3WKJD

The nucleosome containing human tsh2b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjD00
5AY8D 2FJ7B 5AVBC 3RELD 5AVCB 5AVCC 1P3MC 4G91B 4J8WC 5CP6C 1F66D 3NQJB 3V9RA 2HIOB 2YFVA 3WAAC 3X1SA 5B0ZA 3KUYA 3X1SD 5B0ZD 1BH8B 3REKB 3MNNA 3KUYD 3REKC 3UTBA 4H9OB 4R8PA 3AZFC 3UTBD 4R8PD 2YFWB 1P34D 1ID3B 4H9SC 4H9RB 4LD9B 5B2JB 3WKJC 5B2JC 5AV6B 1KX3B 1KX3C 5GXQA 4JJNB 4JJNC 3A6NA 5GXQD 3REHA 3AZKA 3KWQC 3A6ND 3REHD 4X23B 1P3LB 4X23C 3NQUA 5B1LA 5B1LD 3W99B 3W99C 5B33B 4Z66B 2NQBA 1ULYA 5B24B 3X1TB 1P3BA 5F99C 3B0DB 5BNXB 3TU4B 2F8NB 3TU4C 2NQBD 1AOIC 2CWEA 2BYMB 3MVDB 4Z5TC 1BH9B 3AZHC 5AY8B 1M1AC 4Z2MH 3W97C 5E5AC 3MGRA 3RELB 3RELC 1A7WA 1P3FA 3MGRD 2F8NG 4YS3A 1P3FD 1S32A 1KX5A 4YS3D 1S32D 1F66B 1F66C 1P3AA 1P3AD 2F8NK 2YFVB 3X1SB 5B0ZB 4H9NB 3KXBC 3KUYB 4G92B 3X1UC 3KSYA 3C1CC 3AYWC 3UTBB 4DRBA 5AVBA 3W98C 4ZUXC 5AVCA 5AVBD 1P3MA 5AVCD 1P34B 1P3MD 1P34C 4KHAA 4J8WA 5CP6A 1M18C 5AV5C 4J8WD 5CP6D 1P3PC 4KUDC 3WAAA 3WAAD 3WA9C 3REKA 5GSUC 3A6NB 3AZFA 3REKD 4WU9C 3LJAC 3AZFD 5B1LB 1N1JA 2YFWA 4DRAA 2HUEB 2HUEC 2BYKA 4H9SA 4AWLB 2NQBB 3WKJA 5B2JA 4KGCC 1KX3A 1ZLAC 3WKJD 1KX3D 2IO5B 2IO5C 4JJNA 3AZNC 4JJND 4NE6A 5C3IB 4X23A 5KDMA 3VH5A 3KWQD 3W99A 3AZJC 1P3FB 3UTAD 4YS3B 1KX4D 5F99A 5BNXA 1S32B 3TU4A 2F8NA 5F99D 1AOIA 3TU4D 1P3AB 1AOID 2BYMA 4Z5TA 3AZHA 1BH9A 4Z5TD 1WWSA 3VH5W 3AZHD 1M1AA 3W97A 5E5AA 1M1AD 3RELA 4H9QA 3W97D 5AVBB 5E5AD 3AZGC 1P3MB 5B0YC 4NE5A 1F66A 4KHAB 4J8WB 5JRGD 5CP6B 3WAAB 3KXBA 4H9NA 5FUGA 2CV5C 3KXBD 4E45A 3C1CA 3X1VC 3AYWA 3X1UD 3AZFB 3W98A 4ZUXA 3C1CD 3AYWD 3W98D 3UT9C 4ZUXD 1N1JB 1P34A 2BYKB 1M18A 5AV5A 3WKJB 1P3PA 3B6GC 1M18D 3VH5T 5AV5D 3O62C 1P3PD 3LZ1C 4M6BA 4KUDD 3WA9A 4XZQC 1TZYC 5GSUA 3C1BB 3WA9D 3C1BC 1P3GD 5GSUD 3KWQB 4WU9A 5KDMB 4WU9D 3LJAD 3UTAB 3UTAC 1KX4B 1KX4C 1P3ID 5F99B 4KGCA 1ZLAA 4ZBJC 5B32C 4CAYB 4KGCD 4CSRA 1HQ3C 4YM6C 1AOIB 5B31C 1ZLAD 5B1MC 1HTAA 3WTPB 3WTPC 4Z5TB 4E44A 3AZNA 3AZHB 3AZND 1U35C 1M1AB 2PYOC 3W97B 5E5AB 4H9QB 3AZLC 3AZJA 1P3OC 5B32G 3B0CW 3AZJD 3MGSC 5B31G 5JRGB 5JRGC 5AV8C 2RVQC 4XUJB 4XUJC 3AZMC 1F1EA 3REJC 4EO5C 3KXBB 5FUGB 3MGQC 3X1UB 3C1CB 3AYWB 3AZGA 5BO0A 3W98B 4ZUXB 4J8UB 4J8UC 3AZGD 5B0YA 3AZIC 3LZ0D 5B0YD 1H3OA 3AV1B 3AV1C 3B6FB 1M18B 3B6FC 3AFAC 5AV5B 1P3KC 1P3PB 4KUDB 1EQZC 3AV2C 3WA9B 2CV5A 1P3GB 4J8VC 1P3GC 3B0BA 5GSUB 3X1VA 2CV5D 3B0CT 3AN2D 5BNVA 3X1VD 4WU9B 3LJAB 4J8XC 3UT9A 5JA4A 3UT9D 4NE3A 1P3IB 1P3IC 3B6GA 4KGCB 1ZLAB 3O62A 3B6GD 3LZ1A 4CSRB 3O62D 4XZQA 3LZ1D 1TZYA 4XZQD 3C1BA 3AZNB 1TZYD 3KWQA 3C1BD 2AROC 3UTAA 1KX4A 3AZJB 5AV9C 5B32A 4WV4B 4CAYA 4YM6A 1HQ3A 5B32D 5B31A 5B1MA 4YM6D 1HQ3D 5B31D 1TAFB 5B1MD 3WTPA 1R4VA 3WTPD 5DNMD 1U35A 2PYOA 5G49B 1U35D 2PYOD 4Z2MG 4QLCC 3AZLA 3AZGB 5BO0B 4WU8D 1P3OA 3LZ0B 3AZLD 3LZ0C 3MGSA 5B0YB 1P3OD 2F8NH 3MGSD 5JRGA 1H3OB 5AV8A 3LELC 5AV8D 5B2IC 4XUJA 3AZMA 2RVQD 3REJA 5B40C 3MGPD 1KU5A 4UUZA 4XUJD 3AZMD 3REJD 3MGQA 2CV5B 5CPJC 5CPIC 2NZDC 3X1UA 3AN2B 1M19C 3AN2C 3MGQD 3X1VB 3REID 5DNNC 4HGAB 4HGAC 5BNVB 4J8UA 3UT9B 5JA4B 3AZIA 4J8UD 3AZID 1WWIA 2FJ7C 3AV1A 3B6FA 3AFAA 1P3KA 5CHLB 4G91C 3B6GB 3AV1D 4KUDA 2JSSA 3B6FD 3AFAD 1P3KD 3O62B 1EQZA 3LZ1B 4WNNA 1BFMA 3AV2A 4XZQB 1EQZD 5GT3B 5GT0B 5GT3C 1TZYB 5GT0C 4J8VA 3AV2D 1P3GA 3W96B 2HIOC 3W96C 4J8VD 3LJAA 4J8XA 4J8XD 3MNND 5BS7C 1P3IA 5CPKB 5B32B 4ZBJB 4NFTA 5CPKC 4H9PA 4YM6B 1HQ3B 5B31B 1ID3C 5B1MB 4LD9C 3AZEB 3R45A 3AZEC 5AV6C 1JFIA 5DNMB 4WZSB 5DNMC 1U35B 2PYOB 4WU8B 4WU8C 2AROA 3AZLB 1P3OB 3AZKD 2AROD 1P3LC 3MGSB 5AV9A 1B67A 5AV9D 5B33C 5AV8B 4Z66C 5B24C 3X1TC 1TAFA 3B0DC 3MGPB 3MGPC 3AZMB 1P3BD 5BT1C 3REJB 4EO5B 4UUZB 3MGQB 3REIB 5G49A 3REIC 3MVDC 4QLCA 5AY8C 4QLCD 3LZ0A 3AZIB 3VH6A 3LELA 3AFAB 3LELD 5B2IA 1P3KB 5B40A 5B2ID 1KX5D 1EQZB 4WNNB 3AV2B 5B40D 2NZDA 5CPJA 5CPIA 4J8VB 1M19A 3AN2A 2NZDD 5CPJD 3V9RB 5DNNA 5CPID 1M19D 3X1SC 5B0ZC 5DNND 4J8XB 3KUYC 4G92C 3MNNB 3MNNC 3VH6W 3UTBC 2FJ7A 4R8PB 4R8PC 2FJ7D 1B6WA 4H9PB 3NQJA 5GT3A 5GT0A 3R45B 1JFIB 2HIOA 1Q9CA 3W96A 5GT3D 5GT0D 2HIOD 3W96D 5GXQB 5GXQC 1BH8A 2L5AA 2AROB 4H9OA 3A6NC 3REHB 3REHC 3AZKB 3AZKC 5BS7A 3NQUB 5B1LC 5AV9B 5CPKA 5CPKD 1ID3A 4H9RA 4AWLC 4LD9A 2NQBC 3AZEA 1P3BB 5AV6A 1P3BC 1ID3D 3WTPE 4LD9D 5B2JD 3AZED 5DNMA 2LY8A 5AV6D 3VH6T 4WU8A 4QLCB 1P3LA 5C3IC 4X23D 1P3LD 3MGRB 3MGRC 5B33A 4Z66A 3LELB 1P3FC 3W99D 5B24A 5B33D 4YS3C 4Z66D 3X1TA 5B2IB 1KX5B 1S32C 1KX5C 3MGPA 5B24D 3X1TD 5B40B 2F8ND 5BT1D 1P3AC 2NZDB 5CPJB 3REIA 5CPIB 3MVDA 1M19B 5DNNB 3MVDD 5AY8A
