1M1AC

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aC00
1M19B 3UTBC 4E44A 5BO0B 2PYOB 1P3MA 2AROB 3W98C 5CP6C 1WWSA 5B31B 1F1EA 1P3IA 1BH9A 3AZGD 3UT9A 5AV6A 3WAAD 3C1CB 3X1TA 1P3KD 5AVBD 3V9RA 3MGSB 5B0YC 1U35D 1HQ3D 5F99D 3W96A 3REJB 2BYMB 1P3FB 3AZHB 5JRGD 2L5AA 1M19D 3WKJB 4HGAC 3O62B 3VH5A 2YFWB 2PYOD 2AROD 4QLCC 5B31D 4H9OB 5B1MC 3REKC 5BNXA 3C1CD 4H9RB 5AV8C 3AV2C 2HUEC 3MGSD 1P3BA 4UUZA 4WV4B 1KU5A 3UT9B 3REJD 4J8WC 1P3FD 3AZHD 4J8UC 3X1TB 1P3GB 4YS3C 3KWQA 3LZ1B 5C3IC 3WKJD 3VH6W 3O62D 4NE3A 3X1VB 4AWLC 3B0DB 4J8VA 3B0BA 3AZEC 3AZMC 4XUJC 1M18B 3TU4A 4WU8B 5B2IA 3A6NB 5GT0B 3LELA 5BS7A 5DNNB 5AV5C 3UT9D 4M6BA 1P3AB 4LD9C 1P34A 3X1TD 2YFVB 3W99C 3KUYC 5CPJC 5B24B 1P3GD 3LZ1D 4Z5TB 3MVDC 4ZUXB 4UUZB 5BT1D 3X1VD 1BFMA 4Z66B 1AOIA 1M18D 4WU8D 3REIC 4JJNC 4WNNA 3KWQB 4H9PB 3A6ND 3NQJB 3B6GB 3AZNC 3MGPC 3AZGA 3AZJB 1P3KC 3RELC 3B6FA 3AZIA 5AVBC 5B0ZB 3WAAA 2IO5B 5DNND 5E5AB 5BNVA 1HQ3C 4KGCA 1P3AD 5AVCB 1U35A 5B24D 3LELB 5F99A 4H9QB 4Z5TD 5JRGC 5CPKB 4Z2MG 1M19C 4ZUXD 3LZ0A 1P34B 4Z66D 3C1BC 2PYOC 3AZKB 5AV9C 3KWQD 5B31C 1TZYA 2LY8A 1KX4A 5CPIC 3B6GD 2AROA 5AY8A 5DNMA 3AZJD 5B33B 1AOIB 3AZLB 5B0ZD 1H3OB 1P3PB 5E5AD 1M1AA 5AVCD 1N1JB 3MGSA 5GXQC 3UTAA 3LJAB 3X1SB 3AZHC 3LELD 5CPKD 3B6FB 3AZIB 3REJA 1P3FA 3WKJC 5BNVB 4KGCB 3W97B 1P34D 3MGRB 3AZKD 3O62A 3AZFB 4Z2MH 4ZBJC 3LZ0B 1KX5A 4H9OA 4R8PB 5B33D 1AOID 1P3MC 3AZLD 1P3PD 4H9RA 1TZYB 1KX4B 1P3IC 4KUDA 1F66A 5AY8B 5DNMB 5AV6C 3LJAD 3X1SD 3X1TC 4G91B 3B6FD 3AZID 4XZQB 4J8XA 4KGCD 1P3GA 3W97D 1M1AB 3MGRD 3LZ1A 3W96C 3UTAB 4G92C 5B40B 3X1VA 5B32A 3AZFD 3LZ0D 1M18A 4R8PD 4WU8A 5B31G 1HTAA 1EQZA 3A6NA 1TZYD 4NE5A 1KX4D 5GT0A 5AY8D 5DNMD 1KX5B 3AFAB 3AN2B 5GT3B 5DNNA 2HIOB 1P3AA 4XZQD 4DRAA 1P3BC 2JSSA 2YFVA 1M1AD 3WA9A 5B24A 4KUDB 4Z5TA 4WU9C 1F66B 3UTAD 4ZUXA 3AYWA 5B40D 3MGQB 2FJ7B 5B2JB 3WTPB 3KWQC 2NZDB 4Z66A 4J8XB 1ULYA 3X1UB 4CSRA 4H9PA 3NQJA 4J8VC 3B6GA 2F8NA 1B6WA 3TU4C 4DRBA 2IO5C 5B32B 1ZLAA 1S32A 3AZJA 5B2IC 1KX5D 5B0ZA 3AFAD 3AN2D 5GT3D 5E5AA 2HIOD 3LELC 4YM6A 1EQZB 1P3OA 5AVCA 5BS7C 1ID3C 4KUDD 4H9QA 1F66D 5CPKA 1P34C 3MGQD 2FJ7D 3W98B 5B2JD 5CP6B 3WTPD 2NZDD 5B32G 3MNNA 4J8XD 3B0CW 3AZKA 5B1LA 3WA9B 3AV1A 3X1UD 3AYWB 1AOIC 5B0YB 5B32D 5B33A 5GSUA 3AZLA 1P3PA 1H3OA 5G49A 3KSYA 1EQZD 4CSRB 4X23A 3AZGC 2F8NB 1N1JA 3AZIC 4KHAB 3WAAC 3X1SA 3LJAA 5GT0D 1ZLAB 1S32B 4KGCC 3VH5W 3W98D 1U35C 3REHA 5CP6D 4QLCB 3W97A 4YM6B 5F99C 3MGRA 5B1MB 3REKB 1P3OB 3WA9D 3LZ0C 1R4VA 5CHLB 3KXBA 5AV8B 3AV2B 3AZFA 3AYWD 2RVQD 5B0YD 2F8NG 2NQBA 4R8PA 2BYKB 3MNNB 1KX4C 5B1LB 2AROC 5AY8C 4J8WB 5DNMC 3AV1B 5KDMA 4G91C 4YS3B 2F8ND 5C3IB 3C1CC 1ZLAD 1S32D 1M1AC 5GSUB 4AWLB 4XZQA 3MGSC 3UTAC 3AZEB 3AZMB 5G49B 3VH6T 4QLCD 4YM6D 4X23B 5B1MD 3REKD 1P3OD 3REJC 1P3FC 5B40A 5AV8D 3AV2D 3REHB 3O62C 3MNND 5B1LD 4J8WD 3C1BA 1KX5C 3KXBB 3AV1D 3KUYB 5CPJB 3W99B 5AV9A 4YS3D 4H9SA 2NQBB 3MVDB 3AFAA 3AN2A 5GT3A 5GSUD 2HIOA 4KUDC 2CV5A 1F66C 3AZED 3AZMD 5KDMB 4X23D 3REIB 4JJNB 3UT9C 4CAYB 3MGQA 4J8XC 4WZSB 3AZNB 5B2JA 1P3GC 2FJ7A 3MGPB 3WTPA 2NZDA 3LZ1C 3REHD 3RELB 5AVBB 5BT1C 3X1VC 1P3LA 5B32C 1BH8B 3B0DC 3X1UA 1KX3A 1M18C 3VH5T 3KXBD 5CPJD 3W99D 3KUYD 4WU8C 1WWIA 1EQZC 3A6NC 2NQBD 3MVDD 1TAFB 1Q9CA 4H9NB 5GT0C 3C1BB 3UTBA 5DNNC 5AV9B 3REID 4JJND 1P3AC 5CPIB 3AZND 3W98A 3WA9C 5CP6A 5B24C 3MGPD 2CV5B 4Z5TC 3RELD 4ZUXC 3AYWC 2RVQC 4NFTA 4Z66C 5GXQB 5B0YA 2F8NK 3B6GC 1P3LB 1ZLAC 1S32C 3AZJC 1KX3B 3C1BD 4KHAA 4EO5B 5B0ZC 5E5AC 5AV9D 4E45A 4YM6C 5CPID 1P3OC 5JA4A 5AVCC 3R45A 4ZBJB 4QLCA 2CV5D 2CWEA 5CPKC 5B1MA 3REKA 3UTBB 1P3MB 5AV8A 1BH9B 3MNNC 3AV2A 1P3IB 3AZKC 4WU9A 5GXQD 5B1LC 5AV6B 2BYKA 3NQUA 3AV1C 4J8WA 3V9RB 1P3LD 4J8UA 5B33C 5GSUC 4YS3A 1KX3D 3W96B 3AZLC 1P3PC 4G92B 4X23C 3AZEA 3LJAC 3AZMA 3X1SC 4XUJA 1JFIA 3B6FC 3UTBD 1P3MD 4HGAB 3REHC 3W97C 1P3ID 3MGRC 1ID3A 5JA4B 3R45B 5AV6D 5BNXB 3KXBC 5AV5A 3AZFC 4LD9A 1P3BB 2NQBC 4R8PC 3KUYA 5CPJA 3W99A 2HUEB 4WU9B 3W96D 5FUGA 3WTPE 3MVDA 1TZYC 3NQUB 4J8UB 3REIA 4JJNA 4XZQC 4CAYA 4J8VB 3AZNA 3TU4B 3MGPA 1P3KA 5B2IB 3RELA 4XUJB 5AVBA 5B40C 1JFIB 1BH8A 1HQ3A 1P3BD 1ID3B 5JRGA 4WU9D 1M19A 1TAFA 4H9NA 5AV5B 4LD9B 4H9SC 4NE6A 5BO0A 2PYOA 4J8UD 3AFAC 3AN2C 5GT3C 2HIOC 5B31A 2CV5C 5FUGB 4J8VD 5CPIA 2F8NH 3B0CT 3TU4D 3C1CA 4WNNB 5B2ID 4XUJD 3MGQC 2FJ7C 5B2JC 3WTPC 2NZDC 3AZGB 5GXQA 2BYMA 3WAAB 1P3LC 1A7WA 3VH6A 3AZHA 1ID3D 3X1UC 1P3KB 1KX3C 4EO5C 5AV5D 1B67A 1U35B 1HQ3B 3WKJA 5F99B 2YFWA 4LD9D 5JRGB
