5B2IC

Human nucleosome containing cpg unmethylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iC00
1P3LA 3AFAC 4KHAB 3TU4D 5B2JA 3AV2A 4H9PA 3KWQB 5CPKD 1F66B 1P3GD 1H3OB 3LZ0C 1BH8A 4NE3A 3AZHD 4H9NA 4KUDA 3AN2C 4E44A 3REJD 3TU4B 3LZ1D 3REHA 1S32C 1P3BA 4JJND 5GT3D 3AZGD 3AFAA 3AZJD 4YM6D 5CPKB 2PYOD 1EQZC 1P3GB 1WWIA 3AZHB 1KX3C 2AROD 5B24C 3X1UC 4WU8D 3REJB 5AV9D 3LZ1B 5BT1D 3LZ0A 3X1VC 4JJNB 5GSUD 5GT3B 2NQBD 3AZGB 3AZJB 4YM6B 3AN2A 2PYOB 1ULYA 1S32A 4Z2MG 1M1AC 2AROB 4J8WC 1EQZA 4WU8B 3B6GD 5AV9B 5BNXA 3MVDC 4G91B 1KX3A 2NQBB 5GSUB 5AV6D 5B24A 3X1UA 3REKD 4WU9C 4LD9D 1Q9CA 5CHLB 1P3MD 3X1VA 4EO5C 4Z66D 4CSRB 3WA9D 4YS3D 4NE6A 3B6GB 1M1AA 1JFIB 4J8WA 5AV6B 2F8ND 3REKB 4LD9B 3VH5W 3W96C 3MVDA 2HUEC 1P3MB 4H9QB 5BNVA 5B1LC 4Z66B 3MGRD 4WU9A 3WA9B 4YS3B 3AV1C 1M18D 2F8NB 1TAFB 5G49B 1AOIC 5F99D 3NQUB 2L5AA 2F8NG 3KWQC 3MGRB 3W96A 3C1CD 4AWLC 5GT0C 1TZYD 5B1LA 3UTBC 1M18B 1M19D 5AV8D 4QLCD 3AV1A 5F99B 3WTPC 4HGAB 4UUZA 4Z5TD 4H9SC 5AY8D 3C1CB 1AOIA 4XZQC 1A7WA 1TZYB 1N1JA 3KWQA 1M19B 3LELD 3MGSD 5AV8B 4QLCB 5GT0A 3A6NC 3UTBA 5AVCC 3B0BA 4Z5TB 3AZND 1P3OD 5E5AC 5AY8B 3V9RA 3NQJA 3WTPA 4WNNB 5B0ZD 2IO5C 3AZKD 4H9SA 3LELB 5DNMD 3MGSB 4XZQA 1P3FD 5B2IC 5AV9C 4M6BA 4XUJD 1KX4C 3AZNB 1P3OB 2HIOD 5B31D 3MGQD 3C1BD 3A6NA 3KSYA 5AVCA 5B0ZB 5E5AA 5B32G 3AZKB 5DNMB 3W98D 3AYWD 1P3FB 5AV5D 4XUJB 1P3AD 2HIOB 5B31B 3MGQB 3C1BB 5B2IA 5AV9A 3UTAC 3AZLC 1KX4A 3AZMD 1KX5C 3W98B 4R8PC 3AYWB 5B0YC 5AV5B 1P3AB 3MNND 4H9RA 3RELC 5B33C 3AZFD 1F1EA 5GXQD 3KXBD 4G92B 3WKJC 2RVQD 1WWSA 3AZMB 3B0CT 5CPJC 1P34C 3KUYD 1U35D 5KDMA 3B6FD 3O62D 1ZLAC 3UTAA 4KGCD 3AZLA 1HQ3C 5JA4B 1P3ID 3W97C 3MNNB 4H9OB 3AZFB 1KX5A 1M18C 5GXQB 4R8PA 5B0YA 2BYKB 3KXBB 5B40D 2YFWB 1P3PC 3X1TD 4J8VD 4CAYA 5B33A 3KUYB 3RELA 1U35B 2F8NA 5BO0A 3WKJA 5JRGC 3LJAD 3O62B 3B6FB 4KGCB 1P3IB 5CPJA 1HTAA 5CPID 1P34A 1M19C 5B40B 1ZLAA 3AZEC 3VH6T 1HQ3A 3W97A 4J8VB 3X1TB 4J8UC 1M18A 5DNND 5CP6D 2NZDC 4J8XD 2FJ7C 5AY8C 3LJAB 1P3PA 1BH9A 3MGPC 3UT9D 2YFVB 3AZIC 5CPIB 1ID3D 3W99C 3X1SD 3REID 5JRGA 1P3KD 3R45A 4ZBJB 4X23C 5DNNB 4ZUXD 5CP6B 1M19A 4J8XB 5B32C 3AZEA 3UT9B 4J8UA 5B0ZC 1ID3B 2NZDA 3X1SB 3REIB 2FJ7A 1P3KB 5AY8A 1P3LD 3MGPA 3AZIA 3WAAC 5B2JD 3W99A 4ZUXB 3AV2D 2HIOC 4X23A 3C1BC 2BYMB 5B32A 1P3LB 4KUDD 5B1MD 5B0ZA 5C3IB 5B2JB 3REHD 3AV2B 3WAAA 1F66C 1BH8B 2HIOA 4H9NB 4KUDB 3C1BA 3B0DB 5B1MB 3REHB 3LZ0D 3TU4C 1BFMA 3AN2D 5CPKC 4KHAA 1S32D 5BS7C 1P3GC 3AZHC 3B0CW 1EQZD 1F66A 2LY8A 3LZ0B 3REJC 3LZ1C 1H3OA 4JJNC 5GT3C 3X1UD 3AN2B 3AZGC 3AZJC 4YM6C 1S32B 2PYOC 3TU4A 3X1VD 3VH5A 1EQZB 2AROC 5CPKA 5BNXB 1R4VA 1M1AD 5BS7A 4WU8C 1P3GA 5BT1C 3AZHA 4G91C 2NQBC 5GSUC 3X1UB 1KU5A 3REJA 3X1VB 3LZ1A 4JJNA 5GT3A 4WU9D 3AZGA 3AZJA 4YM6A 2PYOA 3UT9C 1M1AB 3B6GC 5AVBD 1ID3C 2AROA 1B6WA 5AV6C 3REKC 4WU8A 4LD9C 2JSSA 5BNVB 1P3MC 2NQBA 3VH5T 5GSUA 4WU9B 4Z66C 5B31G 3W96D 3WA9C 4YS3C 4EO5B 5B1LD 5AVBB 4NFTA 4CSRA 2F8NH 3UT9A 3B6GA 3AV1D 1ID3A 5C3IC 3VH6A 1JFIA 5AV6A 3MGRC 3REKA 2HUEB 3W96B 1AOID 4LD9A 2CV5D 4DRBA 4H9QA 5B1LB 1P3MA 4Z66A 3WA9A 4YS3A 5GT0D 3AV1B 5B1MC 3UTBD 4UUZB 5F99C 1TAFA 4HGAC 5G49A 4WZSB 1AOIB 2CV5B 3WTPD 3C1CC 1N1JB 3NQUA 1TZYC 3MGRA 4AWLB 4XZQD 5GT0B 5AV8C 3UTBB 4QLCC 4Z5TC 3V9RB 3A6ND 3NQJB 3WTPB 5B1MA 5AVCD 5F99A 5E5AD 4XZQB 3LELC 3C1CA 3MGSC 1TZYA 3AZNC 1P3OC 3A6NB 5B2ID 5AV8A 4QLCA 5AVCB 1KX4D 5E5AB 4Z5TA 3AZKC 5DNMC 4WNNA 4WV4B 2IO5B 1P3FC 4XUJC 5FUGB 3LELA 5B31C 5B2IB 3MGSA 3MGQC 1KX4B 3AZNA 1P3OA 3W98C 3UTAD 3AYWC 3AZLD 4H9RB 5AV5C 5AVBC 1P3BD 1P3AC 4H9PB 4R8PD 5B0YD 3AZKA 1KX5D 5DNMA 3AFAD 4G92C 1P3FA 5B33D 3RELD 4XUJA 3AZMC 5KDMB 3WKJD 5B31A 3UTAB 3MGQA 3AZLB 5CPJD 1P34D 1KX5B 1P3BB 4R8PB 3MNNC 5B0YB 3AZFC 1ZLAD 3W98A 5GXQC 3AFAB 3AYWA 3KXBC 1HQ3D 3W97D 4CAYB 2RVQC 5AV5A 5B33B 5AVBA 3RELB 1P3AA 5BO0B 3KUYC 3WKJB 1U35C 1P3PD 3B6FC 3O62C 5CPJB 2CV5C 1P34B 4KGCC 4E45A 3AZMA 1P3IC 1KX3D 5JRGD 4Z2MH 1ZLAB 5B24D 1HQ3B 3W97B 5B40C 5JA4A 4J8VC 3X1TC 3MNNA 4H9OA 3AZFA 5GXQA 3AZED 2BYKA 3KXBA 1P3PB 1BH9B 2YFWA 3LJAC 4J8UD 2NZDD 5CPIC 3KUYA 1KX3B 2FJ7D 5JRGB 4J8WD 1U35A 2F8NK 3MGPD 3R45B 5B24B 3B6FA 3O62A 3AZID 2CV5A 4KGCA 4ZBJC 3MVDD 1P3IA 3W99D 3WTPE 3VH6W 5DNNC 5CP6C 3AZEB 4J8XC 4X23D 5B40A 4J8UB 3X1TA 4J8VA 2NZDB 5B32D 2FJ7B 4J8WB 3REIC 3MGPB 3X1SC 1P3KC 3LJAA 3AZIB 4DRAA 3MVDB 2YFVA 2CWEA 5CPIA 3W99B 4ZUXC 4X23B 3WAAD 1B67A 5DNNA 5B32B 5CP6A 4J8XA 1P3LC 5B2JC 3X1SA 3REIA 3AV2C 1P3KA 3WAAB 4ZUXA 5FUGA 3KWQD 1F66D 4KUDC 3B0DC 3REHC 2BYMA 1P3BC 4NE5A
