B;  3LZ0 C;  1P3P D;  4QLC C;  1AOI B;  3AV2 C;  1A7W A;  2BYK A;  4WU9 B;  1P3M C;  3X1V C;  5BNX B;  1M18 B;  4HGA C;  5G49 A;  3AZE A;  4XUJ B;  2RVQ D;  1P3F D;  5E5A A;  3AZL B;  4H9R B;  3AZH C;  3LZ1 D;  1F66 D;  5F99 C;  4H9N A;  1HQ3 C;  5B1M D;  5GT0 A;  3A6N C;  3AN2 B;  2PYO B;  4Z5T B;  4AWL B;  5CPK D;  3UTA B;  3AZE D;  3REJ A;  1B6W A;  5E5A D;  3LJA A;  4KUD B;  3C1B C;  5BS7 A;  3B0C W;  4J8X D;  3AZF D;  3MGQ A;  4WU8 C;  3AZI C;  3WA9 B;  5B33 D;  3W98 A;  1R4V A;  2NZD D;  3AZM A;  2IO5 C;  3WKJ C;  5KDM A;  5JRG C;  3UTB C;  4YS3 C;  5B0Y A;  3REJ D;  3AZN B;  5GXQ C;  1KX4 A;  1KX3 B;  1ID3 B;  5AV6 A;  5B31 D;  3MNN A;  3MGQ D;  3AZG A;  3W98 D;  1M1A A;  5DNM C;  3AZM D;  3MVD C;  2F8N K;  3MGS A;  5B0Y D;  2F8N H;  3W96 C;  2CV5 C;  3AZJ C;  5AV6 D;  1F66 B;  3KUY B;  3MNN D;  1EQZ C;  4ZUX C;  1M1A D;  5AVC A;  2BYK B;  3WTP C;  3R45 B;  1U35 C;  1P3O A;  1TZY A;  5G49 B;  3MGS D;  3AZE B;  1ULY A;  5CPJ C;  1ZLA A;  5E5A B;  1S32 A;  4H9N B;  5GT0 B;  5AVC D;  4H9S C;  2F8N B;  1P3O D;  1TZY D;  2HIO C;  1KX5 D;  1P3K C;  3W99 C;  5AV5 A;  3LJA B;  1S32 D;  3KXB A;  3W97 A;  4WV4 B;  3MGQ B;  3B6F D;  5AV8 A;  3AZM B;  4H9Q A;  5KDM B;  4KGC A;  5B0Y B;  4LD9 A;  5AV9 D;  1M19 C;  5AV5 D;  1P3G C;  1KX4 B;  5B2I C;  3W97 D;  5AV6 B;  3REH C;  3AZG B;  2FJ7 A;  5CP6 C;  1WWS A;  5CPI C;  3AYW A;  3AZK C;  5DNN D;  5JA4 A;  3MGS B;  1P3B C;  3B0B A;  5FUG A;  1BH8 A;  5AVC B;  3REK D;  5B24 A;  5B0Z A;  3REL C;  3AYW D;  3MGR C;  4J8W C;  1P3O B;  1AOI D;  1TZY B;  4XZQ A;  4WU9 D;  1ZLA B;  1M18 D;  1S32 B;  5GT3 A;  2YFW A;  1P3P C;  5B24 D;  5B0Z D;  4R8P C;  3LEL C;  3X1S A;  4XZQ D;  2PYO D;  3KSY A;  4Z5T D;  5AV5 B;  1P3F C;  5GT3 D;  3KXB B;  3W97 B;  3LZ1 C;  4YM6 A;  5B2J A;  5AV8 B;  5B1M C;  3TU4 C;  4H9Q B;  4KGC B;  5CPK C;  4LD9 B;  4KHA A;  3B0C T;  2HUE B;  2LY8 A;  4J8V C;  1P3A A;  3AZN D;  4YM6 D;  5B2J D;  3C1C A;  4J8X C;  3AZF C;  2FJ7 B;  1KX3 D;  1P3L A;  5B33 C;  1ID3 D;  3AYW B;  3KUY A;  2NZD C;  5B40 A;  5JA4 B;  3R45 A;  5AY8 A;  3REJ C;  5FUG B;  5C3I C;  4X23 