chains in the Genus database with same CATH superfamily
1M19B 3UTBC 1W2EA 4E44A 5BO0B 2PYOB 1P3MA 2AROB 3W98C 5CP6C 1WWSA 5B31B 1F1EA 1P3IA 1BH9A 3AZGD 3UT9A 5AV6A 3WAAD 3C1CB 3X1TA 1P3KD 5AVBD 3V9RA 3MGSB 5B0YC 1U35D 1HQ3D 5F99D 3W96A 3REJB 2BYMB 1P3FB 3AZHB 5JRGD 2L5AA 1M19D 2ZY4A 3WKJB 4HGAC 3O62B 3VH5A 2YFWB 2PYOD 2AROD 4QLCC 5B31D 4H9OB 3EPHA 5B1MC 3REKC 5BNXA 3C1CD 4H9RB 5AV8C 3AV2C 2HUEC 3MGSD 1P3BA 4UUZA 4WV4B 1KU5A 3KFUG 3UT9B 3REJD 4J8WC 1P3FD 3AZHD 4J8UC 2Y2NA 3X1TB 1P3GB 4YS3C 3KWQA 3LZ1B 5C3IC 3WKJD 3VH6W 3O62D 4NE3A 3X1VB 4AWLC 3B0DB 2BG1A 4J8VA 3B0BA 3AZEC 3AZMC 4XUJC 1M18B 3TU4A 4WU8B 5B2IA 3A6NB 5GT0B 3LELA 2VQRA 5BS7A 5DNNB 5AV5C 1T3UA 3UT9D 4M6BA 1P3AB 4LD9C 1P34A 3X1TD 2YFVB 3W99C 3KUYC 5CPJC 5B24B 1P3GD 3LZ1D 4Z5TB 3MVDC 4ZUXB 4UUZB 5BT1D 3X1VD 1BFMA 4Z66B 1AOIA 1M18D 4WU8D 3REIC 4JJNC 4WNNA 3KWQB 4H9PB 3A6ND 3NQJB 3B6GB 3AZNC 3FDDA 3MGPC 3AZGA 3AZJB 1P3KC 3RELC 3B6FA 2Y2LA 3AZIA 5AVBC 5B0ZB 3WAAA 2IO5B 5DNND 5E5AB 5BNVA 1HQ3C 4KGCA 1P3AD 5AVCB 1U35A 5B24D 3LELB 5F99A 4H9QB 4Z5TD 5JRGC 5CPKB 4Z2MG 1M19C 4ZUXD 3AL0C 3LZ0A 1P34B 2UWXA 4Z66D 3C1BC 2PYOC 3AZKB 5AV9C 3KWQD 5B31C 1TZYA 2LY8A 1KX4A 5CPIC 3B6GD 2AROA 5AY8A 5DNMA 3AZJD 5B33B 1AOIB 3AZLB 5B0ZD 1H3OB 1P3PB 5E5AD 1M1AA 2J8PA 2ZY3A 5AVCD 1N1JB 3MGSA 5GXQC 3UTAA 3LJAB 3X1SB 3AZHC 3LELD 5CPKD 3B6FB 3AZIB 3REJA 1P3FA 3WKJC 5BNVB 4KGCB 3W97B 1P34D 3MGRB 3AZKD 3O62A 2W8SA 2G5IC 3AZFB 4Z2MH 2DQNC 4ZBJC 3LZ0B 1KX5A 4H9OA 4R8PB 5B33D 1AOID 1P3MC 3AZLD 1P3PD 4H9RA 1TZYB 1KX4B 1P3IC 2JE5A 4KUDA 1F66A 5AY8B 5DNMB 5AV6C 3LJAD 3X1SD 3A1IA 2ZM5A 3X1TC 4G91B 3B6FD 3AZID 4XZQB 2DF4C 4J8XA 4KGCD 1P3GA 3W97D 1M1AB 2ZY5A 3MGRD 3LZ1A 3W96C 3UTAB 4G92C 3IP4C 5B40B 3X1VA 5B32A 3AZFD 3LZ0D 1M18A 4R8PD 4WU8A 5B31G 1HTAA 1EQZA 3A6NA 1TZYD 4NE5A 1KX4D 5GT0A 5AY8D 5DNMD 1KX5B 3AFAB 3AN2B 5GT3B 5DNNA 2FFFB 2HIOB 1P3AA 4XZQD 4DRAA 1P3BC 2JSSA 2YFVA 1M1AD 3WA9A 5B24A 4KUDB 4Z5TA 4WU9C 1F66B 3UTAD 4ZUXA 3AYWA 5B40D 3MGQB 2FJ7B 5B2JB 3WTPB 3KWQC 2NZDB 4Z66A 4J8XB 1ULYA 3H0LC 3X1UB 4CSRA 4H9PA 3NQJA 4J8VC 3B6GA 2F8NA 1B6WA 3TU4C 4DRBA 2IO5C 5B32B 1ZLAA 1S32A 3AZJA 5B2IC 1KX5D 5B0ZA 3AFAD 3AN2D 5GT3D 5E5AA 2HIOD 3LELC 4YM6A 1EQZB 1P3OA 5AVCA 5BS7C 1ID3C 4KUDD 4H9QA 1F66D 5CPKA 1P34C 2JCHA 3MGQD 2FJ7D 3W98B 5B2JD 5CP6B 3WTPD 2NZDD 5B32G 3MNNA 4J8XD 3B0CW 3AZKA 5B1LA 3WA9B 3P5JB 3AV1A 3X1UD 3AYWB 1AOIC 5B0YB 5B32D 3EPKA 5B33A 5GSUA 2Y2IA 3AZLA 1P3PA 1H3OA 5G49A 3EPJA 3KSYA 1EQZD 4CSRB 4X23A 3AZGC 2F8NB 1N1JA 3AZIC 4KHAB 3WAAC 3X1SA 3LJAA 5GT0D 1ZLAB 1S32B 4KGCC 3F6TA 3VH5W 3W98D 1U35C 3REHA 5CP6D 4QLCB 3W97A 4YM6B 5F99C 3MGRA 5B1MB 3REKB 1P3OB 3WA9D 3LZ0C 1R4VA 5CHLB 3KXBA 5AV8B 3AV2B 3AZFA 3AYWD 2RVQD 5B0YD 2F8NG 2NQBA 4R8PA 2BYKB 3MNNB 1KX4C 4DQYB 5B1LB 2AROC 5AY8C 4J8WB 5DNMC 2Y2MA 3AV1B 5KDMA 4G91C 4YS3B 2XD5A 2F8ND 3EG5B 5C3IB 3C1CC 1ZLAD 1S32D 1M1AC 5GSUB 4AWLB 4XZQA 3MGSC 3UTAC 3AZEB 3AZMB 5G49B 3VH6T 4QLCD 4YM6D 4X23B 5B1MD 3REKD 1P3OD 3REJC 1P3FC 5B40A 5AV8D 3AV2D 3REHB 3O62C 3MNND 5B1LD 4J8WD 3C1BA 1KX5C 3KXBB 3AV1D 3KUYB 5CPJB 3W99B 5AV9A 4YS3D 4H9SA 2NQBB 3MVDB 3AFAA 3AN2A 5GT3A 5GSUD 2HIOA 4KUDC 2CV5A 1F66C 3AZED 3AZMD 5KDMB 4X23D 3REIB 4JJNB 3UT9C 4CAYB 3MGQA 4J8XC 4WZSB 3AZNB 5B2JA 1P3GC 2FJ7A 3MGPB 3WTPA 2NZDA 3LZ1C 3REHD 3RELB 5AVBB 5BT1C 3X1VC 1P3LA 5B32C 1BH8B 3B0DC 3X1UA 1KX3A 1M18C 3VH5T 3KXBD 5CPJD 3W99D 3KUYD 4WU8C 1WWIA 1EQZC 3A6NC 2NQBD 3MVDD 1TAFB 1Q9CA 4H9NB 5GT0C 2Y2KA 3C1BB 3UTBA 5DNNC 5AV9B 3REID 4JJND 1P3AC 5CPIB 3AZND 3W98A 3WA9C 2RIQA 5CP6A 5B24C 3MGPD 2CV5B 4Z5TC 3RELD 4ZUXC 3AYWC 2RVQC 4NFTA 4Z66C 5GXQB 5B0YA 2F8NK 3B6GC 1P3LB 1ZLAC 1S32C 3AZJC 1KX3B 3C1BD 4KHAA 4EO5B 5B0ZC 5E5AC 5AV9D 4E45A 4YM6C 1Z2CB 5CPID 1P3OC 5JA4A 5AVCC 2ZY2A 3R45A 4ZBJB 4QLCA 2CV5D 2CWEA 5CPKC 5B1MA 3REKA 3UTBB 1P3MB 3EPLA 5AV8A 1BH9B 3MNNC 3AV2A 1P3IB 3AZKC 4WU9A 5GXQD 5B1LC 5AV6B 2BYKA 3NQUA 3AV1C 4J8WA 3V9RB 1P3LD 4J8UA 5B33C 5GSUC 4YS3A 1KX3D 3W96B 3AZLC 1P3PC 4G92B 4X23C 3AZEA 3LJAC 3AZMA 3X1SC 4XUJA 2Y2PA 4UPKA 1JFIA 3B6FC 3UTBD 1P3MD 4HGAB 3REHC 3W97C 1P3ID 3MGRC 1ID3A 5JA4B 3R45B 5AV6D 5BNXB 3KXBC 5AV5A 3AZFC 4LD9A 2F2AC 1P3BB 2NQBC 4R8PC 3KUYA 5CPJA 3W99A 2HUEB 4WU9B 3W96D 5FUGA 3WTPE 3MVDA 1TZYC 3NQUB 1PZRA 4J8UB 3REIA 4JJNA 4XZQC 4CAYA 4J8VB 3AZNA 3TU4B 3MGPA 4WJ3C 1P3KA 5B2IB 3RELA 4XUJB 5AVBA 5B40C 1JFIB 1BH8A 1HQ3A 1P3BD 1ID3B 5JRGA 4WU9D 2XD1A 2G5HC 1M19A 1TAFA 4H9NA 5AV5B 4LD9B 4H9SC 4NE6A 3A1KA 5BO0A 2PYOA 4J8UD 3AFAC 3AN2C 5GT3C 3H0RC 2HIOC 5B31A 2CV5C 2Y2JA 5FUGB 4J8VD 5CPIA 2F8NH 3B0CT 3TU4D 3C1CA 4WNNB 5B2ID 4XUJD 3MGQC 2FJ7C 5B2JC 3WTPC 2NZDC 3AZGB 2Y2GA 2Y2HA 5GXQA 2BYMA 3WAAB 1P3LC 1A7WA 3VH6A 3AZHA 1ID3D 3X1UC 1P3KB 1KX3C 4EO5C 3H0MC 1B67A 2Y2OA 1HQ3B 5AV5D 1U35B 3WKJA 5F99B 2YFWA 4LD9D 2Y2QA 5JRGB
