5B2IC

Human nucleosome containing cpg unmethylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Histone H3.1
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iC00
3MGPB 4H9RA 3LJAC 5AVBB 5AY8B 3X1UD 1KX4B 1U35A 4JJNC 5B1MD 3AZNA 3AN2A 4WU8B 2CV5C 3UT9C 3MGSB 5GXQD 3WKJC 4XUJC 5B31G 4JJNB 1P3PD 3W98C 3VH6W 3MGSC 4H9OA 4H9QA 1TZYA 4KUDC 5C3IB 5FUGB 2AROD 5AV5D 3UTAA 1ZLAB 4G91B 5B2ID 2RVQD 4KGCB 4LD9B 5F99D 2F8NG 1P3AD 2IO5B 1S32A 1EQZC 1P3IB 1ZLAC 5CPIC 3KXBB 1JFIB 5B0YA 3REKA 5AV5A 1ULYA 5AV9B 3TU4D 5GT3B 3AZHC 1M1AC 1HQ3D 3AZMB 2F8NA 3AZID 1P3FD 1M18A 3KWQD 5DNNC 3MNNC 1P3MB 3B6FD 4Z66D 4DRAA 5AVCD 3AZNC 3AN2C 5B24A 5B0YD 3LELD 1WWIA 5JRGA 4X23D 2HIOC 3WKJA 3MVDA 4R8PC 1EQZB 4QLCC 4J8WB 3AYWB 2YFWB 3WAAD 3X1SB 5GT0C 4ZBJC 4J8XB 4J8WC 3AYWC 1P3LB 5JRGD 4X23A 4UUZA 1AOIA 1TAFB 3MVDD 5BNXB 3W96C 4WU9D 4G92B 3MNNB 4YM6B 1P3MC 3AZFB 4YS3A 5GXQA 3A6NB 3WA9B 3WTPB 2HIOB 5E5AC 5CPJA 3W96B 2BYMA 4G92C 3O62B 3B0DB 5B0ZB 3RELB 4CAYA 3KSYA 3NQUA 5B1LD 1P3BA 3W97D 1S32D 4XZQB 3AV1D 3X1TA 1B67A 4R8PA 4WV4B 1P3OB 3AFAC 1TZYC 1N1JA 3REID 3AZLD 5B40B 2CV5B 5CPIB 3AZJA 3W97A 5B2JB 4CSRB 3W98B 3AV2C 3VH5W 4KUDB 3AZEA 3KWQA 5C3IC 3AZMC 1P3PA 4Z66A 3UT9D 3C1BA 1ID3A 3KUYD 3WKJD 5B31B 4XUJD 3R45B 3KXBC 3W99A 1KX5A 5AV8C 1F1EA 2RVQC 3MGPC 5F99C 1P3AC 1ID3D 5G49A 3TU4A 5CPKB 1F66B 5JA4B 3REHB 1KX4D 4WU8D 1M18D 1P3KA 3AZJC 3LZ0A 3WTPC 5DNND 4Z5TC 2IO5C 5B1LA 5B1MA 5CP6D 2AROB 5AVCC 3AZND 3AN2D 1P3BD 1KX4A 3AZKB 2F8NH 4X23C 5DNMC 1P3AB 4R8PD 3LJAA 1KX3D 1Q9CA 3AZLA 4ZUXB 3B6GA 3B0CT 3LZ0D 4H9OB 5AV8A 1TZYB 5CP6A 1H3OB 4H9NA 3AZGD 5AV6B 5GT3D 1P34A 5JRGC 4YS3D 5BNVB 4NFTA 3AZED 5CPJD 4EO5B 1KX3A 3NQJA 3UT9A 1P3MD 3B6GD 3REKD 5AVCB 5B33B 4QLCB 4XUJA 2PYOD 3LELB 1B6WA 2BYKA 1HQ3A 2F8ND 3X1TD 3REJD 1P3FA 2LY8A 3MGQC 3B6FA 1S32C 5DNMA 4WZSB 2NZDB 5AV6C 5JRGB 3X1VC 3MGQB 4M6BA 4H9PB 1KX5C 3WAAA 5B24C 4WU8A 1F66C 3A6ND 5B33C 3VH5T 3LZ1D 3WA9D 4JJNA 1AOID 4J8VB 1U35C 3VH5A 4WNNA 5B0ZD 3UTAB 4WU9A 3KUYC 3AFAB 1M19B 1S32B 3AV1B 3UTAC 5BO0A 1P3OD 3X1UC 1BH9B 3UTBD 5AV8D 2NQBB 2CV5D 4ZUXC 3MGPD 5BS7C 3AZGA 1P34D 3RELA 5AVBD 4CAYB 3MGRA 1ID3C 2FJ7B 5B32B 5AY8D 4E45A 3X1UB 1P3KD 5E5AA 3AZMA 1P3PC 3W98D 3MGSD 4KUDD 4Z5TB 5AV5C 5KDMA 4YM6C 5B2IC 5DNNA 5B40A 3AZJD 3MGPA 5GT0B 4KHAA 3O62C 1M19C 4NE3A 1ZLAD 5BT1D 5B2IB 1P3LC 5F99B 5CP6C 4HGAB 2NQBC 1P3ID 5DNMD 3KUYA 1P3LA 5B32C 4EO5C 5GT3A 3W99D 1P3FC 3C1BC 3AZGC 3A6NA 3AZIB 5GT3C 3WA9A 1P3IA 1P3MA 2F8NK 4NE6A 1P3GA 4YS3C 1M1AA 4DRBA 3W96A 2HUEC 1BH8A 3WAAC 5B0YB 1HTAA 3B6GC 4J8VC 1U35B 3AZNB 3AN2B 5JA4A 3REHA 3WTPE 2PYOC 5B32G 5GSUB 3C1CB 4J8WD 4J8UC 3AZKD 3AYWD 4XZQA 4Z2MH 3X1SD 3X1VB 1P3GD 1P3OA 3X1TC 4J8XD 5B24B 3LZ0B 3MVDB 5AVBA 3MGRD 5B1MB 5AV6D 5E5AD 3LJAD 3AZFA 3X1SA 5GXQB 4YS3B 3LZ1A 4KUDA 3AZEB 3WTPA 5CPJB 4JJND 3C1CC 4KGCC 4LD9C 1JFIA 3B6GB 5B33D 4UUZB 3A6NC 3WA9C 2JSSA 3AV2A 1AOIC 5AV6A 3AZLC 2AROC 5AV9C 2HIOA 3REHC 3KXBA 4E44A 4J8UA 3REIA 3REIB 3V9RA 2BYMB 3AZHB 3O62A 2PYOA 4QLCA 5CPID 3AV2D 3REJA 1F66A 4CSRA 3UTBC 2YFWA 3AZMD 3MGSA 3W98A 1P34C 5AVBC 4Z66B 1WWSA 1M1AD 1P3KC 4X23B 4H9QB 3KWQC 3WKJB 1ZLAA 3MGQA 3B6FC 1EQZA 5B0YC 3WAAB 3AZKA 5B2JA 2L5AA 4AWLB 5BS7A 1M19D 1P3LD 4J8XA 2YFVA 3C1BB 1ID3B 1KX4C 5B0ZA 4J8VA 5AV9A 5AV8B 1P3IC 2NQBD 1M18C 3NQUB 5CPKD 4WU9B 4H9NB 1P34B 2FJ7D 4H9SA 5B32D 3AZFD 1P3KB 1KX5B 4YM6A 1M18B 3WTPD 3W96D 4Z5TD 5BO0B 3UTBA 1BFMA 2CV5A 5B33A 4H9RB 3RELD 3AZJB 5AY8A 3W97B 1P3BB 4J8WA 3AYWA 4XZQD 2NZDC 5B1LC 4R8PB 3AZKC 4J8UD 5B40D 1N1JB 5B2JC 5DNMB 2NZDA 5B31A 5CPIA 1P3GC 5FUGA 1TZYD 3AZEC 5BNXA 4KGCA 4LD9A 5B2IA 3MNNA 3MGRC 3NQJB 3UT9B 1P3PB 4H9SC 5G49B 5B31D 3REKB 5AV5B 3REJC 4NE5A 1H3OA 4KGCD 4LD9D 1KU5A 2F8NB 3B0DC 3X1TB 4G91C 5GSUD 3AFAA 3C1CD 1M19A 3VH6T 3KXBD 3X1VD 4AWLC 5B1MC 5AVCA 5AV9D 3TU4B 5B24D 1BH8B 4H9PA 1F66D 5CPKA 3REHD 5GXQC 3MGRB 1HQ3B 5E5AB 1P3FB 3LJAB 3KWQB 3B6FB 4ZUXA 5B0ZC 4WU8C 2CWEA 1AOIB 5DNNB 1TAFA 5CP6B 4HGAC 1EQZD 2HUEB 2AROA 3UTAD 1P3OC 1P3BC 1KX3B 4ZUXD 3TU4C 2NQBA 5AY8C 3AZHD 1HQ3C 1KX3C 3AZIC 4WNNB 3AZGB 2FJ7A 3AV2B 3LZ0C 3MNND 4YM6D 4Z66C 5BNVA 3LELC 5CPKC 2HIOD 3AZIA 2FJ7C 5KDMB 3AZFC 3O62D 1M1AB 4QLCD 3AZHA 5CPJC 3V9RB 5BT1C 2PYOB 4KHAB 3LELA 5B1LB 5GT0D 3REKC 3REJB 5F99A 3RELC 1P3AA 4Z2MG 3MVDC 3AZLB 4XZQC 2NZDD 3W99C 4WU9C 3VH6A 3MGQD 3C1BD 5GT0A 5B40C 3R45A 5B2JD 3W99B 1R4VA 1A7WA 1KX5D 3LZ1B 4J8UB 3KUYB 4J8VD 1BH9A 2YFVB 5CHLB 4XUJB 3W97C 3B0CW 3LZ1C 2BYKB 3AV1C 3X1SC 3B0BA 4ZBJB 5B32A 5B31C 3X1UA 1U35D 5GSUA 3AFAD 3C1CA 3REIC 4J8XC 3X1VA 4Z5TA 3AV1A 1P3GB 3UTBB 5GSUC
