1M1AC

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aC00
3UT9D 5BO0B 3VH6T 1M18B 1HQ3C 3LJAB 1M1AB 1M18D 4KGCC 5GSUA 3WAAC 1M1AD 5B1LA 1KX5B 5CP6C 1KX5D 4J8UC 5DNMC 3WTPC 5JRGB 3KWQA 1M19A 4WV4B 5JRGD 4J8XC 1BH9A 3AV2D 4H9NB 1ID3B 3KSYA 4WZSB 1ID3D 3W97D 3NQUA 3W96C 4Z66C 3REHA 2PYOD 3UTAB 4H9OB 4Z2MG 5AV9B 4AWLC 3UTAD 3AZNA 2L5AA 1P3AB 4H9QA 5B2IB 1P3AD 1EQZC 5B2ID 2BYMB 1KU5A 3C1BA 3MGRC 3KXBA 3REKC 1F66A 5AV5A 4JJNA 1P3FB 3AZFB 5C3IB 2HUEC 2IO5B 3UT9C 3AZFD 5GXQB 5CPIB 5CPID 3LZ0A 1M18C 4Z2MH 3LJAC 1M1AC 4YS3A 1KX5C 2RVQC 2YFVA 1P3LD 3UTBB 4G92B 1P3PB 1BH8A 1P3IA 4XUJA 5JRGC 1P3PD 4CAYA 1P34D 1ID3C 3REIA 4J8VD 3V9RA 5FUGA 3MGQA 3WA9B 3UTAC 4WU9A 5AV9C 4H9PA 3B6FB 1P3AC 5B2IC 3B6FD 3B6GB 3AZGB 5KDMA 3R45A 3AZGD 4KUDD 2NZDB 5CPKD 3MNND 3AN2A 5AV6A 4QLCD 1P3FC 3AZFC 5C3IC 1JFIB 2NQBA 5GXQC 5CPIC 3AZLA 5AV8B 1S32D 5GT0D 1AOIB 1KX4B 1B6WA 5F99D 1KX4D 5B33B 3X1SB 1P3BB 5B33D 4EO5B 1P3BD 4XZQB 3UTBC 4G92C 4XZQD 1P3PC 3RELB 4YM6B 3KUYD 5DNNA 5B31B 4YM6D 5GT3A 4X23B 5B31D 3MVDA 5AVCA 5B2JB 4X23D 5B1MB 3A6NB 2YFWB 5B2JD 5B0ZD 3WA9C 3AZIA 3MGSA 5BT1D 3B6FC 4E44A 3B6GC 3AZGC 5B0YD 1HQ3A 3W98B 3MNNC 3W98D 5G49B 4KGCA 2NZDC 3X1VB 3WAAA 4J8WB 3NQJA 4J8WD 3REJD 5CP6A 4R8PD 3AZEB 4J8UA 5DNMA 3AYWD 1P3OD 1TAFA 3AZED 3WTPA 2F8NK 3MGPD 5AV8C 4J8XA 3B0CT 3X1TB 2F8NB 4Z5TB 1AOIC 1KX4C 4ZUXB 3X1TD 2F8ND 4Z5TD 5B33C 4ZUXD 3X1SC 4H9SC 1P3BC 3W96A 4Z66A 3AZKB 1B67A 3W99D 4EO5C 4XZQC 5JA4A 5E5AD 3AZKD 4WNNA 3RELC 4YM6C 1EQZA 5B31C 3MGRA 4UUZA 4X23C 3REKA 1BFMA 1A7WA 5B2JC 5B1MC 3A6NC 1KX3B 2FJ7B 4H9RA 1KX3D 2CV5A 2FJ7D 5BT1C 3AV2B 1P3OB 3W97B 3AV1B 5BO0A 3KWQD 1M19D 3AV1D 2PYOB 3W98C 1TZYB 2AROB 5BNXB 3LJAA 1M1AA 1TZYD 2AROD 3X1VC 4J8WC 1KX5A 3C1CB 1P3OC 3AZEC 3REHD 3C1CD 3MGPC 5JRGA 3LELB 3AZND 1H3OB 2HIOB 3LELD 2HIOD 4H9NA 3X1TC 4Z5TC 1ID3A 3C1BD 4ZUXC 3KXBD 1F66D 5AV5D 3AZKC 4JJND 3UTAA 4H9OA 5AV9A 5AVBB 4WU8A 1WWSA 5AVBD 1P3AA 2CWEA 3LZ0D 2BYMA 5B40B 1HTAA 3X1UA 1P3LB 3TU4B 5B40D 3AZHB 3TU4D 1KX3C 2FJ7C 3AZHD 3VH5A 1P3FA 3AZFA 3AV2C 1P34B 1P3MB 5GXQA 3O62B 4G91B 4J8VB 5CPIA 3VH6A 1P3MD 3AV1C 3O62D 3W97C 1P3ID 4CAYB 2PYOC 1TZYC 2AROC 4NE3A 5B32B 3AFAB 5B32D 3AFAD 3B0BA 3C1CC 4E45A 4NE5A 3UTBA 4KUDB 4WU9D 1P3PA 3LELC 5CPKB 3MNNB 2HIOC 1U35B 4QLCB 1U35D 4NE6A 4KHAB 4LD9B 4JJNC 1S32B 4LD9D 3WA9A 2NQBD 5AVBC 5GT0B 3B6FA 5CPJA 5F99B 3B6GA 5B40C 1P3LC 3TU4C 3AZHC 2NZDA 2LY8A 3AZMC 1P3GB 3KUYB 1JFIA 1P3GD 1P34C 1P3MC 3O62C 4G91C 4J8VC 3WKJB 5AV8A 3WKJD 5B0ZB 3AZJA 1Q9CA 5B32C 3AFAC 1KX4A 1AOIA 5GT3D 1N1JB 3MVDD 3AZMA 1P3KA 3X1SA 5B33A 5B31G 4H9SA 5AVCD 1P3BA 5B0YB 4KUDC 1ZLAB 3LZ1B 3MGSD 3RELA 3LZ1D 5CPKC 1ZLAD 4YM6A 1U35C 4QLCC 5B31A 4CSRB 3REJB 4R8PB 3AYWB 1HQ3D 5B2JA 5B1MA 3A6NA 4LD9C 3MGPB 2YFWA 5AY8B 3WAAD 1S32C 3NQJB 5AY8D 5GT0C 5CP6D 4J8UD 5DNMD 5F99C 3W99B 2BYKB 4J8XD 5E5AB 5B24B 3X1VA 5B24D 1P3GC 2F8NG 3VH5W 3KUYC 1P3OA 3W96D 4Z66D 3AZEA 3WKJC 4NFTA 5GSUB 5B0ZC 5B1LB 5GSUD 3MVDC 5BNVA 3X1TA 4Z5TA 1EQZD 2F8NA 5B1LD 4ZUXA 1WWIA 3UT9A 5BS7C 3AZKA 3KWQB 4DRAA 1M19B 5B0YC 2CV5D 1BH9B 1ZLAC 3LZ1C 1M18A 3WTPE 3NQUB 2F8NH 3REJC 4R8PC 3REHB 3AYWC 3LJAD 1KX3A 5AY8C 3AZNB 2FJ7A 4H9QB 3AV2A 2RVQD 3C1BB 3KXBB 3W97A 3AV1A 1F66B 5AV5B 3W99C 2PYOA 4JJNB 1TZYA 2AROA 5BNXA 5E5AC 5B24C 3C1CA 5B2IA 3LZ0B 4WU8B 5AV9D 4WU8D 3LELA 4YS3B 1H3OA 5GSUC 2HIOA 4YS3D 5B1LC 3X1UB 2YFVB 3X1UD 1ULYA 1BH8B 4HGAB 4XUJB 3KWQC 2CV5C 1P3IB 1M19C 1P3FD 4XUJD 5AVBA 3REIB 5GXQD 3V9RB 3REID 5FUGB 5B40A 3REHC 3MGQB 1P3LA 3TU4A 4WU9B 