chains in the Genus database with same CATH topology
1M19B 3UTBC 1W2EA 4E44A 5BO0B 2PYOB 1P3MA 2AROB 3W98C 5CP6C 1WWSA 5B31B 1F1EA 1P3IA 1BH9A 3AZGD 3UT9A 5AV6A 3WAAD 3C1CB 3X1TA 1P3KD 5AVBD 3V9RA 3MGSB 5B0YC 1U35D 1HQ3D 5F99D 3W96A 3REJB 2BYMB 1P3FB 3AZHB 5JRGD 2L5AA 1M19D 2ZY4A 3WKJB 4HGAC 3O62B 3VH5A 2YFWB 2PYOD 2AROD 4QLCC 5B31D 4H9OB 3EPHA 5B1MC 3REKC 5BNXA 3C1CD 4H9RB 5AV8C 3AV2C 2HUEC 3MGSD 1P3BA 4UUZA 4WV4B 1KU5A 3KFUG 3UT9B 3REJD 4J8WC 1P3FD 3AZHD 4J8UC 2Y2NA 3X1TB 1P3GB 4YS3C 3KWQA 3LZ1B 5C3IC 3WKJD 3VH6W 3O62D 4NE3A 3X1VB 4AWLC 3B0DB 2BG1A 4J8VA 3B0BA 3AZEC 3AZMC 4XUJC 1M18B 3TU4A 4WU8B 5B2IA 3A6NB 5GT0B 3LELA 2VQRA 5BS7A 5DNNB 5AV5C 1T3UA 3UT9D 4M6BA 1P3AB 4LD9C 1P34A 3X1TD 2YFVB 3W99C 3KUYC 5CPJC 5B24B 1P3GD 3LZ1D 4Z5TB 3MVDC 4ZUXB 4UUZB 5BT1D 3X1VD 1BFMA 4Z66B 1AOIA 1M18D 4WU8D 3REIC 4JJNC 4WNNA 3KWQB 4H9PB 3A6ND 3NQJB 3B6GB 3AZNC 3FDDA 3MGPC 3AZGA 3AZJB 1P3KC 3RELC 3B6FA 2Y2LA 3AZIA 5AVBC 5B0ZB 3WAAA 2IO5B 5DNND 5E5AB 5BNVA 1HQ3C 4KGCA 1P3AD 5AVCB 1U35A 5B24D 3LELB 5F99A 4H9QB 4Z5TD 5JRGC 5CPKB 4Z2MG 1M19C 4ZUXD 3AL0C 3LZ0A 1P34B 2UWXA 4Z66D 3C1BC 2PYOC 3AZKB 5AV9C 3KWQD 5B31C 1TZYA 2LY8A 1KX4A 5CPIC 3B6GD 2AROA 5AY8A 5DNMA 3AZJD 5B33B 1AOIB 3AZLB 5B0ZD 1H3OB 1P3PB 5E5AD 1M1AA 2J8PA 2ZY3A 5AVCD 1N1JB 3MGSA 5GXQC 3UTAA 3LJAB 3X1SB 3AZHC 3LELD 5CPKD 3B6FB 3AZIB 3REJA 1P3FA 3WKJC 5BNVB 4KGCB 3W97B 1P34D 3MGRB 3AZKD 3O62A 2W8SA 2G5IC 3AZFB 4Z2MH 2DQNC 4ZBJC 3LZ0B 1KX5A 4H9OA 4R8PB 5B33D 1AOID 1P3MC 3AZLD 1P3PD 4H9RA 1TZYB 1KX4B 1P3IC 2JE5A 4KUDA 1F66A 5AY8B 5DNMB 5AV6C 3LJAD 3X1SD 3A1IA 2ZM5A 3X1TC 4G91B 3B6FD 3AZID 4XZQB 2DF4C 4J8XA 4KGCD 1P3GA 3W97D 1M1AB 2ZY5A 3MGRD 3LZ1A 3W96C 3UTAB 4G92C 3IP4C 5B40B 3X1VA 5B32A 3AZFD 3LZ0D 1M18A 4R8PD 4WU8A 5B31G 1HTAA 1EQZA 3A6NA 1TZYD 4NE5A 1KX4D 5GT0A 5AY8D 5DNMD 1KX5B 3AFAB 3AN2B 5GT3B 5DNNA 2FFFB 2HIOB 1P3AA 4XZQD 4DRAA 1P3BC 2JSSA 2YFVA 1M1AD 3WA9A 5B24A 4KUDB 4Z5TA 4WU9C 1F66B 3UTAD 4ZUXA 3AYWA 5B40D 3MGQB 2FJ7B 5B2JB 3WTPB 3KWQC 2NZDB 4Z66A 4J8XB 1ULYA 3H0LC 3X1UB 4CSRA 4H9PA 3NQJA 4J8VC 3B6GA 2F8NA 1B6WA 3TU4C 4DRBA 2IO5C 5B32B 1ZLAA 1S32A 3AZJA 5B2IC 1KX5D 5B0ZA 3AFAD 3AN2D 5GT3D 5E5AA 2HIOD 3LELC 4YM6A 1EQZB 1P3OA 5AVCA 5BS7C 1ID3C 4KUDD 4H9QA 1F66D 5CPKA 1P34C 2JCHA 3MGQD 2FJ7D 3W98B 5B2JD 5CP6B 3WTPD 2NZDD 5B32G 3MNNA 4J8XD 3B0CW 3AZKA 5B1LA 3WA9B 3P5JB 3AV1A 3X1UD 3AYWB 1AOIC 5B0YB 5B32D 3EPKA 5B33A 5GSUA 2Y2IA 3AZLA 1P3PA 1H3OA 5G49A 3EPJA 3KSYA 1EQZD 4CSRB 4X23A 3AZGC 2F8NB 1N1JA 3AZIC 4KHAB 3WAAC 3X1SA 3LJAA 5GT0D 1ZLAB 1S32B 4KGCC 3F6TA 3VH5W 3W98D 1U35C 3REHA 5CP6D 4QLCB 3W97A 4YM6B 5F99C 3MGRA 5B1MB 3REKB 1P3OB 3WA9D 3LZ0C 1R4VA 5CHLB 3KXBA 5AV8B 3AV2B 3AZFA 3AYWD 2RVQD 5B0YD 2F8NG 2NQBA 4R8PA 2BYKB 3MNNB 1KX4C 4DQYB 5B1LB 2AROC 5AY8C 4J8WB 5DNMC 2Y2MA 3AV1B 5KDMA 4G91C 4YS3B 2XD5A 2F8ND 3EG5B 5C3IB 3C1CC 1ZLAD 1S32D 1M1AC 5GSUB 4AWLB 4XZQA 3MGSC 3UTAC 3AZEB 3AZMB 5G49B 3VH6T 4QLCD 4YM6D 4X23B 5B1MD 3REKD 1P3OD 3REJC 1P3FC 5B40A 5AV8D 3AV2D 3REHB 3O62C 3MNND 5B1LD 4J8WD 3C1BA 1KX5C 3KXBB 3AV1D 3KUYB 5CPJB 3W99B 5AV9A 4YS3D 4H9SA 2NQBB 3MVDB 3AFAA 3AN2A 5GT3A 5GSUD 2HIOA 4KUDC 2CV5A 1F66C 3AZED 3AZMD 5KDMB 4X23D 3REIB 4JJNB 3UT9C 4CAYB 3MGQA 4J8XC 4WZSB 3AZNB 5B2JA 1P3GC 2FJ7A 3MGPB 3WTPA 2NZDA 3LZ1C 3REHD 3RELB 5AVBB 5BT1C 3X1VC 1P3LA 5B32C 1BH8B 3B0DC 3X1UA 1KX3A 1M18C 3VH5T 3KXBD 5CPJD 3W99D 3KUYD 4WU8C 1WWIA 1EQZC 3A6NC 2NQBD 3MVDD 1TAFB 1Q9CA 4H9NB 5GT0C 2Y2KA 3C1BB 3UTBA 5DNNC 5AV9B 3REID 4JJND 1P3AC 5CPIB 3AZND 3W98A 3WA9C 2RIQA 5CP6A 5B24C 3MGPD 2CV5B 4Z5TC 3RELD 4ZUXC 3AYWC 2RVQC 4NFTA 4Z66C 5GXQB 5B0YA 2F8NK 3B6GC 1P3LB 1ZLAC 1S32C 3AZJC 1KX3B 3C1BD 4KHAA 4EO5B 5B0ZC 5E5AC 5AV9D 4E45A 4YM6C 1Z2CB 5CPID 1P3OC 5JA4A 5AVCC 2ZY2A 3R45A 4ZBJB 4QLCA 2CV5D 2CWEA 5CPKC 5B1MA 3REKA 3UTBB 1P3MB 3EPLA 5AV8A 1BH9B 3MNNC 3AV2A 1P3IB 3AZKC 4WU9A 5GXQD 5B1LC 5AV6B 2BYKA 