5B2IC

Human nucleosome containing cpg unmethylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iC00
5B31B 3WTPC 1P3ID 1KX5C 1S32C 2NZDD 3LJAC 5F99C 1P3KD 1KX4B 1P3GA 4WU8B 4XUJB 1P3LB 5JA4B 3MNNA 3REJA 3TU4B 1P34C 1AOIC 5CPJA 5JRGA 3W99D 5BO0A 5GXQD 1B67A 3B6FB 5E5AB 3MGPB 5GSUD 5GT3B 3WKJD 4X23A 1KX4C 3W98B 4AWLB 4WU8C 3REKA 4XUJC 1P3LC 1P3MA 5B1MB 4JJNB 5B2JA 4J8XA 3C1BA 2YFVB 4R8PD 1HQ3D 3KSYA 3AZEB 2F8ND 3B6FC 5KDMB 1BH8B 5E5AC 3B0CW 5GT3C 4WU9D 3MGPC 3W98C 4AWLC 4DRAA 5B1MC 1JFIB 5AV8A 4Z5TA 5AV5B 3X1VA 4JJNC 2FJ7B 1N1JB 4WNNB 5DNMB 3W97D 1P3AA 3KWQD 3AZEC 3LELA 3UTBC 5B0YB 3WA9B 1P3BA 5JRGD 2IO5B 1M1AA 1P3OD 1U35D 1ULYA 1EQZB 3X1TA 1P3PB 3MGRA 5AV5C 4LD9B 2FJ7C 1H3OB 3W96A 3AFAA 5B0YC 3WA9C 3UT9B 4XZQA 1P3FA 2IO5C 5AY8A 4J8XD 1F66A 3AV2A 1EQZC 1P3PC 3LZ0D 3WAAC 1KX3A 4LD9C 2HIOD 3UTAB 4H9QB 4EO5B 3UT9C 3REHA 3X1VD 5B33B 3A6NB 1ZLAB 3VH5A 3REIB 3VH5T 3KUYD 4QLCD 5B0ZA 3UTAC 5B2ID 4EO5C 3AZNA 5B33C 2AROA 5AVCB 4NFTA 3A6NC 1M19A 5B1LA 1ZLAC 5AVBA 3X1UC 3REIC 3NQUB 5BNVB 3MVDD 3B0DB 3AZGA 3AZID 3AZJD 1R4VA 3AV2D 3C1CA 1ID3A 5CPKD 1BH9A 3B6GA 4H9SC 2BYMB 3MGQB 5BS7C 2F8NG 5AVCC 1TZYD 4ZUXA 3LZ1A 1KX5D 4YM6A 3B0DC 5AV6B 1S32D 3REHD 3KXBA 3AYWA 5AV9B 3LJAD 3AZKB 3MGQC 1P3IA 3AV1B 5FUGB 1P34D 5B31D 2NZDA 4ZBJB 5AV6C 3AZND 1JFIA 1P3KA 3AZHB 5AV9C 5B1LD 4YS3A 1KX4D 5CP6B 4WU8D 4XUJD 3AZKC 4CSRA 1P3LD 3W99A 3TU4D 3AV1C 3AZLB 4ZBJC 4UUZB 4H9RB 3R45B 5B40B 3B6GD 1M18B 3B6FD 3WKJA 5E5AD 3AZHC 5GT3D 1A7WA 2PYOB 4Z66B 5CP6C 3W98D 2CV5B 2BYKB 1KU5A 4R8PA 3AZLC 4WU9A 5B40C 3V9RA 3LELC 3AZED 1M18C 1AOIB 2PYOC 4Z66C 2CV5C 4KUDB 3W97A 5AV5D 2NQBB 2FJ7D 5DNMD 3KWQA 4YS3D 1P34B 3RELB 2RVQC 2YFWA 5DNNB 5B0YD 1U35A 1P3FC 1P3OA 3WA9D 4KGCB 3X1SA 3NQJA 4G92B 4J8VB 1EQZD 5C3IB 4KUDC 1P3PD 3O62B 4H9OA 4LD9D 2NQBC 4H9NB 5GT0A 3RELC 5DNNC 3AN2B 3UT9D 5G49B 4KGCC 3LZ0A 3AZFA 4G92C 4J8VC 3UTBB 5C3IC 3O62C 2HIOA 5B0ZC 1WWSA 1TAFA 5B31G 3AN2C 4J8WB 2F8NH 5B33D 3A6ND 1ZLAD 3REID 3KUYA 4QLCA 5BNXA 3MGSB 5B2IA 3X1SD 3WAAB 4J8WC 5B32B 5AVCD 3MVDA 3AZIA 5GT0D 3AZJA 4CAYA 5CHLB 4E44A 3MGSC 4J8UB 5CPKA 3AZFD 3AZMB 1TZYA 5B32C 3MGQD 3WTPA 1KX5A 5GXQB 4KHAA 1S32A 5AV6D 5GSUB 4J8UC 3X1UB 3LJAA 5F99A 5B24B 1WWIA 4NE5A 3AZMC 1P34A 1AOIA 3AZKD 5B31A 5CPIB 4E45A 3AV1D 5GXQC 2F8NB 5GSUC 3AZHD 1KX4A 5B24C 4WU8A 4XUJA 1P3LA 5JA4A 3TU4A 5CP6D 3VH5W 5CPIC 1P3GB 1HQ3C 3AZLD 3VH6A 3MNNB 3REJB 2L5AA 3VH6T 3B6FA 5E5AA 3MGPA 5GT3A 5CPJB 5JRGB 2HUEB 3WTPD 3W98A 5BO0B 2PYOD 5B1MA 4Z66D 5BT1C 4JJNA 4X23B 5F99D 2YFVA 1P3GC 3REKB 1P3MB 3MNNC 3AZEA 3REJC 5KDMA 1BH8A 3UTBA 5CPJC 5JRGC 1AOID 2HUEC 5B2JB 4J8XB 2RVQD 3C1BB 4DRBA 4KUDD 5AV5A 2FJ7A 1N1JA 4WNNA 5DNMA 4X23C 3REKC 1P3MC 5AV8B 4Z5TB 5B0YA 3RELD 3X1VB 2F8NK 3WA9A 5B2JC 4J8XC 5DNND 3C1BC 1P3AB 1EQZA 4KGCD 1P3PA 3LELB 3WAAA 3MGPD 4LD9A 1P3BB 4WV4B 3O62D 1M1AB 1H3OA 3X1TB 3MGRB 5B1MD 4H9PB 5AV8C 4Z5TC 3X1VC 3WTPE 3UT9A 4JJND 3AN2D 3AFAB 1P3AC 3W96B 4HGAB 3UTBD 4XZQB 4QLCC 1P3BC 5AY8B 1P3FB 1M1AC 4WZSB 1F66B 3UTAA 3AV2B 3X1TC 4H9QA 3MGRC 1KX3B 5B33A 4Z2MG 3W96C 3AFAC 3A6NA 4J8WD 4HGAC 1ZLAA 3MVDC 3REIA 4XZQC 3REHB 5AY8C 2CWEA 1F66C 3AV2C 3MGSD 5CPKC 4G91B 1KX3C 3WAAD 5B0ZB 5AVCA 5B32D 3NQUA 5BNVA 3AZNB 3REHC 2AROB 1M19B 5B1LB 4J8UD 5AVBB 4G91C 3AZGB 3MGQA 2BYMA 3AZMD 5B31C 3UTAD 3C1CB 3B0CT 1ID3B 3AZNC 1BH9B 5AV6A 3B6GB 2AROC 1M19C 4ZUXB 5B1LC 5AVBC 4NE3A 5AV9A 3LZ1B 3X1UD 4YM6B 3AZGC 5B24D 3AZKA 3TU4C 3KXBB 3AYWB 3AV1A 5FUGA 3C1CC 1ID3C 5CPID 3B6GC 1P3IB 4ZUXC 3AZHA 2NZDB 3LZ1C 4YM6C 5CP6A 2LY8A 3KXBC 5BT1D 3AYWC 1P3KB 3AZLA 4YS3B 1P3GD 4UUZA 4H9RA 3R45A 4CSRB 5B40A 3MNND 3REJD 1P3IC 1M18A 3W99B 5CPJD 2NZDC 2PYOA 4Z66A 2CV5A 2BYKA 4H9PA 3WKJB 1P3KC 1F1EA 5DNMC 5AV9D 4YS3C 4X23D 3REKD 1P3MD 3W99C 4R8PB 1HQ3B 5B2JD 3C1BD 4WU9B 4KUDA 3V9RB 3WKJC 1BFMA 2NQBA 3RELA 3W97B 5B32G 5DNNA 5AV8D 4Z2MH 4Z5TD 4R8PC 4KGCA 3KWQB 1P3AD 4WU9C 4J8VA 5B40D 3O62A 3LELD 2YFWB 1P3OB 1M18D 1U35B 1P3BD 1M1AD 3X1SB 3NQJB 4H9NA 2CV5D 3X1TD 3W97C 3MGRD 3AN2A 4H9OB 5G49A 3KWQC 5GT0B 3AFAD 3W96D 4M6BA 1P3OC 1U35C 4XZQD 1P3FD 5AY8D 3VH6W 3LZ0B 3X1SC 3AZFB 1F66D 1KX3D 2HIOB 4J8WA 2NQBD 5GT0C 1TAFB 3MGSA 3LZ0C 3AZFC 4J8VD 2JSSA 3KUYB 4QLCB 2HIOC 5BNXB 1HTAA 5B32A 5B2IB 5B0ZD 4J8UA 2AROD 3MVDB 1M19D 3AZIB 3AZJB 5AVBD 3KUYC 4CAYB 3AZGD 3AZMA 5B2IC 5CPKB 5GXQA 3C1CD 1ID3D 5GSUA 1TZYB 3WTPB 3X1UA 1KX5B 3AZIC 4ZUXD 3AZJC 4KHAB 3B0BA 5B24A 3LZ1D 1S32B 1Q9CA 4YM6D 3KXBD 3LJAB 5F99B 3AYWD 5CPIA 1B6WA 1HQ3A 2F8NA 4H9SA 4NE6A 5BS7A 1TZYC