chains in the Genus database with same CATH superfamily
1P3LA 3AFAC 2ZY5A 4KHAB 3TU4D 5B2JA 3AV2A 4H9PA 3KWQB 5CPKD 1F66B 1P3GD 1H3OB 3LZ0C 1BH8A 4NE3A 3AZHD 4H9NA 4KUDA 3AN2C 4E44A 3REJD 3TU4B 3LZ1D 3REHA 1S32C 1P3BA 2VQRA 4JJND 5GT3D 3AZGD 3AFAA 3AZJD 4YM6D 5CPKB 2PYOD 1EQZC 1P3GB 1WWIA 3AZHB 1KX3C 2AROD 5B24C 3X1UC 4WU8D 3REJB 5AV9D 3LZ1B 5BT1D 3LZ0A 3X1VC 4JJNB 5GSUD 5GT3B 2NQBD 3AZGB 3AZJB 4YM6B 3AN2A 2PYOB 1ULYA 2DF4C 1S32A 4Z2MG 1M1AC 2AROB 4J8WC 1EQZA 4WU8B 3B6GD 5AV9B 5BNXA 3MVDC 4G91B 1KX3A 2NQBB 5GSUB 5AV6D 5B24A 3X1UA 3REKD 4WU9C 4LD9D 1Q9CA 1Z2CB 5CHLB 1P3MD 3X1VA 4EO5C 4Z66D 4CSRB 2Y2LA 3WA9D 4YS3D 4NE6A 3B6GB 2Y2QA 1M1AA 2JCHA 1JFIB 4J8WA 5AV6B 2F8ND 3REKB 4LD9B 3VH5W 3W96C 3MVDA 2HUEC 1P3MB 4H9QB 5BNVA 5B1LC 4Z66B 3MGRD 4WU9A 3WA9B 4YS3B 3AV1C 1M18D 2F8NB 1TAFB 5G49B 1AOIC 5F99D 3NQUB 2L5AA 2F8NG 3KWQC 3MGRB 3EPJA 3W96A 3C1CD 4AWLC 5GT0C 1TZYD 5B1LA 3UTBC 1M18B 1M19D 5AV8D 4QLCD 3A1KA 3AV1A 5F99B 3WTPC 4HGAB 4UUZA 4Z5TD 2Y2KA 2Y2NA 4H9SC 5AY8D 3C1CB 1AOIA 4XZQC 1A7WA 1TZYB 1N1JA 3KWQA 1M19B 3LELD 3MGSD 5AV8B 4QLCB 5GT0A 3A6NC 3UTBA 5AVCC 3B0BA 4Z5TB 3AZND 1P3OD 5E5AC 5AY8B 3V9RA 3NQJA 3WTPA 4WNNB 5B0ZD 2Y2JA 3EPLA 2IO5C 3AZKD 4H9SA 3LELB 5DNMD 3MGSB 4XZQA 2Y2PA 5B2IC 5AV9C 4M6BA 1P3FD 4XUJD 1KX4C 3AZNB 1P3OB 2HIOD 5B31D 3MGQD 3C1BD 3A6NA 3P5JB 3KSYA 5AVCA 5B0ZB 5E5AA 5B32G 3AZKB 5DNMB 3W98D 3AYWD 1P3FB 2Y2OA 5AV5D 4XUJB 1P3AD 2HIOB 5B31B 3MGQB 3C1BB 5B2IA 5AV9A 3UTAC 3AZLC 1KX4A 3AZMD 3F6TA 1KX5C 3W98B 4R8PC 3AYWB 5B0YC 5AV5B 1P3AB 3MNND 4H9RA 3RELC 5B33C 3AZFD 1F1EA 5GXQD 3KXBD 4G92B 3WKJC 2RVQD 1WWSA 3AZMB 3B0CT 5CPJC 3IP4C 3KUYD 1P34C 1U35D 5KDMA 3AL0C 3B6FD 3O62D 1ZLAC 3UTAA 4KGCD 3AZLA 2FFFB 1HQ3C 5JA4B 1P3ID 3W97C 3MNNB 4H9OB 3AZFB 1KX5A 1M18C 5GXQB 4R8PA 5B0YA 2BYKB 3KXBB 5B40D 2Y2GA 2YFWB 1P3PC 3X1TD 4J8VD 4CAYA 5B33A 3KUYB 1T3UA 3RELA 1U35B 2F8NA 5BO0A 3WKJA 5JRGC 3LJAD 3O62B 3B6FB 4KGCB 1P3IB 4UPKA 1HTAA 5CPJA 5CPID 1P34A 1M19C 5B40B 1ZLAA 3AZEC 3VH6T 1HQ3A 3W97A 4J8VB 3X1TB 4J8UC 1M18A 5DNND 5CP6D 2NZDC 4J8XD 2FJ7C 5AY8C 3LJAB 1P3PA 1BH9A 3MGPC 3UT9D 2YFVB 3AZIC 5CPIB 1ID3D 3W99C 3X1SD 3REID 5JRGA 1P3KD 3R45A 4ZBJB 4X23C 2W8SA 5DNNB 4ZUXD 5CP6B 1M19A 4J8XB 5B32C 3AZEA 3UT9B 4J8UA 5B0ZC 2ZM5A 1ID3B 2NZDA 3X1SB 3REIB 2FJ7A 1P3KB 5AY8A 1P3LD 3MGPA 3AZIA 3WAAC 5B2JD 3FDDA 4ZUXB 3AV2D 3W99A 2HIOC 4X23A 3C1BC 2BYMB 5B32A 1P3LB 4KUDD 2G5IC 3KFUG 5B1MD 5B0ZA 5C3IB 5B2JB 3REHD 3AV2B 2ZY2A 3WAAA 1F66C 1BH8B 2HIOA 4H9NB 4KUDB 3C1BA 3B0DB 5B1MB 2RIQA 3LZ0D 3REHB 3TU4C 1BFMA 3AN2D 5CPKC 4KHAA 1S32D 5BS7C 1P3GC 3AZHC 3B0CW 1EQZD 1F66A 2LY8A 3LZ0B 3REJC 3H0LC 3LZ1C 1H3OA 4JJNC 5GT3C 3X1UD 3AN2B 3AZGC 3AZJC 4YM6C 1S32B 2PYOC 3TU4A 3X1VD 3VH5A 1EQZB 2AROC 5CPKA 2ZY3A 5BNXB 1R4VA 1M1AD 5BS7A 4WU8C 1P3GA 5BT1C 3AZHA 4G91C 2NQBC 5GSUC 3X1UB 1KU5A 1PZRA 3REJA 3X1VB 3LZ1A 2ZY4A 3EPHA 4JJNA 5GT3A 4WU9D 3AZGA 3AZJA 4YM6A 2PYOA 3UT9C 1M1AB 3B6GC 3EG5B 5AVBD 1ID3C 2AROA 1B6WA 3H0RC 5AV6C 3REKC 4WU8A 4LD9C 2JSSA 5BNVB 1P3MC 2NQBA 3VH5T 5GSUA 4WU9B 4Z66C 5B31G 3W96D 3WA9C 4YS3C 4EO5B 5B1LD 5AVBB 4NFTA 4CSRA 2F8NH 3UT9A 3B6GA 3AV1D 1ID3A 5C3IC 3VH6A 1JFIA 5AV6A 3MGRC 3REKA 2HUEB 3W96B 1AOID 4LD9A 2CV5D 4DRBA 4H9QA 5B1LB 1P3MA 4Z66A 3WA9A 4YS3A 5GT0D 3AV1B 5B1MC 3UTBD 4UUZB 5F99C 1TAFA 4HGAC 5G49A 4WZSB 1AOIB 2CV5B 3WTPD 3C1CC 1N1JB 3H0MC 3EPKA 3NQUA 1TZYC 3MGRA 4AWLB 4XZQD 5GT0B 2BG1A 5AV8C 3UTBB 4QLCC 4Z5TC 3V9RB 3A6ND 3NQJB 3WTPB 5B1MA 5AVCD 5F99A 5E5AD 4XZQB 3LELC 3C1CA 3MGSC 1TZYA 3AZNC 1P3OC 3A6NB 5B2ID 5AV8A 4QLCA 5AVCB 1KX4D 5E5AB 4Z5TA 2UWXA 3AZKC 5DNMC 4WNNA 4WV4B 2IO5B 1P3FC 4XUJC 5FUGB 3LELA 5B31C 5B2IB 3MGSA 3MGQC 1KX4B 3AZNA 1P3OA 2G5HC 3W98C 3UTAD 3AYWC 3AZLD 2Y2MA 4H9RB 5AV5C 5AVBC 1P3BD 1P3AC 4H9PB 4R8PD 5B0YD 3AZKA 1KX5D 5DNMA 3AFAD 4G92C 1P3FA 2DQNC 5B33D 3RELD 4XUJA 3AZMC 5KDMB 3WKJD 1W2EA 5B31A 3UTAB 3MGQA 3AZLB 5CPJD 1P34D 2J8PA 1KX5B 1P3BB 4R8PB 3MNNC 5B0YB 3AZFC 1ZLAD 3W98A 5GXQC 3AFAB 3AYWA 3KXBC 1HQ3D 3W97D 4CAYB 4DQYB 2RVQC 5AV5A 5B33B 5AVBA 2JE5A 3RELB 1P3AA 5BO0B 3KUYC 3WKJB 1U35C 1P3PD 2XD1A 3B6FC 3O62C 5CPJB 2CV5C 1P34B 4KGCC 4E45A 3AZMA 1P3IC 1KX3D 5JRGD 4Z2MH 1ZLAB 5B24D 1HQ3B 3W97B 5B40C 5JA4A 4J8VC 3X1TC 3MNNA 4H9OA 3AZFA 5GXQA 3AZED 2BYKA 3KXBA 1P3PB 1BH9B 2YFWA 3LJAC 4J8UD 2NZDD 5CPIC 3KUYA 1KX3B 2FJ7D 5JRGB 4J8WD 1U35A 2F8NK 3MGPD 3R45B 5B24B 3B6FA 3O62A 3AZID 2CV5A 4KGCA 4ZBJC 3MVDD 1P3IA 3W99D 2F2AC 3WTPE 3VH6W 5DNNC 5CP6C 3AZEB 4J8XC 4X23D 5B40A 4J8UB 3X1TA 4J8VA 2NZDB 5B32D 2FJ7B 4J8WB 3REIC 3MGPB 3X1SC 1P3KC 3LJAA 3AZIB 4DRAA 2XD5A 3MVDB 2YFVA 2CWEA 2Y2IA 5CPIA 3W99B 2Y2HA 4ZUXC 4X23B 3WAAD 1B67A 4WJ3C 5DNNA 5B32B 5CP6A 4J8XA 1P3LC 5B2JC 3A1IA 3X1SA 3REIA 3AV2C 1P3KA 3WAAB 4ZUXA 5FUGA 3KWQD 1F66D 4KUDC 3B0DC 3REHC 2BYMA 1P3BC 4NE5A