chains in the Genus database with same CATH superfamily
5AY8D 2FJ7B 5AVBC 3RELD 4DQYB 5AVCB 5AVCC 1P3MC 4G91B 2VQRA 4J8WC 5CP6C 1F66D 3NQJB 3V9RA 2HIOB 2YFVA 3WAAC 3X1SA 2Y2PA 5B0ZA 2XD1A 3KUYA 3X1SD 5B0ZD 1BH8B 3REKB 3MNNA 3KUYD 3REKC 3UTBA 4H9OB 4R8PA 3AZFC 3UTBD 4R8PD 2FFFB 2YFWB 1P34D 1ID3B 4H9SC 4H9RB 4LD9B 5B2JB 3WKJC 5B2JC 5AV6B 1KX3B 1KX3C 5GXQA 4JJNB 4JJNC 3A6NA 5GXQD 3REHA 3AZKA 3KWQC 3A6ND 3REHD 4X23B 1P3LB 4X23C 3NQUA 5B1LA 2Y2JA 3A1KA 2DF4C 5B1LD 3W99B 3W99C 5B33B 4Z66B 2NQBA 1ULYA 5B24B 3X1TB 1P3BA 5F99C 3B0DB 5BNXB 3TU4B 2F8NB 3TU4C 2NQBD 1AOIC 2CWEA 2BYMB 3MVDB 4Z5TC 1BH9B 3AZHC 2Y2NA 5AY8B 1M1AC 4Z2MH 3W97C 5E5AC 3MGRA 3RELB 3RELC 1A7WA 1P3FA 3MGRD 2F8NG 4YS3A 1P3FD 1S32A 1KX5A 4YS3D 1S32D 1F66B 1F66C 1P3AA 2Y2QA 1P3AD 2F8NK 2YFVB 3X1SB 5B0ZB 4H9NB 3KXBC 3KUYB 4G92B 3X1UC 3KSYA 3C1CC 3AYWC 3UTBB 5AVBA 4DRBA 3W98C 4ZUXC 5AVCA 5AVBD 1P3MA 5AVCD 1P34B 1P3MD 1P34C 4KHAA 4J8WA 5CP6A 1M18C 5AV5C 4J8WD 5CP6D 1P3PC 4KUDC 3WAAA 3WAAD 3WA9C 3REKA 5GSUC 3A6NB 2JE5A 3AZFA 3REKD 4WU9C 3LJAC 2G5IC 3AZFD 5B1LB 1N1JA 2YFWA 4DRAA 2HUEB 2Y2OA 2HUEC 2BYKA 4H9SA 4AWLB 2NQBB 3WKJA 5B2JA 3EPKA 4KGCC 1KX3A 1ZLAC 3WKJD 1KX3D 2IO5B 2IO5C 4JJNA 3AZNC 4JJND 4NE6A 5C3IB 4X23A 5KDMA 3VH5A 3KWQD 3W99A 3AZJC 1P3FB 3UTAD 4YS3B 1KX4D 5F99A 5BNXA 1S32B 3TU4A 2F8NA 1W2EA 5F99D 1AOIA 3TU4D 1P3AB 1AOID 2BYMA 4Z5TA 3AZHA 2G5HC 1BH9A 2ZY2A 4Z5TD 1WWSA 3VH5W 3AZHD 1M1AA 3W97A 5E5AA 1M1AD 3RELA 4H9QA 3W97D 5AVBB 5E5AD 3AZGC 3F6TA 1P3MB 5B0YC 2ZY4A 4NE5A 2Y2HA 1F66A 4KHAB 3H0MC 4J8WB 2Y2KA 3H0RC 5JRGD 5CP6B 2BG1A 3WAAB 3KXBA 4H9NA 5FUGA 2ZY5A 3KXBD 2CV5C 4E45A 3C1CA 3X1VC 3AYWA 3X1UD 3AZFB 3W98A 4ZUXA 3C1CD 3AYWD 3W98D 3UT9C 4ZUXD 4WJ3C 1N1JB 1P34A 2BYKB 1M18A 5AV5A 3WKJB 1P3PA 3B6GC 1M18D 3VH5T 5AV5D 3O62C 1P3PD 3LZ1C 4M6BA 4KUDD 3WA9A 4XZQC 1TZYC 5GSUA 3C1BB 3WA9D 3C1BC 1P3GD 5GSUD 3KWQB 4WU9A 5KDMB 4WU9D 3LJAD 3UTAB 3UTAC 1KX4B 1KX4C 1P3ID 5F99B 4KGCA 1ZLAA 3IP4C 4ZBJC 5B32C 4CAYB 4KGCD 4CSRA 1HQ3C 4YM6C 1AOIB 5B31C 1ZLAD 5B1MC 1HTAA 3WTPB 3WTPC 4Z5TB 4E44A 3AZNA 3AZHB 3AZND 1U35C 1M1AB 2PYOC 3W97B 5E5AB 4H9QB 3H0LC 3AZLC 3AZJA 1P3OC 5B32G 3B0CW 3AZJD 3MGSC 5B31G 4UPKA 5JRGB 5JRGC 5AV8C 2RVQC 4XUJB 4XUJC 3AZMC 1F1EA 3EG5B 3REJC 4EO5C 3KXBB 5FUGB 3MGQC 3X1UB 3C1CB 3AYWB 3AZGA 5BO0A 3W98B 4ZUXB 4J8UB 4J8UC 3AZGD 5B0YA 3AZIC 3LZ0D 5B0YD 1H3OA 3AV1B 3AV1C 3B6FB 1M18B 3B6FC 3AFAC 5AV5B 1P3KC 1P3PB 4KUDB 1PZRA 2UWXA 1EQZC 3AV2C 3WA9B 2Y2MA 2CV5A 2Y2GA 4J8VC 1P3GB 3B0BA 5GSUB 3X1VA 2CV5D 1P3GC 3AL0C 3B0CT 3AN2D 5BNVA 3X1VD 4WU9B 3LJAB 4J8XC 3UT9A 5JA4A 3UT9D 4NE3A 1P3IB 1P3IC 3B6GA 4KGCB 1ZLAB 3O62A 3B6GD 3LZ1A 4CSRB 3O62D 4XZQA 3LZ1D 1TZYA 4XZQD 3C1BA 3AZNB 1TZYD 3KWQA 3C1BD 2AROC 3EPLA 3UTAA 1KX4A 3AZJB 5AV9C 5B32A 4WV4B 4CAYA 4YM6A 1HQ3A 5B32D 3KFUG 5B31A 5B1MA 4YM6D 1HQ3D 5B31D 2DQNC 1TAFB 5B1MD 1R4VA 3WTPA 3WTPD 5DNMD 1U35A 2PYOA 5G49B 1U35D 2PYOD 4Z2MG 4QLCC 3AZLA 3AZGB 5BO0B 4WU8D 1P3OA 3LZ0B 3AZLD 3LZ0C 3MGSA 5B0YB 1P3OD 2F8NH 3MGSD 5JRGA 1H3OB 5AV8A 3LELC 5AV8D 5B2IC 4XUJA 3AZMA 2RVQD 3REJA 5B40C 3MGPD 1KU5A 4UUZA 2J8PA 4XUJD 3AZMD 3REJD 3MGQA 2CV5B 5CPJC 5CPIC 2NZDC 3X1UA 3AN2B 1M19C 3AN2C 3MGQD 3X1VB 3REID 5DNNC 4HGAB 4HGAC 5BNVB 4J8UA 3UT9B 2Y2IA 5JA4B 3AZIA 4J8UD 3AZID 1WWIA 2FJ7C 3P5JB 3AV1A 3B6FA 3AFAA 1P3KA 5CHLB 4G91C 3B6GB 3AV1D 4KUDA 2JSSA 3B6FD 3AFAD 2XD5A 1P3KD 3O62B 1EQZA 3LZ1B 4WNNA 1BFMA 3AV2A 4XZQB 1EQZD 5GT3B 5GT0B 5GT3C 1TZYB 5GT0C 3EPJA 4J8VA 3AV2D 1P3GA 3W96B 2HIOC 3W96C 4J8VD 3LJAA 4J8XA 3EPHA 4J8XD 2JCHA 3MNND 5BS7C 1P3IA 5CPKB 5B32B 4ZBJB 4NFTA 5CPKC 4H9PA 4YM6B 1HQ3B 5B31B 1ID3C 5B1MB 4LD9C 3AZEB 3R45A 3AZEC 5AV6C 1JFIA 5DNMB 4WZSB 2RIQA 5DNMC 1U35B 2PYOB 4WU8B 4WU8C 2AROA 3AZLB 1P3OB 3AZKD 2AROD 1P3LC 3MGSB 5AV9A 1B67A 5AV9D 5B33C 5AV8B 4Z66C 5B24C 3X1TC 1TAFA 3B0DC 3MGPB 3MGPC 3AZMB 1P3BD 5BT1C 3REJB 4EO5B 4UUZB 3MGQB 3REIB 5G49A 3REIC 3MVDC 4QLCA 5AY8C 4QLCD 3LZ0A 3AZIB 3VH6A 2Y2LA 3LELA 3AFAB 3LELD 5B2IA 1P3KB 5B40A 5B2ID 1KX5D 1EQZB 4WNNB 3AV2B 5B40D 2NZDA 5CPJA 5CPIA 4J8VB 1M19A 3AN2A 1T3UA 2NZDD 5CPJD 3V9RB 5DNNA 5CPID 1M19D 3X1SC 5B0ZC 5DNND 4J8XB 3KUYC 4G92C 2W8SA 3MNNB 3MNNC 3VH6W 3UTBC 2FJ7A 4R8PB 4R8PC 2FJ7D 1B6WA 2ZY3A 4H9PB 3NQJA 5GT3A 5GT0A 3R45B 1JFIB 2HIOA 1Q9CA 3W96A 5GT3D 5GT0D 2HIOD 3W96D 5GXQB 5GXQC 1BH8A 1Z2CB 2L5AA 2AROB 4H9OA 3A6NC 3REHB 3REHC 3AZKB 3AZKC 5BS7A 3NQUB 5B1LC 5AV9B 5CPKA 2F2AC 5CPKD 1ID3A 4H9RA 4AWLC 4LD9A 2NQBC 3AZEA 1P3BB 5AV6A 1P3BC 1ID3D 3WTPE 4LD9D 3FDDA 5B2JD 3AZED 5DNMA 2LY8A 5AV6D 3VH6T 4WU8A 4QLCB 1P3LA 5C3IC 3A1IA 4X23D 1P3LD 3MGRB 3MGRC 5B33A 4Z66A 3LELB 1P3FC 3W99D 5B24A 5B33D 4YS3C 4Z66D 3X1TA 5B2IB 1KX5B 1S32C 1KX5C 3MGPA 5B24D 3X1TD 5B40B 2F8ND 5BT1D 1P3AC 2NZDB 5CPJB 3REIA 5CPIB 3MVDA 1M19B 5DNNB 2ZM5A 3MVDD 5AY8A