chains in the Genus database with same CATH superfamily
5B31B 3WTPC 2Y2QA 1P3ID 1KX5C 1S32C 2NZDD 3IP4C 3LJAC 5F99C 1P3KD 1KX4B 1P3GA 4WU8B 4XUJB 1P3LB 5JA4B 3MNNA 3REJA 3TU4B 1P34C 1AOIC 5CPJA 5JRGA 3W99D 5BO0A 5GXQD 3A1IA 1B67A 3B6FB 3P5JB 5E5AB 3MGPB 5GSUD 5GT3B 3WKJD 4X23A 1KX4C 3W98B 4AWLB 4WU8C 3REKA 4XUJC 1P3LC 1P3MA 5B1MB 4JJNB 3FDDA 5B2JA 4J8XA 3C1BA 2YFVB 4R8PD 1HQ3D 3KSYA 3AZEB 2F8ND 3B6FC 5KDMB 1BH8B 5E5AC 3B0CW 5GT3C 4WU9D 3MGPC 3W98C 4AWLC 4DRAA 5B1MC 1JFIB 5AV8A 4Z5TA 5AV5B 3X1VA 4JJNC 2FJ7B 1N1JB 4WNNB 5DNMB 3W97D 1P3AA 3KWQD 3AZEC 3LELA 3UTBC 5B0YB 3WA9B 1P3BA 5JRGD 2IO5B 1M1AA 1P3OD 1U35D 1ULYA 1EQZB 2Y2HA 3X1TA 3MGRA 1P3PB 5AV5C 4LD9B 2FJ7C 1H3OB 3W96A 3AFAA 5B0YC 3EPKA 3UT9B 3WA9C 4XZQA 1P3FA 2IO5C 5AY8A 4J8XD 1F66A 3AV2A 1EQZC 1P3PC 3LZ0D 3WAAC 1KX3A 4LD9C 2HIOD 3UTAB 4H9QB 4EO5B 2ZY4A 3UT9C 3REHA 3X1VD 3H0LC 5B33B 3A6NB 1ZLAB 3VH5A 3REIB 3VH5T 3KUYD 4QLCD 5B0ZA 3UTAC 5B2ID 4EO5C 3AZNA 5B33C 2AROA 5AVCB 4NFTA 3A6NC 1M19A 5B1LA 1ZLAC 5AVBA 3X1UC 3REIC 3NQUB 4DQYB 5BNVB 3MVDD 3B0DB 3AZGA 3AZID 3AZJD 1R4VA 3AV2D 3C1CA 2J8PA 1ID3A 5CPKD 1BH9A 3B6GA 4H9SC 2BYMB 3MGQB 5BS7C 2F8NG 5AVCC 1TZYD 4ZUXA 3LZ1A 1KX5D 3B0DC 4YM6A 5AV6B 1S32D 3REHD 3KXBA 3AYWA 5AV9B 3LJAD 3AZKB 3MGQC 1P3IA 3AV1B 5FUGB 1P34D 5B31D 2NZDA 4ZBJB 5AV6C 3AZND 1JFIA 1P3KA 3AZHB 5AV9C 5B1LD 4YS3A 2ZY2A 1KX4D 5CP6B 3EPLA 4WU8D 4XUJD 3AZKC 4CSRA 1P3LD 3W99A 3TU4D 3AV1C 3AZLB 4ZBJC 4UUZB 4H9RB 3R45B 5B40B 3B6GD 1M18B 3B6FD 3WKJA 5E5AD 3AZHC 5GT3D 1A7WA 2PYOB 4Z66B 5CP6C 3W98D 2CV5B 2BYKB 1KU5A 4R8PA 3AZLC 3A1KA 2ZY3A 4WU9A 5B40C 3V9RA 3LELC 3AZED 1M18C 1AOIB 2PYOC 4Z66C 2CV5C 4KUDB 3W97A 5AV5D 2NQBB 2FJ7D 5DNMD 3KWQA 4YS3D 1P34B 3RELB 2RVQC 2YFWA 5DNNB 5B0YD 1U35A 1P3FC 1P3OA 3WA9D 4KGCB 3X1SA 2JCHA 3NQJA 4G92B 4J8VB 1EQZD 5C3IB 4KUDC 1P3PD 3O62B 4H9OA 4LD9D 2NQBC 1T3UA 2BG1A 4H9NB 5GT0A 3RELC 5DNNC 3AN2B 3UT9D 5G49B 4KGCC 3LZ0A 3AZFA 4G92C 2Y2KA 4J8VC 5C3IC 3UTBB 3O62C 2XD1A 2HIOA 1Z2CB 5B0ZC 1WWSA 1TAFA 5B31G 3AN2C 4J8WB 2F8NH 4UPKA 5B33D 3A6ND 1ZLAD 3REID 3KUYA 4QLCA 5BNXA 3MGSB 5B2IA 3X1SD 3WAAB 4J8WC 5B32B 5AVCD 3MVDA 3AZIA 5GT0D 3AZJA 4CAYA 5CHLB 4E44A 3MGSC 4J8UB 5CPKA 3AZFD 3AZMB 1TZYA 5B32C 3MGQD 3WTPA 1KX5A 5GXQB 4KHAA 1S32A 5AV6D 5GSUB 2DF4C 4J8UC 3X1UB 3LJAA 5F99A 2Y2NA 5B24B 1WWIA 2XD5A 4NE5A 3AZMC 1P34A 1AOIA 3AZKD 5B31A 5CPIB 4E45A 3AV1D 5GXQC 2F8NB 5GSUC 3AZHD 1KX4A 2G5HC 5B24C 4WU8A 4XUJA 1P3LA 5JA4A 3TU4A 5CP6D 3VH5W 5CPIC 1P3GB 1HQ3C 3AZLD 3VH6A 3MNNB 3REJB 2L5AA 3VH6T 2UWXA 3B6FA 5E5AA 3MGPA 5GT3A 5CPJB 5JRGB 2HUEB 3WTPD 3W98A 5BO0B 2PYOD 5B1MA 4Z66D 5BT1C 4JJNA 4X23B 5F99D 2YFVA 1P3GC 3REKB 1P3MB 3MNNC 3AZEA 3REJC 5KDMA 1BH8A 3UTBA 5CPJC 5JRGC 1AOID 2HUEC 5B2JB 4J8XB 2RVQD 3C1BB 4DRBA 4KUDD 5AV5A 2FJ7A 1N1JA 4WNNA 5DNMA 4X23C 3REKC 1P3MC 2RIQA 5AV8B 4Z5TB 5B0YA 3RELD 3X1VB 2F8NK 3WA9A 5B2JC 4J8XC 5DNND 3C1BC 1P3AB 1EQZA 4KGCD 1P3PA 2Y2MA 3LELB 3WAAA 3F6TA 3MGPD 4LD9A 1P3BB 4WV4B 3O62D 3EPJA 1M1AB 1H3OA 3X1TB 3MGRB 5B1MD 4H9PB 5AV8C 4Z5TC 3X1VC 3WTPE 3UT9A 4JJND 3AN2D 3AFAB 1P3AC 3W96B 4HGAB 3UTBD 4XZQB 4QLCC 1P3BC 5AY8B 1P3FB 1M1AC 4WZSB 1F66B 3UTAA 3AV2B 3X1TC 4H9QA 3MGRC 1KX3B 3EG5B 5B33A 4Z2MG 3W96C 3AFAC 3A6NA 4J8WD 4HGAC 1ZLAA 3MVDC 3REIA 4XZQC 3REHB 5AY8C 2CWEA 1F66C 3AV2C 3MGSD 3KFUG 5CPKC 4G91B 2Y2OA 1KX3C 3WAAD 2DQNC 5B0ZB 5AVCA 2G5IC 5B32D 3NQUA 5BNVA 3AZNB 3REHC 2AROB 1M19B 5B1LB 4J8UD 5AVBB 4G91C 2FFFB 3AZGB 3MGQA 2BYMA 4WJ3C 3AZMD 5B31C 3UTAD 3C1CB 3B0CT 1ID3B 3AZNC 1BH9B 5AV6A 3B6GB 2AROC 1M19C 4ZUXB 5B1LC 5AVBC 4NE3A 5AV9A 3LZ1B 3X1UD 4YM6B 2Y2LA 3AZGC 5B24D 3AZKA 3TU4C 3EPHA 3KXBB 3AYWB 3AV1A 3H0MC 5FUGA 3C1CC 1ID3C 5CPID 2ZM5A 2JE5A 3B6GC 1P3IB 4ZUXC 3AZHA 2NZDB 3LZ1C 4YM6C 5CP6A 2LY8A 3KXBC 5BT1D 3AYWC 1P3KB 3AZLA 4YS3B 1P3GD 4UUZA 4H9RA 3R45A 4CSRB 5B40A 3MNND 3REJD 1P3IC 1M18A 3W99B 5CPJD 2NZDC 2PYOA 4Z66A 2CV5A 2BYKA 4H9PA 3WKJB 1P3KC 1F1EA 5DNMC 5AV9D 4YS3C 4X23D 3REKD 1P3MD 3W99C 4R8PB 1HQ3B 5B2JD 3C1BD 4WU9B 4KUDA 3V9RB 2Y2JA 3WKJC 1BFMA 2NQBA 2ZY5A 3RELA 3W97B 5B32G 5DNNA 5AV8D 4Z2MH 4Z5TD 3H0RC 4R8PC 4KGCA 3KWQB 1P3AD 4WU9C 4J8VA 5B40D 3O62A 3LELD 2YFWB 1P3OB 1M18D 1U35B 2VQRA 1P3BD 1M1AD 3X1SB 3NQJB 4H9NA 2CV5D 3X1TD 3W97C 3MGRD 3AN2A 4H9OB 5G49A 3KWQC 3AL0C 5GT0B 3AFAD 3W96D 4M6BA 1P3OC 1U35C 4XZQD 1P3FD 5AY8D 3VH6W 3LZ0B 3X1SC 3AZFB 1F66D 1KX3D 2HIOB 2Y2IA 4J8WA 2NQBD 5GT0C 1TAFB 2F2AC 3MGSA 3LZ0C 3AZFC 1W2EA 4J8VD 2JSSA 2Y2PA 3KUYB 4QLCB 2HIOC 5BNXB 1HTAA 5B32A 5B2IB 5B0ZD 2W8SA 1PZRA 4J8UA 2AROD 3MVDB 1M19D 3AZIB 3AZJB 5AVBD 3KUYC 4CAYB 3AZGD 3AZMA 5B2IC 5CPKB 5GXQA 3C1CD 2Y2GA 1ID3D 5GSUA 1TZYB 3WTPB 3X1UA 1KX5B 3AZIC 4ZUXD 3AZJC 4KHAB 3B0BA 5B24A 3LZ1D 1S32B 1Q9CA 4YM6D 3KXBD 3LJAB 5F99B 3AYWD 5CPIA 1B6WA 1HQ3A 2F8NA 4H9SA 4NE6A 5BS7A 1TZYC