chains in the Genus database with same CATH topology
1P3LA 3AFAC 2ZY5A 4KHAB 3TU4D 5B2JA 3AV2A 4H9PA 3KWQB 5CPKD 1F66B 1P3GD 1H3OB 3LZ0C 1BH8A 4NE3A 3AZHD 4H9NA 4KUDA 3AN2C 4E44A 3REJD 3TU4B 3LZ1D 3REHA 1S32C 1P3BA 2VQRA 4JJND 5GT3D 3AZGD 3AFAA 3AZJD 4YM6D 5CPKB 2PYOD 1EQZC 1P3GB 1WWIA 3AZHB 1KX3C 2AROD 5B24C 3X1UC 4WU8D 3REJB 5AV9D 3LZ1B 5BT1D 3LZ0A 3X1VC 4JJNB 5GSUD 5GT3B 2NQBD 3AZGB 3AZJB 4YM6B 3AN2A 2PYOB 1ULYA 2DF4C 1S32A 4Z2MG 1M1AC 2AROB 4J8WC 1EQZA 4WU8B 3B6GD 5AV9B 5BNXA 3MVDC 4G91B 1KX3A 2NQBB 5GSUB 5AV6D 5B24A 3X1UA 3REKD 4WU9C 4LD9D 1Q9CA 1Z2CB 5CHLB 1P3MD 3X1VA 4EO5C 4Z66D 4CSRB 2Y2LA 3WA9D 4YS3D 4NE6A 3B6GB 2Y2QA 1M1AA 2JCHA 1JFIB 4J8WA 5AV6B 2F8ND 3REKB 4LD9B 3VH5W 3W96C 3MVDA 2HUEC 1P3MB 4H9QB 5BNVA 5B1LC 4Z66B 3MGRD 4WU9A 3WA9B 4YS3B 3AV1C 1M18D 2F8NB 1TAFB 5G49B 1AOIC 5F99D 3NQUB 2L5AA 2F8NG 3KWQC 3MGRB 3EPJA 3W96A 3C1CD 4AWLC 5GT0C 1TZYD 5B1LA 3UTBC 1M18B 1M19D 5AV8D 4QLCD 3A1KA 3AV1A 5F99B 3WTPC 4HGAB 4UUZA 4Z5TD 2Y2KA 2Y2NA 4H9SC 5AY8D 3C1CB 1AOIA 4XZQC 1A7WA 1TZYB 1N1JA 3KWQA 1M19B 3LELD 3MGSD 5AV8B 4QLCB 5GT0A 3A6NC 3UTBA 5AVCC 3B0BA 4Z5TB 3AZND 1P3OD 5E5AC 5AY8B 3V9RA 3NQJA 3WTPA 4WNNB 5B0ZD 2Y2JA 3EPLA 2IO5C 3AZKD 4H9SA 3LELB 5DNMD 3MGSB 4XZQA 2Y2PA 5B2IC 5AV9C 4M6BA 1P3FD 4XUJD 1KX4C 3AZNB 1P3OB 2HIOD 5B31D 3MGQD 3C1BD 3A6NA 3P5JB 3KSYA 5AVCA 5B0ZB 5E5AA 5B32G 3AZKB 5DNMB 3W98D 3AYWD 1P3FB 2Y2OA 5AV5D 4XUJB 1P3AD 2HIOB 5B31B 3MGQB 3C1BB 5B2IA 5AV9A 3UTAC 3AZLC 1KX4A 3AZMD 3F6TA 1KX5C 3W98B 4R8PC 3AYWB 5B0YC 5AV5B 1P3AB 3MNND 4H9RA 3RELC 5B33C 3AZFD 1F1EA 5GXQD 3KXBD 4G92B 3WKJC 2RVQD 1WWSA 3AZMB 3B0CT 5CPJC 3IP4C 3KUYD 1P34C 1U35D 5KDMA 3AL0C 3B6FD 3O62D 1ZLAC 3UTAA 4KGCD 3AZLA 2FFFB 1HQ3C 5JA4B 1P3ID 3W97C 3MNNB 4H9OB 3AZFB 1KX5A 1M18C 5GXQB 4R8PA 5B0YA 2BYKB 3KXBB 5B40D 2Y2GA 2YFWB 1P3PC 3X1TD 4J8VD 4CAYA 5B33A 3KUYB 1T3UA 3RELA 1U35B 2F8NA 5BO0A 3WKJA 5JRGC 3LJAD 3O62B 3B6FB 4KGCB 1P3IB 4UPKA 1HTAA 5CPJA 5CPID 1P34A 1M19C 5B40B 1ZLAA 3AZEC 3VH6T 1HQ3A 3W97A 4J8VB 3X1TB 4J8UC 1M18A 5DNND 5CP6D 2NZDC 4J8XD 2FJ7C 5AY8C 3LJAB 1P3PA 1BH9A 3MGPC 3UT9D 2YFVB 3AZIC 5CPIB 1ID3D 3W99C 3X1SD 3REID 5JRGA 1P3KD 3R45A 4ZBJB 4X23C 2W8SA 5DNNB 4ZUXD 5CP6B 1M19A 4J8XB 5B32C 3AZEA 3UT9B 4J8UA 5B0ZC 2ZM5A 1ID3B 2NZDA 3X1SB 3REIB 2FJ7A 1P3KB 5AY8A 1P3LD 3MGPA 3AZIA 3WAAC 5B2JD 3FDDA 4ZUXB 3AV2D 3W99A 2HIOC 4X23A 3C1BC 2BYMB 5B32A 1P3LB 4KUDD 2G5IC 3KFUG 5B1MD 5B0ZA 5C3IB 5B2JB 3REHD 3AV2B 2ZY2A 3WAAA 1F66C 1BH8B 2HIOA 4H9NB 4KUDB 3C1BA 3B0DB 5B1MB 2RIQA 3LZ0D 3REHB 3TU4C 1BFMA 3AN2D 5CPKC 4KHAA 1S32D 5BS7C 1P3GC 3AZHC 3B0CW 1EQZD 1F66A 2LY8A 3LZ0B 3REJC 3H0LC 3LZ1C 1H3OA 4JJNC 5GT3C 3X1UD 3AN2B 3AZGC 3AZJC 4YM6C 1S32B 2PYOC 3TU4A 3X1VD 3VH5A 1EQZB 2AROC 5CPKA 2ZY3A 5BNXB 1R4VA 1M1AD 5BS7A 4WU8C 1P3GA 5BT1C 3AZHA 4G91C 2NQBC 5GSUC 3X1UB 1KU5A 1PZRA 3REJA 3X1VB 3LZ1A 2ZY4A 3EPHA 4JJNA 5GT3A 4WU9D 3AZGA 3AZJA 4YM6A 2PYOA 3UT9C 1M1AB 3B6GC 3EG5B 5AVBD 1ID3C 2AROA 1B6WA 3H0RC 5AV6C 3REKC 4WU8A 4LD9C 2JSSA 5BNVB 1P3MC 2NQBA 3VH5T 5GSUA 4WU9B 4Z66C 5B31G 3W96D 3WA9C 4YS3C 4EO5B 5B1LD 5AVBB 4NFTA 4CSRA 2F8NH 3UT9A 3B6GA 3AV1D 1ID3A 5C3IC 3VH6A 1JFIA 5AV6A 3MGRC 3REKA 2HUEB 3W96B 1AOID 4LD9A 2CV5D 4DRBA 4H9QA 5B1LB 1P3MA 4Z66A 3WA9A 4YS3A 5GT0D 3AV1B 5B1MC 3UTBD 4UUZB 5F99C 1TAFA 4HGAC 5G49A 4WZSB 1AOIB 2CV5B 3WTPD 3C1CC 1N1JB 3H0MC 3EPKA 3NQUA 1TZYC 3MGRA 4AWLB 4XZQD 5GT0B 2BG1A 5AV8C 3UTBB 4QLCC 4Z5TC 3V9RB 3A6ND 3NQJB 3WTPB 5B1MA 5AVCD 5F99A 5E5AD 4XZQB 3LELC 3C1CA 3MGSC 1TZYA 3AZNC 1P3OC 3A6NB 5B2ID 5AV8A 4QLCA 5AVCB 1KX4D 5E5AB 4Z5TA 2UWXA 3AZKC 5DNMC 4WNNA 4WV4B 2IO5B 1P3FC 4XUJC 5FUGB 3LELA 5B31C 5B2IB 3MGSA 3MGQC 1KX4B 3AZNA 1P3OA 2G5HC 3W98C 3UTAD 3AYWC 3AZLD 2Y2MA 4H9RB 5AV5C 5AVBC 1P3BD 1P3AC 4H9PB 4R8PD 5B0YD 3AZKA 1KX5D 5DNMA 3AFAD 4G92C 1P3FA 2DQNC 5B33D 3RELD 4XUJA 3AZMC 5KDMB 3WKJD 1W2EA 5B31A 