chains in the Genus database with same CATH topology
5AY8D 2FJ7B 5AVBC 3RELD 4DQYB 5AVCB 5AVCC 1P3MC 4G91B 2VQRA 4J8WC 5CP6C 1F66D 3NQJB 3V9RA 2HIOB 2YFVA 3WAAC 3X1SA 2Y2PA 5B0ZA 2XD1A 3KUYA 3X1SD 5B0ZD 1BH8B 3REKB 3MNNA 3KUYD 3REKC 3UTBA 4H9OB 4R8PA 3AZFC 3UTBD 4R8PD 2FFFB 2YFWB 1P34D 1ID3B 4H9SC 4H9RB 4LD9B 5B2JB 3WKJC 5B2JC 5AV6B 1KX3B 1KX3C 5GXQA 4JJNB 4JJNC 3A6NA 5GXQD 3REHA 3AZKA 3KWQC 3A6ND 3REHD 4X23B 1P3LB 4X23C 3NQUA 5B1LA 2Y2JA 3A1KA 2DF4C 5B1LD 3W99B 3W99C 5B33B 4Z66B 2NQBA 1ULYA 5B24B 3X1TB 1P3BA 5F99C 3B0DB 5BNXB 3TU4B 2F8NB 3TU4C 2NQBD 1AOIC 2CWEA 2BYMB 3MVDB 4Z5TC 1BH9B 3AZHC 2Y2NA 5AY8B 1M1AC 4Z2MH 3W97C 5E5AC 3MGRA 3RELB 3RELC 1A7WA 1P3FA 3MGRD 2F8NG 4YS3A 1P3FD 1S32A 1KX5A 4YS3D 1S32D 1F66B 1F66C 1P3AA 2Y2QA 1P3AD 2F8NK 2YFVB 3X1SB 5B0ZB 4H9NB 3KXBC 3KUYB 4G92B 3X1UC 3KSYA 3C1CC 3AYWC 3UTBB 5AVBA 4DRBA 3W98C 4ZUXC 5AVCA 5AVBD 1P3MA 5AVCD 1P34B 1P3MD 1P34C 4KHAA 4J8WA 5CP6A 1M18C 5AV5C 4J8WD 5CP6D 1P3PC 4KUDC 3WAAA 3WAAD 3WA9C 3REKA 5GSUC 3A6NB 2JE5A 3AZFA 3REKD 4WU9C 3LJAC 2G5IC 3AZFD 5B1LB 1N1JA 2YFWA 4DRAA 2HUEB 2Y2OA 2HUEC 2BYKA 4H9SA 4AWLB 2NQBB 3WKJA 5B2JA 3EPKA 4KGCC 1KX3A 1ZLAC 3WKJD 1KX3D 2IO5B 2IO5C 4JJNA 3AZNC 4JJND 4NE6A 5C3IB 4X23A 5KDMA 3VH5A 3KWQD 3W99A 3AZJC 1P3FB 3UTAD 4YS3B 1KX4D 5F99A 5BNXA 1S32B 3TU4A 2F8NA 1W2EA 5F99D 1AOIA 3TU4D 1P3AB 1AOID 2BYMA 4Z5TA 3AZHA 2G5HC 1BH9A 2ZY2A 4Z5TD 1WWSA 3VH5W 3AZHD 1M1AA 3W97A 5E5AA 1M1AD 3RELA 4H9QA 3W97D 5AVBB 5E5AD 3AZGC 3F6TA 1P3MB 5B0YC 2ZY4A 4NE5A 2Y2HA 1F66A 4KHAB 3H0MC 4J8WB 2Y2KA 3H0RC 5JRGD 5CP6B 2BG1A 3WAAB 3KXBA 4H9NA 5FUGA 2ZY5A 3KXBD 2CV5C 4E45A 3C1CA 3X1VC 3AYWA 3X1UD 3AZFB 3W98A 4ZUXA 3C1CD 3AYWD 3W98D 3UT9C 4ZUXD 4WJ3C 1N1JB 1P34A 2BYKB 1M18A 5AV5A 3WKJB 1P3PA 3B6GC 1M18D 3VH5T 5AV5D 3O62C 1P3PD 3LZ1C 4M6BA 4KUDD 3WA9A 4XZQC 1TZYC 5GSUA 3C1BB 3WA9D 3C1BC 1P3GD 5GSUD 3KWQB 4WU9A 5KDMB 4WU9D 3LJAD 3UTAB 3UTAC 1KX4B 1KX4C 1P3ID 5F99B 4KGCA 1ZLAA 3IP4C 4ZBJC 5B32C 4CAYB 4KGCD 4CSRA 1HQ3C 4YM6C 1AOIB 5B31C 1ZLAD 5B1MC 1HTAA 3WTPB 3WTPC 4Z5TB 4E44A 3AZNA 3AZHB 3AZND 1U35C 1M1AB 2PYOC 3W97B 5E5AB 4H9QB 3H0LC 3AZLC 3AZJA 1P3OC 5B32G 3B0CW 3AZJD 3MGSC 5B31G 4UPKA 5JRGB 5JRGC 5AV8C 2RVQC 4XUJB 4XUJC 3AZMC 1F1EA 3EG5B 3REJC 4EO5C 3KXBB 5FUGB 3MGQC 3X1UB 3C1CB 3AYWB 3AZGA 5BO0A 3W98B 4ZUXB 4J8UB 4J8UC 3AZGD 5B0YA 3AZIC 3LZ0D 5B0YD 1H3OA 3AV1B 3AV1C 3B6FB 1M18B 3B6FC 3AFAC 5AV5B 1P3KC 1P3PB 4KUDB 1PZRA 2UWXA 1EQZC 3AV2C 3WA9B 2Y2MA 2CV5A 2Y2GA 4J8VC 1P3GB 3B0BA 5GSUB 3X1VA 2CV5D 1P3GC 3AL0C 3B0CT 3AN2D 5BNVA 3X1VD 4WU9B 3LJAB 4J8XC 3UT9A 5JA4A 3UT9D 4NE3A 1P3IB 1P3IC 3B6GA 4KGCB 1ZLAB 3O62A 3B6GD 3LZ1A 4CSRB 3O62D 4XZQA 3LZ1D 1TZYA 4XZQD 3C1BA 3AZNB 1TZYD 3KWQA 3C1BD 2AROC 3EPLA 3UTAA 1KX4A 3AZJB 5AV9C 5B32A 4WV4B 4CAYA 4YM6A 1HQ3A 5B32D 3KFUG 5B31A 5B1MA 4YM6D 1HQ3D 5B31D 2DQNC 1TAFB 5B1MD 1R4VA 3WTPA 3WTPD 5DNMD 1U35A 2PYOA 5G49B 1U35D 2PYOD 4Z2MG 4QLCC 3AZLA 3AZGB 5BO0B 4WU8D 1P3OA 3LZ0B 3AZLD 3LZ0C 3MGSA 5B0YB 1P3OD 2F8NH 3MGSD 5JRGA 1H3OB 5AV8A 3LELC 5AV8D 5B2IC 4XUJA 3AZMA 2RVQD 3REJA 5B40C 3MGPD 1KU5A 4UUZA 2J8PA 4XUJD 3AZMD 3REJD 3MGQA 2CV5B 5CPJC 5CPIC 2NZDC 3X1UA 3AN2B 1M19C 3AN2C 3MGQD 3X1VB 3REID 5DNNC 4HGAB 4HGAC 5BNVB 4J8UA 3UT9B 2Y2IA 5JA4B 3AZIA 4J8UD 3AZID 1WWIA 2FJ7C 3P5JB 3AV1A 3B6FA 3AFAA 1P3KA 5CHLB 4G91C 3B6GB 3AV1D 4KUDA 2JSSA 3B6FD 3AFAD 2XD5A 1P3KD 3O62B 1EQZA 3LZ1B 4WNNA 1BFMA 3AV2A 4XZQB 1EQZD 5GT3B 5GT0B 5GT3C 1TZYB 5GT0C 3EPJA 4J8VA 3AV2D 1P3GA 3W96B 2HIOC 3W96C 4J8VD 3LJAA 4J8XA 3EPHA 4J8XD 2JCHA 3MNND 5BS7C 1P3IA 5CPKB 5B32B 4ZBJB 4NFTA 5CPKC 4H9PA 4YM6B 1HQ3B 5B31B 1ID3C 5B1MB 4LD9C 3AZEB 3R45A 3AZEC 5AV6C 1JFIA 5DNMB 4WZSB 2RIQA 5DNMC 1U35B 2PYOB 4WU8B 4WU8C 2AROA 3AZLB 1P3OB 3AZKD 2AROD 1P3LC 3MGSB 5AV9A 1B67A 5AV9D 5B33C 5AV8B 4Z66C 5B24C 3X1TC 1TAFA 3B0DC 3MGPB 3MGPC 3AZMB 1P3BD 5BT1C 3REJB 4EO5B 