chains in the Genus database with same CATH superfamily
3MGPB 4H9RA 3LJAC 5AVBB 3EPKA 5AY8B 3X1UD 1KX4B 1U35A 4JJNC 2Y2QA 5B1MD 3AZNA 4WU8B 3AN2A 3UT9C 3MGSB 2CV5C 2Y2NA 3A1IA 5GXQD 3WKJC 4XUJC 5B31G 2Y2IA 4JJNB 1P3PD 3W98C 3VH6W 3MGSC 4H9OA 4H9QA 1TZYA 4KUDC 5C3IB 5FUGB 2AROD 5AV5D 3UTAA 1ZLAB 4G91B 5B2ID 2RVQD 4KGCB 4LD9B 5F99D 2F8NG 2Y2JA 1P3AD 2IO5B 1S32A 1EQZC 1P3IB 1ZLAC 5CPIC 3KXBB 1JFIB 5B0YA 3FDDA 3REKA 5AV5A 1ULYA 5AV9B 3TU4D 5GT3B 3AZHC 1M1AC 1HQ3D 3AZMB 2F8NA 3AZID 1P3FD 1M18A 3KWQD 5DNNC 3MNNC 1P3MB 3B6FD 4Z66D 4DRAA 5AVCD 3AZNC 3AN2C 5B24A 5B0YD 3LELD 1WWIA 5JRGA 4X23D 2HIOC 3WKJA 3MVDA 4R8PC 1EQZB 4QLCC 4J8WB 3AYWB 2YFWB 3WAAD 3X1SB 5GT0C 4ZBJC 3H0RC 4J8XB 3EPJA 4J8WC 3AYWC 1P3LB 5JRGD 4X23A 4UUZA 1AOIA 1TAFB 3MVDD 5BNXB 3W96C 4WU9D 2UWXA 4G92B 3MNNB 4YM6B 1P3MC 3AZFB 4YS3A 5GXQA 3A6NB 3WA9B 3WTPB 2HIOB 5E5AC 5CPJA 3W96B 2BYMA 4G92C 3O62B 3B0DB 5B0ZB 3RELB 4CAYA 3KSYA 3NQUA 5B1LD 1P3BA 3W97D 1S32D 4XZQB 3AV1D 3X1TA 1B67A 2Y2GA 4R8PA 4WV4B 1P3OB 3AFAC 1TZYC 1N1JA 3REID 3AZLD 2Y2OA 5B40B 2CV5B 5CPIB 3AZJA 2Y2MA 3W97A 5B2JB 4CSRB 3W98B 3AV2C 3VH5W 4KUDB 3AZEA 3KWQA 5C3IC 3AZMC 1P3PA 4Z66A 3AL0C 3UT9D 3C1BA 1ID3A 3KUYD 3WKJD 2FFFB 5B31B 4XUJD 4WJ3C 3R45B 3KXBC 3W99A 1KX5A 5AV8C 1F1EA 2RVQC 3MGPC 5F99C 1PZRA 1P3AC 1ID3D 5G49A 3TU4A 2Y2LA 5CPKB 1F66B 5JA4B 3REHB 1KX4D 4WU8D 1M18D 1P3KA 4UPKA 3AZJC 3LZ0A 3WTPC 5DNND 4Z5TC 2IO5C 5B1LA 5B1MA 5CP6D 2AROB 5AVCC 3AZND 3AN2D 1P3BD 1KX4A 3AZKB 2F8NH 2J8PA 4X23C 5DNMC 1P3AB 4R8PD 3LJAA 1KX3D 1Q9CA 3AZLA 4ZUXB 3B6GA 3B0CT 3LZ0D 4H9OB 5AV8A 1TZYB 5CP6A 1H3OB 4H9NA 3AZGD 5AV6B 5GT3D 1P34A 5JRGC 4YS3D 5BNVB 4NFTA 3AZED 5CPJD 4EO5B 3EG5B 1KX3A 3NQJA 3UT9A 1P3MD 3B6GD 3REKD 5AVCB 5B33B 4QLCB 4XUJA 2PYOD 3LELB 2VQRA 1B6WA 2BYKA 1HQ3A 2F8ND 3X1TD 3REJD 1P3FA 2LY8A 2DF4C 3MGQC 1T3UA 3B6FA 1S32C 5DNMA 4WZSB 2NZDB 5AV6C 5JRGB 3X1VC 3MGQB 4M6BA 4H9PB 1Z2CB 1KX5C 3WAAA 5B24C 4WU8A 2JE5A 1F66C 3A6ND 5B33C 3VH5T 3LZ1D 3WA9D 4JJNA 1AOID 4J8VB 1U35C 3VH5A 2F2AC 4WNNA 5B0ZD 3UTAB 4WU9A 3KUYC 3H0MC 3AFAB 1M19B 1S32B 3AV1B 3UTAC 5BO0A 3KFUG 1P3OD 3X1UC 1BH9B 3UTBD 5AV8D 2NQBB 2CV5D 4ZUXC 3MGPD 5BS7C 3AZGA 1P34D 3RELA 5AVBD 4CAYB 3MGRA 1ID3C 2FJ7B 5B32B 3X1UB 5AY8D 4E45A 1P3KD 5E5AA 3AZMA 1P3PC 3W98D 3MGSD 4KUDD 4Z5TB 5AV5C 5KDMA 4YM6C 3EPLA 5B2IC 5DNNA 5B40A 3AZJD 3MGPA 5GT0B 4KHAA 3O62C 1M19C 4NE3A 1ZLAD 5BT1D 5B2IB 1P3LC 5F99B 2DQNC 5CP6C 4HGAB 2NQBC 1P3ID 2Y2HA 5DNMD 3KUYA 1P3LA 5B32C 4EO5C 5GT3A 3W99D 1P3FC 3C1BC 3AZGC 3A6NA 3AZIB 5GT3C 3WA9A 2JCHA 1P3IA 1P3MA 4NE6A 1P3GA 4YS3C 2F8NK 1M1AA 4DRBA 3W96A 2HUEC 1BH8A 3WAAC 5B0YB 2XD5A 1HTAA 3B6GC 4J8VC 1U35B 3AZNB 3AN2B 5JA4A 3REHA 3WTPE 2PYOC 5B32G 5GSUB 3C1CB 4J8WD 4J8UC 3AZKD 3AYWD 4XZQA 4Z2MH 3X1SD 3X1VB 1P3GD 1P3OA 3X1TC 4J8XD 5B24B 2ZY2A 3LZ0B 3MVDB 5AVBA 3MGRD 5B1MB 5AV6D 2ZY5A 5E5AD 2Y2KA 3LJAD 3AZFA 3X1SA 5GXQB 4YS3B 3LZ1A 4KUDA 3AZEB 3WTPA 5CPJB 4JJND 1W2EA 3C1CC 4KGCC 4LD9C 1JFIA 2G5HC 3B6GB 5B33D 2XD1A 4UUZB 3A6NC 3WA9C 2JSSA 3H0LC 3AV2A 1AOIC 2ZY3A 5AV6A 3AZLC 2AROC 5AV9C 2HIOA 3REHC 3KXBA 4E44A 2G5IC 4J8UA 3REIA 3V9RA 2BYMB 3REIB 3O62A 3AZHB 2PYOA 4QLCA 5CPID 3AV2D 3REJA 1F66A 4CSRA 3UTBC 2YFWA 3AZMD 3MGSA 3W98A 2ZM5A 1P34C 5AVBC 4Z66B 1WWSA 1M1AD 1P3KC 4X23B 4H9QB 3KWQC 3WKJB 1ZLAA 3MGQA 3B6FC 4DQYB 1EQZA 5B0YC 3WAAB 3AZKA 5B2JA 2L5AA 4AWLB 5BS7A 1M19D 1P3LD 2W8SA 2ZY4A 4J8XA 2YFVA 3A1KA 3C1BB 1ID3B 1KX4C 5B0ZA 4J8VA 5AV9A 5AV8B 1P3IC 2NQBD 1M18C 3NQUB 5CPKD 4WU9B 4H9NB 1P34B 2FJ7D 4H9SA 5B32D 3AZFD 1P3KB 1KX5B 4YM6A 1M18B 3WTPD 3W96D 4Z5TD 5BO0B 3UTBA 1BFMA 2CV5A 5B33A 4H9RB 3RELD 3AZJB 5AY8A 3W97B 1P3BB 4J8WA 3AYWA 4XZQD 2NZDC 5B1LC 4R8PB 3AZKC 4J8UD 5B40D 1N1JB 5B2JC 5DNMB 2NZDA 5B31A 5CPIA 3IP4C 5FUGA 1P3GC 1TZYD 3AZEC 5BNXA 4KGCA 4LD9A 5B2IA 3MNNA 3MGRC 3NQJB 3UT9B 1P3PB 4H9SC 5G49B 5B31D 3REKB 5AV5B 3REJC 4NE5A 1H3OA 4KGCD 4LD9D 1KU5A 2F8NB 3B0DC 3X1TB 4G91C 5GSUD 3AFAA 3C1CD 1M19A 3VH6T 3KXBD 3X1VD 3F6TA 4AWLC 5B1MC 5AVCA 5AV9D 3TU4B 5B24D 1BH8B 4H9PA 1F66D 5CPKA 3REHD 5GXQC 3MGRB 1HQ3B 5E5AB 1P3FB 2Y2PA 3LJAB 3KWQB 2BG1A 3B6FB 4ZUXA 5B0ZC 4WU8C 2CWEA 1AOIB 5DNNB 1TAFA 3EPHA 5CP6B 4HGAC 1EQZD 2HUEB 2AROA 3UTAD 1P3OC 1P3BC 1KX3B 4ZUXD 3TU4C 2NQBA 5AY8C 3AZHD 1HQ3C 1KX3C 3AZIC 4WNNB 3AZGB 2FJ7A 3AV2B 3LZ0C 3MNND 4YM6D 4Z66C 5BNVA 3LELC 5CPKC 2HIOD 3AZIA 2FJ7C 5KDMB 3AZFC 3O62D 1M1AB 4QLCD 3AZHA 5CPJC 3V9RB 5BT1C 2PYOB 4KHAB 2RIQA 3LELA 5B1LB 5GT0D 3REKC 3REJB 5F99A 3RELC 1P3AA 4Z2MG 3MVDC 3AZLB 4XZQC 2NZDD 3W99C 4WU9C 3VH6A 3MGQD 3C1BD 5GT0A 5B40C 3R45A 5B2JD 3W99B 1R4VA 1A7WA 1KX5D 3LZ1B 4J8UB 3KUYB 4J8VD 1BH9A 2YFVB 4XUJB 5CHLB 3W97C 3B0CW 3LZ1C 2BYKB 3AV1C 3X1SC 3B0BA 4ZBJB 5B32A 5B31C 3X1UA 1U35D 5GSUA 3AFAD 3C1CA 3REIC 4J8XC 3X1VA 4Z5TA 3AV1A 3P5JB 1P3GB 3UTBB 5GSUC