3UTAB 3MGQA 3AZLB 5CPJD 1P34D 2J8PA 1KX5B 1P3BB 4R8PB 3MNNC 5B0YB 3AZFC 1ZLAD 3W98A 5GXQC 3AFAB 3AYWA 3KXBC 1HQ3D 3W97D 4CAYB 4DQYB 2RVQC 5AV5A 5B33B 5AVBA 2JE5A 3RELB 1P3AA 5BO0B 3KUYC 3WKJB 1U35C 1P3PD 2XD1A 3B6FC 3O62C 5CPJB 2CV5C 1P34B 4KGCC 4E45A 3AZMA 1P3IC 1KX3D 5JRGD 4Z2MH 1ZLAB 5B24D 1HQ3B 3W97B 5B40C 5JA4A 4J8VC 3X1TC 3MNNA 4H9OA 3AZFA 5GXQA 3AZED 2BYKA 3KXBA 1P3PB 1BH9B 2YFWA 3LJAC 4J8UD 2NZDD 5CPIC 3KUYA 1KX3B 2FJ7D 5JRGB 4J8WD 1U35A 2F8NK 3MGPD 3R45B 5B24B 3B6FA 3O62A 3AZID 2CV5A 4KGCA 4ZBJC 3MVDD 1P3IA 3W99D 2F2AC 3WTPE 3VH6W 5DNNC 5CP6C 3AZEB 4J8XC 4X23D 5B40A 4J8UB 3X1TA 4J8VA 2NZDB 5B32D 2FJ7B 4J8WB 3REIC 3MGPB 3X1SC 1P3KC 3LJAA 3AZIB 4DRAA 2XD5A 3MVDB 2YFVA 2CWEA 2Y2IA 5CPIA 3W99B 2Y2HA 4ZUXC 4X23B 3WAAD 1B67A 4WJ3C 5DNNA 5B32B 5CP6A 4J8XA 1P3LC 5B2JC 3A1IA 3X1SA 3REIA 3AV2C 1P3KA 3WAAB 4ZUXA 5FUGA 3KWQD 1F66D 4KUDC 3B0DC 3REHC 2BYMA 1P3BC 4NE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3L A;  3AFA C;  4KHA B;  3TU4 D;  5B2J A;  3AV2 A;  4H9P A;  3KWQ B;  5CPK D;  1F66 B;  1P3G D;  1H3O B;  3LZ0 C;  1BH8 A;  4NE3 A;  3AZH D;  4H9N A;  4KUD A;  3AN2 C;  4E44 A;  3REJ D;  3TU4 B;  3LZ1 D;  3REH A;  1S32 C;  1P3B A;  4JJN D;  5GT3 D;  3AZG D;  3AFA A;  3AZJ D;  4YM6 D;  5CPK B;  2PYO D;  1EQZ C;  1P3G B;  1WWI A;  3AZH B;  1KX3 C;  2ARO D;  5B24 C;  3X1U C;  4WU8 D;  3REJ B;  5AV9 D;  3LZ1 B;  5BT1 D;  3LZ0 A;  3X1V C;  4JJN B;  5GSU D;  5GT3 B;  2NQB D;  3AZG B;  3AZJ B;  4YM6 B;  3AN2 A;  2PYO B;  1ULY A;  1S32 A;  4Z2M G;  1M1A C;  2ARO B;  4J8W C;  1EQZ A;  4WU8 B;  3B6G D;  5AV9 B;  5BNX A;  3MVD C;  4G91 B;  1KX3 A;  2NQB B;  5GSU B;  5AV6 D;  5B24 A;  3X1U A;  3REK D;  4WU9 C;  4LD9 D;  1Q9C A;  5CHL B;  1P3M D;  3X1V A;  4EO5 C;  4Z66 D;  4CSR B;  3WA9 D;  4YS3 D;  4NE6 A;  3B6G B;  1M1A A;  1JFI B;  4J8W A;  5AV6 B;  2F8N D;  3REK B;  4LD9 B;  3VH5 W;  3W96 C;  3MVD A;  2HUE C;  1P3M B;  4H9Q B;  5BNV A;  5B1L C;  4Z66 B;  3MGR D;  4WU9 A;  3WA9 B;  4YS3 B;  3AV1 C;  1M18 D;  2F8N B;  1TAF B;  5G49 B;  1AOI C;  5F99 D;  3NQU B;  2L5A A;  2F8N G;  3KWQ C;  3MGR B;  3W96 A;  3C1C D;  4AWL C;  5GT0 C;  1TZY D;  5B1L A;  3UTB C;  1M18 B;  1M19 D;  5AV8 D;  4QLC D;  3AV1 A;  5F99 B;  3WTP C;  4HGA B;  4UUZ A;  4Z5T D;  4H9S C;  5AY8 D;  3C1C B;  1AOI A;  4XZQ C;  1A7W A;  1TZY B;  1N1J A;  3KWQ A;  1M19 B;  3LEL D;  3MGS D;  5AV8 B;  4QLC B;  5GT0 A;  3A6N C;  3UTB A;  5AVC C;  3B0B A;  4Z5T B;  3AZN D;  1P3O D;  5E5A C;  5AY8 B;  3V9R A;  3NQJ A;  3WTP A;  4WNN B;  5B0Z D;  2IO5 C;  3AZK D;  4H9S A;  3LEL B;  5DNM D;  3MGS B;  4XZQ A;  1P3F D;  5B2I C;  5AV9 C;  4M6B A;  4XUJ D;  1KX4 C;  3AZN B;  1P3O B;  2HIO D;  5B31 D;  3MGQ D;  3C1B D;  3A6N A;  3KSY A;  5AVC A;  5B0Z B;  5E5A A;  5B32 G;  3AZK B;  5DNM B;  3W98 D;  3AYW D;  1P3F B;  5AV5 D;  4XUJ B;  1P3A D;  2HIO B;  5B31 B;  3MGQ B;  3C1B B;  5B2I A;  5AV9 A;  3UTA C;  3AZL C;  1KX4 A;  3AZM D;  1KX5 C;  3W98 B;  4R8P C;  3AYW B;  5B0Y C;  5AV5 B;  1P3A B;  3MNN D;  4H9R A;  3REL C;  5B33 C;  3AZF D;  1F1E A;  5GXQ D;  3KXB D;  4G92 B;  3WKJ C;  2RVQ D;  1WWS A;  3AZM B;  3B0C T;  5CPJ C;  1P34 C;  3KUY D;  1U35 D;  5KDM A;  3B6F D;  3O62 D;  1ZLA C;  3UTA A;  4KGC D;  3AZL A;  1HQ3 C;  5JA4 B;  1P3I D;  3W97 C;  3MNN B;  4H9O B;  3AZF B;  1KX5 A;  1M18 C;  5GXQ B;  4R8P A;  5B0Y A;  2BYK B;  3KXB B;  5B40 D;  2YFW B;  1P3P C;  3X1T D;  4J8V D;  4CAY A;  5B33 A;  3KUY B;  3REL A;  1U35 B;  2F8N A;  5BO0 A;  3WKJ A;  5JRG C;  3LJA D;  3O62 B;  3B6F B;  4KGC B;  1P3I B;  5CPJ A;  1HTA A;  5CPI D;  1P34 A;  1M19 C;  5B40 B;  1ZLA A;  3AZE C;  3VH6 T;  1HQ3 A;  3W97 A;  4J8V B;  3X1T B;  4J8U C;  1M18 A;  5DNN D;  5CP6 D;  2NZD C;  4J8X D;  2FJ7 C;  5AY8 C;  3LJA B;  1P3P A;  1BH9 A;  3MGP C;  3UT9 D;  2YFV B;  3AZI C;  5CPI B;  1ID3 D;  3W99 C;  3X1S D;  3REI D;  5JRG A;  1P3K D;  3R45 A;  4ZBJ B;  4X23 C;  5DNN B;  4ZUX D;  5CP6 B;  1M19 A;  4J8X B;  5B32 C;  3AZE A;  3UT9 B;  4J8U A;  5B0Z C;  1ID3 B;  2NZD A;  3X1S B;  3REI B;  2FJ7 A;  1P3K B;  5AY8 A;  1P3L D;  3MGP A;  3AZI A;  3WAA C;  5B2J D;  3W99 A;  4ZUX B;  3AV2 D;  2HIO C;  4X23 A;  3C1B C;  2BYM B;  5B32 A;  1P3L B;  4KUD D;  5B1M D;  5B0Z A;  5C3I B;  5B2J B;  3REH D;  3AV2 B;  3WAA A;  1F66 C;  1BH8 B;  2HIO A;  4H9N B;  4KUD B;  3C1B A;  