4UUZB 3MGQB 3REIB 5G49A 3REIC 3MVDC 4QLCA 5AY8C 4QLCD 3LZ0A 3AZIB 3VH6A 2Y2LA 3LELA 3AFAB 3LELD 5B2IA 1P3KB 5B40A 5B2ID 1KX5D 1EQZB 4WNNB 3AV2B 5B40D 2NZDA 5CPJA 5CPIA 4J8VB 1M19A 3AN2A 1T3UA 2NZDD 5CPJD 3V9RB 5DNNA 5CPID 1M19D 3X1SC 5B0ZC 5DNND 4J8XB 3KUYC 4G92C 2W8SA 3MNNB 3MNNC 3VH6W 3UTBC 2FJ7A 4R8PB 4R8PC 2FJ7D 1B6WA 2ZY3A 4H9PB 3NQJA 5GT3A 5GT0A 3R45B 1JFIB 2HIOA 1Q9CA 3W96A 5GT3D 5GT0D 2HIOD 3W96D 5GXQB 5GXQC 1BH8A 1Z2CB 2L5AA 2AROB 4H9OA 3A6NC 3REHB 3REHC 3AZKB 3AZKC 5BS7A 3NQUB 5B1LC 5AV9B 5CPKA 2F2AC 5CPKD 1ID3A 4H9RA 4AWLC 4LD9A 2NQBC 3AZEA 1P3BB 5AV6A 1P3BC 1ID3D 3WTPE 4LD9D 3FDDA 5B2JD 3AZED 5DNMA 2LY8A 5AV6D 3VH6T 4WU8A 4QLCB 1P3LA 5C3IC 3A1IA 4X23D 1P3LD 3MGRB 3MGRC 5B33A 4Z66A 3LELB 1P3FC 3W99D 5B24A 5B33D 4YS3C 4Z66D 3X1TA 5B2IB 1KX5B 1S32C 1KX5C 3MGPA 5B24D 3X1TD 5B40B 2F8ND 5BT1D 1P3AC 2NZDB 5CPJB 3REIA 5CPIB 3MVDA 1M19B 5DNNB 2ZM5A 3MVDD 5AY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 D;  2FJ7 B;  5AVB C;  3REL D;  5AVC B;  5AVC C;  1P3M C;  4G91 B;  4J8W C;  5CP6 C;  1F66 D;  3NQJ B;  3V9R A;  2HIO B;  2YFV A;  3WAA C;  3X1S A;  5B0Z A;  3KUY A;  3X1S D;  5B0Z D;  1BH8 B;  3REK B;  3MNN A;  3KUY D;  3REK C;  3UTB A;  4H9O B;  4R8P A;  3AZF C;  3UTB D;  4R8P D;  2YFW B;  1P34 D;  1ID3 B;  4H9S C;  4H9R B;  4LD9 B;  5B2J B;  3WKJ C;  5B2J C;  5AV6 B;  1KX3 B;  1KX3 C;  5GXQ A;  4JJN B;  4JJN C;  3A6N A;  5GXQ D;  3REH A;  3AZK A;  3KWQ C;  3A6N D;  3REH D;  4X23 B;  1P3L B;  4X23 C;  3NQU A;  5B1L A;  5B1L D;  3W99 B;  3W99 C;  5B33 B;  4Z66 B;  2NQB A;  1ULY A;  5B24 B;  3X1T B;  1P3B A;  5F99 C;  3B0D B;  5BNX B;  3TU4 B;  2F8N B;  3TU4 C;  2NQB D;  1AOI C;  2CWE A;  2BYM B;  3MVD B;  4Z5T C;  1BH9 B;  3AZH C;  5AY8 B;  1M1A C;  4Z2M H;  3W97 C;  5E5A C;  3MGR A;  3REL B;  3REL C;  1A7W A;  1P3F A;  3MGR D;  2F8N G;  4YS3 A;  1P3F D;  1S32 A;  1KX5 A;  4YS3 D;  1S32 D;  1F66 B;  1F66 C;  1P3A A;  1P3A D;  2F8N K;  2YFV B;  3X1S B;  5B0Z B;  4H9N B;  3KXB C;  3KUY B;  4G92 B;  3X1U C;  3KSY A;  3C1C C;  3AYW C;  3UTB B;  4DRB A;  5AVB A;  3W98 C;  4ZUX C;  5AVC A;  5AVB D;  1P3M A;  5AVC D;  1P34 B;  1P3M D;  1P34 C;  4KHA A;  4J8W A;  5CP6 A;  1M18 C;  5AV5 C;  4J8W D;  5CP6 D;  1P3P C;  4KUD C;  3WAA A;  3WAA D;  3WA9 C;  3REK A;  5GSU C;  3A6N B;  3AZF A;  3REK D;  4WU9 C;  3LJA C;  3AZF D;  5B1L B;  1N1J A;  2YFW A;  4DRA A;  2HUE B;  2HUE C;  2BYK A;  4H9S A;  4AWL B;  2NQB B;  3WKJ A;  5B2J A;  4KGC C;  1KX3 A;  1ZLA C;  3WKJ D;  1KX3 D;  2IO5 B;  2IO5 C;  4JJN A;  3AZN C;  4JJN D;  4NE6 A;  5C3I B;  4X23 A;  5KDM A;  3VH5 A;  3KWQ D;  3W99 A;  3AZJ C;  1P3F B;  3UTA D;  4YS3 B;  1KX4 D;  5F99 A;  5BNX A;  1S32 B;  3TU4 A;  2F8N A;  5F99 D;  1AOI A;  3TU4 D;  1P3A B;  1AOI D;  2BYM A;  4Z5T A;  3AZH A;  1BH9 A;  4Z5T D;  1WWS A;  3VH5 W;  3AZH D;  1M1A A;  3W97 A;  5E5A A;  1M1A D;  3REL A;  4H9Q A;  3W97 D;  5AVB B;  5E5A D;  3AZG C;  1P3M B;  5B0Y C;  4NE5 A;  1F66 A;  4KHA B;  4J8W B;  5JRG D;  5CP6 B;  3WAA B;  3KXB A;  4H9N A;  5FUG A;  2CV5 C;  3KXB D;  4E45 A;  3C1C A;  3X1V C;  3AYW A;  3X1U D;  3AZF B;  3W98 A;  4ZUX A;  3C1C D;  3AYW D;  3W98 D;  3UT9 C;  4ZUX D;  1N1J B;  1P34 A;  2BYK B;  1M18 A;  5AV5 A;  3WKJ B;  1P3P A;  3B6G C;  1M18 D;  3VH5 T;  5AV5 D;  3O62 C;  1P3P D;  3LZ1 C;  4M6B A;  4KUD D;  3WA9 A;  4XZQ C;  1TZY C;  5GSU A;  3C1B B;  3WA9 D;  3C1B C;  1P3G D;  5GSU D;  3KWQ B;  4WU9 A;  5KDM B;  4WU9 D;  3LJA D;  3UTA B;  3UTA C;  1KX4 B;  1KX4 C;  1P3I D;  5F99 B;  4KGC A;  1ZLA A;  4ZBJ C;  5B32 C;  4CAY B;  4KGC D;  4CSR A;  1HQ3 C;  4YM6 C;  1AOI B;  5B31 C;  1ZLA D;  5B1M C;  1HTA A;  3WTP B;  3WTP C;  4Z5T B;  4E44 A;  3AZN A;  3AZH B;  3AZN D;  1U35 C;  1M1A B;  2PYO C;  3W97 B;  5E5A B;  4H9Q B;  3AZL C;  3AZJ A;  1P3O C;  5B32 G;  3B0C W;  3AZJ D;  3MGS C;  5B31 G;  5JRG B;  5JRG C;  5AV8 C;  2RVQ C;  4XUJ B;  4XUJ C;  3AZM C;  1F1E A;  3REJ C;  4EO5 C;  3KXB B;  5FUG B;  3MGQ C;  3X1U B;  3C1C B;  3AYW B;  3AZG A;  5BO0 A;  3W98 B;  4ZUX B;  4J8U B;  4J8U C;  3AZG D;  5B0Y A;  3AZI C;  3LZ0 D;  5B0Y D;  1H3O A;  3AV1 B;  3AV1 C;  3B6F B;  1M18 B;  3B6F C;  3AFA C;  5AV5 B;  1P3K C;  1P3P B;  4KUD B;  1EQZ C;  3AV2 C;  3WA9 B;  2CV5 A;  1P3G B;  4J8V C;  1P3G C;  3B0B A;  5GSU B;  3X1V A;  2CV5 D;  3B0C T;  3AN2 D;  5BNV