A;  3WTP E;  5BT1 D;  5GSU C;  1BH8 B;  3AFA C;  5B31 C;  3MGP A;  3KWQ A;  3W98 C;  5B24 B;  5B0Z B;  3KUY D;  5B40 D;  1P34 A;  4ZBJ B;  4XZQ B;  2F8N A;  4J8U A;  5AY8 D;  5GT3 B;  3O62 A;  4G92 C;  2YFW B;  3VH6 W;  4JJN A;  2NQB A;  4E45 A;  5AVB A;  3MNN C;  3B6G C;  1M1A C;  1P3I A;  3WAA A;  3X1S B;  5GT0 D;  2F8N D;  5B1L A;  1H3O A;  4EO5 B;  3O62 D;  5B31 G;  4YM6 B;  5B2J B;  3LJA D;  5AVB D;  3AV1 C;  3WAA D;  2ARO C;  3X1T A;  3LZ0 A;  4QLC A;  3AV2 A;  1TZY C;  5B1L D;  4DRA A;  1KX5 C;  1P3M A;  4KHA B;  3REI C;  3NQU A;  3X1V A;  3B0D C;  1P3A B;  3C1C B;  1KX4 D;  4Z66 A;  1P3L B;  3B6F C;  3AZH A;  5B40 B;  3AZG D;  3X1T D;  4QLC D;  1HQ3 A;  3A6N A;  1P3M D;  5AY8 B;  5AV9 C; 
#chains in the Genus database with same CATH topology
 4X23 B;  3VH5 A;  3MGP B;  3KWQ B;  4G91 C;  4Z66 D;  3C1B A;  3AZH D;  4DRB A;  1P34 B;  3AZI A;  3UT9 C;  3X1U C;  2XD5 A;  4J8U B;  5DNN C;  3WKJ A;  3O62 B;  4CSR A;  4YS3 A;  4JJN B;  2NQB B;  1ZLA D;  5AVB B;  5GXQ A;  1P3I B;  2G5H C;  3WAA B;  3REK C;  5B32 C;  1AOI C;  5B1L B;  4WU9 C;  1H3O B;  3V9R A;  4YS3 D;  1M18 C;  3MVD A;  4XUJ C;  3W96 A;  2CV5 A;  3KXB D;  2W8S A;  3AZJ A;  3AZL C;  4H9P A;  3X1T B;  3LZ0 B;  5BO0 A;  1EQZ A;  4QLC B;  4ZUX A;  5AV8 D;  3AV2 B;  3AN2 C;  3H0R C;  2PYO C;  3WTP A;  1P3M B;  1U35 A;  4KGC D;  3NQU B;  4Z5T C;  4AWL C;  3X1V B;  4HGA B;  3UTA C;  4LD9 D;  3W96 D;  5CPJ A;  3EG5 B;  4Z66 B;  4KUD C;  3AZJ D;  3AZH B;  5B32 G;  2FJ7 D;  3VH6 A;  5F99 B;  3WA9 C;  1EQZ D;  1HQ3 B;  3A6N B;  4H9S A;  3WTP D;  1U35 D;  2HIO A;  2CWE A;  1P3K A;  3W99 A;  4NE6 A;  3AZN C;  3C1B B;  1KX3 C;  1ID3 C;  4CAY A;  4WU8 B;  2JSS A;  3AZI B;  2IO5 B;  3WKJ B;  3VH5 W;  2HIO D;  4CSR B;  4YS3 B;  5BT1 C;  2RVQ C;  3W99 D;  1P3G A;  5GXQ B;  5B2I A;  3EPK A;  3REH A;  1F66 C;  3KUY C;  2Y2G A;  5CP6 A;  5CPI A;  3X1S D;  3AZK A;  2ZY5 A;  3V9R B;  1BH9 A;  3MVD B;  2L5A A;  3AZE C;  1P3B A;  2CV5 B;  3W96 B;  5E5A C;  3AZJ B;  3REH D;  4H9P B;  1B67 A;  5BO0 B;  1EQZ B;  4ZUX B;  5CP6 D;  5GT0 C;  5CPI D;  3WTP B;  3REL A;  3MGR A;  1U35 