chains in the Genus database with same CATH topology
3MGPB 4H9RA 3LJAC 5AVBB 3EPKA 5AY8B 3X1UD 1KX4B 1U35A 4JJNC 2Y2QA 5B1MD 3AZNA 4WU8B 3AN2A 3UT9C 3MGSB 2CV5C 2Y2NA 3A1IA 5GXQD 3WKJC 4XUJC 5B31G 2Y2IA 4JJNB 1P3PD 3W98C 3VH6W 3MGSC 4H9OA 4H9QA 1TZYA 4KUDC 5C3IB 5FUGB 2AROD 5AV5D 3UTAA 1ZLAB 4G91B 5B2ID 2RVQD 4KGCB 4LD9B 5F99D 2F8NG 2Y2JA 1P3AD 2IO5B 1S32A 1EQZC 1P3IB 1ZLAC 5CPIC 3KXBB 1JFIB 5B0YA 3FDDA 3REKA 5AV5A 1ULYA 5AV9B 3TU4D 5GT3B 3AZHC 1M1AC 1HQ3D 3AZMB 2F8NA 3AZID 1P3FD 1M18A 3KWQD 5DNNC 3MNNC 1P3MB 3B6FD 4Z66D 4DRAA 5AVCD 3AZNC 3AN2C 5B24A 5B0YD 3LELD 1WWIA 5JRGA 4X23D 2HIOC 3WKJA 3MVDA 4R8PC 1EQZB 4QLCC 4J8WB 3AYWB 2YFWB 3WAAD 3X1SB 5GT0C 4ZBJC 3H0RC 4J8XB 3EPJA 4J8WC 3AYWC 1P3LB 5JRGD 4X23A 4UUZA 1AOIA 1TAFB 3MVDD 5BNXB 3W96C 4WU9D 2UWXA 4G92B 3MNNB 4YM6B 1P3MC 3AZFB 4YS3A 5GXQA 3A6NB 3WA9B 3WTPB 2HIOB 5E5AC 5CPJA 3W96B 2BYMA 4G92C 3O62B 3B0DB 5B0ZB 3RELB 4CAYA 3KSYA 3NQUA 5B1LD 1P3BA 3W97D 1S32D 4XZQB 3AV1D 3X1TA 1B67A 2Y2GA 4R8PA 4WV4B 1P3OB 3AFAC 1TZYC 1N1JA 3REID 3AZLD 2Y2OA 5B40B 2CV5B 5CPIB 3AZJA 2Y2MA 3W97A 5B2JB 4CSRB 3W98B 3AV2C 3VH5W 4KUDB 3AZEA 3KWQA 5C3IC 3AZMC 1P3PA 4Z66A 3AL0C 3UT9D 3C1BA 1ID3A 3KUYD 3WKJD 2FFFB 5B31B 4XUJD 4WJ3C 3R45B 3KXBC 3W99A 1KX5A 5AV8C 1F1EA 2RVQC 3MGPC 5F99C 1PZRA 1P3AC 1ID3D 5G49A 3TU4A 2Y2LA 5CPKB 1F66B 5JA4B 3REHB 1KX4D 4WU8D 1M18D 1P3KA 4UPKA 3AZJC 3LZ0A 3WTPC 5DNND 4Z5TC 2IO5C 5B1LA 5B1MA 5CP6D 2AROB 5AVCC 3AZND 3AN2D 1P3BD 1KX4A 3AZKB 2F8NH 2J8PA 4X23C 5DNMC 1P3AB 4R8PD 3LJAA 1KX3D 1Q9CA 3AZLA 4ZUXB 3B6GA 3B0CT 3LZ0D 4H9OB 5AV8A 1TZYB 5CP6A 1H3OB 4H9NA 3AZGD 5AV6B 5GT3D 1P34A 5JRGC 4YS3D 5BNVB 4NFTA 3AZED 5CPJD 4EO5B 3EG5B 1KX3A 3NQJA 3UT9A 1P3MD 3B6GD 3REKD 5AVCB 5B33B 4QLCB 4XUJA 2PYOD 3LELB 2VQRA 1B6WA 2BYKA 1HQ3A 2F8ND 3X1TD 3REJD 1P3FA 2LY8A 2DF4C 3MGQC 1T3UA 3B6FA 1S32C 5DNMA 4WZSB 2NZDB 5AV6C 5JRGB 3X1VC 3MGQB 4M6BA 4H9PB 1Z2CB 1KX5C 3WAAA 5B24C 4WU8A 2JE5A 1F66C 3A6ND 5B33C 3VH5T 3LZ1D 3WA9D 4JJNA 1AOID 4J8VB 1U35C 3VH5A 2F2AC 4WNNA 5B0ZD 3UTAB 4WU9A 3KUYC 3H0MC 3AFAB 1M19B 1S32B 3AV1B 3UTAC 5BO0A 3KFUG 1P3OD 3X1UC 1BH9B 3UTBD 5AV8D 2NQBB 2CV5D 4ZUXC 3MGPD 5BS7C 3AZGA 1P34D 3RELA 5AVBD 4CAYB 3MGRA 1ID3C 2FJ7B 5B32B 3X1UB 5AY8D 4E45A 1P3KD 5E5AA 3AZMA 1P3PC 3W98D 3MGSD 4KUDD 4Z5TB 5AV5C 5KDMA 4YM6C 3EPLA 5B2IC 5DNNA 5B40A 3AZJD 3MGPA 5GT0B 4KHAA 3O62C 1M19C 4NE3A 1ZLAD 5BT1D 5B2IB 1P3LC 5F99B 2DQNC 5CP6C 4HGAB 2NQBC 1P3ID 2Y2HA 5DNMD 3KUYA 1P3LA 5B32C 4EO5C 5GT3A 3W99D 1P3FC 3C1BC 3AZGC 3A6NA 3AZIB 5GT3C 3WA9A 2JCHA 1P3IA 1P3MA 4NE6A 1P3GA 4YS3C 2F8NK 1M1AA 4DRBA 3W96A 2HUEC 1BH8A 3WAAC 5B0YB 2XD5A 1HTAA 3B6GC 4J8VC 1U35B 3AZNB 3AN2B 5JA4A 3REHA 3WTPE 2PYOC 5B32G 5GSUB 3C1CB 4J8WD 4J8UC 3AZKD 3AYWD 4XZQA 4Z2MH 3X1SD 3X1VB 1P3GD 1P3OA 3X1TC 4J8XD 5B24B 2ZY2A 3LZ0B 3MVDB 5AVBA 3MGRD 5B1MB 5AV6D 2ZY5A 5E5AD 2Y2KA 3LJAD 3AZFA 3X1SA 5GXQB 4YS3B 3LZ1A 4KUDA 3AZEB 3WTPA 5CPJB 4JJND 1W2EA 3C1CC 4KGCC 4LD9C 1JFIA 2G5HC 3B6GB 5B33D 2XD1A 4UUZB 3A6NC 3WA9C 2JSSA 3H0LC 3AV2A 1AOIC 2ZY3A 5AV6A 3AZLC 2AROC 5AV9C 2HIOA 3REHC 3KXBA 4E44A 2G5IC 4J8UA 3REIA 3V9RA 2BYMB 3REIB 3O62A 3AZHB 2PYOA 4QLCA 5CPID 3AV2D 3REJA 1F66A 4CSRA 3UTBC 2YFWA 3AZMD 3MGSA 3W98A 2ZM5A 1P34C 5AVBC 4Z66B 1WWSA 1M1AD 1P3KC 4X23B 4H9QB 3KWQC 3WKJB 1ZLAA 3MGQA 3B6FC 4DQYB 1EQZA 5B0YC 3WAAB 3AZKA 5B2JA 2L5AA 4AWLB 5BS7A 1M19D 1P3LD 2W8SA 2ZY4A 4J8XA 2YFVA 3A1KA 3C1BB 1ID3B 1KX4C 5B0ZA 4J8VA 5AV9A 5AV8B 1P3IC 2NQBD 1M18C 3NQUB 5CPKD 4WU9B 4H9NB 1P34B 2FJ7D 4H9SA 5B32D 3AZFD 1P3KB 1KX5B 4YM6A 1M18B 3WTPD 3W96D 4Z5TD 5BO0B 3UTBA 1BFMA 2CV5A 5B33A 4H9RB 3RELD 3AZJB 5AY8A 3W97B 1P3BB 4J8WA 3AYWA 4XZQD 2NZDC 5B1LC 4R8PB 3AZKC 4J8UD 5B40D 1N1JB 5B2JC 5DNMB 2NZDA 5B31A 5CPIA 3IP4C 5FUGA 1P3GC 1TZYD 3AZEC 5BNXA 4KGCA 4LD9A 5B2IA 3MNNA 3MGRC 3NQJB 3UT9B 1P3PB 