3MGQD 4H9PB 3AZHA 3AZNC 2JSSA 5B32G 1P34A 5KDMB 3R45B 1P3MA 3O62A 3C1BC 4J8VA 3KXBC 3UTBD 1F66C 5AV5C 3B0DB 3AN2B 5AV6B 2NQBB 5B32A 3AFAA 3AN2D 5AV6D 3AZLB 5CHLB 1F1EA 3LZ0C 3AZLD 3AZGA 3WA9D 4WU8C 4KUDA 5CPJB 4YS3C 5CPKA 5CPJD 3MNNA 1U35A 3B6GD 4QLCA 3X1UC 4DRBA 4KHAA 4LD9A 2NZDD 4HGAC 4XUJC 1S32A 1P3IC 2IO5C 5DNNB 5GT0A 5DNND 3REIC 5GT3B 3MVDB 5F99A 5AVCB 5AV8D 3AZJB 4ZBJB 1R4VA 3MGQC 3AZJD 3AZMB 4XZQA 4WU9C 3AZIB 1P3KB 1AOID 3MGSB 3AZMD 1P3KD 3AZID 1P3GA 3X1SD 3KUYA 1HQ3B 3WKJA 4X23A 4KGCB 3B0DC 3RELD 3WAAB 5B0ZA 4KGCD 3AN2C 5AV6C 2NQBC 5CP6B 1N1JA 4J8UB 5DNMB 5BS7A 1TAFB 3WTPB 5B1MD 3A6ND 3AZLC 3WTPD 5B0YA 4J8XB 1ZLAA 3LZ1A 5CPJC 3W98A 5G49A 3B0CW 4CSRA 3W96B 4J8WA 4Z66B 3REJA 4R8PA 3AYWA 5JA4B 3MGPA 4AWLB 5AY8A 3X1VD 4WNNB 3VH6W 5DNNC 1EQZB 3MGRB 5GT3C 4UUZB 3REKB 5AVCC 3MGRD 3REKD 4M6BA 3AZJC 3W99A 4ZBJC 5BNVB 2BYKA 4H9RB 2CV5B 5E5AA 3VH5T 2HUEB 5B24A 3UT9B 1P3KC 3AZIC 3MGSC
chains in the Genus database with same CATH superfamily
3UT9D 5BO0B 3VH6T 1M18B 1HQ3C 3LJAB 1M1AB 1M18D 4KGCC 5GSUA 3WAAC 1M1AD 5B1LA 1KX5B 3A1IA 5CP6C 1KX5D 4J8UC 5DNMC 3WTPC 2JCHA 5JRGB 3KWQA 1M19A 4WV4B 5JRGD 4J8XC 1BH9A 3AV2D 4H9NB 1ID3B 3KSYA 4WZSB 1ID3D 2Y2JA 3W97D 3NQUA 3W96C 4Z66C 3REHA 2PYOD 3EPHA 2G5HC 3UTAB 4H9OB 4Z2MG 5AV9B 4AWLC 3UTAD 3AZNA 2L5AA 1P3AB 4H9QA 5B2IB 1P3AD 1EQZC 5B2ID 2BYMB 1KU5A 3C1BA 3MGRC 3KXBA 3REKC 1F66A 5AV5A 4JJNA 1P3FB 3AZFB 5C3IB 2HUEC 2IO5B 3UT9C 3AZFD 5GXQB 5CPIB 5CPID 3LZ0A 1M18C 4Z2MH 3LJAC 1M1AC 4YS3A 1KX5C 2RVQC 2YFVA 2ZY2A 1P3LD 3UTBB 4G92B 1P3PB 1BH8A 1P3IA 4XUJA 5JRGC 1P3PD 4CAYA 3P5JB 1P34D 1ID3C 3REIA 4J8VD 3V9RA 5FUGA 4DQYB 3MGQA 3WA9B 3UTAC 4WU9A 5AV9C 4H9PA 3B6FB 1P3AC 5B2IC 3B6FD 3B6GB 3AZGB 5KDMA 3R45A 3AZGD 4KUDD 1T3UA 2ZY5A 2NZDB 5CPKD 3MNND 3KFUG 3AN2A 5AV6A 4QLCD 1P3FC 3AZFC 5C3IC 1JFIB 2NQBA 5GXQC 5CPIC 3AZLA 2Y2LA 5AV8B 1S32D 5GT0D 1AOIB 1KX4B 1B6WA 5F99D 1KX4D 5B33B 3X1SB 3H0MC 1P3BB 5B33D 4EO5B 1P3BD 4XZQB 3UTBC 4G92C 4XZQD 1P3PC 3RELB 4YM6B 3KUYD 5DNNA 5B31B 4YM6D 5GT3A 4X23B 5B31D 3MVDA 5AVCA 5B2JB 4X23D 5B1MB 3A6NB 2YFWB 5B2JD 5B0ZD 3WA9C 3AZIA 3MGSA 5BT1D 3B6FC 4E44A 3B6GC 3AZGC 5B0YD 3H0RC 1HQ3A 3W98B 3MNNC 2DQNC 3W98D 5G49B 4KGCA 2NZDC 3X1VB 3WAAA 4J8WB 2Y2MA 3NQJA 4J8WD 3REJD 5CP6A 4R8PD 3AZEB 4J8UA 5DNMA 3AYWD 1P3OD 1TAFA 3AZED 3WTPA 2F8NK 3IP4C 3MGPD 5AV8C 4J8XA 3B0CT 3X1TB 2F8NB 4Z5TB 1AOIC 1KX4C 4ZUXB 3X1TD 2F8ND 4Z5TD 5B33C 4ZUXD 2F2AC 4H9SC 3X1SC 3W96A 1P3BC 4Z66A 3AZKB 1B67A 3W99D 4EO5C 4XZQC 5JA4A 5E5AD 3AZKD 4WNNA 3RELC 4YM6C 4UPKA 1EQZA 5B31C 3MGRA 4UUZA 4X23C 3REKA 1BFMA 1A7WA 5B2JC 5B1MC 3A6NC 1KX3B 2FJ7B 2Y2IA 4H9RA 1KX3D 2CV5A 2FJ7D 5BT1C 3AV2B 1P3OB 3W97B 3AV1B 2Y2NA 5BO0A 3KWQD 1M19D 3AV1D 2PYOB 3W98C 1TZYB 2AROB 3FDDA 5BNXB 3LJAA 1M1AA 1TZYD 2AROD 3X1VC 4J8WC 1KX5A 3C1CB 1P3OC 3AZEC 3REHD 3C1CD 3MGPC 5JRGA 3LELB 3AZND 1H3OB 2HIOB 3LELD 2HIOD 4H9NA 3X1TC 4Z5TC 1ID3A 3C1BD 4ZUXC 3KXBD 2ZY3A 1F66D 5AV5D 3AZKC 3EPLA 4JJND 3UTAA 4H9OA 5AV9A 2XD1A 5AVBB 4WU8A 1WWSA 5AVBD 1P3AA 2RIQA 2CWEA 3LZ0D 2BYMA 5B40B 2XD5A 1HTAA 3X1UA 1P3LB 3TU4B 5B40D 3AZHB 3TU4D 1KX3C 2FJ7C 2Y2OA 3AZHD 2JE5A 3VH5A 1P3FA 3AZFA 3AV2C 1P34B 1P3MB 5GXQA 3O62B 4G91B 4J8VB 5CPIA 3VH6A 1P3MD 3AV1C 3O62D 3W97C 1P3ID 2W8SA 4CAYB 2PYOC 1TZYC 2AROC 4NE3A 5B32B 3AFAB 3EPJA 5B32D 3AFAD 3B0BA 3C1CC 4E45A 4NE5A 3UTBA 4KUDB 4WU9D 1P3PA 3LELC 5CPKB 3MNNB 2HIOC 1W2EA 1U35B 4QLCB 1U35D 4NE6A 4KHAB 4LD9B 4JJNC 1S32B 4LD9D 3WA9A 2NQBD 5AVBC 5GT0B 3B6FA 5CPJA 5F99B 3B6GA 