B;  3AZK D;  4J8W A;  4M6B A;  1P3B D;  5CPJ B;  3LJA C;  2BG1 A;  4NE5 A;  5BS7 C;  1P3A D;  4Z2M G;  3C1C D;  1Z2C B;  3MGQ C;  1P3L D;  2Y2I A;  4R8P A;  3LEL A;  3MGR D;  3AZM C;  4J8W D;  2HIO B;  3H0L C;  1P3K B;  5B0Y C;  3W99 B;  1KX4 C;  4X23 D;  1P3F A;  5AV6 C;  3MGP D;  4CAY B;  2BYM A;  3LZ1 A;  3KWQ D;  3AZG C;  2F8N G;  4UUZ A;  5B1M A;  4R8P D;  3LEL D;  3TU4 A;  1P34 D;  1KU5 A;  5CPK A;  4J8U D;  3MGS C;  1M19 B;  1P3G B;  4WJ3 C;  5B2I B;  4JJN D;  4Z66 C;  2NQB D;  3REH B;  4J8V A;  1F1E A;  2XD1 A;  4J8X A;  3AZF A;  2F2A C;  5CP6 B;  2Y2P A;  3NQJ A;  5B33 A;  5AVC C;  5CPI B;  1P3I D;  3TU4 D;  2NZD A;  3AZK B;  1P3O C;  1BH9 B;  1N1J B;  1P3B B;  1ZLA C;  1S32 C;  5GSU A;  4J8V D;  3AFA A;  5B31 A;  2G5I C;  3REL B;  3LZ0 D;  5F99 A;  3MGR B;  4J8W B;  3AV2 D;  4Z2M H;  3X1V D;  5AV5 C;  3KXB C;  3W97 C;  5GSU D;  4H9O A;  3AFA D;  1P3P B;  3B6G A;  4WZS B;  5AV8 C;  4WU8 A;  4R8P B;  5F99 D;  3LEL B;  1HQ3 D;  4KGC C;  3A6N D;  1TAF A;  4LD9 C;  5JRG A;  3UTB A;  4NFT A;  1P3F B;  4E44 A;  2HUE C;  2BYM B;  3LZ1 B;  2FJ7 C;  3B6G D;  3C1B D;  4UUZ B;  5B1M B;  3AYW C;  3AV1 A;  3TU4 B;  4WU8 D;  2ARO A;  3A1I A;  3AZI D;  5CPK B;  5DNM A;  1KX5 A;  3WKJ D;  5JRG D;  3REI A;  3UTB D;  2YFV A;  4J8V B;  5GXQ D;  4WNN A;  4J8X B;  3AZF B;  3NQJ B;  5B33 B;  3AV1 D;  3B6F A;  1JFI A;  5B24 C;  5B0Z C;  3VH5 T;  2ARO D;  2NZD B;  1HTA A;  4ZBJ C;  4XZQ C;  5DNM D;  3REI D;  3REJ B;  5AV9 A;  3FDD A;  2FFF B;  5C3I B;  3MVD D;  5GT3 C;  2ZM5 A;  1Q9C A;  5GSU B;  3AFA B;  5B31 B;  2CV5 D;  3W98 B;  5BNV A;  4ZUX D;  3X1S C;  3UT9 A;  3X1U A;  2JCH A;  5DNN A;  4EO5 C;  4G92 B;  4H9O B;  5CPJ D;  5B2J C;  4YM6 C;  3MNN B;  3B6G B;  1M1A B;  3REK A;  3IP4 C;  5B32 A;  1T3U A;  3UT9 D;  3X1U D;  1AOI A;  4WU9 A;  1TAF B;  5JRG B;  3UTB B;  5BNX A;  1P3K D;  1M18 A;  2J8P A;  1P3A C;  1M19 A;  4XUJ A;  3C1C C;  1W2E A;  1BFM A;  1P3L C;  3AV1 B;  3AZL A;  4H9R A;  2ARO B;  5B40 C;  5B32 D;  2ZY2 A;  5DNM B;  3AN2 A;  2PYO A;  1KX5 B;  5AY8 C;  3REI B;  4Z5T A;  3VH6 T;  2YFV B;  4X23 C;  3B0D B;  3UTA