chains in the Genus database with same CATH topology
5B31B 3WTPC 2Y2QA 1P3ID 1KX5C 1S32C 2NZDD 3IP4C 3LJAC 5F99C 1P3KD 1KX4B 1P3GA 4WU8B 4XUJB 1P3LB 5JA4B 3MNNA 3REJA 3TU4B 1P34C 1AOIC 5CPJA 5JRGA 3W99D 5BO0A 5GXQD 3A1IA 1B67A 3B6FB 3P5JB 5E5AB 3MGPB 5GSUD 5GT3B 3WKJD 4X23A 1KX4C 3W98B 4AWLB 4WU8C 3REKA 4XUJC 1P3LC 1P3MA 5B1MB 4JJNB 3FDDA 5B2JA 4J8XA 3C1BA 2YFVB 4R8PD 1HQ3D 3KSYA 3AZEB 2F8ND 3B6FC 5KDMB 1BH8B 5E5AC 3B0CW 5GT3C 4WU9D 3MGPC 3W98C 4AWLC 4DRAA 5B1MC 1JFIB 5AV8A 4Z5TA 5AV5B 3X1VA 4JJNC 2FJ7B 1N1JB 4WNNB 5DNMB 3W97D 1P3AA 3KWQD 3AZEC 3LELA 3UTBC 5B0YB 3WA9B 1P3BA 5JRGD 2IO5B 1M1AA 1P3OD 1U35D 1ULYA 1EQZB 2Y2HA 3X1TA 3MGRA 1P3PB 5AV5C 4LD9B 2FJ7C 1H3OB 3W96A 3AFAA 5B0YC 3EPKA 3UT9B 3WA9C 4XZQA 1P3FA 2IO5C 5AY8A 4J8XD 1F66A 3AV2A 1EQZC 1P3PC 3LZ0D 3WAAC 1KX3A 4LD9C 2HIOD 3UTAB 4H9QB 4EO5B 2ZY4A 3UT9C 3REHA 3X1VD 3H0LC 5B33B 3A6NB 1ZLAB 3VH5A 3REIB 3VH5T 3KUYD 4QLCD 5B0ZA 3UTAC 5B2ID 4EO5C 3AZNA 5B33C 2AROA 5AVCB 4NFTA 3A6NC 1M19A 5B1LA 1ZLAC 5AVBA 3X1UC 3REIC 3NQUB 4DQYB 5BNVB 3MVDD 3B0DB 3AZGA 3AZID 3AZJD 1R4VA 3AV2D 3C1CA 2J8PA 1ID3A 5CPKD 1BH9A 3B6GA 4H9SC 2BYMB 3MGQB 5BS7C 2F8NG 5AVCC 1TZYD 4ZUXA 3LZ1A 1KX5D 3B0DC 4YM6A 5AV6B 1S32D 3REHD 3KXBA 3AYWA 5AV9B 3LJAD 3AZKB 3MGQC 1P3IA 3AV1B 5FUGB 1P34D 5B31D 2NZDA 4ZBJB 5AV6C 3AZND 1JFIA 1P3KA 3AZHB 5AV9C 5B1LD 4YS3A 2ZY2A 1KX4D 5CP6B 3EPLA 4WU8D 4XUJD 3AZKC 4CSRA 1P3LD 3W99A 3TU4D 3AV1C 3AZLB 4ZBJC 4UUZB 4H9RB 3R45B 5B40B 3B6GD 1M18B 3B6FD 3WKJA 5E5AD 3AZHC 5GT3D 1A7WA 2PYOB 4Z66B 5CP6C 3W98D 2CV5B 2BYKB 1KU5A 4R8PA 3AZLC 3A1KA 2ZY3A 4WU9A 5B40C 3V9RA 3LELC 3AZED 1M18C 1AOIB 2PYOC 4Z66C 2CV5C 4KUDB 3W97A 5AV5D 2NQBB 2FJ7D 5DNMD 3KWQA 4YS3D 1P34B 3RELB 2RVQC 2YFWA 5DNNB 5B0YD 1U35A 1P3FC 1P3OA 3WA9D 4KGCB 3X1SA 2JCHA 3NQJA 4G92B 4J8VB 1EQZD 5C3IB 4KUDC 1P3PD 3O62B 4H9OA 4LD9D 2NQBC 1T3UA 2BG1A 4H9NB 5GT0A 3RELC 5DNNC 3AN2B 3UT9D 5G49B 4KGCC 3LZ0A 3AZFA 4G92C 2Y2KA 4J8VC 5C3IC 3UTBB 3O62C 2XD1A 2HIOA 1Z2CB 5B0ZC 1WWSA 1TAFA 5B31G 3AN2C 4J8WB 2F8NH 4UPKA 5B33D 3A6ND 1ZLAD 3REID 3KUYA 4QLCA 5BNXA 3MGSB 5B2IA 3X1SD 3WAAB 4J8WC 5B32B 5AVCD 3MVDA 3AZIA 5GT0D 3AZJA 4CAYA 5CHLB 4E44A 3MGSC 4J8UB 5CPKA 3AZFD 3AZMB 1TZYA 5B32C 3MGQD 3WTPA 1KX5A 5GXQB 4KHAA 1S32A 5AV6D 5GSUB 2DF4C 4J8UC 3X1UB 3LJAA 5F99A 2Y2NA 5B24B 1WWIA 2XD5A 4NE5A 3AZMC 1P34A 1AOIA 3AZKD 5B31A 5CPIB 4E45A 3AV1D 5GXQC 2F8NB 5GSUC 3AZHD 1KX4A 2G5HC 5B24C 4WU8A 4XUJA 1P3LA 5JA4A 3TU4A 5CP6D 3VH5W 5CPIC 1P3GB 1HQ3C 3AZLD 3VH6A 3MNNB 3REJB 2L5AA 3VH6T 2UWXA 3B6FA 5E5AA 3MGPA 5GT3A 5CPJB 5JRGB 2HUEB 3WTPD 3W98A 5BO0B 2PYOD 5B1MA 4Z66D 5BT1C 4JJNA 4X23B 5F99D 2YFVA 1P3GC 3REKB 1P3MB 3MNNC 3AZEA 3REJC 5KDMA 1BH8A 3UTBA 5CPJC 5JRGC 1AOID 2HUEC 5B2JB 4J8XB 2RVQD 3C1BB 4DRBA 4KUDD 5AV5A 2FJ7A 1N1JA 4WNNA 5DNMA 4X23C 3REKC 1P3MC 2RIQA 5AV8B 4Z5TB 5B0YA 3RELD 3X1VB 2F8NK 3WA9A 5B2JC 4J8XC 5DNND 3C1BC 1P3AB 1EQZA 4KGCD 1P3PA 2Y2MA 3LELB 3WAAA 3F6TA 3MGPD 4LD9A 1P3BB 4WV4B 3O62D 3EPJA 1M1AB 1H3OA 3X1TB 3MGRB 5B1MD 4H9PB 5AV8C 4Z5TC 3X1VC 3WTPE 3UT9A 4JJND 3AN2D 3AFAB 1P3AC 3W96B 4HGAB 3UTBD 4XZQB 4QLCC 1P3BC 5AY8B 1P3FB 1M1AC 4WZSB 1F66B 3UTAA 3AV2B 3X1TC 4H9QA 3MGRC 1KX3B 3EG5B 5B33A 4Z2MG 3W96C 3AFAC 3A6NA 4J8WD 4HGAC 1ZLAA 3MVDC 3REIA 4XZQC 3REHB 5AY8C 2CWEA 1F66C 3AV2C 3MGSD 3KFUG 5CPKC 4G91B 2Y2OA 1KX3C 3WAAD 2DQNC 5B0ZB 5AVCA 2G5IC 5B32D 3NQUA 5BNVA 3AZNB 3REHC 2AROB 1M19B 5B1LB 4J8UD 5AVBB 4G91C 2FFFB 3AZGB 3MGQA 2BYMA 4WJ3C 3AZMD 5B31C 3UTAD 3C1CB 3B0CT 1ID3B 3AZNC 1BH9B 5AV6A 3B6GB 2AROC 1M19C 4ZUXB 5B1LC 5AVBC 4NE3A 5AV9A 3LZ1B 3X1UD 4YM6B 2Y2LA 3AZGC 5B24D 3AZKA 3TU4C 3EPHA 3KXBB 3AYWB 3AV1A 3H0MC 5FUGA 3C1CC 1ID3C 5CPID 2ZM5A 2JE5A 3B6GC 1P3IB 4ZUXC 3AZHA 2NZDB 3LZ1C 4YM6C 5CP6A 2LY8A 3KXBC 5BT1D 3AYWC 1P3KB 3AZLA 4YS3B 1P3GD 4UUZA 4H9RA 3R45A 4CSRB 5B40A 3MNND 3REJD 1P3IC 1M18A 3W99B 5CPJD 2NZDC 