2BG1A 5B40C 1P3LC 2ZY4A 3TU4C 3AZHC 2NZDA 2LY8A 3AZMC 1P3GB 3KUYB 1JFIA 1P3GD 1P34C 1P3MC 3O62C 4G91C 4J8VC 3WKJB 5AV8A 3WKJD 5B0ZB 3AZJA 1Q9CA 2J8PA 5B32C 3AFAC 1KX4A 1AOIA 5GT3D 1N1JB 3MVDD 3AZMA 1P3KA 3X1SA 5B33A 5B31G 4H9SA 5AVCD 1P3BA 5B0YB 3AL0C 4KUDC 1ZLAB 3LZ1B 3MGSD 3RELA 3LZ1D 5CPKC 1ZLAD 4YM6A 1U35C 4QLCC 5B31A 4CSRB 3REJB 4R8PB 3AYWB 1HQ3D 5B2JA 1PZRA 5B1MA 3A6NA 4LD9C 3MGPB 2YFWA 5AY8B 3WAAD 1S32C 3NQJB 5AY8D 5GT0C 5CP6D 4J8UD 5DNMD 5F99C 3W99B 2BYKB 4J8XD 5E5AB 5B24B 3X1VA 5B24D 1P3GC 2F8NG 3VH5W 3KUYC 1P3OA 3W96D 4Z66D 3AZEA 3WKJC 4NFTA 5GSUB 5B0ZC 5B1LB 5GSUD 3A1KA 5BNVA 3MVDC 4Z5TA 3X1TA 2VQRA 1EQZD 5B1LD 2F8NA 4ZUXA 1WWIA 3UT9A 5BS7C 3AZKA 3KWQB 4DRAA 1M19B 5B0YC 2CV5D 1BH9B 1ZLAC 3LZ1C 1M18A 3WTPE 3NQUB 2F8NH 3REJC 4R8PC 3REHB 3EPKA 3AYWC 3LJAD 1KX3A 5AY8C 3AZNB 2FJ7A 1Z2CB 4H9QB 3AV2A 2RVQD 3C1BB 3KXBB 3W97A 3AV1A 1F66B 5AV5B 2UWXA 3W99C 2PYOA 4JJNB 1TZYA 2AROA 5BNXA 5E5AC 5B24C 3C1CA 5B2IA 3LZ0B 4WU8B 5AV9D 4WU8D 3LELA 4YS3B 2Y2QA 1H3OA 5GSUC 2HIOA 4YS3D 5B1LC 3X1UB 2YFVB 3X1UD 3EG5B 1ULYA 1BH8B 4HGAB 4XUJB 3KWQC 2CV5C 1P3IB 1M19C 1P3FD 4XUJD 5AVBA 2Y2KA 3REIB 5GXQD 3V9RB 3REID 5FUGB 5B40A 4WJ3C 3REHC 3MGQB 1P3LA 3TU4A 4WU9B 3MGQD 2FFFB 4H9PB 3AZHA 3AZNC 2JSSA 5B32G 1P34A 5KDMB 3R45B 1P3MA 3O62A 3C1BC 4J8VA 3KXBC 3UTBD 1F66C 5AV5C 3B0DB 3AN2B 5AV6B 2NQBB 5B32A 3AFAA 3AN2D 5AV6D 2Y2PA 3AZLB 5CHLB 1F1EA 3LZ0C 3AZLD 3AZGA 3WA9D 4WU8C 4KUDA 5CPJB 2ZM5A 4YS3C 5CPKA 5CPJD 3MNNA 1U35A 3B6GD 4QLCA 3X1UC 4DRBA 4KHAA 4LD9A 2NZDD 4HGAC 4XUJC 1S32A 1P3IC 2IO5C 5DNNB 2DF4C 5GT0A 5DNND 3REIC 3F6TA 5GT3B 3MVDB 5F99A 5AVCB 5AV8D 3AZJB 4ZBJB 1R4VA 3MGQC 3AZJD 3AZMB 4XZQA 4WU9C 3AZIB 1P3KB 1AOID 3MGSB 3AZMD 3H0LC 1P3KD 3AZID 1P3GA 3X1SD 3KUYA 1HQ3B 3WKJA 4X23A 4KGCB 3B0DC 3RELD 3WAAB 5B0ZA 2Y2GA 3AN2C 4KGCD 5AV6C 2NQBC 5CP6B 1N1JA 2G5IC 5DNMB 4J8UB 5BS7A 1TAFB 3WTPB 5B1MD 3A6ND 3AZLC 3WTPD 5B0YA 4J8XB 1ZLAA 3LZ1A 5CPJC 3W98A 5G49A 2Y2HA 3B0CW 4CSRA 3W96B 4J8WA 4Z66B 3REJA 4R8PA 3AYWA 5JA4B 3MGPA 4AWLB 5AY8A 3X1VD 4WNNB 3VH6W 5DNNC 1EQZB 3MGRB 5GT3C 4UUZB 3REKB 5AVCC 3MGRD 3REKD 4M6BA 3AZJC 3W99A 4ZBJC 5BNVB 2BYKA 4H9RB 2CV5B 5E5AA 3VH5T 2HUEB 5B24A 3UT9B 1P3KC 3AZIC 3MGSC
chains in the Genus database with same CATH topology
3UT9D 5BO0B 3VH6T 1M18B 1HQ3C 3LJAB 1M1AB 1M18D 4KGCC 5GSUA 3WAAC 1M1AD 5B1LA 1KX5B 3A1IA 5CP6C 1KX5D 4J8UC 5DNMC 3WTPC 2JCHA 5JRGB 3KWQA 1M19A 4WV4B 5JRGD 4J8XC 1BH9A 3AV2D 4H9NB 1ID3B 3KSYA 4WZSB 1ID3D 2Y2JA 3W97D 3NQUA 3W96C 4Z66C 3REHA 2PYOD 3EPHA 2G5HC 3UTAB 4H9OB 4Z2MG 5AV9B 4AWLC 3UTAD 3AZNA 2L5AA 1P3AB 4H9QA 5B2IB 1P3AD 1EQZC 5B2ID 2BYMB 1KU5A 3C1BA 3MGRC 3KXBA 3REKC 1F66A 5AV5A 4JJNA 1P3FB 3AZFB 5C3IB 2HUEC 2IO5B 3UT9C 3AZFD 5GXQB 5CPIB 5CPID 3LZ0A 1M18C 4Z2MH 3LJAC 1M1AC 4YS3A 1KX5C 2RVQC 2YFVA 2ZY2A 1P3LD 3UTBB 4G92B 1P3PB 1BH8A 1P3IA 4XUJA 5JRGC 1P3PD 4CAYA 3P5JB 1P34D 1ID3C 3REIA 4J8VD 3V9RA 5FUGA 4DQYB 3MGQA 3WA9B 3UTAC 4WU9A 5AV9C 4H9PA 3B6FB 1P3AC 5B2IC 3B6FD 3B6GB 3AZGB 5KDMA 3R45A 3AZGD 4KUDD 1T3UA 2ZY5A 2NZDB 5CPKD 3MNND 3KFUG 3AN2A 5AV6A 4QLCD 1P3FC 3AZFC 5C3IC 1JFIB 2NQBA 5GXQC 5CPIC 3AZLA 2Y2LA 5AV8B 1S32D 5GT0D 1AOIB 1KX4B 1B6WA 5F99D 1KX4D 5B33B 3X1SB 3H0MC 1P3BB 5B33D 4EO5B 1P3BD 4XZQB 3UTBC 4G92C 4XZQD 1P3PC 3RELB 4YM6B 3KUYD 5DNNA 5B31B 4YM6D 5GT3A 4X23B 5B31D 3MVDA 5AVCA 5B2JB 4X23D 5B1MB 3A6NB 2YFWB 5B2JD 5B0ZD 3WA9C 3AZIA 3MGSA 5BT1D 3B6FC 4E44A 3B6GC 3AZGC 5B0YD 3H0RC 1HQ3A 3W98B 3MNNC 2DQNC 3W98D 5G49B 4KGCA 2NZDC 3X1VB 3WAAA 