A;  3X1V D;  4WU9 B;  3LJA B;  4J8X C;  3UT9 A;  5JA4 A;  3UT9 D;  4NE3 A;  1P3I B;  1P3I C;  3B6G A;  4KGC B;  1ZLA B;  3O62 A;  3B6G D;  3LZ1 A;  4CSR B;  3O62 D;  4XZQ A;  3LZ1 D;  1TZY A;  4XZQ D;  3C1B A;  3AZN B;  1TZY D;  3KWQ A;  3C1B D;  2ARO C;  3UTA A;  1KX4 A;  3AZJ B;  5AV9 C;  5B32 A;  4WV4 B;  4CAY A;  4YM6 A;  1HQ3 A;  5B32 D;  5B31 A;  5B1M A;  4YM6 D;  1HQ3 D;  5B31 D;  1TAF B;  5B1M D;  3WTP A;  1R4V A;  3WTP D;  5DNM D;  1U35 A;  2PYO A;  5G49 B;  1U35 D;  2PYO D;  4Z2M G;  4QLC C;  3AZL A;  3AZG B;  5BO0 B;  4WU8 D;  1P3O A;  3LZ0 B;  3AZL D;  3LZ0 C;  3MGS A;  5B0Y B;  1P3O D;  2F8N H;  3MGS D;  5JRG A;  1H3O B;  5AV8 A;  3LEL C;  5AV8 D;  5B2I C;  4XUJ A;  3AZM A;  2RVQ D;  3REJ A;  5B40 C;  3MGP D;  1KU5 A;  4UUZ A;  4XUJ D;  3AZM D;  3REJ D;  3MGQ A;  2CV5 B;  5CPJ C;  5CPI C;  2NZD C;  3X1U A;  3AN2 B;  1M19 C;  3AN2 C;  3MGQ D;  3X1V B;  3REI D;  5DNN C;  4HGA B;  4HGA C;  5BNV B;  4J8U A;  3UT9 B;  5JA4 B;  3AZI A;  4J8U D;  3AZI D;  1WWI A;  2FJ7 C;  3AV1 A;  3B6F A;  3AFA A;  1P3K A;  5CHL B;  4G91 C;  3B6G B;  3AV1 D;  4KUD A;  2JSS A;  3B6F D;  3AFA D;  1P3K D;  3O62 B;  1EQZ A;  3LZ1 B;  4WNN A;  1BFM A;  3AV2 A;  4XZQ B;  1EQZ D;  5GT3 B;  5GT0 B;  5GT3 C;  1TZY B;  5GT0 C;  4J8V A;  3AV2 D;  1P3G A;  3W96 B;  2HIO C;  3W96 C;  4J8V D;  3LJA A;  4J8X A;  4J8X D;  3MNN D;  5BS7 C;  1P3I A;  5CPK B;  5B32 B;  4ZBJ B;  4NFT A;  5CPK C;  4H9P A;  4YM6 B;  1HQ3 B;  5B31 B;  1ID3 C;  5B1M B;  4LD9 C;  3AZE B;  3R45 A;  3AZE C;  5AV6 C;  1JFI A;  5DNM B;  4WZS B;  5DNM C;  1U35 B;  2PYO B;  4WU8 B;  4WU8 C;  2ARO A;  3AZL B;  1P3O B;  3AZK D;  2ARO D;  1P3L C;  3MGS B;  5AV9 A;  1B67 A;  5AV9 D;  5B33 C;  5AV8 B;  4Z66 C;  5B24 C;  3X1T C;  1TAF A;  3B0D C;  3MGP B;  3MGP C;  3AZM B;  1P3B D;  5BT1 C;  3REJ B;  4EO5 B;  4UUZ B;  3MGQ B;  3REI B;  5G49 A;  3REI C;  3MVD C;  4QLC A;  5AY8 C;  4QLC D;  3LZ0 A;  3AZI B;  3VH6 A;  3LEL A;  3AFA B;  3LEL D;  5B2I A;  1P3K B;  5B40 A;  5B2I D;  1KX5 D;  1EQZ B;  4WNN B;  3AV2 B;  5B40 D;  2NZD A;  5CPJ A;  5CPI A;  4J8V B;  1M19 A;  3AN2 A;  2NZD D;  5CPJ D;  3V9R B;  5DNN A;  5CPI D;  1M19 D;  3X1S C;  5B0Z C;  5DNN D;  4J8X B;  3KUY C;  4G92 C;  3MNN B;  3MNN C;  3VH6 W;  3UTB C;  2FJ7 A;  4R8P B;  4R8P C;  2FJ7 D;  1B6W A;  4H9P B;  3NQJ A;  5GT3 A;  5GT0 A;  3R45 B;  1JFI B;  2HIO A;  1Q9C A;  3W96 A;  5GT3 D;  5GT0 D;  2HIO D;  3W96 D;  5GXQ B;  5GXQ C;  1BH8 A;  2L5A A;  2ARO B;  4H9O A;  3A6N C;  3REH B;  3REH C;  3AZK B;  3AZK C;  5BS7 A;  3NQU B;  5B1L C;  5AV9 B;  5CPK A;  5CPK D;  1ID3 A;  4H9R A;  4AWL C;  4LD9 A;  2NQB C;  3AZE A;  1P3B B;  5AV6 A;  1P3B C;  1ID3 D;  3WTP E;  4LD9 D;  5B2J D;  3AZE D;  5DNM A;  2LY8 A;  5AV6 D;  3VH6 T;  4WU8 A;  4QLC B;  1P3L A;  5C3I C;  4X23 D;  1P3L D;  3MGR B;  3MGR C;  5B33 A;  4Z66 A;  3LEL B;  1P3F C;  3W99 D;  5B24 A;  5B33 D;  4YS3 C;  4Z66 D;  3X1T A;  5B2I B;  1KX5 B;  1S32 C;  1KX5 C;  3MGP A;  5B24 D;  3X1T D;  5B40 B;  2F8N D;  5BT1 D;  1P3A C;  2NZD B;  5CPJ B;  3REI A;  5CPI B;  3MVD A;  1M19 B;  5DNN B;  3MVD D;  5AY8 A; 
#chains in the Genus database with same CATH topology
 5AY8 D;  2FJ7 B;  5AVB C;  3REL D;  4DQY B;  5AVC B;  5AVC C;  1P3M C;  4G91 B;  2VQR A;  4J8W C;  5CP6 C;  1F66 D;  3NQJ B;  3V9R A;  2HIO B;  2YFV A;  3WAA C;  3X1S A;  2Y2P A;  5B0Z A;  2XD1 A;  3KUY A;  3X1S D;  5B0Z D;  1BH8 B;  3REK B;  3MNN A;  3KUY D;  3REK C;  3UTB A;  4H9O B;  4R8P A;  3AZF C;  3UTB D;  4R8P D;  2FFF B;  2YFW B;  1P34 D;  1ID3 B;  4H9S C;  4H9R B;  4LD9 B;  5B2J B;  3WKJ C;  5B2J C;  5AV6 B;  1KX3 B;  1KX3 C;  5GXQ A;  4JJN B;  4JJN C;  3A6N A;  5GXQ D;  3REH A;  3AZK A;  3KWQ C;  3A6N D;  3REH D;  4X23 B;  1P3L B;  4X23 C;  3NQU A;  5B1L A;  2Y2J A;  3A1K A;  2DF4 C;  5B1L D;  3W99 B;  3W99 C;  5B33 B;  4Z66 B;  2NQB A;  1ULY A;  5B24 B;  3X1T B;  1P3B A;  5F99 C;  3B0D B;  5BNX B;  3TU4 B;  2F8N B;  3TU4 C;  2NQB D;  1AOI C;  2CWE A;  2BYM B;  3MVD B;  4Z5T C;  1BH9 B;  3AZH C;  2Y2N A;  5AY8 B;  1M1A C;  4Z2M H;  3W97 C;  5E5A C;  3MGR A;  3REL B;  3REL C;  1A7W A;  1P3F A;  3MGR D;  2F8N G;  4YS3 A;  1P3F D;  1S32 A;  1KX5 A;  4YS3 D;  1S32 D;  1F66 B;  1F66 C;  1P3A A;  2Y2Q A;  1P3A D;  2F8N K;  2YFV B;  3X1S B;  5B0Z B;  4H9N B;  3KXB C;  3KUY B;  4G92 