3NQUA 3AV1C 4J8WA 3V9RB 1P3LD 4J8UA 5B33C 5GSUC 4YS3A 1KX3D 3W96B 3AZLC 1P3PC 4G92B 4X23C 3AZEA 3LJAC 3AZMA 3X1SC 4XUJA 2Y2PA 4UPKA 1JFIA 3B6FC 3UTBD 1P3MD 4HGAB 3REHC 3W97C 1P3ID 3MGRC 1ID3A 5JA4B 3R45B 5AV6D 5BNXB 3KXBC 5AV5A 3AZFC 4LD9A 2F2AC 1P3BB 2NQBC 4R8PC 3KUYA 5CPJA 3W99A 2HUEB 4WU9B 3W96D 5FUGA 3WTPE 3MVDA 1TZYC 3NQUB 1PZRA 4J8UB 3REIA 4JJNA 4XZQC 4CAYA 4J8VB 3AZNA 3TU4B 3MGPA 4WJ3C 1P3KA 5B2IB 3RELA 4XUJB 5AVBA 5B40C 1JFIB 1BH8A 1HQ3A 1P3BD 1ID3B 5JRGA 4WU9D 2XD1A 2G5HC 1M19A 1TAFA 4H9NA 5AV5B 4LD9B 4H9SC 4NE6A 3A1KA 5BO0A 2PYOA 4J8UD 3AFAC 3AN2C 5GT3C 3H0RC 2HIOC 5B31A 2CV5C 2Y2JA 5FUGB 4J8VD 5CPIA 2F8NH 3B0CT 3TU4D 3C1CA 4WNNB 5B2ID 4XUJD 3MGQC 2FJ7C 5B2JC 3WTPC 2NZDC 3AZGB 2Y2GA 2Y2HA 5GXQA 2BYMA 3WAAB 1P3LC 1A7WA 3VH6A 3AZHA 1ID3D 3X1UC 1P3KB 1KX3C 4EO5C 3H0MC 1B67A 2Y2OA 1HQ3B 5AV5D 1U35B 3WKJA 5F99B 2YFWA 4LD9D 2Y2QA 5JRGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 B;  3UTB C;  4E44 A;  5BO0 B;  2PYO B;  1P3M A;  2ARO B;  3W98 C;  5CP6 C;  1WWS A;  5B31 B;  1F1E A;  1P3I A;  1BH9 A;  3AZG D;  3UT9 A;  5AV6 A;  3WAA D;  3C1C B;  3X1T A;  1P3K D;  5AVB D;  3V9R A;  3MGS B;  5B0Y C;  1U35 D;  1HQ3 D;  5F99 D;  3W96 A;  3REJ B;  2BYM B;  1P3F B;  3AZH B;  5JRG D;  2L5A A;  1M19 D;  3WKJ B;  4HGA C;  3O62 B;  3VH5 A;  2YFW B;  2PYO D;  2ARO D;  4QLC C;  5B31 D;  4H9O B;  5B1M C;  3REK C;  5BNX A;  3C1C D;  4H9R B;  5AV8 C;  3AV2 C;  2HUE C;  3MGS D;  1P3B A;  4UUZ A;  4WV4 B;  1KU5 A;  3UT9 B;  3REJ D;  4J8W C;  1P3F D;  3AZH D;  4J8U C;  3X1T B;  1P3G B;  4YS3 C;  3KWQ A;  3LZ1 B;  5C3I C;  3WKJ D;  3VH6 W;  3O62 D;  4NE3 A;  3X1V B;  4AWL C;  3B0D B;  4J8V A;  3B0B A;  3AZE C;  3AZM C;  4XUJ C;  1M18 B;  3TU4 A;  4WU8 B;  5B2I A;  3A6N B;  5GT0 B;  3LEL A;  5BS7 A;  5DNN B;  5AV5 C;  3UT9 D;  4M6B A;  1P3A B;  4LD9 C;  1P34 A;  3X1T D;  2YFV B;  3W99 C;  3KUY C;  5CPJ C;  5B24 B;  1P3G D;  3LZ1 D;  4Z5T B;  3MVD C;  4ZUX B;  4UUZ B;  5BT1 D;  3X1V D;  1BFM A;  4Z66 B;  1AOI A;  1M18 D;  4WU8 D;  3REI C;  4JJN C;  4WNN A;  3KWQ B;  4H9P B;  3A6N D;  3NQJ B;  3B6G B;  3AZN C;  3MGP C;  3AZG A;  3AZJ B;  1P3K C;  3REL C;  3B6F A;  3AZI A;  5AVB C;  5B0Z B;  3WAA A;  2IO5 B;  5DNN D;  5E5A B;  5BNV A;  1HQ3 C;  4KGC A;  1P3A D;  5AVC B;  1U35 A;  5B24 D;  3LEL B;  5F99 A;  4H9Q B;  4Z5T D;  5JRG C;  5CPK B;  4Z2M G;  1M19 C;  4ZUX D;  3LZ0 A;  1P34 B;  4Z66 D;  3C1B C;  2PYO C;  3AZK B;  5AV9 C;  3KWQ D;  5B31 C;  1TZY A;  2LY8 A;  1KX4 A;  5CPI C;  3B6G D;  2ARO A;  5AY8 A;  5DNM A;  3AZJ D;  5B33 B;  1AOI B;  3AZL B;  5B0Z D;  1H3O B;  1P3P B;  5E5A D;  1M1A A;  5AVC D;  1N1J B;  3MGS A;  5GXQ C;  3UTA A;  3LJA B;  3X1S B;  3AZH C;  3LEL D;  5CPK D;  3B6F B;  3AZI B;  3REJ A;  1P3F A;  3WKJ C;  5BNV B;  4KGC B;  3W97 B;  1P34 D;  3MGR B;  3AZK D;  3O62 A;  3AZF B;  4Z2M H;  4ZBJ C;  3LZ0 B;  1KX5 A;  4H9O A;  4R8P B;  5B33 D;  1AOI D;  1P3M C;  3AZL D;  1P3P D;  4H9R A;  1TZY B;  1KX4 B;  1P3I C;  4KUD A;  1F66 A;  5AY8 B;  5DNM B;  5AV6 C;  3LJA D;  3X1S D;  3X1T C;  4G91 B;  3B6F D;  3AZI D;  4XZQ B;  4J8X A;  4KGC D;  1P3G A;  3W97 D;  1M1A B;  3MGR D;  3LZ1 A;  3W96 C;  3UTA B;  4G92 C;  5B40 B;  3X1V A;  5B32 A;  3AZF D;  3LZ0 D;  1M18 A;  4R8P D;  4WU8 A;  5B31 G;  1HTA A;  1EQZ A;  3A6N A;  1TZY D;  4NE5 A;  1KX4 D;  5GT0 A;  5AY8 D;  5DNM D;  1KX5 B;  3AFA B;  3AN2 B;  5GT3 B;  5DNN A;  2HIO B;  1P3A A;  4XZQ D;  4DRA A;  1P3B C;  2JSS A;  2YFV A;  1M1A D;  3WA9 A;  5B24 A;  4KUD B;  4Z5T A;  4WU9 C;  1F66 B;  3UTA D;  4ZUX A;  3AYW A;  5B40 D;  3MGQ B;  2FJ7 B;  5B2J B;  3WTP B;  3KWQ C;  2NZD B;  4Z66 A;  4J8X B;  1ULY A;  3X1U B;  4CSR A;  4H9P A;  3NQJ A;  4J8V C;  3B6G A;  2F8N A;  1B6W A;  3TU4 C;  4DRB A;  2IO5 C;  5B32 B;  1ZLA A;  1S32 A;  3AZJ A;  5B2I C;  1KX5 D;  5B0Z A;  3AFA D;  3AN2 D;  5GT3 D;  5E5A A;  2HIO D;  3LEL C;  4YM6 A;  1EQZ B;  1P3O A;  5AVC A;  5BS7 C;  1ID3 C;  4KUD D;  4H9Q A;  1F66 D;  5CPK A;  1P34 C;  3MGQ D;  2FJ7 D;  3W98 B;  5B2J D;  5CP6 B;  3WTP D;  2NZD D;  5B32 G;  3MNN A;  4J8X D;  3B0C W;  3AZK A;  5B1L A;  3WA9 B;  3AV1 A;  3X1U D;  3AYW B;  1AOI C;  5B0Y B;  5B32 D;  5B33 A;  5GSU A;  3AZL A;  1P3P A;  1H3O A;  5G49 A;  3KSY A;  1EQZ D;  4CSR B;  4X23 A;  3AZG C;  2F8N B;  1N1J A;  3AZI C;  4KHA B;  3WAA C;  3X1S