4J8WB 2Y2MA 3NQJA 4J8WD 3REJD 5CP6A 4R8PD 3AZEB 4J8UA 5DNMA 3AYWD 1P3OD 1TAFA 3AZED 3WTPA 2F8NK 3IP4C 3MGPD 5AV8C 4J8XA 3B0CT 3X1TB 2F8NB 4Z5TB 1AOIC 1KX4C 4ZUXB 3X1TD 2F8ND 4Z5TD 5B33C 4ZUXD 2F2AC 4H9SC 3X1SC 3W96A 1P3BC 4Z66A 3AZKB 1B67A 3W99D 4EO5C 4XZQC 5JA4A 5E5AD 3AZKD 4WNNA 3RELC 4YM6C 4UPKA 1EQZA 5B31C 3MGRA 4UUZA 4X23C 3REKA 1BFMA 1A7WA 5B2JC 5B1MC 3A6NC 1KX3B 2FJ7B 2Y2IA 4H9RA 1KX3D 2CV5A 2FJ7D 5BT1C 3AV2B 1P3OB 3W97B 3AV1B 2Y2NA 5BO0A 3KWQD 1M19D 3AV1D 2PYOB 3W98C 1TZYB 2AROB 3FDDA 5BNXB 3LJAA 1M1AA 1TZYD 2AROD 3X1VC 4J8WC 1KX5A 3C1CB 1P3OC 3AZEC 3REHD 3C1CD 3MGPC 5JRGA 3LELB 3AZND 1H3OB 2HIOB 3LELD 2HIOD 4H9NA 3X1TC 4Z5TC 1ID3A 3C1BD 4ZUXC 3KXBD 2ZY3A 1F66D 5AV5D 3AZKC 3EPLA 4JJND 3UTAA 4H9OA 5AV9A 2XD1A 5AVBB 4WU8A 1WWSA 5AVBD 1P3AA 2RIQA 2CWEA 3LZ0D 2BYMA 5B40B 2XD5A 1HTAA 3X1UA 1P3LB 3TU4B 5B40D 3AZHB 3TU4D 1KX3C 2FJ7C 2Y2OA 3AZHD 2JE5A 3VH5A 1P3FA 3AZFA 3AV2C 1P34B 1P3MB 5GXQA 3O62B 4G91B 4J8VB 5CPIA 3VH6A 1P3MD 3AV1C 3O62D 3W97C 1P3ID 2W8SA 4CAYB 2PYOC 1TZYC 2AROC 4NE3A 5B32B 3AFAB 3EPJA 5B32D 3AFAD 3B0BA 3C1CC 4E45A 4NE5A 3UTBA 4KUDB 4WU9D 1P3PA 3LELC 5CPKB 3MNNB 2HIOC 1W2EA 1U35B 4QLCB 1U35D 4NE6A 4KHAB 4LD9B 4JJNC 1S32B 4LD9D 3WA9A 2NQBD 5AVBC 5GT0B 3B6FA 5CPJA 5F99B 3B6GA 2BG1A 5B40C 1P3LC 2ZY4A 3TU4C 3AZHC 2NZDA 2LY8A 3AZMC 1P3GB 3KUYB 1JFIA 1P3GD 1P34C 1P3MC 3O62C 4G91C 4J8VC 3WKJB 5AV8A 3WKJD 5B0ZB 3AZJA 1Q9CA 2J8PA 5B32C 3AFAC 1KX4A 1AOIA 5GT3D 1N1JB 3MVDD 3AZMA 1P3KA 3X1SA 5B33A 5B31G 4H9SA 5AVCD 1P3BA 5B0YB 3AL0C 4KUDC 1ZLAB 3LZ1B 3MGSD 3RELA 3LZ1D 5CPKC 1ZLAD 4YM6A 1U35C 4QLCC 5B31A 4CSRB 3REJB 4R8PB 3AYWB 1HQ3D 5B2JA 1PZRA 5B1MA 3A6NA 4LD9C 3MGPB 2YFWA 5AY8B 3WAAD 1S32C 3NQJB 5AY8D 5GT0C 5CP6D 4J8UD 5DNMD 5F99C 3W99B 2BYKB 4J8XD 5E5AB 5B24B 3X1VA 5B24D 1P3GC 2F8NG 3VH5W 3KUYC 1P3OA 3W96D 4Z66D 3AZEA 3WKJC 4NFTA 5GSUB 5B0ZC 5B1LB 5GSUD 3A1KA 5BNVA 3MVDC 4Z5TA 3X1TA 2VQRA 1EQZD 5B1LD 2F8NA 4ZUXA 1WWIA 3UT9A 5BS7C 3AZKA 3KWQB 4DRAA 1M19B 5B0YC 2CV5D 1BH9B 1ZLAC 3LZ1C 1M18A 3WTPE 3NQUB 2F8NH 3REJC 4R8PC 3REHB 3EPKA 3AYWC 3LJAD 1KX3A 5AY8C 3AZNB 2FJ7A 1Z2CB 4H9QB 3AV2A 2RVQD 3C1BB 3KXBB 3W97A 3AV1A 1F66B 5AV5B 2UWXA 3W99C 2PYOA 4JJNB 1TZYA 2AROA 5BNXA 5E5AC 5B24C 3C1CA 5B2IA 3LZ0B 4WU8B 5AV9D 4WU8D 3LELA 4YS3B 2Y2QA 1H3OA 5GSUC 2HIOA 4YS3D 5B1LC 3X1UB 2YFVB 3X1UD 3EG5B 1ULYA 1BH8B 4HGAB 4XUJB 3KWQC 2CV5C 1P3IB 1M19C 1P3FD 4XUJD 5AVBA 2Y2KA 3REIB 5GXQD 3V9RB 3REID 5FUGB 5B40A 4WJ3C 3REHC 3MGQB 1P3LA 3TU4A 4WU9B 3MGQD 2FFFB 4H9PB 3AZHA 3AZNC 2JSSA 5B32G 1P34A 5KDMB 3R45B 1P3MA 3O62A 3C1BC 4J8VA 3KXBC 3UTBD 1F66C 5AV5C 3B0DB 3AN2B 5AV6B 2NQBB 5B32A 3AFAA 3AN2D 5AV6D 2Y2PA 3AZLB 5CHLB 1F1EA 3LZ0C 3AZLD 3AZGA 3WA9D 4WU8C 4KUDA 5CPJB 2ZM5A 4YS3C 5CPKA 5CPJD 3MNNA 1U35A 3B6GD 4QLCA 3X1UC 4DRBA 4KHAA 4LD9A 2NZDD 4HGAC 4XUJC 1S32A 1P3IC 2IO5C 5DNNB 2DF4C 5GT0A 5DNND 3REIC 3F6TA 5GT3B 3MVDB 5F99A 5AVCB 5AV8D 3AZJB 4ZBJB 1R4VA 3MGQC 3AZJD 3AZMB 4XZQA 4WU9C 3AZIB 1P3KB 1AOID 3MGSB 3AZMD 3H0LC 1P3KD 3AZID 1P3GA 3X1SD 3KUYA 1HQ3B 3WKJA 4X23A 4KGCB 3B0DC 3RELD 3WAAB 5B0ZA 2Y2GA 3AN2C 4KGCD 5AV6C 2NQBC 5CP6B 1N1JA 2G5IC 5DNMB 4J8UB 5BS7A 1TAFB 3WTPB 5B1MD 3A6ND 3AZLC 3WTPD 5B0YA 4J8XB 1ZLAA 3LZ1A 5CPJC 3W98A 5G49A 2Y2HA 3B0CW 4CSRA 3W96B 4J8WA 4Z66B 3REJA 4R8PA 3AYWA 5JA4B 3MGPA 4AWLB 5AY8A 3X1VD 4WNNB 3VH6W 5DNNC 1EQZB 3MGRB 5GT3C 4UUZB 3REKB 5AVCC 3MGRD 3REKD 4M6BA 3AZJC 3W99A 4ZBJC 5BNVB 2BYKA 4H9RB 2CV5B 5E5AA 3VH5T 2HUEB 5B24A 3UT9B 1P3KC 3AZIC 3MGSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 D;  5BO0 B;  3VH6 T;  1M18 B;  1HQ3 C;  3LJA B;  1M1A B;  1M18 D;  4KGC C;  5GSU A;  3WAA C;  1M1A D;  5B1L A;  1KX5 B;  5CP6 C;  1KX5 D;  4J8U C;  5DNM C;  3WTP C;  5JRG B;  3KWQ A;  1M19 A;  4WV4 B;  5JRG D;  4J8X C;  1BH9 A;  3AV2 D;  4H9N B;  1ID3 B;  3KSY A;  4WZS B;  1ID3 D;  3W97 D;  3NQU A;  3W96 C;  4Z66 C;  3REH A;  2PYO D;  3UTA B;  4H9O B;  4Z2M G;  5AV9 B;  4AWL C;  3UTA D;  3AZN A;  2L5A A;  1P3A B;  4H9Q A;  5B2I B;  1P3A D;  1EQZ C;  5B2I D;  2BYM B;  1KU5 A;  3C1B A;  3MGR C;  3KXB A;  3REK C;  1F66 A;  5AV5 A;  4JJN A;  1P3F B;  3AZF B;  5C3I B;  2HUE C;  2IO5 B;  3UT9 C;  3AZF D;  5GXQ B;  5CPI B;  5CPI D;  3LZ0 A;  1M18 C;  4Z2M H;  3LJA C;  1M1A C;  4YS3 A;  1KX5 C;  2RVQ C;  2YFV A;  1P3L D;  3UTB B;  4G92 B;  1P3P B;  1BH8 A;  1P3I A;  4XUJ A;  5JRG C;  1P3P D;  4CAY A;  1P34 D;  1ID3 C;  3REI A;  4J8V D;  3V9R A;  5FUG A;  3MGQ A;  3WA9 B;  3UTA C;  4WU9 A;  5AV9 C;  4H9P A;  3B6F B;  1P3A C;  5B2I C;  3B6F D;  3B6G B;  3AZG B;  5KDM A;  3R45 A;  3AZG D;  4KUD D;  2NZD B;  5CPK D;  3MNN D;  3AN2 A;  5AV6 A;  4QLC D;  1P3F C;  3AZF C;  5C3I C;  1JFI B;  2NQB A;  5GXQ C;  5CPI C;  3AZL A;  5AV8 B;  1S32 D;  5GT0 D;  1AOI B;  1KX4 B;  1B6W A;  5F99 D;  1KX4 D;  5B33 B;  3X1S B;  1P3B B;  5B33 D;  4EO5 B;  1P3B D;  4XZQ B;  3UTB C;  4G92 C;  4XZQ D;  1P3P C;  3REL B;  4YM6 B;  3KUY D;  5DNN A;  5B31 B;  4YM6 D;  5GT3 A;  4X23 B;  5B31 D;  3MVD A;  5AVC A;  5B2J B;  4X23 D;  5B1M B;  3A6N B;  2YFW B;  5B2J D;  5B0Z D;  3WA9 C;  3AZI A;  3MGS A;  5BT1 D;  3B6F C;  4E44 A;  3B6G C;  3AZG C;  5B0Y D;  1HQ3 A;  3W98 B;  3MNN C;  3W98 D;  5G49 B;  4KGC A;  2NZD C;  3X1V B;  3WAA A;  4J8W B;  3NQJ A;  4J8W D;  3REJ D;  5CP6 A;  4R8P D;  3AZE B;  4J8U A;  5DNM A;  3AYW D;  1P3O D;  1TAF A;  3AZE D;  3WTP A;  2F8N K;  3MGP D;  5AV8 C;  4J8X A;  3B0C T;  3X1T B;  2F8N B;  4Z5T B;  1AOI C;  1KX4 C;  4ZUX B;  3X1T D;  2F8N D;  4Z5T D;  5B33 C;  4ZUX D;  3X1S C;  4H9S C;  1P3B C;  3W96 A;  4Z66 A;  3AZK B;  1B67 A;  3W99 D;  4EO5 C;  4XZQ C;  5JA4 A;  5E5A D;  3AZK D;  4WNN A;  3REL C;  4YM6 C;  1EQZ A;  5B31 C;  3MGR A;  4UUZ A;  4X23 C;  3REK A;  1BFM A;  1A7W A;  5B2J C;  5B1M C;  3A6N C;  1KX3 B;  2FJ7 B;  4H9R A;  1KX3 D;  2CV5 A;  2FJ7 D;  5BT1 C;  3AV2 B;  1P3O B;  3W97 B;  3AV1 B;  5BO0 A;  3KWQ D;  1M19 D;  3AV1 D;  2PYO B;  3W98 C;  1TZY B;  2ARO B;  5BNX B;  3LJA A;  1M1A A;  1TZY D;  2ARO D;  3X1V C;  4J8W C;  1KX5 A;  3C1C B;  1P3O C;  3AZE C;  3REH D;  3C1C D;  3MGP C;  5JRG A;  3LEL B;  3AZN D;  1H3O B;  2HIO B;  3LEL D;  2HIO D;  4H9N A;  3X1T C;  4Z5T C;  1ID3 A;  3C1B D;  4ZUX C;  3KXB D;  1F66 D;  5AV5 D;  3AZK C;  4JJN D;  3UTA A;  4H9O A;  5AV9 A;  5AVB B;  4WU8 A;  1WWS A;  5AVB D;  1P3A A;  2CWE A;  3LZ0 D;  2BYM A;  5B40 B;  1HTA A;  3X1U A;  1P3L B;  3TU4 B;  5B40 D;  3AZH B;  3TU4 D;  1KX3 C;  2FJ7 C;  3AZH D;  3VH5 A;  1P3F A;  3AZF A;  3AV2 C;  1P34 B;  1P3M B;  5GXQ A;  3O62 B;  4G91 B;  4J8V B;  5CPI A;  3VH6 A;  1P3M D;  3AV1 C;  3O62 D;  3W97 C;  1P3I D;  4CAY B;  2PYO C;  1TZY C;  2ARO C;  4NE3 A;  5B32 B;  3AFA B;  5B32 D;  3AFA D;  3B0B A;  3C1C C;  4E45 A;  4NE5 A;  3UTB A;  4KUD B;  4WU9 D;  1P3P A;  3LEL C;  5CPK B;  3MNN B;  2HIO C;  1U35 B;  4QLC B;  1U35 D;  4NE6 A;  4KHA B;  4LD9 B;  4JJN C;  1S32 B;  4LD9 D;  3WA9 A;  2NQB D;  5AVB C;  5GT0 B;  3B6F A;  5CPJ A;  5F99 B;  3B6G A;  5B40 C;  1P3L C;  