4H9SC 5G49B 5B31D 3REKB 5AV5B 3REJC 4NE5A 1H3OA 4KGCD 4LD9D 1KU5A 2F8NB 3B0DC 3X1TB 4G91C 5GSUD 3AFAA 3C1CD 1M19A 3VH6T 3KXBD 3X1VD 3F6TA 4AWLC 5B1MC 5AVCA 5AV9D 3TU4B 5B24D 1BH8B 4H9PA 1F66D 5CPKA 3REHD 5GXQC 3MGRB 1HQ3B 5E5AB 1P3FB 2Y2PA 3LJAB 3KWQB 2BG1A 3B6FB 4ZUXA 5B0ZC 4WU8C 2CWEA 1AOIB 5DNNB 1TAFA 3EPHA 5CP6B 4HGAC 1EQZD 2HUEB 2AROA 3UTAD 1P3OC 1P3BC 1KX3B 4ZUXD 3TU4C 2NQBA 5AY8C 3AZHD 1HQ3C 1KX3C 3AZIC 4WNNB 3AZGB 2FJ7A 3AV2B 3LZ0C 3MNND 4YM6D 4Z66C 5BNVA 3LELC 5CPKC 2HIOD 3AZIA 2FJ7C 5KDMB 3AZFC 3O62D 1M1AB 4QLCD 3AZHA 5CPJC 3V9RB 5BT1C 2PYOB 4KHAB 2RIQA 3LELA 5B1LB 5GT0D 3REKC 3REJB 5F99A 3RELC 1P3AA 4Z2MG 3MVDC 3AZLB 4XZQC 2NZDD 3W99C 4WU9C 3VH6A 3MGQD 3C1BD 5GT0A 5B40C 3R45A 5B2JD 3W99B 1R4VA 1A7WA 1KX5D 3LZ1B 4J8UB 3KUYB 4J8VD 1BH9A 2YFVB 4XUJB 5CHLB 3W97C 3B0CW 3LZ1C 2BYKB 3AV1C 3X1SC 3B0BA 4ZBJB 5B32A 5B31C 3X1UA 1U35D 5GSUA 3AFAD 3C1CA 3REIC 4J8XC 3X1VA 4Z5TA 3AV1A 3P5JB 1P3GB 3UTBB 5GSUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP B;  4H9R A;  3LJA C;  5AVB B;  5AY8 B;  3X1U D;  1KX4 B;  1U35 A;  4JJN C;  5B1M D;  3AZN A;  3AN2 A;  4WU8 B;  2CV5 C;  3UT9 C;  3MGS B;  5GXQ D;  3WKJ C;  4XUJ C;  5B31 G;  4JJN B;  1P3P D;  3W98 C;  3VH6 W;  3MGS C;  4H9O A;  4H9Q A;  1TZY A;  4KUD C;  5C3I B;  5FUG B;  2ARO D;  5AV5 D;  3UTA A;  1ZLA B;  4G91 B;  5B2I D;  2RVQ D;  4KGC B;  4LD9 B;  5F99 D;  2F8N G;  1P3A D;  2IO5 B;  1S32 A;  1EQZ C;  1P3I B;  1ZLA C;  5CPI C;  3KXB B;  1JFI B;  5B0Y A;  3REK A;  5AV5 A;  1ULY A;  5AV9 B;  3TU4 D;  5GT3 B;  3AZH C;  1M1A C;  1HQ3 D;  3AZM B;  2F8N A;  3AZI D;  1P3F D;  1M18 A;  3KWQ D;  5DNN C;  3MNN C;  1P3M B;  3B6F D;  4Z66 D;  4DRA A;  5AVC D;  3AZN C;  3AN2 C;  5B24 A;  5B0Y D;  3LEL D;  1WWI A;  5JRG A;  4X23 D;  2HIO C;  3WKJ A;  3MVD A;  4R8P C;  1EQZ B;  4QLC C;  4J8W B;  3AYW B;  2YFW B;  3WAA D;  3X1S B;  5GT0 C;  4ZBJ C;  4J8X B;  4J8W C;  3AYW C;  1P3L B;  5JRG D;  4X23 A;  4UUZ A;  1AOI A;  1TAF B;  3MVD D;  5BNX B;  3W96 C;  4WU9 D;  4G92 B;  3MNN B;  4YM6 B;  1P3M C;  3AZF B;  4YS3 A;  5GXQ A;  3A6N B;  3WA9 B;  3WTP B;  2HIO B;  5E5A C;  5CPJ A;  3W96 B;  2BYM A;  4G92 C;  3O62 B;  3B0D B;  5B0Z B;  3REL B;  4CAY A;  3KSY A;  3NQU A;  5B1L D;  1P3B A;  3W97 D;  1S32 D;  4XZQ B;  3AV1 D;  3X1T A;  1B67 A;  4R8P A;  4WV4 B;  1P3O B;  3AFA C;  1TZY C;  1N1J A;  3REI D;  3AZL D;  5B40 B;  2CV5 B;  5CPI B;  3AZJ A;  3W97 A;  5B2J B;  4CSR B;  3W98 B;  3AV2 C;  3VH5 W;  4KUD B;  3AZE A;  3KWQ A;  5C3I C;  3AZM C;  1P3P A;  4Z66 A;  3UT9 D;  3C1B A;  1ID3 A;  3KUY D;  3WKJ D;  5B31 B;  4XUJ D;  3R45 B;  3KXB C;  3W99 A;  1KX5 A;  5AV8 C;  1F1E A;  2RVQ C;  3MGP C;  5F99 C;  1P3A C;  1ID3 D;  5G49 A;  3TU4 A;  5CPK B;  1F66 B;  5JA4 B;  3REH B;  1KX4 D;  4WU8 D;  1M18 D;  1P3K A;  3AZJ C;  3LZ0 A;  3WTP C;  5DNN D;  4Z5T C;  2IO5 C;  5B1L A;  5B1M A;  5CP6 D;  2ARO B;  5AVC C;  3AZN D;  3AN2 D;  1P3B D;  1KX4 A;  3AZK B;  2F8N H;  4X23 C;  5DNM C;  1P3A B;  4R8P D;  3LJA A;  1KX3 D;  1Q9C A;  3AZL A;  4ZUX B;  3B6G A;  3B0C T;  3LZ0 D;  4H9O B;  5AV8 A;  1TZY B;  5CP6 A;  1H3O B;  4H9N A;  3AZG D;  5AV6 B;  5GT3 D;  1P34 A;  5JRG C;  4YS3 D;  5BNV B;  4NFT A;  3AZE D;  5CPJ D;  4EO5 B;  1KX3 A;  3NQJ A;  3UT9 A;  1P3M D;  3B6G D;  3REK D;  5AVC B;  5B33 B;  4QLC B;  4XUJ A;  2PYO D;  3LEL B;  1B6W A;  2BYK A;  1HQ3 A;  2F8N D;  3X1T D;  3REJ D;  1P3F A;  2LY8 A;  3MGQ C;  3B6F A;  1S32 C;  5DNM A;  4WZS B;  2NZD B;  5AV6 C;  5JRG B;  3X1V C;  3MGQ B;  4M6B A;  4H9P B;  1KX5 C;  3WAA A;  5B24 C;  4WU8 A;  1F66 C;  3A6N D;  5B33 C;  3VH5 T;  3LZ1 D;  3WA9 D;  4JJN A;  1AOI D;  4J8V B;  1U35 C;  3VH5 A;  4WNN A;  5B0Z D;  3UTA B;  4WU9 A;  3KUY C;  3AFA B;  1M19 B;  1S32 B;  3AV1 B;  3UTA C;  5BO0 A;  1P3O D;  3X1U C;  1BH9 B;  3UTB D;  5AV8 D;  2NQB B;  2CV5 D;  4ZUX C;  3MGP D;  5BS7 C;  3AZG A;  1P34 D;  3REL A;  5AVB D;  4CAY B;  3MGR A;  1ID3 C;  2FJ7 B;  5B32 B;  5AY8 D;  4E45 A;  3X1U B;  1P3K D;  5E5A A;  3AZM A;  1P3P C;  3W98 D;  3MGS D;  4KUD D;  4Z5T B;  5AV5 C;  5KDM A;  4YM6 C;  5B2I C;  5DNN A;  5B40 A;  3AZJ D;  3MGP A;  5GT0 B;  4KHA A;  3O62 C;  1M19 C;  4NE3 A;  1ZLA D;  5BT1 D;  5B2I B;  1P3L C;  5F99 B;  5CP6 C;  4HGA B;  2NQB C;  1P3I D;  5DNM D;  3KUY A;  1P3L A;  5B32 C;  4EO5 C;  5GT3 A;  3W99 D;  1P3F C;  3C1B