2PYOA 4Z66A 2CV5A 2BYKA 4H9PA 3WKJB 1P3KC 1F1EA 5DNMC 5AV9D 4YS3C 4X23D 3REKD 1P3MD 3W99C 4R8PB 1HQ3B 5B2JD 3C1BD 4WU9B 4KUDA 3V9RB 2Y2JA 3WKJC 1BFMA 2NQBA 2ZY5A 3RELA 3W97B 5B32G 5DNNA 5AV8D 4Z2MH 4Z5TD 3H0RC 4R8PC 4KGCA 3KWQB 1P3AD 4WU9C 4J8VA 5B40D 3O62A 3LELD 2YFWB 1P3OB 1M18D 1U35B 2VQRA 1P3BD 1M1AD 3X1SB 3NQJB 4H9NA 2CV5D 3X1TD 3W97C 3MGRD 3AN2A 4H9OB 5G49A 3KWQC 3AL0C 5GT0B 3AFAD 3W96D 4M6BA 1P3OC 1U35C 4XZQD 1P3FD 5AY8D 3VH6W 3LZ0B 3X1SC 3AZFB 1F66D 1KX3D 2HIOB 2Y2IA 4J8WA 2NQBD 5GT0C 1TAFB 2F2AC 3MGSA 3LZ0C 3AZFC 1W2EA 4J8VD 2JSSA 2Y2PA 3KUYB 4QLCB 2HIOC 5BNXB 1HTAA 5B32A 5B2IB 5B0ZD 2W8SA 1PZRA 4J8UA 2AROD 3MVDB 1M19D 3AZIB 3AZJB 5AVBD 3KUYC 4CAYB 3AZGD 3AZMA 5B2IC 5CPKB 5GXQA 3C1CD 2Y2GA 1ID3D 5GSUA 1TZYB 3WTPB 3X1UA 1KX5B 3AZIC 4ZUXD 3AZJC 4KHAB 3B0BA 5B24A 3LZ1D 1S32B 1Q9CA 4YM6D 3KXBD 3LJAB 5F99B 3AYWD 5CPIA 1B6WA 1HQ3A 2F8NA 4H9SA 4NE6A 5BS7A 1TZYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 B;  3WTP C;  1P3I D;  1KX5 C;  1S32 C;  2NZD D;  3LJA C;  5F99 C;  1P3K D;  1KX4 B;  1P3G A;  4WU8 B;  4XUJ B;  1P3L B;  5JA4 B;  3MNN A;  3REJ A;  3TU4 B;  1P34 C;  1AOI C;  5CPJ A;  5JRG A;  3W99 D;  5BO0 A;  5GXQ D;  1B67 A;  3B6F B;  5E5A B;  3MGP B;  5GSU D;  5GT3 B;  3WKJ D;  4X23 A;  1KX4 C;  3W98 B;  4AWL B;  4WU8 C;  3REK A;  4XUJ C;  1P3L C;  1P3M A;  5B1M B;  4JJN B;  5B2J A;  4J8X A;  3C1B A;  2YFV B;  4R8P D;  1HQ3 D;  3KSY A;  3AZE B;  2F8N D;  3B6F C;  5KDM B;  1BH8 B;  5E5A C;  3B0C W;  5GT3 C;  4WU9 D;  3MGP C;  3W98 C;  4AWL C;  4DRA A;  5B1M C;  1JFI B;  5AV8 A;  4Z5T A;  5AV5 B;  3X1V A;  4JJN C;  2FJ7 B;  1N1J B;  4WNN B;  5DNM B;  3W97 D;  1P3A A;  3KWQ D;  3AZE C;  3LEL A;  3UTB C;  5B0Y B;  3WA9 B;  1P3B A;  5JRG D;  2IO5 B;  1M1A A;  1P3O D;  1U35 D;  1ULY A;  1EQZ B;  3X1T A;  1P3P B;  3MGR A;  5AV5 C;  4LD9 B;  2FJ7 C;  1H3O B;  3W96 A;  3AFA A;  5B0Y C;  3WA9 C;  3UT9 B;  4XZQ A;  1P3F A;  2IO5 C;  5AY8 A;  4J8X D;  1F66 A;  3AV2 A;  1EQZ C;  1P3P C;  3LZ0 D;  3WAA C;  1KX3 A;  4LD9 C;  2HIO D;  3UTA B;  4H9Q B;  4EO5 B;  3UT9 C;  3REH A;  3X1V D;  5B33 B;  3A6N B;  1ZLA B;  3VH5 A;  3REI B;  3VH5 T;  3KUY D;  4QLC D;  5B0Z A;  3UTA C;  5B2I D;  4EO5 C;  3AZN A;  5B33 C;  2ARO A;  5AVC B;  4NFT A;  3A6N C;  1M19 A;  5B1L A;  1ZLA C;  5AVB A;  3X1U C;  3REI C;  3NQU B;  5BNV B;  3MVD D;  3B0D B;  3AZG A;  3AZI D;  3AZJ D;  1R4V A;  3AV2 D;  3C1C A;  1ID3 A;  5CPK D;  1BH9 A;  3B6G A;  4H9S C;  2BYM B;  3MGQ B;  5BS7 C;  2F8N G;  5AVC C;  1TZY D;  4ZUX A;  3LZ1 A;  1KX5 D;  4YM6 A;  3B0D C;  5AV6 B;  1S32 D;  3REH D;  3KXB A;  3AYW A;  5AV9 B;  3LJA D;  3AZK B;  3MGQ C;  1P3I A;  3AV1 B;  5FUG B;  1P34 D;  5B31 D;  2NZD A;  4ZBJ B;  5AV6 C;  3AZN D;  1JFI A;  1P3K A;  3AZH B;  5AV9 C;  5B1L D;  4YS3 A;  1KX4 D;  5CP6 B;  4WU8 D;  4XUJ D;  3AZK C;  4CSR A;  1P3L D;  3W99 A;  3TU4 D;  3AV1 C;  3AZL B;  4ZBJ C;  4UUZ B;  4H9R B;  3R45 B;  5B40 B;  3B6G D;  1M18 B;  3B6F D;  3WKJ A;  5E5A D;  3AZH C;  5GT3 D;  1A7W A;  2PYO B;  4Z66 B;  5CP6 C;  3W98 D;  2CV5 B;  2BYK B;  1KU5 A;  4R8P A;  3AZL C;  4WU9 A;  5B40 C;  3V9R A;  3LEL C;  3AZE D;  1M18 C;  1AOI B;  2PYO C;  4Z66 C;  2CV5 C;  4KUD B;  3W97 A;  5AV5 D;  2NQB B;  2FJ7 D;  5DNM D;  3KWQ A;  4YS3 D;  1P34 B;  3REL B;  2RVQ C;  2YFW A;  5DNN B;  5B0Y D;  1U35 A;  1P3F C;  1P3O A;  3WA9 D;  4KGC B;  3X1S A;  3NQJ A;  4G92 B;  4J8V B;  1EQZ D;  5C3I B;  4KUD C;  1P3P D;  3O62 B;  4H9O A;  4LD9 D;  2NQB C;  4H9N B;  5GT0 A;  3REL C;  5DNN C;  3AN2 B;  3UT9 D;  5G49 B;  4KGC C;  3LZ0 A;  3AZF A;  4G92 C;  4J8V C;  3UTB B;  5C3I C;  3O62 C;  2HIO A;  5B0Z C;  1WWS A;  1TAF A;  5B31 G;  3AN2 C;  4J8W B;  2F8N H;  5B33 D;  3A6N D;  1ZLA D;  3REI D;  3KUY A;  4QLC A;  5BNX A;  3MGS B;  5B2I A;  3X1S D;  3WAA B;  4J8W C;  5B32 B;  5AVC D;  3MVD A;  3AZI A;  5GT0 D;  3AZJ A;  4CAY A;  5CHL B;  4E44 A;  3MGS C;  4J8U B;  5CPK A;  3AZF D;  3AZM B;  1TZY A;  5B32 C;  3MGQ D;  3WTP A;  1KX5 A;  5GXQ B;  4KHA A;  1S32 A;  5AV6 D;  5GSU B;  4J8U C;  3X1U B;  3LJA A;  5F99 A;  5B24 B;  1WWI A;  4NE5 A;  3AZM C;  1P34 A;  1AOI A;  3AZK D;  5B31 A;  5CPI B;  4E45 A;  3AV1 D;  5GXQ C;  2F8N B;  5GSU C;  3AZH D;  1KX4 A;  5B24 C;  4WU8 A;  4XUJ A;  1P3L A;  5JA4 A;  3TU4 A;  5CP6 D;  3VH5 W;  5CPI C;  1P3G B;  1HQ3 C;  