A;  3LJA A;  5GT0 D;  1ZLA B;  1S32 B;  4KGC C;  3VH5 W;  3W98 D;  1U35 C;  3REH A;  5CP6 D;  4QLC B;  3W97 A;  4YM6 B;  5F99 C;  3MGR A;  5B1M B;  3REK B;  1P3O B;  3WA9 D;  3LZ0 C;  1R4V A;  5CHL B;  3KXB A;  5AV8 B;  3AV2 B;  3AZF A;  3AYW D;  2RVQ D;  5B0Y D;  2F8N G;  2NQB A;  4R8P A;  2BYK B;  3MNN B;  1KX4 C;  5B1L B;  2ARO C;  5AY8 C;  4J8W B;  5DNM C;  3AV1 B;  5KDM A;  4G91 C;  4YS3 B;  2F8N D;  5C3I B;  3C1C C;  1ZLA D;  1S32 D;  1M1A C;  5GSU B;  4AWL B;  4XZQ A;  3MGS C;  3UTA C;  3AZE B;  3AZM B;  5G49 B;  3VH6 T;  4QLC D;  4YM6 D;  4X23 B;  5B1M D;  3REK D;  1P3O D;  3REJ C;  1P3F C;  5B40 A;  5AV8 D;  3AV2 D;  3REH B;  3O62 C;  3MNN D;  5B1L D;  4J8W D;  3C1B A;  1KX5 C;  3KXB B;  3AV1 D;  3KUY B;  5CPJ B;  3W99 B;  5AV9 A;  4YS3 D;  4H9S A;  2NQB B;  3MVD B;  3AFA A;  3AN2 A;  5GT3 A;  5GSU D;  2HIO A;  4KUD C;  2CV5 A;  1F66 C;  3AZE D;  3AZM D;  5KDM B;  4X23 D;  3REI B;  4JJN B;  3UT9 C;  4CAY B;  3MGQ A;  4J8X C;  4WZS B;  3AZN B;  5B2J A;  1P3G C;  2FJ7 A;  3MGP B;  3WTP A;  2NZD A;  3LZ1 C;  3REH D;  3REL B;  5AVB B;  5BT1 C;  3X1V C;  1P3L A;  5B32 C;  1BH8 B;  3B0D C;  3X1U A;  1KX3 A;  1M18 C;  3VH5 T;  3KXB D;  5CPJ D;  3W99 D;  3KUY D;  4WU8 C;  1WWI A;  1EQZ C;  3A6N C;  2NQB D;  3MVD D;  1TAF B;  1Q9C A;  4H9N B;  5GT0 C;  3C1B B;  3UTB A;  5DNN C;  5AV9 B;  3REI D;  4JJN D;  1P3A C;  5CPI B;  3AZN D;  3W98 A;  3WA9 C;  5CP6 A;  5B24 C;  3MGP D;  2CV5 B;  4Z5T C;  3REL D;  4ZUX C;  3AYW C;  2RVQ C;  4NFT A;  4Z66 C;  5GXQ B;  5B0Y A;  2F8N K;  3B6G C;  1P3L B;  1ZLA C;  1S32 C;  3AZJ C;  1KX3 B;  3C1B D;  4KHA A;  4EO5 B;  5B0Z C;  5E5A C;  5AV9 D;  4E45 A;  4YM6 C;  5CPI D;  1P3O C;  5JA4 A;  5AVC C;  3R45 A;  4ZBJ B;  4QLC A;  2CV5 D;  2CWE A;  5CPK C;  5B1M A;  3REK A;  3UTB B;  1P3M B;  5AV8 A;  1BH9 B;  3MNN C;  3AV2 A;  1P3I B;  3AZK C;  4WU9 A;  5GXQ D;  5B1L C;  5AV6 B;  2BYK A;  3NQU A;  3AV1 C;  4J8W A;  3V9R B;  1P3L D;  4J8U A;  5B33 C;  5GSU C;  4YS3 A;  1KX3 D;  3W96 B;  3AZL C;  1P3P C;  4G92 B;  4X23 C;  3AZE A;  3LJA C;  3AZM A;  3X1S C;  4XUJ A;  1JFI A;  3B6F C;  3UTB D;  1P3M D;  4HGA B;  3REH C;  3W97 C;  1P3I D;  3MGR C;  1ID3 A;  5JA4 B;  3R45 B;  5AV6 D;  5BNX B;  3KXB C;  5AV5 A;  3AZF C;  4LD9 A;  1P3B B;  2NQB C;  4R8P C;  3KUY A;  5CPJ A;  3W99 A;  2HUE B;  4WU9 B;  3W96 D;  5FUG A;  3WTP E;  3MVD A;  1TZY C;  3NQU B;  4J8U B;  3REI A;  4JJN A;  4XZQ C;  4CAY A;  4J8V B;  3AZN A;  3TU4 B;  3MGP A;  1P3K A;  5B2I B;  3REL A;  4XUJ B;  5AVB A;  5B40 C;  1JFI B;  1BH8 A;  1HQ3 A;  1P3B D;  1ID3 B;  5JRG A;  4WU9 D;  1M19 A;  1TAF A;  4H9N A;  5AV5 B;  4LD9 B;  4H9S C;  4NE6 A;  5BO0 A;  2PYO A;  4J8U D;  3AFA C;  3AN2 C;  5GT3 C;  2HIO C;  5B31 A;  2CV5 C;  5FUG B;  4J8V D;  5CPI A;  2F8N H;  3B0C T;  3TU4 D;  3C1C A;  4WNN B;  5B2I D;  4XUJ D;  3MGQ C;  2FJ7 C;  5B2J C;  3WTP C;  2NZD C;  3AZG B;  5GXQ A;  2BYM A;  3WAA B;  1P3L C;  1A7W A;  3VH6 A;  3AZH A;  1ID3 D;  3X1U C;  1P3K B;  1KX3 C;  4EO5 C;  5AV5 D;  1B67 A;  1U35 B;  1HQ3 B;  3WKJ A;  5F99 B;  2YFW A;  4LD9 D;  5JRG B; 
#chains in the Genus database with same CATH topology
 1M19 B;  3UTB C;  1W2E A;  4E44 A;  5BO0 B;  2PYO B;  1P3M A;  2ARO B;  3W98 C;  5CP6 C;  1WWS A;  5B31 B;  1F1E A;  1P3I A;  1BH9 A;  3AZG D;  3UT9 A;  5AV6 A;  3WAA D;  3C1C B;  3X1T A;  1P3K D;  5AVB D;  3V9R A;  3MGS B;  5B0Y C;  1U35 D;  1HQ3 D;  5F99 D;  3W96 A;  3REJ B;  2BYM B;  1P3F B;  3AZH B;  5JRG D;  2L5A A;  1M19 D;  2ZY4 A;  3WKJ B;  4HGA C;  3O62 B;  3VH5 A;  2YFW B;  2PYO D;  2ARO D;  4QLC C;  5B31 D;  4H9O B;  3EPH A;  5B1M C;  3REK C;  5BNX A;  3C1C D;  4H9R B;  5AV8 C;  3AV2 C;  2HUE C;  3MGS D;  1P3B A;  4UUZ A;  4WV4 B;  1KU5 A;  3KFU G;  3UT9 B;  3REJ D;  4J8W C;  1P3F D;  3AZH D;  4J8U C;  2Y2N A;  3X1T B;  1P3G B;  4YS3 C;  3KWQ A;  3LZ1 B;  5C3I C;  3WKJ D;  3VH6 W;  3O62 D;  4NE3 A;  3X1V B;  4AWL C;  3B0D B;  2BG1 A;  4J8V A;  3B0B A;  3AZE C;  3AZM C;  4XUJ C;  1M18 B;  3TU4 A;  4WU8 B;  5B2I A;  3A6N B;  5GT0 B;  3LEL A;  2VQR A;  5BS7 A;  5DNN B;  5AV5 C;  1T3U A;  3UT9 D;  4M6B A;  1P3A B;  4LD9 C;  1P34 A;  3X1T D;  2YFV B;  3W99 C;  3KUY C;  5CPJ C;  5B24 B;  1P3G D;  3LZ1 D;  4Z5T B;  3MVD C;  4ZUX B;  4UUZ B;  5BT1 D;  3X1V D;  1BFM A;  4Z66 B;  1AOI A;  1M18 D;  