A;  1M19 D;  1N1J A;  4XUJ D;  4NE3 A;  3MGP C;  4WNN B;  3KWQ C;  1P3G D;  5B2I D;  2ZY3 A;  4KUD A;  3AZL D;  1JFI B;  3B6F B;  1P34 C;  3WA9 A;  3KFU G;  3AN2 D;  4J8U C;  2UWX A;  5AV9 B;  2Y2O A;  3O62 C;  3UTA D;  4JJN C;  2NQB C;  3AZN A;  5AVB C;  4G91 B;  4KUD D;  5BNV B;  1P3I C;  1KX3 A;  5CHL B;  3WAA C;  1ID3 A;  1P3P A;  3WA9 D;  3UT9 B;  3X1U B;  1WWI A;  3REL D;  5B1L C;  5DNN B;  3P5J B;  2Y2K A;  3REK B;  1F66 A;  3AL0 C;  3X1T C;  5B32 B;  3LZ0 C;  1P3P D;  4QLC C;  1AOI B;  3AV2 C;  1A7W A;  2BYK A;  4WU9 B;  1P3M C;  3X1V C;  5BNX B;  1M18 B;  4HGA C;  5G49 A;  3AZE A;  4XUJ B;  2RVQ D;  1P3F D;  5E5A A;  3AZL B;  4H9R B;  3AZH C;  3LZ1 D;  1F66 D;  5F99 C;  4H9N A;  1HQ3 C;  5B1M D;  5GT0 A;  3A6N C;  3AN2 B;  2PYO B;  4Z5T B;  4AWL B;  5CPK D;  3EPJ A;  3UTA B;  3AZE D;  3REJ A;  1B6W A;  5E5A D;  3LJA A;  4KUD B;  2ZY4 A;  5BS7 A;  3C1B C;  3B0C W;  4J8X D;  3AZF D;  3MGQ A;  4WU8 C;  3AZI C;  3WA9 B;  5B33 D;  3W98 A;  1R4V A;  2NZD D;  3AZM A;  2IO5 C;  3WKJ C;  5KDM A;  5JRG C;  3UTB C;  4YS3 C;  5B0Y A;  3REJ D;  3AZN B;  5GXQ C;  1KX4 A;  1KX3 B;  1ID3 B;  5AV6 A;  5B31 D;  3MNN A;  3MGQ D;  3AZG A;  3W98 D;  1M1A A;  5DNM C;  3AZM D;  1PZR A;  3MVD C;  2F8N K;  3MGS A;  5B0Y D;  2F8N H;  3W96 C;  2CV5 C;  3AZJ C;  5AV6 D;  1F66 B;  3KUY B;  3H0M C;  3MNN D;  1EQZ C;  4ZUX C;  1M1A D;  5AVC A;  2BYK B;  3WTP C;  3R45 B;  1U35 C;  1P3O A;  1TZY A;  5G49 B;  3MGS D;  3AZE B;  1ULY A;  5CPJ C;  1ZLA A;  5E5A B;  1S32 A;  4H9N B;  5GT0 B;  5AVC D;  4H9S C;  2F8N B;  2Y2N A;  1P3O D;  1TZY D;  2HIO C;  1KX5 D;  1P3K C;  3W99 C;  5AV5 A;  3LJA B;  1S32 D;  3KXB A;  3W97 A;  4WV4 B;  3MGQ B;  3B6F D;  5AV8 A;  3AZM B;  4H9Q A;  5KDM B;  4KGC A;  3A1K A;  5B0Y B;  4LD9 A;  5AV9 D;  1M19 C;  5AV5 D;  1P3G C;  1KX4 B;  5B2I C;  3W97 D;  5AV6 B;  3REH C;  3AZG B;  2FJ7 A;  5CP6 C;  1WWS A;  5CPI C;  3AYW A;  3AZK C;  5DNN D;  5JA4 A;  3MGS B;  1P3B C;  3B0B A;  5FUG A;  2Y2M A;  1BH8 A;  5AVC B;  2DQN C;  3REK D;  5B24 A;  5B0Z A;  3REL C;  3AYW D;  3MGR C;  4J8W C;  1P3O B;  3F6T A;  1AOI D;  1TZY