3AZL D;  3VH6 A;  3MNN B;  3REJ B;  2L5A A;  3VH6 T;  3B6F A;  5E5A A;  3MGP A;  5GT3 A;  5CPJ B;  5JRG B;  2HUE B;  3WTP D;  3W98 A;  5BO0 B;  2PYO D;  5B1M A;  4Z66 D;  5BT1 C;  4JJN A;  4X23 B;  5F99 D;  2YFV A;  1P3G C;  3REK B;  1P3M B;  3MNN C;  3AZE A;  3REJ C;  5KDM A;  1BH8 A;  3UTB A;  5CPJ C;  5JRG C;  1AOI D;  2HUE C;  5B2J B;  4J8X B;  2RVQ D;  3C1B B;  4DRB A;  4KUD D;  5AV5 A;  2FJ7 A;  1N1J A;  4WNN A;  5DNM A;  4X23 C;  3REK C;  1P3M C;  5AV8 B;  4Z5T B;  5B0Y A;  3REL D;  3X1V B;  2F8N K;  3WA9 A;  5B2J C;  4J8X C;  5DNN D;  3C1B C;  1P3A B;  1EQZ A;  4KGC D;  1P3P A;  3LEL B;  3WAA A;  3MGP D;  4LD9 A;  1P3B B;  4WV4 B;  3O62 D;  1M1A B;  1H3O A;  3X1T B;  3MGR B;  5B1M D;  4H9P B;  5AV8 C;  4Z5T C;  3X1V C;  3WTP E;  3UT9 A;  4JJN D;  3AN2 D;  3AFA B;  1P3A C;  3W96 B;  4HGA B;  3UTB D;  4XZQ B;  4QLC C;  1P3B C;  5AY8 B;  1P3F B;  1M1A C;  4WZS B;  1F66 B;  3UTA A;  3AV2 B;  3X1T C;  4H9Q A;  3MGR C;  1KX3 B;  5B33 A;  4Z2M G;  3W96 C;  3AFA C;  3A6N A;  4J8W D;  4HGA C;  1ZLA A;  3MVD C;  3REI A;  4XZQ C;  3REH B;  5AY8 C;  2CWE A;  1F66 C;  3AV2 C;  3MGS D;  5CPK C;  4G91 B;  1KX3 C;  3WAA D;  5B0Z B;  5AVC A;  5B32 D;  3NQU A;  5BNV A;  3AZN B;  3REH C;  2ARO B;  1M19 B;  5B1L B;  4J8U D;  5AVB B;  4G91 C;  3AZG B;  3MGQ A;  2BYM A;  3AZM D;  5B31 C;  3UTA D;  3C1C B;  3B0C T;  1ID3 B;  3AZN C;  1BH9 B;  5AV6 A;  3B6G B;  2ARO C;  1M19 C;  4ZUX B;  5B1L C;  5AVB C;  4NE3 A;  5AV9 A;  3LZ1 B;  3X1U D;  4YM6 B;  3AZG C;  5B24 D;  3AZK A;  3TU4 C;  3KXB B;  3AYW B;  3AV1 A;  5FUG A;  3C1C C;  1ID3 C;  5CPI D;  3B6G C;  1P3I B;  4ZUX C;  3AZH A;  2NZD B;  3LZ1 C;  4YM6 C;  5CP6 A;  2LY8 A;  3KXB C;  5BT1 D;  3AYW C;  1P3K B;  3AZL A;  4YS3 B;  1P3G D;  4UUZ A;  4H9R A;  3R45 A;  4CSR B;  5B40 A;  3MNN D;  3REJ D;  1P3I C;  1M18 A;  3W99 B;  5CPJ D;  2NZD C;  2PYO A;  4Z66 A;  2CV5 A;  2BYK A;  4H9P A;  3WKJ B;  1P3K C;  1F1E A;  5DNM C;  5AV9 D;  4YS3 C;  4X23 D;  3REK D;  1P3M D;  3W99 C;  4R8P B;  1HQ3 B;  5B2J D;  3C1B D;  4WU9 B;  4KUD A;  3V9R B;  3WKJ C;  1BFM A;  2NQB A;  3REL A;  3W97 B;  5B32 G;  5DNN A;  5AV8 D;  4Z2M H;  4Z5T D;  4R8P C;  4KGC A;  3KWQ B;  1P3A D;  4WU9 C;  4J8V A;  5B40 D;  3O62 A;  3LEL D;  2YFW B;  1P3O B;  1M18 D;  1U35 B;  1P3B D;  1M1A D;  3X1S B;  3NQJ B;  4H9N A;  2CV5 D;  3X1T D;  3W97 C;  3MGR D;  3AN2 A;  4H9O B;  5G49 A;  3KWQ C;  5GT0 B;  3AFA D;  3W96 D;  4M6B A;  1P3O C;  1U35 C;  4XZQ D;  1P3F D;  5AY8 D;  3VH6 W;  3LZ0 B;  3X1S C;  3AZF B;  1F66 D;  1KX3 D;  2HIO B;  4J8W A;  2NQB D;  5GT0 C;  1TAF B;  3MGS A;  3LZ0 C;  3AZF C;  4J8V D;  2JSS A;  3KUY B;  4QLC B;  2HIO C;  5BNX B;  1HTA A;  5B32 A;  5B2I B;  5B0Z D;  4J8U A;  2ARO D;  3MVD B;  1M19 D;  3AZI B;  3AZJ B;  5AVB D;  3KUY C;  4CAY B;  3AZG D;  3AZM A;  5B2I C;  5CPK B;  5GXQ A;  3C1C D;  1ID3 D;  5GSU A;  1TZY B;  3WTP B;  3X1U A;  1KX5 B;  3AZI C;  4ZUX D;  3AZJ C;  4KHA B;  3B0B A;  5B24 A;  3LZ1 D;  1S32 B;  1Q9C A;  4YM6 D;  3KXB D;  3LJA B;  5F99 B;  3AYW D;  5CPI A;  1B6W A;  1HQ3 A;  2F8N A;  4H9S A;  4NE6 A;  5BS7 A;  1TZY C; 
#chains in the Genus database with same CATH topology
 5B31 B;  3WTP C;  2Y2Q A;  1P3I D;  1KX5 C;  1S32 C;  2NZD D;  3IP4 C;  3LJA C;  5F99 C;  1P3K D;  1KX4 B;  1P3G A;  4WU8 B;  4XUJ B;  1P3L B;  5JA4 B;  3MNN A;  3REJ A;  3TU4 B;  1P34 C;  1AOI C;  5CPJ A;  5JRG A;  3W99 D;  5BO0 A;  5GXQ D;  3A1I A;  1B67 A;  3B6F B;  3P5J B;  5E5A B;  3MGP B;  5GSU D;  5GT3 B;  3WKJ D;  4X23 A;  1KX4 C;  3W98 B;  4AWL B;  4WU8 C;  3REK A;  4XUJ C;  1P3L C;  1P3M A;  5B1M B;  4JJN B;  3FDD A;  5B2J A;  4J8X A;  3C1B A;  2YFV B;  4R8P D;  1HQ3 D;  3KSY A;  3AZE B;  2F8N D;  3B6F C;  5KDM B;  1BH8 B;  5E5A C;  3B0C W;  5GT3 C;  4WU9 D;  3MGP C;  3W98 C;  4AWL C;  4DRA A;  5B1M C;  1JFI B;  5AV8 A;  4Z5T A;  5AV5 B;  3X1V A;  4JJN C;  2FJ7 B;  1N1J B;  4WNN B;  5DNM B;  3W97 D;  1P3A A;  3KWQ D;  3AZE C;  3LEL A;  3UTB C;  5B0Y B;  3WA9 B;  1P3B A;  5JRG D;  2IO5 B;  1M1A A;  1P3O D;  1U35 D;  1ULY A;  1EQZ B;  2Y2H A;  3X1T A;  3MGR A;  1P3P B;  5AV5 C;  4LD9 B;  2FJ7 C;  1H3O B;  3W96 A;  3AFA A;  5B0Y C;  3EPK A;  3UT9 B;  3WA9 C;  4XZQ A;  1P3F A;  2IO5 C;  5AY8 A;  4J8X D;  1F66 A;  3AV2 A;  1EQZ C;  1P3P C;  3LZ0 D;  3WAA C;  1KX3 A;  4LD9 C;  2HIO