3TU4 C;  3AZH C;  2NZD A;  2LY8 A;  3AZM C;  1P3G B;  3KUY B;  1JFI A;  1P3G D;  1P34 C;  1P3M C;  3O62 C;  4G91 C;  4J8V C;  3WKJ B;  5AV8 A;  3WKJ D;  5B0Z B;  3AZJ A;  1Q9C A;  5B32 C;  3AFA C;  1KX4 A;  1AOI A;  5GT3 D;  1N1J B;  3MVD D;  3AZM A;  1P3K A;  3X1S A;  5B33 A;  5B31 G;  4H9S A;  5AVC D;  1P3B A;  5B0Y B;  4KUD C;  1ZLA B;  3LZ1 B;  3MGS D;  3REL A;  3LZ1 D;  5CPK C;  1ZLA D;  4YM6 A;  1U35 C;  4QLC C;  5B31 A;  4CSR B;  3REJ B;  4R8P B;  3AYW B;  1HQ3 D;  5B2J A;  5B1M A;  3A6N A;  4LD9 C;  3MGP B;  2YFW A;  5AY8 B;  3WAA D;  1S32 C;  3NQJ B;  5AY8 D;  5GT0 C;  5CP6 D;  4J8U D;  5DNM D;  5F99 C;  3W99 B;  2BYK B;  4J8X D;  5E5A B;  5B24 B;  3X1V A;  5B24 D;  1P3G C;  2F8N G;  3VH5 W;  3KUY C;  1P3O A;  3W96 D;  4Z66 D;  3AZE A;  3WKJ C;  4NFT A;  5GSU B;  5B0Z C;  5B1L B;  5GSU D;  3MVD C;  5BNV A;  3X1T A;  4Z5T A;  1EQZ D;  2F8N A;  5B1L D;  4ZUX A;  1WWI A;  3UT9 A;  5BS7 C;  3AZK A;  3KWQ B;  4DRA A;  1M19 B;  5B0Y C;  2CV5 D;  1BH9 B;  1ZLA C;  3LZ1 C;  1M18 A;  3WTP E;  3NQU B;  2F8N H;  3REJ C;  4R8P C;  3REH B;  3AYW C;  3LJA D;  1KX3 A;  5AY8 C;  3AZN B;  2FJ7 A;  4H9Q B;  3AV2 A;  2RVQ D;  3C1B B;  3KXB B;  3W97 A;  3AV1 A;  1F66 B;  5AV5 B;  3W99 C;  2PYO A;  4JJN B;  1TZY A;  2ARO A;  5BNX A;  5E5A C;  5B24 C;  3C1C A;  5B2I A;  3LZ0 B;  4WU8 B;  5AV9 D;  4WU8 D;  3LEL A;  4YS3 B;  1H3O A;  5GSU C;  2HIO A;  4YS3 D;  5B1L C;  3X1U B;  2YFV B;  3X1U D;  1ULY A;  1BH8 B;  4HGA B;  4XUJ B;  3KWQ C;  2CV5 C;  1P3I B;  1M19 C;  1P3F D;  4XUJ D;  5AVB A;  3REI B;  5GXQ D;  3V9R B;  3REI D;  5FUG B;  5B40 A;  3REH C;  3MGQ B;  1P3L A;  3TU4 A;  4WU9 B;  3MGQ D;  4H9P B;  3AZH A;  3AZN C;  2JSS A;  5B32 G;  1P34 A;  5KDM B;  3R45 B;  1P3M A;  3O62 A;  3C1B C;  4J8V A;  3KXB C;  3UTB D;  1F66 C;  5AV5 C;  3B0D B;  3AN2 B;  5AV6 B;  2NQB B;  5B32 A;  3AFA A;  3AN2 D;  5AV6 D;  3AZL B;  5CHL B;  1F1E A;  3LZ0 C;  3AZL D;  3AZG A;  3WA9 D;  4WU8 C;  4KUD A;  5CPJ B;  4YS3 C;  5CPK A;  5CPJ D;  3MNN A;  1U35 A;  3B6G D;  4QLC A;  3X1U C;  4DRB A;  4KHA A;  4LD9 A;  2NZD D;  4HGA C;  4XUJ C;  1S32 A;  1P3I C;  2IO5 C;  5DNN B;  5GT0 A;  5DNN D;  3REI C;  5GT3 B;  3MVD B;  5F99 A;  5AVC B;  5AV8 D;  3AZJ B;  4ZBJ B;  1R4V A;  3MGQ C;  3AZJ D;  3AZM B;  4XZQ A;  4WU9 C;  3AZI B;  1P3K B;  1AOI D;  3MGS B;  3AZM D;  1P3K D;  3AZI D;  1P3G A;  3X1S D;  3KUY A;  1HQ3 B;  3WKJ A;  4X23 A;  4KGC B;  3B0D C;  3REL D;  3WAA B;  5B0Z A;  4KGC D;  3AN2 C;  5AV6 C;  2NQB C;  5CP6 B;  1N1J A;  4J8U B;  5DNM B;  5BS7 A;  1TAF B;  3WTP B;  5B1M D;  3A6N D;  3AZL C;  3WTP D;  5B0Y A;  4J8X B;  1ZLA A;  3LZ1 A;  5CPJ C;  3W98 A;  5G49 A;  3B0C W;  4CSR A;  3W96 B;  4J8W A;  4Z66 B;  3REJ A;  4R8P A;  3AYW A;  5JA4 B;  3MGP A;  4AWL B;  5AY8 A;  3X1V D;  4WNN B;  3VH6 W;  5DNN C;  1EQZ B;  3MGR B;  5GT3 C;  4UUZ B;  3REK B;  5AVC C;  3MGR D;  3REK D;  4M6B A;  3AZJ C;  3W99 A;  4ZBJ C;  5BNV B;  2BYK A;  4H9R B;  2CV5 B;  5E5A A;  3VH5 T;  2HUE B;  5B24 A;  3UT9 B;  1P3K C;  3AZI C;  3MGS C; 
#chains in the Genus database with same CATH topology