3B0D B;  5B1M B;  3REH B;  3LZ0 D;  3TU4 C;  1BFM A;  3AN2 D;  5CPK C;  4KHA A;  1S32 D;  5BS7 C;  1P3G C;  3AZH C;  3B0C W;  1EQZ D;  1F66 A;  2LY8 A;  3LZ0 B;  3REJ C;  3LZ1 C;  1H3O A;  4JJN C;  5GT3 C;  3X1U D;  3AN2 B;  3AZG C;  3AZJ C;  4YM6 C;  1S32 B;  2PYO C;  3TU4 A;  3X1V D;  3VH5 A;  1EQZ B;  2ARO C;  5CPK A;  5BNX B;  1R4V A;  1M1A D;  5BS7 A;  4WU8 C;  1P3G A;  5BT1 C;  3AZH A;  4G91 C;  2NQB C;  5GSU C;  3X1U B;  1KU5 A;  3REJ A;  3X1V B;  3LZ1 A;  4JJN A;  5GT3 A;  4WU9 D;  3AZG A;  3AZJ A;  4YM6 A;  2PYO A;  3UT9 C;  1M1A B;  3B6G C;  5AVB D;  1ID3 C;  2ARO A;  1B6W A;  5AV6 C;  3REK C;  4WU8 A;  4LD9 C;  2JSS A;  5BNV B;  1P3M C;  2NQB A;  3VH5 T;  5GSU A;  4WU9 B;  4Z66 C;  5B31 G;  3W96 D;  3WA9 C;  4YS3 C;  4EO5 B;  5B1L D;  5AVB B;  4NFT A;  4CSR A;  2F8N H;  3UT9 A;  3B6G A;  3AV1 D;  1ID3 A;  5C3I C;  3VH6 A;  1JFI A;  5AV6 A;  3MGR C;  3REK A;  2HUE B;  3W96 B;  1AOI D;  4LD9 A;  2CV5 D;  4DRB A;  4H9Q A;  5B1L B;  1P3M A;  4Z66 A;  3WA9 A;  4YS3 A;  5GT0 D;  3AV1 B;  5B1M C;  3UTB D;  4UUZ B;  5F99 C;  1TAF A;  4HGA C;  5G49 A;  4WZS B;  1AOI B;  2CV5 B;  3WTP D;  3C1C C;  1N1J B;  3NQU A;  1TZY C;  3MGR A;  4AWL B;  4XZQ D;  5GT0 B;  5AV8 C;  3UTB B;  4QLC C;  4Z5T C;  3V9R B;  3A6N D;  3NQJ B;  3WTP B;  5B1M A;  5AVC D;  5F99 A;  5E5A D;  4XZQ B;  3LEL C;  3C1C A;  3MGS C;  1TZY A;  3AZN C;  1P3O C;  3A6N B;  5B2I D;  5AV8 A;  4QLC A;  5AVC B;  1KX4 D;  5E5A B;  4Z5T A;  3AZK C;  5DNM C;  4WNN A;  4WV4 B;  2IO5 B;  1P3F C;  4XUJ C;  5FUG B;  3LEL A;  5B31 C;  5B2I B;  3MGS A;  3MGQ C;  1KX4 B;  3AZN A;  1P3O A;  3W98 C;  3UTA D;  3AYW C;  3AZL D;  4H9R B;  5AV5 C;  5AVB C;  1P3B D;  1P3A C;  4H9P B;  4R8P D;  5B0Y D;  3AZK A;  1KX5 D;  5DNM A;  3AFA D;  4G92 C;  1P3F A;  5B33 D;  3REL D;  4XUJ A;  3AZM C;  5KDM B;  3WKJ D;  5B31 A;  3UTA B;  3MGQ A;  3AZL B;  5CPJ D;  1P34 D;  1KX5 B;  1P3B B;  4R8P B;  3MNN C;  5B0Y B;  3AZF C;  1ZLA D;  3W98 A;  5GXQ C;  3AFA B;  3AYW A;  3KXB C;  1HQ3 D;  3W97 D;  4CAY B;  2RVQ C;  5AV5 A;  5B33 B;  5AVB A;  3REL B;  1P3A A;  5BO0 B;  3KUY C;  3WKJ B;  1U35 C;  1P3P D;  3B6F C;  3O62 C;  5CPJ B;  2CV5 C;  1P34 B;  4KGC C;  4E45 A;  3AZM A;  1P3I C;  1KX3 D;  5JRG D;  4Z2M H;  1ZLA B;  5B24 D;  1HQ3 B;  3W97 B;  5B40 C;  5JA4 A;  4J8V C;  3X1T C;  3MNN A;  4H9O A;  3AZF A;  5GXQ A;  3AZE D;  2BYK A;  3KXB A;  1P3P B;  1BH9 B;  2YFW A;  3LJA C;  4J8U D;  2NZD D;  5CPI C;  3KUY A;  1KX3 B;  2FJ7 D;  5JRG B;  4J8W D;  1U35 A;  2F8N K;  3MGP D;  3R45 B;  5B24 B;  3B6F A;  3O62 A;  3AZI D;  2CV5 A;  4KGC A;  4ZBJ C;  3MVD D;  1P3I A;  3W99 D;  3WTP E;  3VH6 W;  5DNN C;  5CP6 C;  3AZE B;  4J8X C;  4X23 D;  5B40 A;  4J8U B;  3X1T A;  4J8V A;  2NZD B;  5B32 D;  2FJ7 B;  4J8W B;  3REI C;  3MGP B;  3X1S C;  1P3K C;  3LJA A;  3AZI B;  4DRA A;  3MVD B;  2YFV A;  2CWE A;  5CPI A;  3W99 B;  4ZUX C;  4X23 B;  3WAA D;  1B67 A;  5DNN A;  5B32 B;  5CP6 A;  4J8X A;  1P3L C;  5B2J C;  3X1S A;  3REI A;  3AV2 C;  1P3K A;  3WAA B;  4ZUX A;  5FUG A;  3KWQ D;  1F66 D;  4KUD C;  3B0D C;  3REH C;  2BYM A;  1P3B C;  4NE5 A; 
#chains in the Genus database with same CATH topology
 1P3L A;  3AFA C;  2ZY5 A;  4KHA B;  3TU4 D;  5B2J A;  3AV2 A;  4H9P A;  3KWQ B;  5CPK D;  1F66 B;  1P3G D;  1H3O B;  3LZ0 C;  1BH8 A;  4NE3 A;  3AZH D;  4H9N A;  4KUD A;  3AN2 C;  4E44 A;  3REJ D;  3TU4 B;  3LZ1 D;  3REH A;  1S32 C;  1P3B A;  2VQR A;  4JJN D;  5GT3 D;  3AZG D;  3AFA A;  3AZJ D;  4YM6 D;  5CPK B;  2PYO D;  1EQZ C;  1P3G B;  1WWI A;  3AZH B;  1KX3 C;  2ARO D;  5B24 C;  3X1U C;  4WU8 D;  3REJ B;  5AV9 D;  3LZ1 B;  5BT1 D;  3LZ0 A;  3X1V C;  4JJN B;  5GSU D;  5GT3 B;  2NQB D;  3AZG B;  3AZJ B;  4YM6 B;  3AN2 A;  2PYO B;  1ULY A;  2DF4 C;  1S32 A;  4Z2M G;  1M1A C;  2ARO B;  4J8W C;  1EQZ A;  4WU8 B;  3B6G D;  5AV9 B;  5BNX A;  3MVD C;  4G91 B;  1KX3 A;  2NQB B;  5GSU B;  5AV6 D;  5B24 A;  3X1U A;  3REK D;  4WU9 C;  4LD9 D;  1Q9C A;  1Z2C B;  5CHL B;  1P3M D;  3X1V A;  4EO5 C;  4Z66 D;  4CSR B;  2Y2L A;  3WA9 D;  4YS3 D;  4NE6 A;  3B6G B;  2Y2Q A;  1M1A A;  2JCH A;  1JFI B;  4J8W A;  5AV6 B;  2F8N D;  3REK B;  4LD9 B;  3VH5 W;  3W96 C;  3MVD A;  2HUE C;  1P3M B;  4H9Q B;  5BNV A;  5B1L C;  4Z66 B;  3MGR D;  4WU9 A;  3WA9 B;  4YS3 B;  3AV1 C;  1M18 D;  2F8N B;  1TAF B;  