D;  3UTA B;  4H9Q B;  4EO5 B;  2ZY4 A;  3UT9 C;  3REH A;  3X1V D;  3H0L C;  5B33 B;  3A6N B;  1ZLA B;  3VH5 A;  3REI B;  3VH5 T;  3KUY D;  4QLC D;  5B0Z A;  3UTA C;  5B2I D;  4EO5 C;  3AZN A;  5B33 C;  2ARO A;  5AVC B;  4NFT A;  3A6N C;  1M19 A;  5B1L A;  1ZLA C;  5AVB A;  3X1U C;  3REI C;  3NQU B;  4DQY B;  5BNV B;  3MVD D;  3B0D B;  3AZG A;  3AZI D;  3AZJ D;  1R4V A;  3AV2 D;  3C1C A;  2J8P A;  1ID3 A;  5CPK D;  1BH9 A;  3B6G A;  4H9S C;  2BYM B;  3MGQ B;  5BS7 C;  2F8N G;  5AVC C;  1TZY D;  4ZUX A;  3LZ1 A;  1KX5 D;  3B0D C;  4YM6 A;  5AV6 B;  1S32 D;  3REH D;  3KXB A;  3AYW A;  5AV9 B;  3LJA D;  3AZK B;  3MGQ C;  1P3I A;  3AV1 B;  5FUG B;  1P34 D;  5B31 D;  2NZD A;  4ZBJ B;  5AV6 C;  3AZN D;  1JFI A;  1P3K A;  3AZH B;  5AV9 C;  5B1L D;  4YS3 A;  2ZY2 A;  1KX4 D;  5CP6 B;  3EPL A;  4WU8 D;  4XUJ D;  3AZK C;  4CSR A;  1P3L D;  3W99 A;  3TU4 D;  3AV1 C;  3AZL B;  4ZBJ C;  4UUZ B;  4H9R B;  3R45 B;  5B40 B;  3B6G D;  1M18 B;  3B6F D;  3WKJ A;  5E5A D;  3AZH C;  5GT3 D;  1A7W A;  2PYO B;  4Z66 B;  5CP6 C;  3W98 D;  2CV5 B;  2BYK B;  1KU5 A;  4R8P A;  3AZL C;  3A1K A;  2ZY3 A;  4WU9 A;  5B40 C;  3V9R A;  3LEL C;  3AZE D;  1M18 C;  1AOI B;  2PYO C;  4Z66 C;  2CV5 C;  4KUD B;  3W97 A;  5AV5 D;  2NQB B;  2FJ7 D;  5DNM D;  3KWQ A;  4YS3 D;  1P34 B;  3REL B;  2RVQ C;  2YFW A;  5DNN B;  5B0Y D;  1U35 A;  1P3F C;  1P3O A;  3WA9 D;  4KGC B;  3X1S A;  2JCH A;  3NQJ A;  4G92 B;  4J8V B;  1EQZ D;  5C3I B;  4KUD C;  1P3P D;  3O62 B;  4H9O A;  4LD9 D;  2NQB C;  1T3U A;  2BG1 A;  4H9N B;  5GT0 A;  3REL C;  5DNN C;  3AN2 B;  3UT9 D;  5G49 B;  4KGC C;  3LZ0 A;  3AZF A;  4G92 C;  2Y2K A;  4J8V C;  5C3I C;  3UTB B;  3O62 C;  2XD1 A;  2HIO A;  1Z2C B;  5B0Z C;  1WWS A;  1TAF A;  5B31 G;  3AN2 C;  4J8W B;  2F8N H;  4UPK A;  5B33 D;  3A6N D;  1ZLA D;  3REI D;  3KUY A;  4QLC A;  5BNX A;  3MGS B;  5B2I A;  3X1S D;  3WAA B;  4J8W C;  5B32 B;  5AVC D;  3MVD A;  3AZI A;  5GT0 D;  3AZJ A;  4CAY A;  5CHL B;  4E44 A;  3MGS C;  4J8U B;  5CPK A;  3AZF D;  3AZM B;  1TZY A;  5B32 C;  3MGQ D;  3WTP A;  1KX5 A;  5GXQ B;  4KHA A;  1S32 A;  5AV6 D;  5GSU B;  2DF4 C;  4J8U C;  3X1U B;  3LJA A;  5F99 A;  2Y2N A;  5B24 B;  1WWI A;  2XD5 A;  4NE5 A;  3AZM C;  1P34 A;  1AOI A;  3AZK D;  5B31 A;  5CPI B;  4E45 A;  3AV1 D;  5GXQ C;  2F8N B;  5GSU C;  3AZH D;  1KX4 A;  2G5H C;  5B24 C;  4WU8 A;  4XUJ A;  1P3L A;  5JA4 A;  3TU4 A;  5CP6 D;  3VH5 W;  5CPI C;  1P3G B;  1HQ3 C;  3AZL D;  3VH6 A;  3MNN B;  3REJ B;  2L5A A;  3VH6 T;  2UWX A;  3B6F A;  5E5A A;  3MGP A;  5GT3 A;  5CPJ B;  5JRG B;  2HUE B;  3WTP D;  3W98 A;  5BO0 B;  2PYO D;  5B1M A;  4Z66 D;  5BT1 C;  4JJN A;  4X23 B;  5F99 D;  2YFV A;  1P3G C;  3REK B;  1P3M B;  3MNN C;  3AZE A;  3REJ C;  5KDM A;  1BH8 A;  3UTB A;  5CPJ C;  5JRG C;  1AOI D;  2HUE C;  5B2J B;  4J8X B;  2RVQ D;  3C1B B;  4DRB A;  4KUD D;  5AV5 A;  2FJ7 A;  1N1J A;  4WNN A;  5DNM A;  4X23 C;  3REK C;  1P3M C;  2RIQ A;  5AV8 B;  4Z5T B;  5B0Y A;  3REL D;  3X1V B;  2F8N K;  3WA9 A;  5B2J C;  4J8X C;  5DNN D;  3C1B C;  1P3A B;  1EQZ A;  4KGC D;  1P3P A;  2Y2M A;  3LEL B;  3WAA A;  3F6T A;  3MGP D;  4LD9 A;  1P3B B;  4WV4 B;  3O62 D;  3EPJ A;  1M1A B;  1H3O A;  3X1T B;  3MGR B;  5B1M D;  4H9P B;  5AV8 C;  4Z5T C;  3X1V C;  3WTP E;  3UT9 A;  4JJN D;  3AN2 D;  3AFA B;  1P3A C;  3W96 B;  4HGA B;  3UTB D;  4XZQ B;  4QLC C;  1P3B C;  5AY8 B;  1P3F B;  1M1A C;  4WZS B;  1F66 B;  3UTA A;  3AV2 B;  3X1T C;  4H9Q A;  3MGR C;  1KX3 B;  3EG5 B;  5B33 A;  4Z2M G;  3W96 C;  3AFA C;  3A6N A;  4J8W D;  4HGA C;  1ZLA A;  3MVD C;  3REI A;  4XZQ C;  3REH B;  5AY8 C;  2CWE A;  1F66 C;  3AV2 C;  3MGS D;  3KFU G;  5CPK C;  4G91 B;  2Y2O A;  1KX3 C;  3WAA D;  2DQN C;  5B0Z B;  5AVC A;  2G5I C;  5B32 D;  3NQU A;  5BNV A;  3AZN B;  3REH C;  2ARO B;  1M19 B;  5B1L B;  4J8U D;  5AVB B;  4G91 C;  2FFF B;  3AZG B;  3MGQ A;  2BYM A;  4WJ3 C;  3AZM D;  5B31 C;  3UTA D;  3C1C B;  3B0C T;  1ID3 B;  3AZN C;  1BH9 B;  5AV6 A;  3B6G B;  2ARO C;  1M19 C;  4ZUX B;  5B1L C;  5AVB C;  4NE3 A;  5AV9 A;  3LZ1 B;  3X1U D;  4YM6 B;  2Y2L A;  3AZG C;  5B24 D;  3AZK A;  3TU4 C;  3EPH A;  3KXB B;  3AYW B;  3AV1 A;  3H0M C;  5FUG A;  3C1C C;  1ID3 C;  5CPI D;  2ZM5 A;  2JE5 A;  3B6G C;  1P3I B;  4ZUX C;  3AZH A;  2NZD B;  3LZ1 C;  4YM6 C;  5CP6 A;  2LY8 A;  3KXB