 3UT9 D;  5BO0 B;  3VH6 T;  1M18 B;  1HQ3 C;  3LJA B;  1M1A B;  1M18 D;  4KGC C;  5GSU A;  3WAA C;  1M1A D;  5B1L A;  1KX5 B;  3A1I A;  5CP6 C;  1KX5 D;  4J8U C;  5DNM C;  3WTP C;  2JCH A;  5JRG B;  3KWQ A;  1M19 A;  4WV4 B;  5JRG D;  4J8X C;  1BH9 A;  3AV2 D;  4H9N B;  1ID3 B;  3KSY A;  4WZS B;  1ID3 D;  2Y2J A;  3W97 D;  3NQU A;  3W96 C;  4Z66 C;  3REH A;  2PYO D;  3EPH A;  2G5H C;  3UTA B;  4H9O B;  4Z2M G;  5AV9 B;  4AWL C;  3UTA D;  3AZN A;  2L5A A;  1P3A B;  4H9Q A;  5B2I B;  1P3A D;  1EQZ C;  5B2I D;  2BYM B;  1KU5 A;  3C1B A;  3MGR C;  3KXB A;  3REK C;  1F66 A;  5AV5 A;  4JJN A;  1P3F B;  3AZF B;  5C3I B;  2HUE C;  2IO5 B;  3UT9 C;  3AZF D;  5GXQ B;  5CPI B;  5CPI D;  3LZ0 A;  1M18 C;  4Z2M H;  3LJA C;  1M1A C;  4YS3 A;  1KX5 C;  2RVQ C;  2YFV A;  2ZY2 A;  1P3L D;  3UTB B;  4G92 B;  1P3P B;  1BH8 A;  1P3I A;  4XUJ A;  5JRG C;  1P3P D;  4CAY A;  3P5J B;  1P34 D;  1ID3 C;  3REI A;  4J8V D;  3V9R A;  5FUG A;  4DQY B;  3MGQ A;  3WA9 B;  3UTA C;  4WU9 A;  5AV9 C;  4H9P A;  3B6F B;  1P3A C;  5B2I C;  3B6F D;  3B6G B;  3AZG B;  5KDM A;  3R45 A;  3AZG D;  4KUD D;  1T3U A;  2ZY5 A;  2NZD B;  5CPK D;  3MNN D;  3KFU G;  3AN2 A;  5AV6 A;  4QLC D;  1P3F C;  3AZF C;  5C3I C;  1JFI B;  2NQB A;  5GXQ C;  5CPI C;  3AZL A;  2Y2L A;  5AV8 B;  1S32 D;  5GT0 D;  1AOI B;  1KX4 B;  1B6W A;  5F99 D;  1KX4 D;  5B33 B;  3X1S B;  3H0M C;  1P3B B;  5B33 D;  4EO5 B;  1P3B D;  4XZQ B;  3UTB C;  4G92 C;  4XZQ D;  1P3P C;  3REL B;  4YM6 B;  3KUY D;  5DNN A;  5B31 B;  4YM6 D;  5GT3 A;  4X23 B;  5B31 D;  3MVD A;  5AVC A;  5B2J B;  4X23 D;  5B1M B;  3A6N B;  2YFW B;  5B2J D;  5B0Z D;  3WA9 C;  3AZI A;  3MGS A;  5BT1 D;  3B6F C;  4E44 A;  3B6G C;  3AZG C;  5B0Y D;  3H0R C;  1HQ3 A;  3W98 B;  3MNN C;  2DQN C;  3W98 D;  5G49 B;  4KGC A;  2NZD C;  3X1V B;  3WAA A;  4J8W B;  2Y2M A;  3NQJ A;  4J8W D;  3REJ D;  5CP6 A;  4R8P D;  3AZE B;  4J8U A;  5DNM A;  3AYW D;  1P3O D;  1TAF A;  3AZE D;  3WTP A;  2F8N K;  3IP4 C;  3MGP D;  5AV8 C;  4J8X A;  3B0C T;  3X1T B;  2F8N B;  4Z5T B;  1AOI C;  1KX4 C;  4ZUX B;  3X1T D;  2F8N D;  4Z5T D;  5B33 C;  4ZUX D;  2F2A C;  4H9S C;  3X1S C;  3W96 A;  1P3B C;  4Z66 A;  3AZK B;  1B67 A;  3W99 D;  4EO5 C;  4XZQ C;  5JA4 A;  5E5A D;  3AZK D;  4WNN A;  3REL C;  4YM6 C;  4UPK A;  1EQZ A;  5B31 C;  3MGR A;  4UUZ A;  4X23 C;  3REK A;  1BFM A;  1A7W A;  5B2J C;  5B1M C;  3A6N C;  1KX3 B;  2FJ7 B;  2Y2I A;  4H9R A;  1KX3 D;  2CV5 A;  2FJ7 D;  5BT1 C;  3AV2 B;  1P3O B;  3W97 B;  3AV1 B;  2Y2N A;  5BO0 A;  3KWQ D;  1M19 D;  3AV1 D;  2PYO B;  3W98 C;  1TZY B;  2ARO B;  3FDD A;  5BNX B;  3LJA A;  1M1A A;  1TZY D;  2ARO D;  3X1V C;  4J8W C;  1KX5 A;  3C1C B;  1P3O C;  3AZE C;  3REH D;  3C1C D;  3MGP C;  5JRG A;  3LEL B;  3AZN D;  1H3O B;  2HIO B;  3LEL D;  2HIO D;  4H9N A;  3X1T C;  4Z5T C;  1ID3 A;  3C1B D;  4ZUX C;  3KXB D;  2ZY3 A;  1F66 D;  5AV5 D;  3AZK C;  3EPL A;  4JJN D;  3UTA A;  4H9O A;  5AV9 A;  2XD1 A;  5AVB B;  4WU8 A;  1WWS A;  5AVB D;  1P3A A;  2RIQ A;  2CWE A;  3LZ0 D;  2BYM A;  5B40 B;  2XD5 A;  1HTA A;  3X1U A;  1P3L B;  3TU4 B;  5B40 D;  3AZH B;  3TU4 D;  1KX3 C;  2FJ7 C;  2Y2O A;  3AZH D;  2JE5 A;  3VH5 A;  1P3F A;  3AZF A;  3AV2 C;  1P34 B;  1P3M B;  5GXQ A;  3O62 B;  4G91 B;  4J8V B;  5CPI A;  3VH6 A;  1P3M D;  3AV1 C;  3O62 D;  3W97 C;  1P3I D;  2W8S A;  4CAY B;  2PYO C;  1TZY C;  2ARO C;  4NE3 A;  5B32 B;  3AFA B;  3EPJ A;  5B32 D;  3AFA D;  3B0B A;  3C1C C;  4E45 A;  4NE5 A;  3UTB A;  4KUD B;  4WU9 D;  1P3P A;  3LEL C;  5CPK B;  3MNN B;  2HIO C;  1W2E A;  1U35 B;  4QLC B;  1U35 D;  4NE6 A;  4KHA B;  4LD9 B;  4JJN C;  1S32 B;  4LD9 D;  3WA9 A;  2NQB D;  5AVB C;  5GT0 B;  3B6F A;  5CPJ A;  5F99 B;  3B6G A;  2BG1 A;  5B40 C;  1P3L C;  2ZY4 A;  3TU4 C;  3AZH C;  2NZD A;  2LY8 A;  3AZM C;  1P3G B;  3KUY B;  