C;  3AZG C;  3A6N A;  3AZI B;  5GT3 C;  3WA9 A;  1P3I A;  1P3M A;  2F8N K;  4NE6 A;  1P3G A;  4YS3 C;  1M1A A;  4DRB A;  3W96 A;  2HUE C;  1BH8 A;  3WAA C;  5B0Y B;  1HTA A;  3B6G C;  4J8V C;  1U35 B;  3AZN B;  3AN2 B;  5JA4 A;  3REH A;  3WTP E;  2PYO C;  5B32 G;  5GSU B;  3C1C B;  4J8W D;  4J8U C;  3AZK D;  3AYW D;  4XZQ A;  4Z2M H;  3X1S D;  3X1V B;  1P3G D;  1P3O A;  3X1T C;  4J8X D;  5B24 B;  3LZ0 B;  3MVD B;  5AVB A;  3MGR D;  5B1M B;  5AV6 D;  5E5A D;  3LJA D;  3AZF A;  3X1S A;  5GXQ B;  4YS3 B;  3LZ1 A;  4KUD A;  3AZE B;  3WTP A;  5CPJ B;  4JJN D;  3C1C C;  4KGC C;  4LD9 C;  1JFI A;  3B6G B;  5B33 D;  4UUZ B;  3A6N C;  3WA9 C;  2JSS A;  3AV2 A;  1AOI C;  5AV6 A;  3AZL C;  2ARO C;  5AV9 C;  2HIO A;  3REH C;  3KXB A;  4E44 A;  4J8U A;  3REI A;  3REI B;  3V9R A;  2BYM B;  3AZH B;  3O62 A;  2PYO A;  4QLC A;  5CPI D;  3AV2 D;  3REJ A;  1F66 A;  4CSR A;  3UTB C;  2YFW A;  3AZM D;  3MGS A;  3W98 A;  1P34 C;  5AVB C;  4Z66 B;  1WWS A;  1M1A D;  1P3K C;  4X23 B;  4H9Q B;  3KWQ C;  3WKJ B;  1ZLA A;  3MGQ A;  3B6F C;  1EQZ A;  5B0Y C;  3WAA B;  3AZK A;  5B2J A;  2L5A A;  4AWL B;  5BS7 A;  1M19 D;  1P3L D;  4J8X A;  2YFV A;  3C1B B;  1ID3 B;  1KX4 C;  5B0Z A;  4J8V A;  5AV9 A;  5AV8 B;  1P3I C;  2NQB D;  1M18 C;  3NQU B;  5CPK D;  4WU9 B;  4H9N B;  1P34 B;  2FJ7 D;  4H9S A;  5B32 D;  3AZF D;  1P3K B;  1KX5 B;  4YM6 A;  1M18 B;  3WTP D;  3W96 D;  4Z5T D;  5BO0 B;  3UTB A;  1BFM A;  2CV5 A;  5B33 A;  4H9R B;  3REL D;  3AZJ B;  5AY8 A;  3W97 B;  1P3B B;  4J8W A;  3AYW A;  4XZQ D;  2NZD C;  5B1L C;  4R8P B;  3AZK C;  4J8U D;  5B40 D;  1N1J B;  5B2J C;  5DNM B;  2NZD A;  5B31 A;  5CPI A;  1P3G C;  5FUG A;  1TZY D;  3AZE C;  5BNX A;  4KGC A;  4LD9 A;  5B2I A;  3MNN A;  3MGR C;  3NQJ B;  3UT9 B;  1P3P B;  4H9S C;  5G49 B;  5B31 D;  3REK B;  5AV5 B;  3REJ C;  4NE5 A;  1H3O A;  4KGC D;  4LD9 D;  1KU5 A;  2F8N B;  3B0D C;  3X1T B;  4G91 C;  5GSU D;  3AFA A;  3C1C D;  1M19 A;  3VH6 T;  3KXB D;  3X1V D;  4AWL C;  5B1M C;  5AVC A;  5AV9 D;  3TU4 B;  5B24 D;  1BH8 B;  4H9P A;  1F66 D;  5CPK A;  3REH D;  5GXQ C;  3MGR B;  1HQ3 B;  5E5A B;  1P3F B;  3LJA B;  3KWQ B;  3B6F B;  4ZUX A;  5B0Z C;  4WU8 C;  2CWE A;  1AOI B;  5DNN B;  1TAF A;  5CP6 B;  4HGA C;  1EQZ D;  2HUE B;  2ARO A;  3UTA D;  1P3O C;  1P3B C;  1KX3 B;  4ZUX D;  3TU4 C;  2NQB A;  5AY8 C;  3AZH D;  1HQ3 C;  1KX3 C;  3AZI C;  4WNN B;  3AZG B;  2FJ7 A;  3AV2 B;  3LZ0 C;  3MNN D;  4YM6 D;  4Z66 C;  5BNV A;  3LEL C;  5CPK C;  2HIO D;  3AZI A;  2FJ7 C;  5KDM B;  3AZF C;  3O62 D;  1M1A B;  4QLC D;  3AZH A;  5CPJ C;  3V9R B;  5BT1 C;  2PYO B;  4KHA B;  3LEL A;  5B1L B;  5GT0 D;  3REK C;  3REJ B;  5F99 A;  3REL C;  1P3A A;  4Z2M G;  3MVD C;  3AZL B;  4XZQ C;  2NZD D;  3W99 C;  4WU9 C;  3VH6 A;  3MGQ D;  3C1B D;  5GT0 A;  5B40 C;  3R45 A;  5B2J D;  3W99 B;  1R4V A;  1A7W A;  1KX5 D;  3LZ1 B;  4J8U B;  3KUY B;  4J8V D;  1BH9 A;  2YFV B;  5CHL B;  4XUJ B;  3W97 C;  3B0C W;  3LZ1 C;  2BYK B;  3AV1 C;  3X1S C;  3B0B A;  4ZBJ B;  5B32 A;  5B31 C;  3X1U A;  1U35 D;  5GSU A;  3AFA D;  3C1C A;  3REI C;  4J8X C;  3X1V A;  4Z5T A;  3AV1 A;  1P3G B;  3UTB B;  5GSU C; 
#chains in the Genus database with same CATH topology
 3MGP B;  4H9R A;  3LJA C;  5AVB B;  3EPK A;  5AY8 B;  3X1U D;  1KX4 B;  1U35 A;  4JJN C;  2Y2Q A;  5B1M D;  3AZN A;  4WU8 B;  3AN2 A;  3UT9 C;  3MGS B;  2CV5 C;  2Y2N A;  3A1I A;  5GXQ D;  3WKJ C;  4XUJ C;  5B31 G;  2Y2I A;  4JJN B;  1P3P D;  3W98 C;  3VH6 W;  3MGS C;  4H9O A;  4H9Q A;  1TZY A;  4KUD C;  5C3I B;  5FUG B;  2ARO D;  5AV5 D;  3UTA A;  1ZLA B;  4G91 B;  5B2I D;  2RVQ D;  4KGC B;  4LD9 B;  5F99 D;  2F8N G;  2Y2J A;  1P3A D;  2IO5 B;  1S32 A;  1EQZ C;  1P3I B;  1ZLA C;  5CPI C;  3KXB B;  1JFI B;  5B0Y A;  3FDD A;  3REK A;  5AV5 A;  1ULY A;  5AV9 B;  3TU4 D;  5GT3 B;  3AZH C;  1M1A C;  1HQ3 D;  3AZM B;  2F8N A;  3AZI D;  1P3F D;  1M18 A;  3KWQ D;  5DNN C;  3MNN C;  1P3M B;  3B6F D;  4Z66 D;  4DRA A;  5AVC D;  3AZN C;  3AN2 C;  5B24 A;  5B0Y D;  3LEL D;  1WWI A;  5JRG A;  4X23 D;  2HIO C;  3WKJ A;  3MVD A;  4R8P C;  1EQZ B;  4QLC C;  4J8W B;  3AYW B;  2YFW B;  3WAA D;  3X1S B;  5GT0 C;  4ZBJ C;  3H0R C;  4J8X B;  3EPJ A;  4J8W C;  3AYW C;  1P3L B;  5JRG D;  4X23 A;  4UUZ A;  1AOI A;  1TAF B;  3MVD D;  5BNX B;  3W96 C;  4WU9 D;  2UWX A;  4G92 B;  3MNN