B;  4XZQ A;  4WU9 D;  1ZLA B;  1M18 D;  1S32 B;  5GT3 A;  2YFW A;  1P3P C;  2RIQ A;  5B24 D;  5B0Z D;  4R8P C;  2DF4 C;  3LEL C;  3X1S A;  4XZQ D;  2PYO D;  3KSY A;  4Z5T D;  5AV5 B;  1P3F C;  5GT3 D;  3KXB B;  4UPK A;  3W97 B;  3LZ1 C;  4YM6 A;  5B2J A;  5AV8 B;  5B1M C;  3TU4 C;  4H9Q B;  3EPL A;  4KGC B;  5CPK C;  4LD9 B;  4KHA A;  3EPH A;  3B0C T;  2HUE B;  2LY8 A;  4J8V C;  1P3A A;  3AZN D;  4YM6 D;  5B2J D;  3C1C A;  4J8X C;  3AZF C;  2FJ7 B;  1KX3 D;  1P3L A;  5B33 C;  1ID3 D;  3AYW B;  3KUY A;  2NZD C;  5B40 A;  5JA4 B;  3R45 A;  5AY8 A;  3REJ C;  5FUG B;  5C3I C;  4X23 A;  5BT1 D;  3WTP E;  5GSU C;  1BH8 B;  3AFA C;  5B31 C;  3MGP A;  3KWQ A;  3W98 C;  2VQR A;  5B24 B;  5B0Z B;  3KUY D;  5B40 D;  1P34 A;  4ZBJ B;  2Y2J A;  4XZQ B;  2F8N A;  4J8U A;  5AY8 D;  5GT3 B;  3O62 A;  4G92 C;  2YFW B;  3VH6 W;  4JJN A;  2NQB A;  4E45 A;  5AVB A;  3MNN C;  3B6G C;  1M1A C;  2Y2Q A;  1P3I A;  3WAA A;  3X1S B;  5GT0 D;  4DQY B;  2F8N D;  5B1L A;  1H3O A;  4EO5 B;  2Y2H A;  3O62 D;  5B31 G;  4YM6 B;  5B2J B;  3LJA D;  5AVB D;  2Y2L A;  3AV1 C;  3WAA D;  2ARO C;  3X1T A;  3LZ0 A;  4QLC A;  2JE5 A;  3AV2 A;  1TZY C;  5B1L D;  4DRA A;  1KX5 C;  1P3M A;  4KHA B;  3REI C;  3NQU A;  3X1V A;  3B0D C;  1P3A B;  3C1C B;  1KX4 D;  4Z66 A;  1P3L B;  3B6F C;  3AZH A;  5B40 B;  3AZG D;  3X1T D;  4QLC D;  1HQ3 A;  3A6N A;  1P3M D;  5AY8 B;  5AV9 C; 
#chains in the Genus database with same CATH homology
 4X23 B;  3VH5 A;  3MGP B;  3KWQ B;  4G91 C;  4Z66 D;  3C1B A;  3AZH D;  4DRB A;  1P34 B;  3AZI A;  3UT9 C;  3X1U C;  2XD5 A;  4J8U B;  5DNN C;  3WKJ A;  3O62 B;  4CSR A;  4YS3 A;  4JJN B;  2NQB B;  1ZLA D;  5AVB B;  5GXQ A;  1P3I B;  2G5H C;  3WAA B;  3REK C;  5B32 C;  1AOI C;  5B1L B;  4WU9 C;  1H3O B;  3V9R A;  4YS3 D;  1M18 C;  3MVD A;  4XUJ C;  3W96 A;  2CV5 A;  3KXB D;  2W8S A;  3AZJ A;  3AZL C;  4H9P A;  3X1T B;  3LZ0 B;  5BO0 A;  1EQZ A;  4QLC B;  4ZUX A;  5AV8 D;  3AV2 B;  3AN2 C;  3H0R C;  2PYO C;  3WTP A;  1P3M B;  1U35 A;  4KGC D;  3NQU B;  4Z5T C;  4AWL C;  3X1V B;  4HGA B;  3UTA C;  4LD9 D;  3W96 D;  5CPJ A;  3EG5 B;  4Z66 B;  4KUD C;  3AZJ D;  3AZH B;  5B32 G;  2FJ7 D;  3VH6 A;  5F99 B;  3WA9 C;  1EQZ D;  1HQ3 B;  3A6N B;  4H9S A;  3WTP D;  1U35 D;  2HIO A;  2CWE A;  1P3K A;  3W99 A;  4NE6 A;  3AZN C;  3C1B B;  1KX3 C;  1ID3 C;  4CAY A;  4WU8 B;  2JSS A;  3AZI B;  2IO5 B;  3WKJ B;  3VH5 W;  2HIO D;  4CSR B;  4YS3 B;  5BT1 C;  2RVQ C;  3W99 D;  1P3G A;  5GXQ B;  5B2I A;  3EPK A;  3REH A;  1F66 C;  3KUY C;  2Y2G A;  5CP6 A;  5CPI A;  3X1S D;  3AZK A;  2ZY5 A;  3V9R B;  1BH9 A;  3MVD B;  2L5A A;  3AZE C;  1P3B A;  2CV5 B;  3W96 B;  5E5A C;  3AZJ B;  3REH D;  4H9P B;  1B67 A;  5BO0 B;  1EQZ B;  4ZUX B;  5CP6 D;  5GT0 C;  5CPI D;  3WTP B;  3REL A;  3MGR A;  1U35 B;  3AZK D;  4J8W A;  4M6B A;  1P3B D;  5CPJ B;  3LJA C;  2BG1 A;  4NE5 A;  5BS7 C;  1P3A D;  4Z2M G;  3C1C D;  1Z2C B;  3MGQ C;  1P3L D;  2Y2I A;  4R8P A;  3LEL A;  3MGR D;  3AZM C;  4J8W D;  2HIO B;  3H0L C;  1P3K B;  5B0Y C;  3W99 B;  1KX4 C;  4X23 D;  1P3F A;  5AV6 C;  3MGP D;  4CAY B;  2BYM A;  3LZ1 A;  3KWQ D;  3AZG C;  2F8N G;  4UUZ A;  5B1M A;  4R8P D;  3LEL D;  3TU4 A;  1P34 D;  1KU5 A;  5CPK A;  4J8U D;  3MGS C;  1M19 B;  1P3G B;  4WJ3 C;  5B2I B;  4JJN D;  4Z66 C;  2NQB D;  3REH B;  4J8V A;  1F1E A;  2XD1 A;  4J8X A;  3AZF A;  2F2A C;  5CP6 B;  2Y2P A;  3NQJ A;  5B33 A;  5AVC C;  5CPI B;  1P3I D;  3TU4 D;  2NZD A;  3AZK B;  1P3O C;  1BH9 B;  1N1J B;  1P3B B;  1ZLA C;  1S32 C;  5GSU A;  4J8V D;  3AFA A;  5B31 A;  2G5I C;  3REL B;  3LZ0 D;  5F99 A;  3MGR B;  4J8W B;  3AV2 D;  4Z2M H;  3X1V D;  5AV5 C;  3KXB C;  3W97 C;  5GSU D;  4H9O A;  3AFA D;  1P3P B;  3B6G A;  4WZS B;  5AV8 C;  4WU8 A;  4R8P B;  5F99 D;  3LEL B;  1HQ3 D;  4KGC C;  3A6N D;  1TAF A;  4LD9 C;  5JRG A;  3UTB A;  4NFT A;  1P3F B;  4E44 A;  2HUE C;  2BYM B;  3LZ1 B;  2FJ7 C;  3B6G D;  3C1B D;  4UUZ B;  5B1M B;  3AYW C;  3AV1 A;  3TU4 B;  4WU8 D;  2ARO A;  3A1I A;  3AZI D;  5CPK B;  5DNM A;  1KX5 A;  3WKJ D;  5JRG D;  3REI A;  3UTB D;  2YFV A;  4J8V B;  5GXQ D;  4WNN A;  4J8X B;  3AZF B;  3NQJ B;  5B33 B;  3AV1 D;  3B6F A;  1JFI A;  5B24 C;  5B0Z C;  3VH5 T;  2ARO D;  2NZD B;  1HTA A;  4ZBJ C;  4XZQ C;  5DNM