4WU8 D;  3REI C;  4JJN C;  4WNN A;  3KWQ B;  4H9P B;  3A6N D;  3NQJ B;  3B6G B;  3AZN C;  3FDD A;  3MGP C;  3AZG A;  3AZJ B;  1P3K C;  3REL C;  3B6F A;  2Y2L A;  3AZI A;  5AVB C;  5B0Z B;  3WAA A;  2IO5 B;  5DNN D;  5E5A B;  5BNV A;  1HQ3 C;  4KGC A;  1P3A D;  5AVC B;  1U35 A;  5B24 D;  3LEL B;  5F99 A;  4H9Q B;  4Z5T D;  5JRG C;  5CPK B;  4Z2M G;  1M19 C;  4ZUX D;  3AL0 C;  3LZ0 A;  1P34 B;  2UWX A;  4Z66 D;  3C1B C;  2PYO C;  3AZK B;  5AV9 C;  3KWQ D;  5B31 C;  1TZY A;  2LY8 A;  1KX4 A;  5CPI C;  3B6G D;  2ARO A;  5AY8 A;  5DNM A;  3AZJ D;  5B33 B;  1AOI B;  3AZL B;  5B0Z D;  1H3O B;  1P3P B;  5E5A D;  1M1A A;  2J8P A;  2ZY3 A;  5AVC D;  1N1J B;  3MGS A;  5GXQ C;  3UTA A;  3LJA B;  3X1S B;  3AZH C;  3LEL D;  5CPK D;  3B6F B;  3AZI B;  3REJ A;  1P3F A;  3WKJ C;  5BNV B;  4KGC B;  3W97 B;  1P34 D;  3MGR B;  3AZK D;  3O62 A;  2W8S A;  2G5I C;  3AZF B;  4Z2M H;  2DQN C;  4ZBJ C;  3LZ0 B;  1KX5 A;  4H9O A;  4R8P B;  5B33 D;  1AOI D;  1P3M C;  3AZL D;  1P3P D;  4H9R A;  1TZY B;  1KX4 B;  1P3I C;  2JE5 A;  4KUD A;  1F66 A;  5AY8 B;  5DNM B;  5AV6 C;  3LJA D;  3X1S D;  3A1I A;  2ZM5 A;  3X1T C;  4G91 B;  3B6F D;  3AZI D;  4XZQ B;  2DF4 C;  4J8X A;  4KGC D;  1P3G A;  3W97 D;  1M1A B;  2ZY5 A;  3MGR D;  3LZ1 A;  3W96 C;  3UTA B;  4G92 C;  3IP4 C;  5B40 B;  3X1V A;  5B32 A;  3AZF D;  3LZ0 D;  1M18 A;  4R8P D;  4WU8 A;  5B31 G;  1HTA A;  1EQZ A;  3A6N A;  1TZY D;  4NE5 A;  1KX4 D;  5GT0 A;  5AY8 D;  5DNM D;  1KX5 B;  3AFA B;  3AN2 B;  5GT3 B;  5DNN A;  2FFF B;  2HIO B;  1P3A A;  4XZQ D;  4DRA A;  1P3B C;  2JSS A;  2YFV A;  1M1A D;  3WA9 A;  5B24 A;  4KUD B;  4Z5T A;  4WU9 C;  1F66 B;  3UTA D;  4ZUX A;  3AYW A;  5B40 D;  3MGQ B;  2FJ7 B;  5B2J B;  3WTP B;  3KWQ C;  2NZD B;  4Z66 A;  4J8X B;  1ULY A;  3H0L C;  3X1U B;  4CSR A;  4H9P A;  3NQJ A;  4J8V C;  3B6G A;  2F8N A;  1B6W A;  3TU4 C;  4DRB A;  2IO5 C;  5B32 B;  1ZLA A;  1S32 A;  3AZJ A;  5B2I C;  1KX5 D;  5B0Z A;  3AFA D;  3AN2 D;  5GT3 D;  5E5A A;  2HIO D;  3LEL C;  4YM6 A;  1EQZ B;  1P3O A;  5AVC A;  5BS7 C;  1ID3 C;  4KUD D;  4H9Q A;  1F66 D;  5CPK A;  1P34 C;  2JCH A;  3MGQ D;  2FJ7 D;  3W98 B;  5B2J D;  5CP6 B;  3WTP D;  2NZD D;  5B32 G;  3MNN A;  4J8X D;  3B0C W;  3AZK A;  5B1L A;  3WA9 B;  3P5J B;  3AV1 A;  3X1U D;  3AYW B;  1AOI C;  5B0Y B;  5B32 D;  3EPK A;  5B33 A;  5GSU A;  2Y2I A;  3AZL A;  1P3P A;  1H3O A;  5G49 A;  3EPJ A;  3KSY A;  1EQZ D;  4CSR B;  4X23 A;  3AZG C;  2F8N B;  1N1J A;  3AZI C;  4KHA B;  3WAA C;  3X1S A;  3LJA A;  5GT0 D;  1ZLA B;  1S32 B;  4KGC C;  3F6T A;  3VH5 W;  3W98 D;  1U35 C;  3REH A;  5CP6 D;  4QLC B;  3W97 A;  4YM6 B;  5F99 C;  3MGR A;  5B1M B;  3REK B;  1P3O B;  3WA9 D;  3LZ0 C;  1R4V A;  5CHL B;  3KXB A;  5AV8 B;  3AV2 B;  3AZF A;  3AYW D;  2RVQ D;  5B0Y D;  2F8N G;  2NQB A;  4R8P A;  2BYK B;  3MNN B;  1KX4 C;  4DQY B;  5B1L B;  2ARO C;  5AY8 C;  4J8W B;  5DNM C;  2Y2M A;  3AV1 B;  5KDM A;  4G91 C;  4YS3 B;  2XD5 A;  2F8N D;  3EG5 B;  5C3I B;  3C1C C;  1ZLA D;  1S32 D;  1M1A C;  5GSU B;  4AWL B;  4XZQ A;  3MGS C;  3UTA C;  3AZE B;  3AZM B;  5G49 B;  3VH6 T;  4QLC D;  4YM6 D;  4X23 B;  5B1M D;  3REK D;  1P3O D;  3REJ C;  1P3F C;  5B40 A;  5AV8 D;  3AV2 D;  3REH B;  3O62 C;  3MNN D;  5B1L D;  4J8W D;  3C1B A;  1KX5 C;  3KXB B;  3AV1 D;  3KUY B;  5CPJ B;  3W99 B;  5AV9 A;  4YS3 D;  4H9S A;  2NQB B;  3MVD B;  3AFA A;  3AN2 A;  5GT3 A;  5GSU D;  2HIO A;  4KUD C;  2CV5 A;  1F66 C;  3AZE D;  3AZM D;  5KDM B;  4X23 D;  3REI B;  4JJN B;  3UT9 C;  4CAY B;  3MGQ A;  4J8X C;  4WZS B;  3AZN B;  5B2J A;  1P3G C;  2FJ7 A;  3MGP B;  3WTP A;  2NZD A;  3LZ1 C;  3REH D;  3REL B;  5AVB B;  5BT1 C;  3X1V C;  1P3L A;  5B32 C;  1BH8 B;  3B0D C;  3X1U A;  1KX3 A;  1M18 C;  3VH5 T;  3KXB D;  5CPJ D;  3W99 D;  3KUY D;  4WU8 C;  1WWI A;  1EQZ C;  3A6N C;  2NQB D;  3MVD D;  1TAF B;  1Q9C A;  4H9N B;  5GT0 C;  2Y2K A;  3C1B B;  3UTB A;  5DNN C;  5AV9 B;  3REI D;  4JJN D;  1P3A C;  5CPI B;  3AZN D;  3W98 A;  3WA9 C;  2RIQ A;  5CP6 A;  5B24 C;  3MGP D;  2CV5 B;  4Z5T C;  3REL D;  4ZUX C;  3AYW C;  2RVQ C;  4NFT A;  4Z66 C;  5GXQ B;  5B0Y A;  2F8N K;  3B6G C;  1P3L B;  1ZLA C;  1S32 C;  3AZJ C;  1KX3 B;  3C1B D;  4KHA A;  4EO5 B;  5B0Z C;  5E5A C;  5AV9 D;  4E45 A;  4YM6 C;  1Z2C B;  5CPI D;  1P3O C;  5JA4 A;  5AVC C;  2ZY2 A;  3R45 