B;  3X1U C;  3KSY A;  3C1C C;  3AYW C;  3UTB B;  5AVB A;  4DRB A;  3W98 C;  4ZUX C;  5AVC A;  5AVB D;  1P3M A;  5AVC D;  1P34 B;  1P3M D;  1P34 C;  4KHA A;  4J8W A;  5CP6 A;  1M18 C;  5AV5 C;  4J8W D;  5CP6 D;  1P3P C;  4KUD C;  3WAA A;  3WAA D;  3WA9 C;  3REK A;  5GSU C;  3A6N B;  2JE5 A;  3AZF A;  3REK D;  4WU9 C;  3LJA C;  2G5I C;  3AZF D;  5B1L B;  1N1J A;  2YFW A;  4DRA A;  2HUE B;  2Y2O A;  2HUE C;  2BYK A;  4H9S A;  4AWL B;  2NQB B;  3WKJ A;  5B2J A;  3EPK A;  4KGC C;  1KX3 A;  1ZLA C;  3WKJ D;  1KX3 D;  2IO5 B;  2IO5 C;  4JJN A;  3AZN C;  4JJN D;  4NE6 A;  5C3I B;  4X23 A;  5KDM A;  3VH5 A;  3KWQ D;  3W99 A;  3AZJ C;  1P3F B;  3UTA D;  4YS3 B;  1KX4 D;  5F99 A;  5BNX A;  1S32 B;  3TU4 A;  2F8N A;  1W2E A;  5F99 D;  1AOI A;  3TU4 D;  1P3A B;  1AOI D;  2BYM A;  4Z5T A;  3AZH A;  2G5H C;  1BH9 A;  2ZY2 A;  4Z5T D;  1WWS A;  3VH5 W;  3AZH D;  1M1A A;  3W97 A;  5E5A A;  1M1A D;  3REL A;  4H9Q A;  3W97 D;  5AVB B;  5E5A D;  3AZG C;  3F6T A;  1P3M B;  5B0Y C;  2ZY4 A;  4NE5 A;  2Y2H A;  1F66 A;  4KHA B;  3H0M C;  4J8W B;  2Y2K A;  3H0R C;  5JRG D;  5CP6 B;  2BG1 A;  3WAA B;  3KXB A;  4H9N A;  5FUG A;  2ZY5 A;  3KXB D;  2CV5 C;  4E45 A;  3C1C A;  3X1V C;  3AYW A;  3X1U D;  3AZF B;  3W98 A;  4ZUX A;  3C1C D;  3AYW D;  3W98 D;  3UT9 C;  4ZUX D;  4WJ3 C;  1N1J B;  1P34 A;  2BYK B;  1M18 A;  5AV5 A;  3WKJ B;  1P3P A;  3B6G C;  1M18 D;  3VH5 T;  5AV5 D;  3O62 C;  1P3P D;  3LZ1 C;  4M6B A;  4KUD D;  3WA9 A;  4XZQ C;  1TZY C;  5GSU A;  3C1B B;  3WA9 D;  3C1B C;  1P3G D;  5GSU D;  3KWQ B;  4WU9 A;  5KDM B;  4WU9 D;  3LJA D;  3UTA B;  3UTA C;  1KX4 B;  1KX4 C;  1P3I D;  5F99 B;  4KGC A;  1ZLA A;  3IP4 C;  4ZBJ C;  5B32 C;  4CAY B;  4KGC D;  4CSR A;  1HQ3 C;  4YM6 C;  1AOI B;  5B31 C;  1ZLA D;  5B1M C;  1HTA A;  3WTP B;  3WTP C;  4Z5T B;  4E44 A;  3AZN A;  3AZH B;  3AZN D;  1U35 C;  1M1A B;  2PYO C;  3W97 B;  5E5A B;  4H9Q B;  3H0L C;  3AZL C;  3AZJ A;  1P3O C;  5B32 G;  3B0C W;  3AZJ D;  3MGS C;  5B31 G;  4UPK A;  5JRG B;  5JRG C;  5AV8 C;  2RVQ C;  4XUJ B;  4XUJ C;  3AZM C;  1F1E A;  3EG5 B;  3REJ C;  4EO5 C;  3KXB B;  5FUG B;  3MGQ C;  3X1U B;  3C1C B;  3AYW B;  3AZG A;  5BO0 A;  3W98 B;  4ZUX B;  4J8U B;  4J8U C;  3AZG D;  5B0Y A;  3AZI C;  3LZ0 D;  5B0Y D;  1H3O A;  3AV1 B;  3AV1 C;  3B6F B;  1M18 B;  3B6F C;  3AFA C;  5AV5 B;  1P3K C;  1P3P B;  4KUD B;  1PZR A;  2UWX A;  1EQZ C;  3AV2 C;  3WA9 B;  2Y2M A;  2CV5 A;  2Y2G A;  4J8V C;  1P3G B;  3B0B A;  5GSU B;  3X1V A;  2CV5 D;  1P3G C;  3AL0 C;  3B0C T;  3AN2 D;  5BNV A;  3X1V D;  4WU9 B;  3LJA B;  4J8X C;  3UT9 A;  5JA4 A;  3UT9 D;  4NE3 A;  1P3I B;  1P3I C;  3B6G A;  4KGC B;  1ZLA B;  3O62 A;  3B6G D;  3LZ1 A;  4CSR B;  3O62 D;  4XZQ A;  3LZ1 D;  1TZY A;  4XZQ D;  3C1B A;  3AZN B;  1TZY D;  3KWQ A;  3C1B D;  2ARO C;  3EPL A;  3UTA A;  1KX4 A;  3AZJ B;  5AV9 C;  5B32 A;  4WV4 B;  4CAY A;  4YM6 A;  1HQ3 A;  5B32 D;  3KFU G;  5B31 A;  5B1M A;  4YM6 D;  1HQ3 D;  5B31 D;  2DQN C;  1TAF B;  5B1M D;  1R4V A;  3WTP A;  3WTP D;  5DNM D;  1U35 A;  2PYO A;  5G49 B;  1U35 D;  2PYO D;  4Z2M G;  4QLC C;  3AZL A;  3AZG B;  5BO0 B;  4WU8 D;  1P3O A;  3LZ0 B;  3AZL D;  3LZ0 C;  3MGS A;  5B0Y B;  1P3O D;  2F8N H;  3MGS D;  5JRG A;  1H3O B;  5AV8 A;  3LEL C;  5AV8 D;  5B2I C;  4XUJ A;  3AZM A;  2RVQ D;  3REJ A;  5B40 C;  3MGP D;  1KU5 A;  4UUZ A;  2J8P A;  4XUJ D;  3AZM D;  3REJ D;  3MGQ A;  2CV5 B;  5CPJ C;  5CPI C;  2NZD C;  3X1U A;  3AN2 B;  1M19 C;  3AN2 C;  3MGQ D;  3X1V B;  3REI D;  5DNN C;  4HGA B;  4HGA C;  5BNV B;  4J8U A;  3UT9 B;  2Y2I A;  5JA4 B;  3AZI A;  4J8U D;  3AZI D;  1WWI A;  2FJ7 C;  3P5J B;  3AV1 A;  3B6F A;  3AFA A;  1P3K A;  5CHL B;  4G91 C;  3B6G B;  3AV1 D;  4KUD A;  2JSS A;  3B6F D;  3AFA D;  2XD5 A;  1P3K D;  3O62 B;  1EQZ A;  3LZ1 B;  4WNN A;  1BFM A;  3AV2 A;  4XZQ B;  1EQZ D;  5GT3 B;  5GT0 B;  5GT3 C;  1TZY B;  5GT0 C;  3EPJ A;  4J8V A;  3AV2 D;  1P3G A;  3W96 B;  2HIO C;  3W96 C;  4J8V D;  3LJA A;  4J8X A;  3EPH A;  4J8X D;  2JCH A;  3MNN D;  5BS7 C;  1P3I A;  5CPK B;  5B32 B;  4ZBJ B;  4NFT A;  5CPK C;  4H9P A;  4YM6 B;  1HQ3 B;  5B31 B;  1ID3 C;  5B1M B;  4LD9 C;  3AZE B;  3R45 A;  3AZE C;  5AV6 C;  1JFI A;  5DNM B;  4WZS B;  2RIQ A;  5DNM C;  1U35 B;  2PYO B;  4WU8 B;  4WU8 C;  2ARO A;  3AZL B;  1P3O B;  3AZK D;  2ARO D;  1P3L C;  3MGS B;  5AV9 A;  1B67 A;  5AV9 D;  5B33 C;  5AV8 B;  4Z66 C;  5B24 C;  3X1T C;  1TAF A;  3B0D C;  3MGP B;  3MGP C;  3AZM B;  1P3B D;  5BT1 C;  3REJ B;  4EO5 B;  4UUZ B;  3MGQ B;  3REI B;  5G49 A;  3REI C;  3MVD C;  4QLC A;  5AY8 C;  4QLC D;  3LZ0 A;  3AZI B;  3VH6 A;  2Y2L A;  3LEL A;  3AFA B;  3LEL D;  5B2I A;  1P3K B;  5B40 A;  5B2I D;  1KX5 D;  1EQZ B;  4WNN B;  3AV2 B;  5B40 D;  2NZD A;  5CPJ A;  5CPI A;  4J8V B;  1M19 A;  3AN2 A;  1T3U A;  2NZD D;  5CPJ D;  3V9R B;  5DNN A;  5CPI D;  1M19 D;  3X1S C;  5B0Z C;  5DNN D;  4J8X B;  3KUY C;  4G92 C;  2W8S A;  3MNN B;  3MNN C;  3VH6 W;  3UTB C;  2FJ7 A;  4R8P B;  4R8P C;  2FJ7 D;  1B6W A;  2ZY3 A;  4H9P B;  3NQJ A;  5GT3 A;  5GT0 A;  3R45 B;  1JFI B;  2HIO A;  1Q9C A;  3W96 A;  5GT3 D;  5GT0 D;  2HIO D;  3W96 D;  5GXQ B;  5GXQ C;  1BH8 A;  1Z2C B;  2L5A A;  2ARO B;  4H9O A;  3A6N C;  3REH B;  3REH C;  3AZK B;  3AZK C;  5BS7 A;  3NQU B;  5B1L C;  5AV9 B;  5CPK A;  2F2A C;  5CPK D;  1ID3 A;  4H9R A;  4AWL C;  4LD9 A;  2NQB C;  3AZE A;  1P3B B;  5AV6 A;  1P3B C;  1ID3 D;  3WTP E;  4LD9 D;  3FDD A;  5B2J D;  3AZE D;  5DNM A;  2LY8 A;  5AV6 D;  3VH6 T;  4WU8 A;  4QLC B;  1P3L A;  5C3I C;  3A1I A;  4X23 D;  1P3L D;  3MGR B;  3MGR C;  5B33 A;  4Z66 A;  3LEL B;  1P3F C;  3W99 D;  5B24 A;  5B33 D;  4YS3 C;  4Z66 D;  3X1T A;  5B2I B;  1KX5 B;  1S32 C;  1KX5 C;  3MGP A;  5B24 D;  3X1T D;  5B40 B;  2F8N D;  5BT1 D;  1P3A C;  2NZD B;  5CPJ B;  3REI A;  5CPI B;  3MVD A;  1M19 B;  5DNN B;  2ZM5 A;  3MVD D;  5AY8 A; 
#chains in the Genus database with same CATH homology
 5AY8 D;  2FJ7 B;  5AVB C;  3REL D;  4DQY B;  5AVC B;  5AVC C;  1P3M C;  4G91 B;  2VQR A;  4J8W C;  5CP6 C;  1F66 D;  3NQJ B;  3V9R A;  2HIO B;  2YFV A;  3WAA C;  3X1S A;  2Y2P A;  5B0Z A;  2XD1 A;  3KUY A;  3X1S D;  5B0Z D;  1BH8 B;  3REK B;  3MNN A;  3KUY D;  3REK C;  3UTB A;  4H9O B;  4R8P A;  3AZF C;  3UTB D;  4R8P D;  2FFF B;  2YFW B;  1P34 D;  1ID3 B;  4H9S C;  4H9R B;  4LD9 B;  5B2J B;  3WKJ C;  5B2J C;  5AV6 B;  1KX3 B;  1KX3 C;  5GXQ A;  4JJN B;  4JJN C;  3A6N A;  5GXQ D;  3REH A;  3AZK A;  3KWQ C;  3A6N D;  3REH D;  4X23 B;  1P3L B;  4X23 C;  3NQU A;  5B1L A;  2Y2J A;  3A1K A;  2DF4 C;  5B1L D;  3W99 B;  3W99 C;  5B33 B;  4Z66 B;  2NQB A;  1ULY A;  5B24 B;  3X1T B;  1P3B A;  5F99 C;  3B0D B;  5BNX B;  3TU4 B;  2F8N B;  3TU4 C;  2NQB D;  1AOI C;  2CWE A;  2BYM B;  3MVD B;  4Z5T C;  1BH9 B;  3AZH C;  2Y2N A;  5AY8 B;  1M1A C;  4Z2M H;  3W97 C;  5E5A C;  3MGR A;  3REL B;  3REL C;  1A7W A;  1P3F A;  3MGR D;  2F8N G;  4YS3 A;  1P3F D;  1S32 A;  1KX5 A;  4YS3 D;  1S32 D;  1F66 B;  1F66 C;  1P3A A;  2Y2Q A;  1P3A D;  2F8N K;  2YFV B;  3X1S B;  5B0Z B;  4H9N B;  3KXB C;  3KUY B;  4G92 B;  3X1U C;  3KSY A;  3C1C C;  3AYW C;  3UTB B;  5AVB A;  4DRB A;  3W98 C;  4ZUX C;  5AVC A;  5AVB D;  1P3M A;  5AVC D;  1P34 B;  1P3M D;  1P34 C;  4KHA A;  4J8W A;  5CP6 A;  1M18 C;  5AV5 C;  4J8W D;  5CP6 D;  1P3P C;  4KUD C;  3WAA A;  3WAA D;  3WA9 C;  3REK A;  5GSU C;  3A6N B;  2JE5 A;  3AZF A;  3REK D;  4WU9 C;  3LJA C;  2G5I C;  3AZF D;  5B1L B;  1N1J A;  2YFW A;  4DRA A;  2HUE B;  2Y2O A;  2HUE C;  2BYK A;  4H9S A;  4AWL B;  2NQB B;  3WKJ A;  5B2J A;  3EPK A;  4KGC C;  1KX3 A;  1ZLA C;  3WKJ D;  1KX3 D;  2IO5 B;  2IO5 C;  4JJN A;  3AZN C;  4JJN D;  4NE6 A;  5C3I B;  4X23 A;  5KDM A;  3VH5 A;  3KWQ D;  3W99 A;  3AZJ C;  1P3F B;  3UTA D;  4YS3 B;  1KX4 D;  5F99 A;  5BNX A;  1S32 B;  3TU4 A;  2F8N A;  1W2E A;  5F99 D;  1AOI A;  3TU4 D;  1P3A B;  1AOI D;  2BYM A;  4Z5T A;  3AZH A;  2G5H C;  1BH9 A;  2ZY2 A;  4Z5T D;  1WWS A;  3VH5 W;  3AZH D;  1M1A A;  3W97 A;  5E5A A;  1M1A D;  3REL A;  4H9Q A;  3W97 D;  5AVB B;  5E5A D;  3AZG C;  3F6T A;  1P3M B;  5B0Y C;  2ZY4 A;  4NE5 A;  2Y2H A;  1F66 A;  4KHA B;  3H0M C;  4J8W B;  2Y2K A;  3H0R C;  5JRG D;  5CP6 B;  2BG1 A;  3WAA B;  3KXB A;  4H9N A;  5FUG A;  2ZY5 A;  3KXB D;  2CV5 C;  4E45 A;  3C1C A;  3X1V C;  3AYW A;  3X1U D;  3AZF B;  3W98 A;  4ZUX A;  3C1C D;  3AYW D;  3W98 D;  3UT9 C;  4ZUX D;  4WJ3 C;  1N1J B;  1P34 A;  2BYK B;  1M18 A;  5AV5 A;  3WKJ B;  1P3P A;  3B6G C;  1M18 D;  3VH5 T;  5AV5 D;  3O62 C;  1P3P D;  3LZ1 C;  4M6B A;  4KUD D;  3WA9 A;  4XZQ C;  1TZY C;  5GSU A;  3C1B B;  3WA9 D;  3C1B C;  1P3G D;  5GSU D;  3KWQ B;  4WU9 A;  5KDM B;  4WU9 