C;  5BT1 D;  3AYW C;  1P3K B;  3AZL A;  4YS3 B;  1P3G D;  4UUZ A;  4H9R A;  3R45 A;  4CSR B;  5B40 A;  3MNN D;  3REJ D;  1P3I C;  1M18 A;  3W99 B;  5CPJ D;  2NZD C;  2PYO A;  4Z66 A;  2CV5 A;  2BYK A;  4H9P A;  3WKJ B;  1P3K C;  1F1E A;  5DNM C;  5AV9 D;  4YS3 C;  4X23 D;  3REK D;  1P3M D;  3W99 C;  4R8P B;  1HQ3 B;  5B2J D;  3C1B D;  4WU9 B;  4KUD A;  3V9R B;  2Y2J A;  3WKJ C;  1BFM A;  2NQB A;  2ZY5 A;  3REL A;  3W97 B;  5B32 G;  5DNN A;  5AV8 D;  4Z2M H;  4Z5T D;  3H0R C;  4R8P C;  4KGC A;  3KWQ B;  1P3A D;  4WU9 C;  4J8V A;  5B40 D;  3O62 A;  3LEL D;  2YFW B;  1P3O B;  1M18 D;  1U35 B;  2VQR A;  1P3B D;  1M1A D;  3X1S B;  3NQJ B;  4H9N A;  2CV5 D;  3X1T D;  3W97 C;  3MGR D;  3AN2 A;  4H9O B;  5G49 A;  3KWQ C;  3AL0 C;  5GT0 B;  3AFA D;  3W96 D;  4M6B A;  1P3O C;  1U35 C;  4XZQ D;  1P3F D;  5AY8 D;  3VH6 W;  3LZ0 B;  3X1S C;  3AZF B;  1F66 D;  1KX3 D;  2HIO B;  2Y2I A;  4J8W A;  2NQB D;  5GT0 C;  1TAF B;  2F2A C;  3MGS A;  3LZ0 C;  3AZF C;  1W2E A;  4J8V D;  2JSS A;  2Y2P A;  3KUY B;  4QLC B;  2HIO C;  5BNX B;  1HTA A;  5B32 A;  5B2I B;  5B0Z D;  2W8S A;  1PZR A;  4J8U A;  2ARO D;  3MVD B;  1M19 D;  3AZI B;  3AZJ B;  5AVB D;  3KUY C;  4CAY B;  3AZG D;  3AZM A;  5B2I C;  5CPK B;  5GXQ A;  3C1C D;  2Y2G A;  1ID3 D;  5GSU A;  1TZY B;  3WTP B;  3X1U A;  1KX5 B;  3AZI C;  4ZUX D;  3AZJ C;  4KHA B;  3B0B A;  5B24 A;  3LZ1 D;  1S32 B;  1Q9C A;  4YM6 D;  3KXB D;  3LJA B;  5F99 B;  3AYW D;  5CPI A;  1B6W A;  1HQ3 A;  2F8N A;  4H9S A;  4NE6 A;  5BS7 A;  1TZY C; 
#chains in the Genus database with same CATH homology
 5B31 B;  3WTP C;  2Y2Q A;  1P3I D;  1KX5 C;  1S32 C;  2NZD D;  3IP4 C;  3LJA C;  5F99 C;  1P3K D;  1KX4 B;  1P3G A;  4WU8 B;  4XUJ B;  1P3L B;  5JA4 B;  3MNN A;  3REJ A;  3TU4 B;  1P34 C;  1AOI C;  5CPJ A;  5JRG A;  3W99 D;  5BO0 A;  5GXQ D;  3A1I A;  1B67 A;  3B6F B;  3P5J B;  5E5A B;  3MGP B;  5GSU D;  5GT3 B;  3WKJ D;  4X23 A;  1KX4 C;  3W98 B;  4AWL B;  4WU8 C;  3REK A;  4XUJ C;  1P3L C;  1P3M A;  5B1M B;  4JJN B;  3FDD A;  5B2J A;  4J8X A;  3C1B A;  2YFV B;  4R8P D;  1HQ3 D;  3KSY A;  3AZE B;  2F8N D;  3B6F C;  5KDM B;  1BH8 B;  5E5A C;  3B0C W;  5GT3 C;  4WU9 D;  3MGP C;  3W98 C;  4AWL C;  4DRA A;  5B1M C;  1JFI B;  5AV8 A;  4Z5T A;  5AV5 B;  3X1V A;  4JJN C;  2FJ7 B;  1N1J B;  4WNN B;  5DNM B;  3W97 D;  1P3A A;  3KWQ D;  3AZE C;  3LEL A;  3UTB C;  5B0Y B;  3WA9 B;  1P3B A;  5JRG D;  2IO5 B;  1M1A A;  1P3O D;  1U35 D;  1ULY A;  1EQZ B;  2Y2H A;  3X1T A;  3MGR A;  1P3P B;  5AV5 C;  4LD9 B;  2FJ7 C;  1H3O B;  3W96 A;  3AFA A;  5B0Y C;  3EPK A;  3UT9 B;  3WA9 C;  4XZQ A;  1P3F A;  2IO5 C;  5AY8 A;  4J8X D;  1F66 A;  3AV2 A;  1EQZ C;  1P3P C;  3LZ0 D;  3WAA C;  1KX3 A;  4LD9 C;  2HIO D;  3UTA B;  4H9Q B;  4EO5 B;  2ZY4 A;  3UT9 C;  3REH A;  3X1V D;  3H0L C;  5B33 B;  3A6N B;  1ZLA B;  3VH5 A;  3REI B;  3VH5 T;  3KUY D;  4QLC D;  5B0Z A;  3UTA C;  5B2I D;  4EO5 C;  3AZN A;  5B33 C;  2ARO A;  5AVC B;  4NFT A;  3A6N C;  1M19 A;  5B1L A;  1ZLA C;  5AVB A;  3X1U C;  3REI C;  3NQU B;  4DQY B;  5BNV B;  3MVD D;  3B0D B;  3AZG A;  3AZI D;  3AZJ D;  1R4V A;  3AV2 D;  3C1C A;  2J8P A;  1ID3 A;  5CPK D;  1BH9 A;  3B6G A;  4H9S C;  2BYM B;  3MGQ B;  5BS7 C;  2F8N G;  5AVC C;  1TZY D;  4ZUX A;  3LZ1 A;  1KX5 D;  3B0D C;  4YM6 A;  5AV6 B;  1S32 D;  3REH D;  3KXB A;  3AYW A;  5AV9 B;  3LJA D;  3AZK B;  3MGQ C;  1P3I A;  3AV1 B;  5FUG B;  1P34 D;  5B31 D;  2NZD A;  4ZBJ B;  5AV6 C;  3AZN D;  1JFI A;  1P3K A;  3AZH B;  5AV9 C;  5B1L D;  4YS3 A;  2ZY2 A;  1KX4 D;  5CP6 B;  3EPL A;  4WU8 D;  4XUJ D;  3AZK C;  4CSR A;  1P3L D;  3W99 A;  3TU4 D;  3AV1 C;  3AZL B;  4ZBJ C;  4UUZ B;  4H9R B;  3R45 B;  5B40 B;  3B6G D;  1M18 B;  3B6F D;  3WKJ A;  5E5A D;  3AZH C;  5GT3 D;  1A7W A;  2PYO B;  4Z66 B;  5CP6 C;  3W98 D;  2CV5 B;  2BYK B;  1KU5 A;  4R8P A;  3AZL C;  3A1K A;  2ZY3 A;  4WU9 A;  5B40 C;  3V9R A;  3LEL C;  3AZE D;  1M18 C;  1AOI B;  2PYO C;  4Z66 C;  2CV5 C;  4KUD B;  3W97 A;  5AV5 D;  2NQB B;  2FJ7 D;  5DNM D;  3KWQ A;  4YS3 D;  1P34 B;  3REL B;  2RVQ C;  2YFW A;  5DNN B;  5B0Y D;  1U35 A;  1P3F C;  1P3O A;  3WA9 D;  4KGC B;  3X1S A;  2JCH A;  3NQJ A;  4G92 B;  4J8V B;  1EQZ D;  5C3I B;  4KUD C;  1P3P D;  3O62 B;  4H9O A;  4LD9 D;  2NQB C;  1T3U A;  2BG1 A;  4H9N B;  5GT0 A;  3REL C;  5DNN C;  3AN2 