B;  4YM6 B;  1P3M C;  3AZF B;  4YS3 A;  5GXQ A;  3A6N B;  3WA9 B;  3WTP B;  2HIO B;  5E5A C;  5CPJ A;  3W96 B;  2BYM A;  4G92 C;  3O62 B;  3B0D B;  5B0Z B;  3REL B;  4CAY A;  3KSY A;  3NQU A;  5B1L D;  1P3B A;  3W97 D;  1S32 D;  4XZQ B;  3AV1 D;  3X1T A;  1B67 A;  2Y2G A;  4R8P A;  4WV4 B;  1P3O B;  3AFA C;  1TZY C;  1N1J A;  3REI D;  3AZL D;  2Y2O A;  5B40 B;  2CV5 B;  5CPI B;  3AZJ A;  2Y2M A;  3W97 A;  5B2J B;  4CSR B;  3W98 B;  3AV2 C;  3VH5 W;  4KUD B;  3AZE A;  3KWQ A;  5C3I C;  3AZM C;  1P3P A;  4Z66 A;  3AL0 C;  3UT9 D;  3C1B A;  1ID3 A;  3KUY D;  3WKJ D;  2FFF B;  5B31 B;  4XUJ D;  4WJ3 C;  3R45 B;  3KXB C;  3W99 A;  1KX5 A;  5AV8 C;  1F1E A;  2RVQ C;  3MGP C;  5F99 C;  1PZR A;  1P3A C;  1ID3 D;  5G49 A;  3TU4 A;  2Y2L A;  5CPK B;  1F66 B;  5JA4 B;  3REH B;  1KX4 D;  4WU8 D;  1M18 D;  1P3K A;  4UPK A;  3AZJ C;  3LZ0 A;  3WTP C;  5DNN D;  4Z5T C;  2IO5 C;  5B1L A;  5B1M A;  5CP6 D;  2ARO B;  5AVC C;  3AZN D;  3AN2 D;  1P3B D;  1KX4 A;  3AZK B;  2F8N H;  2J8P A;  4X23 C;  5DNM C;  1P3A B;  4R8P D;  3LJA A;  1KX3 D;  1Q9C A;  3AZL A;  4ZUX B;  3B6G A;  3B0C T;  3LZ0 D;  4H9O B;  5AV8 A;  1TZY B;  5CP6 A;  1H3O B;  4H9N A;  3AZG D;  5AV6 B;  5GT3 D;  1P34 A;  5JRG C;  4YS3 D;  5BNV B;  4NFT A;  3AZE D;  5CPJ D;  4EO5 B;  3EG5 B;  1KX3 A;  3NQJ A;  3UT9 A;  1P3M D;  3B6G D;  3REK D;  5AVC B;  5B33 B;  4QLC B;  4XUJ A;  2PYO D;  3LEL B;  2VQR A;  1B6W A;  2BYK A;  1HQ3 A;  2F8N D;  3X1T D;  3REJ D;  1P3F A;  2LY8 A;  2DF4 C;  3MGQ C;  1T3U A;  3B6F A;  1S32 C;  5DNM A;  4WZS B;  2NZD B;  5AV6 C;  5JRG B;  3X1V C;  3MGQ B;  4M6B A;  4H9P B;  1Z2C B;  1KX5 C;  3WAA A;  5B24 C;  4WU8 A;  2JE5 A;  1F66 C;  3A6N D;  5B33 C;  3VH5 T;  3LZ1 D;  3WA9 D;  4JJN A;  1AOI D;  4J8V B;  1U35 C;  3VH5 A;  2F2A C;  4WNN A;  5B0Z D;  3UTA B;  4WU9 A;  3KUY C;  3H0M C;  3AFA B;  1M19 B;  1S32 B;  3AV1 B;  3UTA C;  5BO0 A;  3KFU G;  1P3O D;  3X1U C;  1BH9 B;  3UTB D;  5AV8 D;  2NQB B;  2CV5 D;  4ZUX C;  3MGP D;  5BS7 C;  3AZG A;  1P34 D;  3REL A;  5AVB D;  4CAY B;  3MGR A;  1ID3 C;  2FJ7 B;  5B32 B;  3X1U B;  5AY8 D;  4E45 A;  1P3K D;  5E5A A;  3AZM A;  1P3P C;  3W98 D;  3MGS D;  4KUD D;  4Z5T B;  5AV5 C;  5KDM A;  4YM6 C;  3EPL A;  5B2I C;  5DNN A;  5B40 A;  3AZJ D;  3MGP A;  5GT0 B;  4KHA A;  3O62 C;  1M19 C;  4NE3 A;  1ZLA D;  5BT1 D;  5B2I B;  1P3L C;  5F99 B;  2DQN C;  5CP6 C;  4HGA B;  2NQB C;  1P3I D;  2Y2H A;  5DNM D;  3KUY A;  1P3L A;  5B32 C;  4EO5 C;  5GT3 A;  3W99 D;  1P3F C;  3C1B C;  3AZG C;  3A6N A;  3AZI B;  5GT3 C;  3WA9 A;  2JCH A;  1P3I A;  1P3M A;  4NE6 A;  1P3G A;  4YS3 C;  2F8N K;  1M1A A;  4DRB A;  3W96 A;  2HUE C;  1BH8 A;  3WAA C;  5B0Y B;  2XD5 A;  1HTA A;  3B6G C;  4J8V C;  1U35 B;  3AZN B;  3AN2 B;  5JA4 A;  3REH A;  3WTP E;  2PYO C;  5B32 G;  5GSU B;  3C1C B;  4J8W D;  4J8U C;  3AZK D;  3AYW D;  4XZQ A;  4Z2M H;  3X1S D;  3X1V B;  1P3G D;  1P3O A;  3X1T C;  4J8X D;  5B24 B;  2ZY2 A;  3LZ0 B;  3MVD B;  5AVB A;  3MGR D;  5B1M B;  5AV6 D;  2ZY5 A;  5E5A D;  2Y2K A;  3LJA D;  3AZF A;  3X1S A;  5GXQ B;  4YS3 B;  3LZ1 A;  4KUD A;  3AZE B;  3WTP A;  5CPJ B;  4JJN D;  1W2E A;  3C1C C;  4KGC C;  4LD9 C;  1JFI A;  2G5H C;  3B6G B;  5B33 D;  2XD1 A;  4UUZ B;  3A6N C;  3WA9 C;  2JSS A;  3H0L C;  3AV2 A;  1AOI C;  2ZY3 A;  5AV6 A;  3AZL C;  2ARO C;  5AV9 C;  2HIO A;  3REH C;  3KXB A;  4E44 A;  2G5I C;  4J8U A;  3REI A;  3V9R A;  2BYM B;  3REI B;  3O62 A;  3AZH B;  2PYO A;  4QLC A;  5CPI D;  3AV2 D;  3REJ A;  1F66 A;  4CSR A;  3UTB C;  2YFW A;  3AZM D;  3MGS A;  3W98 A;  2ZM5 A;  1P34 C;  5AVB C;  4Z66 B;  1WWS A;  1M1A D;  1P3K C;  4X23 B;  4H9Q B;  3KWQ C;  3WKJ B;  1ZLA A;  3MGQ A;  3B6F C;  4DQY B;  1EQZ A;  5B0Y C;  3WAA B;  3AZK A;  5B2J A;  2L5A A;  4AWL B;  5BS7 A;  1M19 D;  1P3L D;  2W8S A;  2ZY4 A;  4J8X A;  2YFV A;  3A1K A;  3C1B B;  1ID3 B;  1KX4 C;  5B0Z A;  4J8V A;  5AV9 A;  5AV8 B;  1P3I C;  2NQB D;  1M18 C;  3NQU B;  5CPK D;  4WU9 B;  4H9N B;  1P34 B;  2FJ7 D;  4H9S A;  5B32 D;  3AZF D;  1P3K B;  1KX5 B;  4YM6 A;  1M18 B;  3WTP D;  3W96 D;  4Z5T D;  5BO0 B;  3UTB A;  1BFM A;  2CV5 A;  5B33 A;  4H9R B;  3REL D;  3AZJ B;  5AY8 A;  3W97 B;  1P3B B;  4J8W A;  3AYW A;  4XZQ D;  2NZD C;  5B1L C;  4R8P B;  3AZK C;  4J8U D;  5B40 D;  1N1J B;  5B2J C;  5DNM B;  2NZD A;  5B31 A;  5CPI A;  3IP4 