5G49 B;  1AOI C;  5F99 D;  3NQU B;  2L5A A;  2F8N G;  3KWQ C;  3MGR B;  3EPJ A;  3W96 A;  3C1C D;  4AWL C;  5GT0 C;  1TZY D;  5B1L A;  3UTB C;  1M18 B;  1M19 D;  5AV8 D;  4QLC D;  3A1K A;  3AV1 A;  5F99 B;  3WTP C;  4HGA B;  4UUZ A;  4Z5T D;  2Y2K A;  2Y2N A;  4H9S C;  5AY8 D;  3C1C B;  1AOI A;  4XZQ C;  1A7W A;  1TZY B;  1N1J A;  3KWQ A;  1M19 B;  3LEL D;  3MGS D;  5AV8 B;  4QLC B;  5GT0 A;  3A6N C;  3UTB A;  5AVC C;  3B0B A;  4Z5T B;  3AZN D;  1P3O D;  5E5A C;  5AY8 B;  3V9R A;  3NQJ A;  3WTP A;  4WNN B;  5B0Z D;  2Y2J A;  3EPL A;  2IO5 C;  3AZK D;  4H9S A;  3LEL B;  5DNM D;  3MGS B;  4XZQ A;  2Y2P A;  5B2I C;  5AV9 C;  4M6B A;  1P3F D;  4XUJ D;  1KX4 C;  3AZN B;  1P3O B;  2HIO D;  5B31 D;  3MGQ D;  3C1B D;  3A6N A;  3P5J B;  3KSY A;  5AVC A;  5B0Z B;  5E5A A;  5B32 G;  3AZK B;  5DNM B;  3W98 D;  3AYW D;  1P3F B;  2Y2O A;  5AV5 D;  4XUJ B;  1P3A D;  2HIO B;  5B31 B;  3MGQ B;  3C1B B;  5B2I A;  5AV9 A;  3UTA C;  3AZL C;  1KX4 A;  3AZM D;  3F6T A;  1KX5 C;  3W98 B;  4R8P C;  3AYW B;  5B0Y C;  5AV5 B;  1P3A B;  3MNN D;  4H9R A;  3REL C;  5B33 C;  3AZF D;  1F1E A;  5GXQ D;  3KXB D;  4G92 B;  3WKJ C;  2RVQ D;  1WWS A;  3AZM B;  3B0C T;  5CPJ C;  3IP4 C;  3KUY D;  1P34 C;  1U35 D;  5KDM A;  3AL0 C;  3B6F D;  3O62 D;  1ZLA C;  3UTA A;  4KGC D;  3AZL A;  2FFF B;  1HQ3 C;  5JA4 B;  1P3I D;  3W97 C;  3MNN B;  4H9O B;  3AZF B;  1KX5 A;  1M18 C;  5GXQ B;  4R8P A;  5B0Y A;  2BYK B;  3KXB B;  5B40 D;  2Y2G A;  2YFW B;  1P3P C;  3X1T D;  4J8V D;  4CAY A;  5B33 A;  3KUY B;  1T3U A;  3REL A;  1U35 B;  2F8N A;  5BO0 A;  3WKJ A;  5JRG C;  3LJA D;  3O62 B;  3B6F B;  4KGC B;  1P3I B;  4UPK A;  1HTA A;  5CPJ A;  5CPI D;  1P34 A;  1M19 C;  5B40 B;  1ZLA A;  3AZE C;  3VH6 T;  1HQ3 A;  3W97 A;  4J8V B;  3X1T B;  4J8U C;  1M18 A;  5DNN D;  5CP6 D;  2NZD C;  4J8X D;  2FJ7 C;  5AY8 C;  3LJA B;  1P3P A;  1BH9 A;  3MGP C;  3UT9 D;  2YFV B;  3AZI C;  5CPI B;  1ID3 D;  3W99 C;  3X1S D;  3REI D;  5JRG A;  1P3K D;  3R45 A;  4ZBJ B;  4X23 C;  2W8S A;  5DNN B;  4ZUX D;  5CP6 B;  1M19 A;  4J8X B;  5B32 C;  3AZE A;  3UT9 B;  4J8U A;  5B0Z C;  2ZM5 A;  1ID3 B;  2NZD A;  3X1S B;  3REI B;  2FJ7 A;  1P3K B;  5AY8 A;  1P3L D;  3MGP A;  3AZI A;  3WAA C;  5B2J D;  3FDD A;  4ZUX B;  3AV2 D;  3W99 A;  2HIO C;  4X23 A;  3C1B C;  2BYM B;  5B32 A;  1P3L B;  4KUD D;  2G5I C;  3KFU G;  5B1M D;  5B0Z A;  5C3I B;  5B2J B;  3REH D;  3AV2 B;  2ZY2 A;  3WAA A;  1F66 C;  1BH8 B;  2HIO A;  4H9N B;  4KUD B;  3C1B A;  3B0D B;  5B1M B;  2RIQ A;  3LZ0 D;  3REH B;  3TU4 C;  1BFM A;  3AN2 D;  5CPK C;  4KHA A;  1S32 D;  5BS7 C;  1P3G C;  3AZH C;  3B0C W;  1EQZ D;  1F66 A;  2LY8 A;  3LZ0 B;  3REJ C;  3H0L C;  3LZ1 C;  1H3O A;  4JJN C;  5GT3 C;  3X1U D;  3AN2 B;  3AZG C;  3AZJ C;  4YM6 C;  1S32 B;  2PYO C;  3TU4 A;  3X1V D;  3VH5 A;  1EQZ B;  2ARO C;  5CPK A;  2ZY3 A;  5BNX B;  1R4V A;  1M1A D;  5BS7 A;  4WU8 C;  1P3G A;  5BT1 C;  3AZH A;  4G91 C;  2NQB C;  5GSU C;  3X1U B;  1KU5 A;  1PZR A;  3REJ A;  3X1V B;  3LZ1 A;  2ZY4 A;  3EPH A;  4JJN A;  5GT3 A;  4WU9 D;  3AZG A;  3AZJ A;  4YM6 A;  2PYO A;  3UT9 C;  1M1A B;  3B6G C;  3EG5 B;  5AVB D;  1ID3 C;  2ARO A;  1B6W A;  3H0R C;  5AV6 C;  3REK C;  4WU8 A;  4LD9 C;  2JSS A;  5BNV B;  1P3M C;  2NQB A;  3VH5 T;  5GSU A;  4WU9 B;  4Z66 C;  5B31 G;  3W96 D;  3WA9 C;  4YS3 C;  4EO5 B;  5B1L D;  5AVB B;  4NFT A;  4CSR A;  2F8N H;  3UT9 A;  3B6G A;  3AV1 D;  1ID3 A;  5C3I C;  3VH6 A;  1JFI A;  5AV6 A;  3MGR C;  3REK A;  2HUE B;  3W96 B;  1AOI D;  4LD9 A;  2CV5 D;  4DRB A;  4H9Q A;  5B1L B;  1P3M A;  4Z66 A;  3WA9 A;  4YS3 A;  5GT0 D;  3AV1 B;  5B1M C;  3UTB D;  4UUZ B;  5F99 C;  1TAF A;  4HGA C;  5G49 A;  4WZS B;  1AOI B;  2CV5 B;  3WTP D;  3C1C C;  1N1J B;  3H0M C;  3EPK A;  3NQU A;  1TZY C;  3MGR A;  4AWL B;  4XZQ D;  5GT0 B;  2BG1 A;  5AV8 C;  3UTB B;  4QLC C;  4Z5T C;  3V9R B;  3A6N D;  3NQJ B;  3WTP B;  5B1M A;  5AVC D;  5F99 A;  5E5A D;  4XZQ B;  3LEL C;  3C1C A;  3MGS C;  1TZY A;  3AZN C;  1P3O C;  3A6N B;  5B2I D;  5AV8 A;  4QLC A;  5AVC B;  1KX4 D;  5E5A B;  4Z5T A;  2UWX A;  3AZK C;  5DNM C;  4WNN A;  4WV4 B;  2IO5 B;  1P3F C;  4XUJ C;  5FUG B;  3LEL A;  5B31 C;  5B2I B;  3MGS A;  3MGQ C;  1KX4 B;  3AZN A;  1P3O A;  2G5H C;  3W98 C;  3UTA D;  3AYW C;  3AZL D;  2Y2M A;  4H9R B;  5AV5 C;  5AVB C;  1P3B D;  1P3A