D;  3REI D;  3REJ B;  5AV9 A;  3FDD A;  2FFF B;  5C3I B;  3MVD D;  5GT3 C;  2ZM5 A;  1Q9C A;  5GSU B;  3AFA B;  5B31 B;  2CV5 D;  3W98 B;  5BNV A;  4ZUX D;  3X1S C;  3UT9 A;  3X1U A;  2JCH A;  5DNN A;  4EO5 C;  4G92 B;  4H9O B;  5CPJ D;  5B2J C;  4YM6 C;  3MNN B;  3B6G B;  1M1A B;  3REK A;  3IP4 C;  5B32 A;  1T3U A;  3UT9 D;  3X1U D;  1AOI A;  4WU9 A;  1TAF B;  5JRG B;  3UTB B;  5BNX A;  1P3K D;  1M18 A;  2J8P A;  1P3A C;  1M19 A;  4XUJ A;  3C1C C;  1W2E A;  1BFM A;  1P3L C;  3AV1 B;  3AZL A;  4H9R A;  2ARO B;  5B40 C;  5B32 D;  2ZY2 A;  5DNM B;  3AN2 A;  2PYO A;  1KX5 B;  5AY8 C;  3REI B;  4Z5T A;  3VH6 T;  2YFV B;  4X23 C;  3B0D B;  3UTA A;  1M19 D;  1N1J A;  4XUJ D;  4NE3 A;  3MGP C;  4WNN B;  3KWQ C;  1P3G D;  5B2I D;  2ZY3 A;  4KUD A;  3AZL D;  1JFI B;  3B6F B;  1P34 C;  3WA9 A;  3KFU G;  3AN2 D;  4J8U C;  2UWX A;  5AV9 B;  2Y2O A;  3O62 C;  3UTA D;  4JJN C;  2NQB C;  3AZN A;  5AVB C;  4G91 B;  4KUD D;  5BNV B;  1P3I C;  1KX3 A;  5CHL B;  3WAA C;  1ID3 A;  1P3P A;  3WA9 D;  3UT9 B;  3X1U B;  1WWI A;  3REL D;  5B1L C;  5DNN B;  3P5J B;  2Y2K A;  3REK B;  1F66 A;  3AL0 C;  3X1T C;  5B32 B;  3LZ0 C;  1P3P D;  4QLC C;  1AOI B;  3AV2 C;  1A7W A;  2BYK A;  4WU9 B;  1P3M C;  3X1V C;  5BNX B;  1M18 B;  4HGA C;  5G49 A;  3AZE A;  4XUJ B;  2RVQ D;  1P3F D;  5E5A A;  3AZL B;  4H9R B;  3AZH C;  3LZ1 D;  1F66 D;  5F99 C;  4H9N A;  1HQ3 C;  5B1M D;  5GT0 A;  3A6N C;  3AN2 B;  2PYO B;  4Z5T B;  4AWL B;  5CPK D;  3EPJ A;  3UTA B;  3AZE D;  3REJ A;  1B6W A;  5E5A D;  3LJA A;  4KUD B;  2ZY4 A;  5BS7 A;  3C1B C;  3B0C W;  4J8X D;  3AZF D;  3MGQ A;  4WU8 C;  3AZI C;  3WA9 B;  5B33 D;  3W98 A;  1R4V A;  2NZD D;  3AZM A;  2IO5 C;  3WKJ C;  5KDM A;  5JRG C;  3UTB C;  4YS3 C;  5B0Y A;  3REJ D;  3AZN B;  5GXQ C;  1KX4 A;  1KX3 B;  1ID3 B;  5AV6 A;  5B31 D;  3MNN A;  3MGQ D;  3AZG A;  3W98 D;  1M1A A;  5DNM C;  3AZM D;  1PZR A;  3MVD C;  2F8N K;  3MGS A;  5B0Y D;  2F8N H;  3W96 C;  2CV5 C;  3AZJ C;  5AV6 D;  1F66 B;  3KUY B;  3H0M C;  3MNN D;  1EQZ C;  4ZUX C;  1M1A D;  5AVC A;  2BYK B;  3WTP C;  3R45 B;  1U35 C;  1P3O A;  1TZY A;  5G49 