A;  4ZBJ B;  4QLC A;  2CV5 D;  2CWE A;  5CPK C;  5B1M A;  3REK A;  3UTB B;  1P3M B;  3EPL A;  5AV8 A;  1BH9 B;  3MNN C;  3AV2 A;  1P3I B;  3AZK C;  4WU9 A;  5GXQ D;  5B1L C;  5AV6 B;  2BYK A;  3NQU A;  3AV1 C;  4J8W A;  3V9R B;  1P3L D;  4J8U A;  5B33 C;  5GSU C;  4YS3 A;  1KX3 D;  3W96 B;  3AZL C;  1P3P C;  4G92 B;  4X23 C;  3AZE A;  3LJA C;  3AZM A;  3X1S C;  4XUJ A;  2Y2P A;  4UPK A;  1JFI A;  3B6F C;  3UTB D;  1P3M D;  4HGA B;  3REH C;  3W97 C;  1P3I D;  3MGR C;  1ID3 A;  5JA4 B;  3R45 B;  5AV6 D;  5BNX B;  3KXB C;  5AV5 A;  3AZF C;  4LD9 A;  2F2A C;  1P3B B;  2NQB C;  4R8P C;  3KUY A;  5CPJ A;  3W99 A;  2HUE B;  4WU9 B;  3W96 D;  5FUG A;  3WTP E;  3MVD A;  1TZY C;  3NQU B;  1PZR A;  4J8U B;  3REI A;  4JJN A;  4XZQ C;  4CAY A;  4J8V B;  3AZN A;  3TU4 B;  3MGP A;  4WJ3 C;  1P3K A;  5B2I B;  3REL A;  4XUJ B;  5AVB A;  5B40 C;  1JFI B;  1BH8 A;  1HQ3 A;  1P3B D;  1ID3 B;  5JRG A;  4WU9 D;  2XD1 A;  2G5H C;  1M19 A;  1TAF A;  4H9N A;  5AV5 B;  4LD9 B;  4H9S C;  4NE6 A;  3A1K A;  5BO0 A;  2PYO A;  4J8U D;  3AFA C;  3AN2 C;  5GT3 C;  3H0R C;  2HIO C;  5B31 A;  2CV5 C;  2Y2J A;  5FUG B;  4J8V D;  5CPI A;  2F8N H;  3B0C T;  3TU4 D;  3C1C A;  4WNN B;  5B2I D;  4XUJ D;  3MGQ C;  2FJ7 C;  5B2J C;  3WTP C;  2NZD C;  3AZG B;  2Y2G A;  2Y2H A;  5GXQ A;  2BYM A;  3WAA B;  1P3L C;  1A7W A;  3VH6 A;  3AZH A;  1ID3 D;  3X1U C;  1P3K B;  1KX3 C;  4EO5 C;  3H0M C;  1B67 A;  2Y2O A;  1HQ3 B;  5AV5 D;  1U35 B;  3WKJ A;  5F99 B;  2YFW A;  4LD9 D;  2Y2Q A;  5JRG B; 
#chains in the Genus database with same CATH homology
 1M19 B;  3UTB C;  1W2E A;  4E44 A;  5BO0 B;  2PYO B;  1P3M A;  2ARO B;  3W98 C;  5CP6 C;  1WWS A;  5B31 B;  1F1E A;  1P3I A;  1BH9 A;  3AZG D;  3UT9 A;  5AV6 A;  3WAA D;  3C1C B;  3X1T A;  1P3K D;  5AVB D;  3V9R A;  3MGS B;  5B0Y C;  1U35 D;  1HQ3 D;  5F99 D;  3W96 A;  3REJ B;  2BYM B;  1P3F B;  3AZH B;  5JRG D;  2L5A A;  1M19 D;  2ZY4 A;  3WKJ B;  4HGA C;  3O62 B;  3VH5 A;  2YFW B;  2PYO D;  2ARO D;  4QLC C;  5B31 D;  4H9O B;  3EPH A;  5B1M C;  3REK C;  5BNX A;  3C1C D;  4H9R B;  5AV8 C;  3AV2 C;  2HUE C;  3MGS D;  1P3B A;  4UUZ A;  4WV4 B;  1KU5 A;  3KFU G;  3UT9 B;  3REJ D;  4J8W C;  1P3F D;  3AZH D;  4J8U C;  2Y2N A;  3X1T B;  1P3G B;  4YS3 C;  3KWQ A;  3LZ1 B;  5C3I C;  3WKJ D;  3VH6 W;  3O62 D;  4NE3 A;  3X1V B;  4AWL C;  3B0D B;  2BG1 A;  4J8V A;  3B0B A;  3AZE C;  3AZM C;  4XUJ C;  1M18 B;  3TU4 A;  4WU8 B;  5B2I A;  3A6N B;  5GT0 B;  3LEL A;  2VQR A;  5BS7 A;  5DNN B;  5AV5 C;  1T3U A;  3UT9 D;  4M6B A;  1P3A B;  4LD9 C;  1P34 A;  3X1T D;  2YFV B;  3W99 C;  3KUY C;  5CPJ C;  5B24 B;  1P3G D;  3LZ1 D;  4Z5T B;  3MVD C;  4ZUX B;  4UUZ B;  5BT1 D;  3X1V D;  1BFM A;  4Z66 B;  1AOI A;  1M18 D;  4WU8 D;  3REI C;  4JJN C;  4WNN A;  3KWQ B;  4H9P B;  3A6N D;  3NQJ B;  3B6G B;  3AZN C;  3FDD A;  3MGP C;  3AZG A;  3AZJ B;  1P3K C;  3REL C;  3B6F A;  2Y2L A;  3AZI A;  5AVB C;  5B0Z B;  3WAA A;  2IO5 B;  5DNN D;  5E5A B;  5BNV A;  1HQ3 C;  4KGC A;  1P3A D;  5AVC B;  1U35 A;  5B24 D;  3LEL B;  5F99 A;  4H9Q B;  4Z5T D;  5JRG C;  5CPK B;  4Z2M G;  1M19 C;  4ZUX D;  3AL0 C;  3LZ0 A;  1P34 B;  2UWX A;  4Z66 D;  3C1B C;  2PYO C;  3AZK B;  5AV9 C;  3KWQ D;  5B31 C;  1TZY A;  2LY8 A;  1KX4 A;  5CPI C;  3B6G D;  2ARO A;  5AY8 A;  5DNM A;  3AZJ D;  5B33 B;  1AOI B;  3AZL B;  5B0Z D;  1H3O B;  1P3P B;  5E5A D;  1M1A A;  2J8P A;  2ZY3 A;  5AVC D;  1N1J B;  3MGS A;  5GXQ C;  3UTA A;  3LJA B;  3X1S B;  3AZH C;  3LEL D;  5CPK D;  3B6F B;  3AZI B;  3REJ A;  1P3F A;  3WKJ C;  5BNV B;  4KGC B;  3W97 B;  1P34 D;  3MGR B;  3AZK D;  3O62 A;  2W8S A;  2G5I C;  3AZF B;  4Z2M H;  2DQN C;  4ZBJ C;  3LZ0 B;  1KX5 A;  4H9O A;  4R8P B;  5B33 D;  1AOI D;  1P3M C;  3AZL D;  1P3P D;  4H9R A;  1TZY B;  1KX4 B;  1P3I C;  2JE5 A;  4KUD A;  1F66 A;  5AY8 B;  5DNM B;  5AV6 C;  3LJA D;  3X1S D;  3A1I A;  2ZM5 A;  3X1T C;  4G91 B;  3B6F D;  3AZI D;  4XZQ B;  2DF4 C;  4J8X A;  4KGC D;  1P3G A;  3W97 D;  1M1A B;  2ZY5 A;  3MGR D;  3LZ1 A;  3W96 C;  3UTA B;  4G92 C;  3IP4 C;  5B40 B;  3X1V A;  5B32 A;  3AZF D;  3LZ0 D;  1M18 A;  4R8P D;  4WU8 A;  5B31 G;  1HTA A;  1EQZ A;  3A6N A;  1TZY D;  4NE5 A;  1KX4 D;  5GT0 A;  5AY8 D;  5DNM D;  1KX5 B;  3AFA B;  3AN2 B;  5GT3 B;  5DNN A;  2FFF B;  2HIO B;  1P3A A;  4XZQ D;  4DRA A;  1P3B C;  