C;  4H9P B;  4R8P D;  5B0Y D;  3AZK A;  1KX5 D;  5DNM A;  3AFA D;  4G92 C;  1P3F A;  2DQN C;  5B33 D;  3REL D;  4XUJ A;  3AZM C;  5KDM B;  3WKJ D;  1W2E A;  5B31 A;  3UTA B;  3MGQ A;  3AZL B;  5CPJ D;  1P34 D;  2J8P A;  1KX5 B;  1P3B B;  4R8P B;  3MNN C;  5B0Y B;  3AZF C;  1ZLA D;  3W98 A;  5GXQ C;  3AFA B;  3AYW A;  3KXB C;  1HQ3 D;  3W97 D;  4CAY B;  4DQY B;  2RVQ C;  5AV5 A;  5B33 B;  5AVB A;  2JE5 A;  3REL B;  1P3A A;  5BO0 B;  3KUY C;  3WKJ B;  1U35 C;  1P3P D;  2XD1 A;  3B6F C;  3O62 C;  5CPJ B;  2CV5 C;  1P34 B;  4KGC C;  4E45 A;  3AZM A;  1P3I C;  1KX3 D;  5JRG D;  4Z2M H;  1ZLA B;  5B24 D;  1HQ3 B;  3W97 B;  5B40 C;  5JA4 A;  4J8V C;  3X1T C;  3MNN A;  4H9O A;  3AZF A;  5GXQ A;  3AZE D;  2BYK A;  3KXB A;  1P3P B;  1BH9 B;  2YFW A;  3LJA C;  4J8U D;  2NZD D;  5CPI C;  3KUY A;  1KX3 B;  2FJ7 D;  5JRG B;  4J8W D;  1U35 A;  2F8N K;  3MGP D;  3R45 B;  5B24 B;  3B6F A;  3O62 A;  3AZI D;  2CV5 A;  4KGC A;  4ZBJ C;  3MVD D;  1P3I A;  3W99 D;  2F2A C;  3WTP E;  3VH6 W;  5DNN C;  5CP6 C;  3AZE B;  4J8X C;  4X23 D;  5B40 A;  4J8U B;  3X1T A;  4J8V A;  2NZD B;  5B32 D;  2FJ7 B;  4J8W B;  3REI C;  3MGP B;  3X1S C;  1P3K C;  3LJA A;  3AZI B;  4DRA A;  2XD5 A;  3MVD B;  2YFV A;  2CWE A;  2Y2I A;  5CPI A;  3W99 B;  2Y2H A;  4ZUX C;  4X23 B;  3WAA D;  1B67 A;  4WJ3 C;  5DNN A;  5B32 B;  5CP6 A;  4J8X A;  1P3L C;  5B2J C;  3A1I A;  3X1S A;  3REI A;  3AV2 C;  1P3K A;  3WAA B;  4ZUX A;  5FUG A;  3KWQ D;  1F66 D;  4KUD C;  3B0D C;  3REH C;  2BYM A;  1P3B C;  4NE5 A; 
#chains in the Genus database with same CATH homology
 1P3L A;  3AFA C;  2ZY5 A;  4KHA B;  3TU4 D;  5B2J A;  3AV2 A;  4H9P A;  3KWQ B;  5CPK D;  1F66 B;  1P3G D;  1H3O B;  3LZ0 C;  1BH8 A;  4NE3 A;  3AZH D;  4H9N A;  4KUD A;  3AN2 C;  4E44 A;  3REJ D;  3TU4 B;  3LZ1 D;  3REH A;  1S32 C;  1P3B A;  2VQR A;  4JJN D;  5GT3 D;  3AZG D;  3AFA A;  3AZJ D;  4YM6 D;  5CPK B;  2PYO D;  1EQZ C;  1P3G B;  1WWI A;  3AZH B;  1KX3 C;  2ARO D;  5B24 C;  3X1U C;  4WU8 D;  3REJ B;  5AV9 D;  3LZ1 B;  5BT1 D;  3LZ0 A;  3X1V C;  4JJN B;  5GSU D;  5GT3 B;  2NQB D;  3AZG B;  3AZJ B;  4YM6 B;  3AN2 A;  2PYO B;  1ULY A;  2DF4 C;  1S32 A;  4Z2M G;  1M1A C;  2ARO B;  4J8W C;  1EQZ A;  4WU8 B;  3B6G D;  5AV9 B;  5BNX A;  3MVD C;  4G91 B;  1KX3 A;  2NQB B;  5GSU B;  5AV6 D;  5B24 A;  3X1U A;  3REK D;  4WU9 C;  4LD9 D;  1Q9C A;  1Z2C B;  5CHL B;  1P3M D;  3X1V A;  4EO5 C;  4Z66 D;  4CSR B;  2Y2L A;  3WA9 D;  4YS3 D;  4NE6 A;  3B6G B;  2Y2Q A;  1M1A A;  2JCH A;  1JFI B;  4J8W A;  5AV6 B;  2F8N D;  3REK B;  4LD9 B;  3VH5 W;  3W96 C;  3MVD A;  2HUE C;  1P3M B;  4H9Q B;  5BNV A;  5B1L C;  4Z66 B;  3MGR D;  4WU9 A;  3WA9 B;  4YS3 B;  3AV1 C;  1M18 D;  2F8N B;  1TAF B;  5G49 B;  1AOI C;  5F99 D;  3NQU B;  2L5A A;  2F8N G;  3KWQ C;  3MGR B;  3EPJ A;  3W96 A;  3C1C D;  4AWL C;  5GT0 C;  1TZY D;  5B1L A;  3UTB C;  1M18 B;  1M19 D;  5AV8 D;  4QLC D;  3A1K A;  3AV1 A;  5F99 B;  3WTP C;  4HGA B;  4UUZ A;  4Z5T D;  2Y2K A;  2Y2N A;  4H9S C;  5AY8 D;  3C1C B;  1AOI A;  4XZQ C;  1A7W A;  1TZY B;  1N1J A;  3KWQ A;  1M19 B;  3LEL D;  3MGS D;  5AV8 B;  4QLC B;  5GT0 A;  3A6N C;  3UTB A;  5AVC C;  3B0B A;  4Z5T B;  3AZN D;  1P3O D;  5E5A C;  5AY8 B;  3V9R A;  3NQJ A;  3WTP A;  4WNN B;  5B0Z D;  2Y2J A;  3EPL A;  2IO5 C;  3AZK D;  4H9S A;  3LEL B;  5DNM D;  3MGS B;  4XZQ A;  2Y2P A;  5B2I C;  5AV9 C;  4M6B A;  1P3F D;  4XUJ D;  1KX4 C;  3AZN B;  1P3O B;  2HIO D;  5B31 D;  3MGQ D;  3C1B D;  3A6N A;  3P5J B;  3KSY A;  5AVC A;  5B0Z B;  5E5A A;  5B32 G;  3AZK B;  5DNM B;  3W98 D;  3AYW D;  1P3F B;  2Y2O A;  5AV5 D;  4XUJ B;  1P3A D;  2HIO B;  5B31 B;  3MGQ B;  3C1B B;  5B2I A;  5AV9 A;  3UTA C;  3AZL C;  1KX4 A;  3AZM D;  3F6T A;  1KX5 C;  3W98 B;  4R8P C;  3AYW B;  5B0Y C;  5AV5 B;  1P3A B;  3MNN D;  4H9R A;  3REL C;  5B33 C;  3AZF D;  1F1E A;  5GXQ D;  3KXB D;  4G92 B;  3WKJ C;  2RVQ D;  1WWS A;  3AZM B;  3B0C T;  5CPJ C;  3IP4 C;  3KUY D;  1P34 C;  1U35 D;  5KDM A;  3AL0 C;  3B6F D;  3O62 D;  1ZLA C;  3UTA A;  4KGC D;  3AZL A;  2FFF B;  1HQ3 C;  5JA4 B;  1P3I D;  3W97 C;  3MNN B;  4H9O B;  3AZF B;  1KX5 A;  1M18 C;  5GXQ B;  4R8P A;  5B0Y A;  2BYK B;  3KXB B;  5B40 D;  2Y2G A;  2YFW B;  1P3P C;  3X1T D;  4J8V D;  4CAY A;  5B33 A;  3KUY B;  1T3U A;  3REL A;  1U35 B;  2F8N A;  5BO0 A;  3WKJ A;  5JRG C;  3LJA D;  3O62 B;  3B6F B;  4KGC B;  1P3I B;  4UPK A;  1HTA A;  5CPJ A;  5CPI D;  1P34 A;  1M19 C;  5B40 B;  1ZLA A;  3AZE C;  3VH6 T;  1HQ3 A;  3W97 A;  4J8V B;  3X1T B;  4J8U C;  1M18 A;  5DNN D;  5CP6 D;  2NZD C;  4J8X D;  2FJ7 C;  5AY8 C;  3LJA B;  1P3P A;  1BH9 A;  3MGP C;  3UT9 D;  2YFV B;  3AZI C;  5CPI B;  1ID3 D;  3W99 C;  3X1S D;  3REI D;  5JRG A;  1P3K D;  3R45 A;  4ZBJ B;  4X23 C;  2W8S A;  5DNN B;  4ZUX D;  5CP6 B;  1M19 A;  4J8X B;  5B32 C;  3AZE A;  3UT9 B;  4J8U A;  5B0Z C;  2ZM5 A;  1ID3 B;  2NZD A;  3X1S B;  3REI B;  2FJ7 A;  1P3K B;  5AY8 A;  1P3L D;  3MGP A;  3AZI A;  3WAA C;  5B2J D;  3FDD A;  4ZUX B;  3AV2 D;  3W99 A;  2HIO C;  4X23 A;  3C1B C;  2BYM B;  5B32 A;  1P3L B;  4KUD D;  2G5I C;  3KFU G;  5B1M D;  5B0Z A;  5C3I B;  5B2J B;  3REH D;  3AV2 B;  2ZY2 A;  3WAA A;  1F66 C;  1BH8 B;  2HIO A;  4H9N B;  4KUD B;  3C1B A;  3B0D B;  5B1M B;  2RIQ A;  3LZ0 D;  3REH B;  3TU4 C;  1BFM A;  3AN2 D;  5CPK C;  4KHA A;  1S32 D;  5BS7 C;  1P3G C;  3AZH C;  3B0C W;  1EQZ D;  1F66 A;  2LY8 A;  3LZ0 B;  3REJ C;  3H0L C;  3LZ1 C;  1H3O A;  4JJN C;  5GT3 C;  3X1U D;  3AN2 B;  3AZG C;  3AZJ C;  4YM6 C;  1S32 B;  2PYO C;  3TU4 A;  3X1V D;  3VH5 A;  1EQZ B;  2ARO C;  5CPK A;  2ZY3 A;  5BNX B;  1R4V A;  1M1A D;  5BS7 A;  4WU8 C;  1P3G A;  5BT1 C;  3AZH A;  4G91 C;  2NQB C;  5GSU C;  3X1U B;  1KU5 A;  1PZR A;  3REJ A;  3X1V B;  3LZ1 A;  2ZY4 A;  3EPH A;  4JJN A;  5GT3 A;  4WU9 D;  3AZG A;  3AZJ A;  4YM6 A;  2PYO A;  3UT9 C;  1M1A B;  3B6G C;  3EG5 B;  5AVB D;  1ID3 C;  2ARO A;  1B6W A;  3H0R C;  5AV6 C;  3REK C;  4WU8 A;  4LD9 C;  2JSS A;  5BNV B;  1P3M C;  2NQB A;  3VH5 T;  5GSU A;  4WU9 B;  4Z66 C;  5B31 G;  3W96 D;  3WA9 C;  4YS3 C;  4EO5 B;  5B1L D;  5AVB B;  4NFT A;  4CSR A;  2F8N H;  3UT9 A;  3B6G A;  3AV1 D;  1ID3 A;  5C3I C;  3VH6 A;  1JFI A;  5AV6 A;  3MGR C;  3REK A;  2HUE B;  3W96 B;  1AOI D;  4LD9 A;  2CV5 D;  4DRB A;  4H9Q A;  5B1L B;  1P3M A;  4Z66 A;  3WA9 A;  4YS3 A;  5GT0 D;  3AV1 B;  5B1M C;  3UTB D;  4UUZ B;  5F99 C;  1TAF A;  4HGA C;  5G49 A;  4WZS B;  1AOI B;  2CV5 B;  3WTP D;  3C1C C;  1N1J B;  3H0M C;  3EPK A;  3NQU A;  1TZY C;  3MGR A;  4AWL B;  4XZQ D;  5GT0 B;  2BG1 A;  5AV8 C;  3UTB B;  4QLC C;  4Z5T C;  3V9R B;  3A6N D;  3NQJ B;  3WTP B;  5B1M A;  5AVC D;  5F99 A;  5E5A D;  4XZQ B;  3LEL C;  3C1C A;  3MGS C;  1TZY A;  3AZN C;  1P3O C;  3A6N B;  5B2I D;  5AV8 A;  4QLC A;  5AVC B;  1KX4 D;  5E5A B;  4Z5T A;  2UWX A;  3AZK C;  5DNM C;  4WNN A;  4WV4 B;  2IO5 B;  1P3F C;  4XUJ C;  5FUG B;  3LEL A;  5B31 C;  5B2I B;  3MGS A;  3MGQ C;  1KX4 B;  3AZN A;  1P3O A;  2G5H C;  3W98 C;  3UTA D;  3AYW C;  3AZL D;  2Y2M A;  4H9R B;  5AV5 C;  5AVB C;  1P3B D;  1P3A C;  4H9P B;  4R8P D;  5B0Y D;  3AZK A;  1KX5 D;  5DNM A;  3AFA D;  4G92 C;  1P3F A;  2DQN C;  5B33 D;  3REL D;  4XUJ A;  3AZM C;  5KDM B;  3WKJ D;  1W2E A;  5B31 A;  3UTA B;  3MGQ A;  3AZL B;  5CPJ D;  1P34 D;  2J8P A;  1KX5 B;  1P3B B;  4R8P B;  3MNN C;  5B0Y B;  3AZF C;  1ZLA D;  3W98 A;  5GXQ C;  3AFA B;  3AYW A;  3KXB C;  1HQ3 D;  3W97 D;  4CAY B;  4DQY B;  2RVQ C;  5AV5 A;  5B33 B;  5AVB A;  2JE5 A;  3REL B;  1P3A A;  5BO0 B;  3KUY C;  3WKJ B;  1U35 C;  1P3P D;  2XD1 A;  3B6F C;  3O62 C;  5CPJ B;  2CV5 C;  1P34 B;  4KGC C;  4E45 A;  3AZM A;  1P3I C;  1KX3 D;  5JRG D;  4Z2M H;  1ZLA B;  5B24 D;  1HQ3 B;  3W97 B;  5B40 C;  5JA4 A;  4J8V C;  3X1T C;  3MNN A;  4H9O A;  3AZF A;  5GXQ A;  3AZE D;  2BYK A;  3KXB A;  1P3P B;  1BH9 B;  2YFW A;  3LJA C;  4J8U D;  2NZD D;  5CPI C;  3KUY A;  1KX3 B;  2FJ7 D;  5JRG B;  4J8W D;  1U35 A;  2F8N K;  3MGP D;  3R45 B;  5B24 B;  3B6F A;  3O62 A;  3AZI D;  2CV5 A;  4KGC A;  4ZBJ C;  3MVD D;  1P3I A;  3W99 D;  2F2A C;  3WTP E;  3VH6 W;  5DNN C;  5CP6 C;  3AZE B;  4J8X C;  4X23 D;  5B40 A;  4J8U B;  3X1T A;  4J8V A;  2NZD B;  5B32 D;  2FJ7 B;  4J8W B;  3REI C;  3MGP B;  3X1S C;  1P3K C;  3LJA A;  3AZI B;  4DRA A;  2XD5 A;  3MVD B;  2YFV A;  2CWE A;  2Y2I A;  5CPI A;  3W99 B;  2Y2H A;  4ZUX C;  4X23 B;  3WAA D;  1B67 A;  4WJ3 C;  5DNN A;  5B32 B;  5CP6 A;  4J8X A;  1P3L C;  5B2J C;  3A1I A;  3X1S A;  3REI A;  3AV2 C;  1P3K A;  3WAA B;  4ZUX A;  5FUG A;  3KWQ D;  1F66 D;  4KUD C;  3B0D C;  3REH C;  2BYM A;  1P3B C;  4NE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...