B;  3MGS D;  3AZE B;  1ULY A;  5CPJ C;  1ZLA A;  5E5A B;  1S32 A;  4H9N B;  5GT0 B;  5AVC D;  4H9S C;  2F8N B;  2Y2N A;  1P3O D;  1TZY D;  2HIO C;  1KX5 D;  1P3K C;  3W99 C;  5AV5 A;  3LJA B;  1S32 D;  3KXB A;  3W97 A;  4WV4 B;  3MGQ B;  3B6F D;  5AV8 A;  3AZM B;  4H9Q A;  5KDM B;  4KGC A;  3A1K A;  5B0Y B;  4LD9 A;  5AV9 D;  1M19 C;  5AV5 D;  1P3G C;  1KX4 B;  5B2I C;  3W97 D;  5AV6 B;  3REH C;  3AZG B;  2FJ7 A;  5CP6 C;  1WWS A;  5CPI C;  3AYW A;  3AZK C;  5DNN D;  5JA4 A;  3MGS B;  1P3B C;  3B0B A;  5FUG A;  2Y2M A;  1BH8 A;  5AVC B;  2DQN C;  3REK D;  5B24 A;  5B0Z A;  3REL C;  3AYW D;  3MGR C;  4J8W C;  1P3O B;  3F6T A;  1AOI D;  1TZY B;  4XZQ A;  4WU9 D;  1ZLA B;  1M18 D;  1S32 B;  5GT3 A;  2YFW A;  1P3P C;  2RIQ A;  5B24 D;  5B0Z D;  4R8P C;  2DF4 C;  3LEL C;  3X1S A;  4XZQ D;  2PYO D;  3KSY A;  4Z5T D;  5AV5 B;  1P3F C;  5GT3 D;  3KXB B;  4UPK A;  3W97 B;  3LZ1 C;  4YM6 A;  5B2J A;  5AV8 B;  5B1M C;  3TU4 C;  4H9Q B;  3EPL A;  4KGC B;  5CPK C;  4LD9 B;  4KHA A;  3EPH A;  3B0C T;  2HUE B;  2LY8 A;  4J8V C;  1P3A A;  3AZN D;  4YM6 D;  5B2J D;  3C1C A;  4J8X C;  3AZF C;  2FJ7 B;  1KX3 D;  1P3L A;  5B33 C;  1ID3 D;  3AYW B;  3KUY A;  2NZD C;  5B40 A;  5JA4 B;  3R45 A;  5AY8 A;  3REJ C;  5FUG B;  5C3I C;  4X23 A;  5BT1 D;  3WTP E;  5GSU C;  1BH8 B;  3AFA C;  5B31 C;  3MGP A;  3KWQ A;  3W98 C;  2VQR A;  5B24 B;  5B0Z B;  3KUY D;  5B40 D;  1P34 A;  4ZBJ B;  2Y2J A;  4XZQ B;  2F8N A;  4J8U A;  5AY8 D;  5GT3 B;  3O62 A;  4G92 C;  2YFW B;  3VH6 W;  4JJN A;  2NQB A;  4E45 A;  5AVB A;  3MNN C;  3B6G C;  1M1A C;  2Y2Q A;  1P3I A;  3WAA A;  3X1S B;  5GT0 D;  4DQY B;  2F8N D;  5B1L A;  1H3O A;  4EO5 B;  2Y2H A;  3O62 D;  5B31 G;  4YM6 B;  5B2J B;  3LJA D;  5AVB D;  2Y2L A;  3AV1 C;  3WAA D;  2ARO C;  3X1T A;  3LZ0 A;  4QLC A;  2JE5 A;  3AV2 A;  1TZY C;  5B1L D;  4DRA A;  1KX5 C;  1P3M A;  4KHA B;  3REI C;  3NQU A;  3X1V A;  3B0D C;  1P3A B;  3C1C B;  1KX4 D;  4Z66 A;  1P3L B;  3B6F C;  3AZH A;  5B40 B;  3AZG D;  3X1T D;  4QLC D;  1HQ3 A;  3A6N A;  1P3M D;  5AY8 B;  5AV9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...