B;  3UT9 D;  5G49 B;  4KGC C;  3LZ0 A;  3AZF A;  4G92 C;  2Y2K A;  4J8V C;  5C3I C;  3UTB B;  3O62 C;  2XD1 A;  2HIO A;  1Z2C B;  5B0Z C;  1WWS A;  1TAF A;  5B31 G;  3AN2 C;  4J8W B;  2F8N H;  4UPK A;  5B33 D;  3A6N D;  1ZLA D;  3REI D;  3KUY A;  4QLC A;  5BNX A;  3MGS B;  5B2I A;  3X1S D;  3WAA B;  4J8W C;  5B32 B;  5AVC D;  3MVD A;  3AZI A;  5GT0 D;  3AZJ A;  4CAY A;  5CHL B;  4E44 A;  3MGS C;  4J8U B;  5CPK A;  3AZF D;  3AZM B;  1TZY A;  5B32 C;  3MGQ D;  3WTP A;  1KX5 A;  5GXQ B;  4KHA A;  1S32 A;  5AV6 D;  5GSU B;  2DF4 C;  4J8U C;  3X1U B;  3LJA A;  5F99 A;  2Y2N A;  5B24 B;  1WWI A;  2XD5 A;  4NE5 A;  3AZM C;  1P34 A;  1AOI A;  3AZK D;  5B31 A;  5CPI B;  4E45 A;  3AV1 D;  5GXQ C;  2F8N B;  5GSU C;  3AZH D;  1KX4 A;  2G5H C;  5B24 C;  4WU8 A;  4XUJ A;  1P3L A;  5JA4 A;  3TU4 A;  5CP6 D;  3VH5 W;  5CPI C;  1P3G B;  1HQ3 C;  3AZL D;  3VH6 A;  3MNN B;  3REJ B;  2L5A A;  3VH6 T;  2UWX A;  3B6F A;  5E5A A;  3MGP A;  5GT3 A;  5CPJ B;  5JRG B;  2HUE B;  3WTP D;  3W98 A;  5BO0 B;  2PYO D;  5B1M A;  4Z66 D;  5BT1 C;  4JJN A;  4X23 B;  5F99 D;  2YFV A;  1P3G C;  3REK B;  1P3M B;  3MNN C;  3AZE A;  3REJ C;  5KDM A;  1BH8 A;  3UTB A;  5CPJ C;  5JRG C;  1AOI D;  2HUE C;  5B2J B;  4J8X B;  2RVQ D;  3C1B B;  4DRB A;  4KUD D;  5AV5 A;  2FJ7 A;  1N1J A;  4WNN A;  5DNM A;  4X23 C;  3REK C;  1P3M C;  2RIQ A;  5AV8 B;  4Z5T B;  5B0Y A;  3REL D;  3X1V B;  2F8N K;  3WA9 A;  5B2J C;  4J8X C;  5DNN D;  3C1B C;  1P3A B;  1EQZ A;  4KGC D;  1P3P A;  2Y2M A;  3LEL B;  3WAA A;  3F6T A;  3MGP D;  4LD9 A;  1P3B B;  4WV4 B;  3O62 D;  3EPJ A;  1M1A B;  1H3O A;  3X1T B;  3MGR B;  5B1M D;  4H9P B;  5AV8 C;  4Z5T C;  3X1V C;  3WTP E;  3UT9 A;  4JJN D;  3AN2 D;  3AFA B;  1P3A C;  3W96 B;  4HGA B;  3UTB D;  4XZQ B;  4QLC C;  1P3B C;  5AY8 B;  1P3F B;  1M1A C;  4WZS B;  1F66 B;  3UTA A;  3AV2 B;  3X1T C;  4H9Q A;  3MGR C;  1KX3 B;  3EG5 B;  5B33 A;  4Z2M G;  3W96 C;  3AFA C;  3A6N A;  4J8W D;  4HGA C;  1ZLA A;  3MVD C;  3REI A;  4XZQ C;  3REH B;  5AY8 C;  2CWE A;  1F66 C;  3AV2 C;  3MGS D;  3KFU G;  5CPK C;  4G91 B;  2Y2O A;  1KX3 C;  3WAA D;  2DQN C;  5B0Z B;  5AVC A;  2G5I C;  5B32 D;  3NQU A;  5BNV A;  3AZN B;  3REH C;  2ARO B;  1M19 B;  5B1L B;  4J8U D;  5AVB B;  4G91 C;  2FFF B;  3AZG B;  3MGQ A;  2BYM A;  4WJ3 C;  3AZM D;  5B31 C;  3UTA D;  3C1C B;  3B0C T;  1ID3 B;  3AZN C;  1BH9 B;  5AV6 A;  3B6G B;  2ARO C;  1M19 C;  4ZUX B;  5B1L C;  5AVB C;  4NE3 A;  5AV9 A;  3LZ1 B;  3X1U D;  4YM6 B;  2Y2L A;  3AZG C;  5B24 D;  3AZK A;  3TU4 C;  3EPH A;  3KXB B;  3AYW B;  3AV1 A;  3H0M C;  5FUG A;  3C1C C;  1ID3 C;  5CPI D;  2ZM5 A;  2JE5 A;  3B6G C;  1P3I B;  4ZUX C;  3AZH A;  2NZD B;  3LZ1 C;  4YM6 C;  5CP6 A;  2LY8 A;  3KXB C;  5BT1 D;  3AYW C;  1P3K B;  3AZL A;  4YS3 B;  1P3G D;  4UUZ A;  4H9R A;  3R45 A;  4CSR B;  5B40 A;  3MNN D;  3REJ D;  1P3I C;  1M18 A;  3W99 B;  5CPJ D;  2NZD C;  2PYO A;  4Z66 A;  2CV5 A;  2BYK A;  4H9P A;  3WKJ B;  1P3K C;  1F1E A;  5DNM C;  5AV9 D;  4YS3 C;  4X23 D;  3REK D;  1P3M D;  3W99 C;  4R8P B;  1HQ3 B;  5B2J D;  3C1B D;  4WU9 B;  4KUD A;  3V9R B;  2Y2J A;  3WKJ C;  1BFM A;  2NQB A;  2ZY5 A;  3REL A;  3W97 B;  5B32 G;  5DNN A;  5AV8 D;  4Z2M H;  4Z5T D;  3H0R C;  4R8P C;  4KGC A;  3KWQ B;  1P3A D;  4WU9 C;  4J8V A;  5B40 D;  3O62 A;  3LEL D;  2YFW B;  1P3O B;  1M18 D;  1U35 B;  2VQR A;  1P3B D;  1M1A D;  3X1S B;  3NQJ B;  4H9N A;  2CV5 D;  3X1T D;  3W97 C;  3MGR D;  3AN2 A;  4H9O B;  5G49 A;  3KWQ C;  3AL0 C;  5GT0 B;  3AFA D;  3W96 D;  4M6B A;  1P3O C;  1U35 C;  4XZQ D;  1P3F D;  5AY8 D;  3VH6 W;  3LZ0 B;  3X1S C;  3AZF B;  1F66 D;  1KX3 D;  2HIO B;  2Y2I A;  4J8W A;  2NQB D;  5GT0 C;  1TAF B;  2F2A C;  3MGS A;  3LZ0 C;  3AZF C;  1W2E A;  4J8V D;  2JSS A;  2Y2P A;  3KUY B;  4QLC B;  2HIO C;  5BNX B;  1HTA A;  5B32 A;  5B2I B;  5B0Z D;  2W8S A;  1PZR A;  4J8U A;  2ARO D;  3MVD B;  1M19 D;  3AZI B;  3AZJ B;  5AVB D;  3KUY C;  4CAY B;  3AZG D;  3AZM A;  5B2I C;  5CPK B;  5GXQ A;  3C1C D;  2Y2G A;  1ID3 D;  5GSU A;  1TZY B;  3WTP B;  3X1U A;  1KX5 B;  3AZI C;  4ZUX D;  3AZJ C;  4KHA B;  3B0B A;  5B24 A;  3LZ1 D;  1S32 B;  1Q9C A;  4YM6 D;  3KXB D;  3LJA B;  5F99 B;  3AYW D;  5CPI A;  1B6W A;  1HQ3 A;  2F8N A;  4H9S A;  4NE6 A;  5BS7 A;  1TZY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...