D;  3LJA D;  3UTA B;  3UTA C;  1KX4 B;  1KX4 C;  1P3I D;  5F99 B;  4KGC A;  1ZLA A;  3IP4 C;  4ZBJ C;  5B32 C;  4CAY B;  4KGC D;  4CSR A;  1HQ3 C;  4YM6 C;  1AOI B;  5B31 C;  1ZLA D;  5B1M C;  1HTA A;  3WTP B;  3WTP C;  4Z5T B;  4E44 A;  3AZN A;  3AZH B;  3AZN D;  1U35 C;  1M1A B;  2PYO C;  3W97 B;  5E5A B;  4H9Q B;  3H0L C;  3AZL C;  3AZJ A;  1P3O C;  5B32 G;  3B0C W;  3AZJ D;  3MGS C;  5B31 G;  4UPK A;  5JRG B;  5JRG C;  5AV8 C;  2RVQ C;  4XUJ B;  4XUJ C;  3AZM C;  1F1E A;  3EG5 B;  3REJ C;  4EO5 C;  3KXB B;  5FUG B;  3MGQ C;  3X1U B;  3C1C B;  3AYW B;  3AZG A;  5BO0 A;  3W98 B;  4ZUX B;  4J8U B;  4J8U C;  3AZG D;  5B0Y A;  3AZI C;  3LZ0 D;  5B0Y D;  1H3O A;  3AV1 B;  3AV1 C;  3B6F B;  1M18 B;  3B6F C;  3AFA C;  5AV5 B;  1P3K C;  1P3P B;  4KUD B;  1PZR A;  2UWX A;  1EQZ C;  3AV2 C;  3WA9 B;  2Y2M A;  2CV5 A;  2Y2G A;  4J8V C;  1P3G B;  3B0B A;  5GSU B;  3X1V A;  2CV5 D;  1P3G C;  3AL0 C;  3B0C T;  3AN2 D;  5BNV A;  3X1V D;  4WU9 B;  3LJA B;  4J8X C;  3UT9 A;  5JA4 A;  3UT9 D;  4NE3 A;  1P3I B;  1P3I C;  3B6G A;  4KGC B;  1ZLA B;  3O62 A;  3B6G D;  3LZ1 A;  4CSR B;  3O62 D;  4XZQ A;  3LZ1 D;  1TZY A;  4XZQ D;  3C1B A;  3AZN B;  1TZY D;  3KWQ A;  3C1B D;  2ARO C;  3EPL A;  3UTA A;  1KX4 A;  3AZJ B;  5AV9 C;  5B32 A;  4WV4 B;  4CAY A;  4YM6 A;  1HQ3 A;  5B32 D;  3KFU G;  5B31 A;  5B1M A;  4YM6 D;  1HQ3 D;  5B31 D;  2DQN C;  1TAF B;  5B1M D;  1R4V A;  3WTP A;  3WTP D;  5DNM D;  1U35 A;  2PYO A;  5G49 B;  1U35 D;  2PYO D;  4Z2M G;  4QLC C;  3AZL A;  3AZG B;  5BO0 B;  4WU8 D;  1P3O A;  3LZ0 B;  3AZL D;  3LZ0 C;  3MGS A;  5B0Y B;  1P3O D;  2F8N H;  3MGS D;  5JRG A;  1H3O B;  5AV8 A;  3LEL C;  5AV8 D;  5B2I C;  4XUJ A;  3AZM A;  2RVQ D;  3REJ A;  5B40 C;  3MGP D;  1KU5 A;  4UUZ A;  2J8P A;  4XUJ D;  3AZM D;  3REJ D;  3MGQ A;  2CV5 B;  5CPJ C;  5CPI C;  2NZD C;  3X1U A;  3AN2 B;  1M19 C;  3AN2 C;  3MGQ D;  3X1V B;  3REI D;  5DNN C;  4HGA B;  4HGA C;  5BNV B;  4J8U A;  3UT9 B;  2Y2I A;  5JA4 B;  3AZI A;  4J8U D;  3AZI D;  1WWI A;  2FJ7 C;  3P5J B;  3AV1 A;  3B6F A;  3AFA A;  1P3K A;  5CHL B;  4G91 C;  3B6G B;  3AV1 D;  4KUD A;  2JSS A;  3B6F D;  3AFA D;  2XD5 A;  1P3K D;  3O62 B;  1EQZ A;  3LZ1 B;  4WNN A;  1BFM A;  3AV2 A;  4XZQ B;  1EQZ D;  5GT3 B;  5GT0 B;  5GT3 C;  1TZY B;  5GT0 C;  3EPJ A;  4J8V A;  3AV2 D;  1P3G A;  3W96 B;  2HIO C;  3W96 C;  4J8V D;  3LJA A;  4J8X A;  3EPH A;  4J8X D;  2JCH A;  3MNN D;  5BS7 C;  1P3I A;  5CPK B;  5B32 B;  4ZBJ B;  4NFT A;  5CPK C;  4H9P A;  4YM6 B;  1HQ3 B;  5B31 B;  1ID3 C;  5B1M B;  4LD9 C;  3AZE B;  3R45 A;  3AZE C;  5AV6 C;  1JFI A;  5DNM B;  4WZS B;  2RIQ A;  5DNM C;  1U35 B;  2PYO B;  4WU8 B;  4WU8 C;  2ARO A;  3AZL B;  1P3O B;  3AZK D;  2ARO D;  1P3L C;  3MGS B;  5AV9 A;  1B67 A;  5AV9 D;  5B33 C;  5AV8 B;  4Z66 C;  5B24 C;  3X1T C;  1TAF A;  3B0D C;  3MGP B;  3MGP C;  3AZM B;  1P3B D;  5BT1 C;  3REJ B;  4EO5 B;  4UUZ B;  3MGQ B;  3REI B;  5G49 A;  3REI C;  3MVD C;  4QLC A;  5AY8 C;  4QLC D;  3LZ0 A;  3AZI B;  3VH6 A;  2Y2L A;  3LEL A;  3AFA B;  3LEL D;  5B2I A;  1P3K B;  5B40 A;  5B2I D;  1KX5 D;  1EQZ B;  4WNN B;  3AV2 B;  5B40 D;  2NZD A;  5CPJ A;  5CPI A;  4J8V B;  1M19 A;  3AN2 A;  1T3U A;  2NZD D;  5CPJ D;  3V9R B;  5DNN A;  5CPI D;  1M19 D;  3X1S C;  5B0Z C;  5DNN D;  4J8X B;  3KUY C;  4G92 C;  2W8S A;  3MNN B;  3MNN C;  3VH6 W;  3UTB C;  2FJ7 A;  4R8P B;  4R8P C;  2FJ7 D;  1B6W A;  2ZY3 A;  4H9P B;  3NQJ A;  5GT3 A;  5GT0 A;  3R45 B;  1JFI B;  2HIO A;  1Q9C A;  3W96 A;  5GT3 D;  5GT0 D;  2HIO D;  3W96 D;  5GXQ B;  5GXQ C;  1BH8 A;  1Z2C B;  2L5A A;  2ARO B;  4H9O A;  3A6N C;  3REH B;  3REH C;  3AZK B;  3AZK C;  5BS7 A;  3NQU B;  5B1L C;  5AV9 B;  5CPK A;  2F2A C;  5CPK D;  1ID3 A;  4H9R A;  4AWL C;  4LD9 A;  2NQB C;  3AZE A;  1P3B B;  5AV6 A;  1P3B C;  1ID3 D;  3WTP E;  4LD9 D;  3FDD A;  5B2J D;  3AZE D;  5DNM A;  2LY8 A;  5AV6 D;  3VH6 T;  4WU8 A;  4QLC B;  1P3L A;  5C3I C;  3A1I A;  4X23 D;  1P3L D;  3MGR B;  3MGR C;  5B33 A;  4Z66 A;  3LEL B;  1P3F C;  3W99 D;  5B24 A;  5B33 D;  4YS3 C;  4Z66 D;  3X1T A;  5B2I B;  1KX5 B;  1S32 C;  1KX5 C;  3MGP A;  5B24 D;  3X1T D;  5B40 B;  2F8N D;  5BT1 D;  1P3A C;  2NZD B;  5CPJ B;  3REI A;  5CPI B;  3MVD A;  1M19 B;  5DNN B;  2ZM5 A;  3MVD D;  5AY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...