C;  5FUG A;  1P3G C;  1TZY D;  3AZE C;  5BNX A;  4KGC A;  4LD9 A;  5B2I A;  3MNN A;  3MGR C;  3NQJ B;  3UT9 B;  1P3P B;  4H9S C;  5G49 B;  5B31 D;  3REK B;  5AV5 B;  3REJ C;  4NE5 A;  1H3O A;  4KGC D;  4LD9 D;  1KU5 A;  2F8N B;  3B0D C;  3X1T B;  4G91 C;  5GSU D;  3AFA A;  3C1C D;  1M19 A;  3VH6 T;  3KXB D;  3X1V D;  3F6T A;  4AWL C;  5B1M C;  5AVC A;  5AV9 D;  3TU4 B;  5B24 D;  1BH8 B;  4H9P A;  1F66 D;  5CPK A;  3REH D;  5GXQ C;  3MGR B;  1HQ3 B;  5E5A B;  1P3F B;  2Y2P A;  3LJA B;  3KWQ B;  2BG1 A;  3B6F B;  4ZUX A;  5B0Z C;  4WU8 C;  2CWE A;  1AOI B;  5DNN B;  1TAF A;  3EPH A;  5CP6 B;  4HGA C;  1EQZ D;  2HUE B;  2ARO A;  3UTA D;  1P3O C;  1P3B C;  1KX3 B;  4ZUX D;  3TU4 C;  2NQB A;  5AY8 C;  3AZH D;  1HQ3 C;  1KX3 C;  3AZI C;  4WNN B;  3AZG B;  2FJ7 A;  3AV2 B;  3LZ0 C;  3MNN D;  4YM6 D;  4Z66 C;  5BNV A;  3LEL C;  5CPK C;  2HIO D;  3AZI A;  2FJ7 C;  5KDM B;  3AZF C;  3O62 D;  1M1A B;  4QLC D;  3AZH A;  5CPJ C;  3V9R B;  5BT1 C;  2PYO B;  4KHA B;  2RIQ A;  3LEL A;  5B1L B;  5GT0 D;  3REK C;  3REJ B;  5F99 A;  3REL C;  1P3A A;  4Z2M G;  3MVD C;  3AZL B;  4XZQ C;  2NZD D;  3W99 C;  4WU9 C;  3VH6 A;  3MGQ D;  3C1B D;  5GT0 A;  5B40 C;  3R45 A;  5B2J D;  3W99 B;  1R4V A;  1A7W A;  1KX5 D;  3LZ1 B;  4J8U B;  3KUY B;  4J8V D;  1BH9 A;  2YFV B;  4XUJ B;  5CHL B;  3W97 C;  3B0C W;  3LZ1 C;  2BYK B;  3AV1 C;  3X1S C;  3B0B A;  4ZBJ B;  5B32 A;  5B31 C;  3X1U A;  1U35 D;  5GSU A;  3AFA D;  3C1C A;  3REI C;  4J8X C;  3X1V A;  4Z5T A;  3AV1 A;  3P5J B;  1P3G B;  3UTB B;  5GSU C; 
#chains in the Genus database with same CATH homology
 3MGP B;  4H9R A;  3LJA C;  5AVB B;  3EPK A;  5AY8 B;  3X1U D;  1KX4 B;  1U35 A;  4JJN C;  2Y2Q A;  5B1M D;  3AZN A;  4WU8 B;  3AN2 A;  3UT9 C;  3MGS B;  2CV5 C;  2Y2N A;  3A1I A;  5GXQ D;  3WKJ C;  4XUJ C;  5B31 G;  2Y2I A;  4JJN B;  1P3P D;  3W98 C;  3VH6 W;  3MGS C;  4H9O A;  4H9Q A;  1TZY A;  4KUD C;  5C3I B;  5FUG B;  2ARO D;  5AV5 D;  3UTA A;  1ZLA B;  4G91 B;  5B2I D;  2RVQ D;  4KGC B;  4LD9 B;  5F99 D;  2F8N G;  2Y2J A;  1P3A D;  2IO5 B;  1S32 A;  1EQZ C;  1P3I B;  1ZLA C;  5CPI C;  3KXB B;  1JFI B;  5B0Y A;  3FDD A;  3REK A;  5AV5 A;  1ULY A;  5AV9 B;  3TU4 D;  5GT3 B;  3AZH C;  1M1A C;  1HQ3 D;  3AZM B;  2F8N A;  3AZI D;  1P3F D;  1M18 A;  3KWQ D;  5DNN C;  3MNN C;  1P3M B;  3B6F D;  4Z66 D;  4DRA A;  5AVC D;  3AZN C;  3AN2 C;  5B24 A;  5B0Y D;  3LEL D;  1WWI A;  5JRG A;  4X23 D;  2HIO C;  3WKJ A;  3MVD A;  4R8P C;  1EQZ B;  4QLC C;  4J8W B;  3AYW B;  2YFW B;  3WAA D;  3X1S B;  5GT0 C;  4ZBJ C;  3H0R C;  4J8X B;  3EPJ A;  4J8W C;  3AYW C;  1P3L B;  5JRG D;  4X23 A;  4UUZ A;  1AOI A;  1TAF B;  3MVD D;  5BNX B;  3W96 C;  4WU9 D;  2UWX A;  4G92 B;  3MNN B;  4YM6 B;  1P3M C;  3AZF B;  4YS3 A;  5GXQ A;  3A6N B;  3WA9 B;  3WTP B;  2HIO B;  5E5A C;  5CPJ A;  3W96 B;  2BYM A;  4G92 C;  3O62 B;  3B0D B;  5B0Z B;  3REL B;  4CAY A;  3KSY A;  3NQU A;  5B1L D;  1P3B A;  3W97 D;  1S32 D;  4XZQ B;  3AV1 D;  3X1T A;  1B67 A;  2Y2G A;  4R8P A;  4WV4 B;  1P3O B;  3AFA C;  1TZY C;  1N1J A;  3REI D;  3AZL D;  2Y2O A;  5B40 B;  2CV5 B;  5CPI B;  3AZJ A;  2Y2M A;  3W97 A;  5B2J B;  4CSR B;  3W98 B;  3AV2 C;  3VH5 W;  4KUD B;  3AZE A;  3KWQ A;  5C3I C;  3AZM C;  1P3P A;  4Z66 A;  3AL0 C;  3UT9 D;  3C1B A;  1ID3 A;  3KUY D;  3WKJ D;  2FFF B;  5B31 B;  4XUJ D;  4WJ3 C;  3R45 B;  3KXB C;  3W99 A;  1KX5 A;  5AV8 C;  1F1E A;  2RVQ C;  3MGP C;  5F99 C;  1PZR A;  1P3A C;  1ID3 D;  5G49 A;  3TU4 A;  2Y2L A;  5CPK B;  1F66 B;  5JA4 B;  3REH B;  1KX4 D;  4WU8 D;  1M18 D;  1P3K A;  4UPK A;  3AZJ C;  3LZ0 A;  3WTP C;  5DNN D;  4Z5T C;  2IO5 C;  5B1L A;  5B1M A;  5CP6 D;  2ARO B;  5AVC C;  3AZN D;  3AN2 D;  1P3B D;  1KX4 A;  3AZK B;  2F8N H;  2J8P A;  4X23 C;  5DNM C;  1P3A B;  4R8P D;  3LJA A;  1KX3 D;  1Q9C A;  3AZL A;  4ZUX B;  3B6G A;  3B0C T;  3LZ0 D;  4H9O B;  5AV8 A;  1TZY B;  5CP6 A;  1H3O B;  4H9N A;  3AZG D;  5AV6 B;  5GT3 D;  1P34 A;  5JRG C;  4YS3 D;  5BNV B;  4NFT A;  3AZE D;  5CPJ D;  4EO5 B;  3EG5 B;  1KX3 A;  3NQJ A;  3UT9 A;  1P3M D;  3B6G D;  3REK D;  5AVC B;  5B33 B;  4QLC B;  4XUJ A;  2PYO D;  3LEL B;  2VQR A;  1B6W A;  2BYK A;  1HQ3 A;  2F8N D;  3X1T D;  3REJ D;  1P3F A;  2LY8 A;  2DF4 C;  3MGQ C;  1T3U A;  3B6F A;  1S32 C;  5DNM A;  4WZS B;  2NZD B;  5AV6 C;  5JRG B;  3X1V C;  3MGQ B;  4M6B A;  4H9P B;  1Z2C B;  1KX5 C;  3WAA A;  5B24 C;  4WU8 A;  2JE5 A;  1F66 C;  3A6N D;  5B33 C;  3VH5 T;  3LZ1 D;  3WA9 D;  4JJN A;  1AOI D;  4J8V B;  1U35 C;  3VH5 A;  2F2A C;  4WNN A;  5B0Z D;  3UTA B;  4WU9 A;  3KUY C;  3H0M C;  3AFA B;  1M19 B;  1S32 B;  3AV1 B;  3UTA C;  5BO0 A;  3KFU G;  1P3O D;  3X1U C;  1BH9 B;  3UTB D;  5AV8 D;  2NQB B;  2CV5 D;  4ZUX C;  3MGP D;  5BS7 C;  3AZG A;  1P34 D;  3REL A;  5AVB D;  4CAY B;  3MGR A;  1ID3 C;  2FJ7 B;  5B32 B;  3X1U B;  5AY8 D;  4E45 A;  1P3K D;  5E5A A;  3AZM A;  1P3P C;  3W98 D;  3MGS D;  4KUD D;  4Z5T B;  5AV5 C;  5KDM A;  4YM6 C;  3EPL A;  5B2I C;  5DNN A;  5B40 A;  3AZJ D;  3MGP A;  5GT0 B;  4KHA A;  3O62 C;  1M19 C;  4NE3 A;  1ZLA D;  5BT1 D;  5B2I B;  1P3L C;  5F99 B;  2DQN C;  5CP6 C;  4HGA B;  2NQB C;  1P3I D;  2Y2H A;  5DNM D;  3KUY A;  1P3L A;  5B32 C;  4EO5 C;  5GT3 A;  3W99 D;  1P3F C;  3C1B C;  3AZG C;  3A6N A;  3AZI B;  5GT3 C;  3WA9 A;  2JCH A;  1P3I A;  1P3M A;  4NE6 A;  1P3G A;  4YS3 C;  2F8N K;  1M1A A;  4DRB A;  3W96 A;  2HUE C;  1BH8 A;  3WAA C;  5B0Y B;  2XD5 A;  1HTA A;  3B6G C;  4J8V C;  1U35 B;  3AZN B;  3AN2 B;  5JA4 A;  3REH A;  3WTP E;  2PYO C;  5B32 G;  5GSU B;  3C1C B;  4J8W D;  4J8U C;  3AZK D;  3AYW D;  4XZQ A;  4Z2M H;  3X1S D;  3X1V B;  1P3G D;  1P3O A;  3X1T C;  4J8X D;  5B24 B;  2ZY2 A;  3LZ0 B;  3MVD B;  5AVB A;  3MGR D;  5B1M B;  5AV6 D;  2ZY5 A;  5E5A D;  2Y2K A;  3LJA D;  3AZF A;  3X1S A;  5GXQ B;  4YS3 B;  3LZ1 A;  4KUD A;  3AZE B;  3WTP A;  5CPJ B;  4JJN D;  1W2E A;  3C1C C;  4KGC C;  4LD9 C;  1JFI A;  2G5H C;  3B6G B;  5B33 D;  2XD1 A;  4UUZ B;  3A6N C;  3WA9 C;  2JSS A;  3H0L C;  3AV2 A;  1AOI C;  2ZY3 A;  5AV6 A;  3AZL C;  2ARO C;  5AV9 C;  2HIO A;  3REH C;  3KXB A;  4E44 A;  2G5I C;  4J8U A;  3REI A;  3V9R A;  2BYM B;  3REI B;  3O62 A;  3AZH B;  2PYO A;  4QLC A;  5CPI D;  3AV2 D;  3REJ A;  1F66 A;  4CSR A;  3UTB C;  2YFW A;  3AZM D;  3MGS A;  3W98 A;  2ZM5 A;  1P34 C;  5AVB C;  4Z66 B;  1WWS A;  1M1A D;  1P3K C;  4X23 B;  4H9Q B;  3KWQ C;  3WKJ B;  1ZLA A;  3MGQ A;  3B6F C;  4DQY B;  1EQZ A;  5B0Y C;  3WAA B;  3AZK A;  5B2J A;  2L5A A;  4AWL B;  5BS7 A;  1M19 D;  1P3L D;  2W8S A;  2ZY4 A;  4J8X A;  2YFV A;  3A1K A;  3C1B B;  1ID3 B;  1KX4 C;  5B0Z A;  4J8V A;  5AV9 A;  5AV8 B;  1P3I C;  2NQB D;  1M18 C;  3NQU B;  5CPK D;  4WU9 B;  4H9N B;  1P34 B;  2FJ7 D;  4H9S A;  5B32 D;  3AZF D;  1P3K B;  1KX5 B;  4YM6 A;  1M18 B;  3WTP D;  3W96 D;  4Z5T D;  5BO0 B;  3UTB A;  1BFM A;  2CV5 A;  5B33 A;  4H9R B;  3REL D;  3AZJ B;  5AY8 A;  3W97 B;  1P3B B;  4J8W A;  3AYW A;  4XZQ D;  2NZD C;  5B1L C;  4R8P B;  3AZK C;  4J8U D;  5B40 D;  1N1J B;  5B2J C;  5DNM B;  2NZD A;  5B31 A;  5CPI A;  3IP4 C;  5FUG A;  1P3G C;  1TZY D;  3AZE C;  5BNX A;  4KGC A;  4LD9 A;  5B2I A;  3MNN A;  3MGR C;  3NQJ B;  3UT9 B;  1P3P B;  4H9S C;  5G49 B;  5B31 D;  3REK B;  5AV5 B;  3REJ C;  4NE5 A;  1H3O A;  4KGC D;  4LD9 D;  1KU5 A;  2F8N B;  3B0D C;  3X1T B;  4G91 C;  5GSU D;  3AFA A;  3C1C D;  1M19 A;  3VH6 T;  3KXB D;  3X1V D;  3F6T A;  4AWL C;  5B1M C;  5AVC A;  5AV9 D;  3TU4 B;  5B24 D;  1BH8 B;  4H9P A;  1F66 D;  5CPK A;  3REH D;  5GXQ C;  3MGR B;  1HQ3 B;  5E5A B;  1P3F B;  2Y2P A;  3LJA B;  3KWQ B;  2BG1 A;  3B6F B;  4ZUX A;  5B0Z C;  4WU8 C;  2CWE A;  1AOI B;  5DNN B;  1TAF A;  3EPH A;  5CP6 B;  4HGA C;  1EQZ D;  2HUE B;  2ARO A;  3UTA D;  1P3O C;  1P3B C;  1KX3 B;  4ZUX D;  3TU4 C;  2NQB A;  5AY8 C;  3AZH D;  1HQ3 C;  1KX3 C;  3AZI C;  4WNN B;  3AZG B;  2FJ7 A;  3AV2 B;  3LZ0 C;  3MNN D;  4YM6 D;  4Z66 C;  5BNV A;  3LEL C;  5CPK C;  2HIO D;  3AZI A;  2FJ7 C;  5KDM B;  3AZF C;  3O62 D;  1M1A B;  4QLC D;  3AZH A;  5CPJ C;  3V9R B;  5BT1 C;  2PYO B;  4KHA B;  2RIQ A;  3LEL A;  5B1L B;  5GT0 D;  3REK C;  3REJ B;  5F99 A;  3REL C;  1P3A A;  4Z2M G;  3MVD C;  3AZL B;  4XZQ C;  2NZD D;  3W99 C;  4WU9 C;  3VH6 A;  3MGQ D;  3C1B D;  5GT0 A;  5B40 C;  3R45 A;  5B2J D;  3W99 B;  1R4V A;  1A7W A;  1KX5 D;  3LZ1 B;  4J8U B;  3KUY B;  4J8V D;  1BH9 A;  2YFV B;  4XUJ B;  5CHL B;  3W97 C;  3B0C W;  3LZ1 C;  2BYK B;  3AV1 C;  3X1S C;  3B0B A;  4ZBJ B;  5B32 A;  5B31 C;  3X1U A;  1U35 D;  5GSU A;  3AFA D;  3C1C A;  3REI C;  4J8X C;  3X1V A;  4Z5T A;  3AV1 A;  3P5J B;  1P3G B;  3UTB B;  5GSU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...