2JSS A;  2YFV A;  1M1A D;  3WA9 A;  5B24 A;  4KUD B;  4Z5T A;  4WU9 C;  1F66 B;  3UTA D;  4ZUX A;  3AYW A;  5B40 D;  3MGQ B;  2FJ7 B;  5B2J B;  3WTP B;  3KWQ C;  2NZD B;  4Z66 A;  4J8X B;  1ULY A;  3H0L C;  3X1U B;  4CSR A;  4H9P A;  3NQJ A;  4J8V C;  3B6G A;  2F8N A;  1B6W A;  3TU4 C;  4DRB A;  2IO5 C;  5B32 B;  1ZLA A;  1S32 A;  3AZJ A;  5B2I C;  1KX5 D;  5B0Z A;  3AFA D;  3AN2 D;  5GT3 D;  5E5A A;  2HIO D;  3LEL C;  4YM6 A;  1EQZ B;  1P3O A;  5AVC A;  5BS7 C;  1ID3 C;  4KUD D;  4H9Q A;  1F66 D;  5CPK A;  1P34 C;  2JCH A;  3MGQ D;  2FJ7 D;  3W98 B;  5B2J D;  5CP6 B;  3WTP D;  2NZD D;  5B32 G;  3MNN A;  4J8X D;  3B0C W;  3AZK A;  5B1L A;  3WA9 B;  3P5J B;  3AV1 A;  3X1U D;  3AYW B;  1AOI C;  5B0Y B;  5B32 D;  3EPK A;  5B33 A;  5GSU A;  2Y2I A;  3AZL A;  1P3P A;  1H3O A;  5G49 A;  3EPJ A;  3KSY A;  1EQZ D;  4CSR B;  4X23 A;  3AZG C;  2F8N B;  1N1J A;  3AZI C;  4KHA B;  3WAA C;  3X1S A;  3LJA A;  5GT0 D;  1ZLA B;  1S32 B;  4KGC C;  3F6T A;  3VH5 W;  3W98 D;  1U35 C;  3REH A;  5CP6 D;  4QLC B;  3W97 A;  4YM6 B;  5F99 C;  3MGR A;  5B1M B;  3REK B;  1P3O B;  3WA9 D;  3LZ0 C;  1R4V A;  5CHL B;  3KXB A;  5AV8 B;  3AV2 B;  3AZF A;  3AYW D;  2RVQ D;  5B0Y D;  2F8N G;  2NQB A;  4R8P A;  2BYK B;  3MNN B;  1KX4 C;  4DQY B;  5B1L B;  2ARO C;  5AY8 C;  4J8W B;  5DNM C;  2Y2M A;  3AV1 B;  5KDM A;  4G91 C;  4YS3 B;  2XD5 A;  2F8N D;  3EG5 B;  5C3I B;  3C1C C;  1ZLA D;  1S32 D;  1M1A C;  5GSU B;  4AWL B;  4XZQ A;  3MGS C;  3UTA C;  3AZE B;  3AZM B;  5G49 B;  3VH6 T;  4QLC D;  4YM6 D;  4X23 B;  5B1M D;  3REK D;  1P3O D;  3REJ C;  1P3F C;  5B40 A;  5AV8 D;  3AV2 D;  3REH B;  3O62 C;  3MNN D;  5B1L D;  4J8W D;  3C1B A;  1KX5 C;  3KXB B;  3AV1 D;  3KUY B;  5CPJ B;  3W99 B;  5AV9 A;  4YS3 D;  4H9S A;  2NQB B;  3MVD B;  3AFA A;  3AN2 A;  5GT3 A;  5GSU D;  2HIO A;  4KUD C;  2CV5 A;  1F66 C;  3AZE D;  3AZM D;  5KDM B;  4X23 D;  3REI B;  4JJN B;  3UT9 C;  4CAY B;  3MGQ A;  4J8X C;  4WZS B;  3AZN B;  5B2J A;  1P3G C;  2FJ7 A;  3MGP B;  3WTP A;  2NZD A;  3LZ1 C;  3REH D;  3REL B;  5AVB B;  5BT1 C;  3X1V C;  1P3L A;  5B32 C;  1BH8 B;  3B0D C;  3X1U A;  1KX3 A;  1M18 C;  3VH5 T;  3KXB D;  5CPJ D;  3W99 D;  3KUY D;  4WU8 C;  1WWI A;  1EQZ C;  3A6N C;  2NQB D;  3MVD D;  1TAF B;  1Q9C A;  4H9N B;  5GT0 C;  2Y2K A;  3C1B B;  3UTB A;  5DNN C;  5AV9 B;  3REI D;  4JJN D;  1P3A C;  5CPI B;  3AZN D;  3W98 A;  3WA9 C;  2RIQ A;  5CP6 A;  5B24 C;  3MGP D;  2CV5 B;  4Z5T C;  3REL D;  4ZUX C;  3AYW C;  2RVQ C;  4NFT A;  4Z66 C;  5GXQ B;  5B0Y A;  2F8N K;  3B6G C;  1P3L B;  1ZLA C;  1S32 C;  3AZJ C;  1KX3 B;  3C1B D;  4KHA A;  4EO5 B;  5B0Z C;  5E5A C;  5AV9 D;  4E45 A;  4YM6 C;  1Z2C B;  5CPI D;  1P3O C;  5JA4 A;  5AVC C;  2ZY2 A;  3R45 A;  4ZBJ B;  4QLC A;  2CV5 D;  2CWE A;  5CPK C;  5B1M A;  3REK A;  3UTB B;  1P3M B;  3EPL A;  5AV8 A;  1BH9 B;  3MNN C;  3AV2 A;  1P3I B;  3AZK C;  4WU9 A;  5GXQ D;  5B1L C;  5AV6 B;  2BYK A;  3NQU A;  3AV1 C;  4J8W A;  3V9R B;  1P3L D;  4J8U A;  5B33 C;  5GSU C;  4YS3 A;  1KX3 D;  3W96 B;  3AZL C;  1P3P C;  4G92 B;  4X23 C;  3AZE A;  3LJA C;  3AZM A;  3X1S C;  4XUJ A;  2Y2P A;  4UPK A;  1JFI A;  3B6F C;  3UTB D;  1P3M D;  4HGA B;  3REH C;  3W97 C;  1P3I D;  3MGR C;  1ID3 A;  5JA4 B;  3R45 B;  5AV6 D;  5BNX B;  3KXB C;  5AV5 A;  3AZF C;  4LD9 A;  2F2A C;  1P3B B;  2NQB C;  4R8P C;  3KUY A;  5CPJ A;  3W99 A;  2HUE B;  4WU9 B;  3W96 D;  5FUG A;  3WTP E;  3MVD A;  1TZY C;  3NQU B;  1PZR A;  4J8U B;  3REI A;  4JJN A;  4XZQ C;  4CAY A;  4J8V B;  3AZN A;  3TU4 B;  3MGP A;  4WJ3 C;  1P3K A;  5B2I B;  3REL A;  4XUJ B;  5AVB A;  5B40 C;  1JFI B;  1BH8 A;  1HQ3 A;  1P3B D;  1ID3 B;  5JRG A;  4WU9 D;  2XD1 A;  2G5H C;  1M19 A;  1TAF A;  4H9N A;  5AV5 B;  4LD9 B;  4H9S C;  4NE6 A;  3A1K A;  5BO0 A;  2PYO A;  4J8U D;  3AFA C;  3AN2 C;  5GT3 C;  3H0R C;  2HIO C;  5B31 A;  2CV5 C;  2Y2J A;  5FUG B;  4J8V D;  5CPI A;  2F8N H;  3B0C T;  3TU4 D;  3C1C A;  4WNN B;  5B2I D;  4XUJ D;  3MGQ C;  2FJ7 C;  5B2J C;  3WTP C;  2NZD C;  3AZG B;  2Y2G A;  2Y2H A;  5GXQ A;  2BYM A;  3WAA B;  1P3L C;  1A7W A;  3VH6 A;  3AZH A;  1ID3 D;  3X1U C;  1P3K B;  1KX3 C;  4EO5 C;  3H0M C;  1B67 A;  2Y2O A;  1HQ3 B;  5AV5 D;  1U35 B;  3WKJ A;  5F99 B;  2YFW A;  4LD9 D;  2Y2Q A;  5JRG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...