1JFI A;  1P3G D;  1P34 C;  1P3M C;  3O62 C;  4G91 C;  4J8V C;  3WKJ B;  5AV8 A;  3WKJ D;  5B0Z B;  3AZJ A;  1Q9C A;  2J8P A;  5B32 C;  3AFA C;  1KX4 A;  1AOI A;  5GT3 D;  1N1J B;  3MVD D;  3AZM A;  1P3K A;  3X1S A;  5B33 A;  5B31 G;  4H9S A;  5AVC D;  1P3B A;  5B0Y B;  3AL0 C;  4KUD C;  1ZLA B;  3LZ1 B;  3MGS D;  3REL A;  3LZ1 D;  5CPK C;  1ZLA D;  4YM6 A;  1U35 C;  4QLC C;  5B31 A;  4CSR B;  3REJ B;  4R8P B;  3AYW B;  1HQ3 D;  5B2J A;  1PZR A;  5B1M A;  3A6N A;  4LD9 C;  3MGP B;  2YFW A;  5AY8 B;  3WAA D;  1S32 C;  3NQJ B;  5AY8 D;  5GT0 C;  5CP6 D;  4J8U D;  5DNM D;  5F99 C;  3W99 B;  2BYK B;  4J8X D;  5E5A B;  5B24 B;  3X1V A;  5B24 D;  1P3G C;  2F8N G;  3VH5 W;  3KUY C;  1P3O A;  3W96 D;  4Z66 D;  3AZE A;  3WKJ C;  4NFT A;  5GSU B;  5B0Z C;  5B1L B;  5GSU D;  3A1K A;  5BNV A;  3MVD C;  4Z5T A;  3X1T A;  2VQR A;  1EQZ D;  5B1L D;  2F8N A;  4ZUX A;  1WWI A;  3UT9 A;  5BS7 C;  3AZK A;  3KWQ B;  4DRA A;  1M19 B;  5B0Y C;  2CV5 D;  1BH9 B;  1ZLA C;  3LZ1 C;  1M18 A;  3WTP E;  3NQU B;  2F8N H;  3REJ C;  4R8P C;  3REH B;  3EPK A;  3AYW C;  3LJA D;  1KX3 A;  5AY8 C;  3AZN B;  2FJ7 A;  1Z2C B;  4H9Q B;  3AV2 A;  2RVQ D;  3C1B B;  3KXB B;  3W97 A;  3AV1 A;  1F66 B;  5AV5 B;  2UWX A;  3W99 C;  2PYO A;  4JJN B;  1TZY A;  2ARO A;  5BNX A;  5E5A C;  5B24 C;  3C1C A;  5B2I A;  3LZ0 B;  4WU8 B;  5AV9 D;  4WU8 D;  3LEL A;  4YS3 B;  2Y2Q A;  1H3O A;  5GSU C;  2HIO A;  4YS3 D;  5B1L C;  3X1U B;  2YFV B;  3X1U D;  3EG5 B;  1ULY A;  1BH8 B;  4HGA B;  4XUJ B;  3KWQ C;  2CV5 C;  1P3I B;  1M19 C;  1P3F D;  4XUJ D;  5AVB A;  2Y2K A;  3REI B;  5GXQ D;  3V9R B;  3REI D;  5FUG B;  5B40 A;  4WJ3 C;  3REH C;  3MGQ B;  1P3L A;  3TU4 A;  4WU9 B;  3MGQ D;  2FFF B;  4H9P B;  3AZH A;  3AZN C;  2JSS A;  5B32 G;  1P34 A;  5KDM B;  3R45 B;  1P3M A;  3O62 A;  3C1B C;  4J8V A;  3KXB C;  3UTB D;  1F66 C;  5AV5 C;  3B0D B;  3AN2 B;  5AV6 B;  2NQB B;  5B32 A;  3AFA A;  3AN2 D;  5AV6 D;  2Y2P A;  3AZL B;  5CHL B;  1F1E A;  3LZ0 C;  3AZL D;  3AZG A;  3WA9 D;  4WU8 C;  4KUD A;  5CPJ B;  2ZM5 A;  4YS3 C;  5CPK A;  5CPJ D;  3MNN A;  1U35 A;  3B6G D;  4QLC A;  3X1U C;  4DRB A;  4KHA A;  4LD9 A;  2NZD D;  4HGA C;  4XUJ C;  1S32 A;  1P3I C;  2IO5 C;  5DNN B;  2DF4 C;  5GT0 A;  5DNN D;  3REI C;  3F6T A;  5GT3 B;  3MVD B;  5F99 A;  5AVC B;  5AV8 D;  3AZJ B;  4ZBJ B;  1R4V A;  3MGQ C;  3AZJ D;  3AZM B;  4XZQ A;  4WU9 C;  3AZI B;  1P3K B;  1AOI D;  3MGS B;  3AZM D;  3H0L C;  1P3K D;  3AZI D;  1P3G A;  3X1S D;  3KUY A;  1HQ3 B;  3WKJ A;  4X23 A;  4KGC B;  3B0D C;  3REL D;  3WAA B;  5B0Z A;  2Y2G A;  3AN2 C;  4KGC D;  5AV6 C;  2NQB C;  5CP6 B;  1N1J A;  2G5I C;  5DNM B;  4J8U B;  5BS7 A;  1TAF B;  3WTP B;  5B1M D;  3A6N D;  3AZL C;  3WTP D;  5B0Y A;  4J8X B;  1ZLA A;  3LZ1 A;  5CPJ C;  3W98 A;  5G49 A;  2Y2H A;  3B0C W;  4CSR A;  3W96 B;  4J8W A;  4Z66 B;  3REJ A;  4R8P A;  3AYW A;  5JA4 B;  3MGP A;  4AWL B;  5AY8 A;  3X1V D;  4WNN B;  3VH6 W;  5DNN C;  1EQZ B;  3MGR B;  5GT3 C;  4UUZ B;  3REK B;  5AVC C;  3MGR D;  3REK D;  4M6B A;  3AZJ C;  3W99 A;  4ZBJ C;  5BNV B;  2BYK A;  4H9R B;  2CV5 B;  5E5A A;  3VH5 T;  2HUE B;  5B24 A;  3UT9 B;  1P3K C;  3AZI C;  3MGS C; 
#chains in the Genus database with same CATH homology
 3UT9 D;  5BO0 B;  3VH6 T;  1M18 B;  1HQ3 C;  3LJA B;  1M1A B;  1M18 D;  4KGC C;  5GSU A;  3WAA C;  1M1A D;  5B1L A;  1KX5 B;  3A1I A;  5CP6 C;  1KX5 D;  4J8U C;  5DNM C;  3WTP C;  2JCH A;  5JRG B;  3KWQ A;  1M19 A;  4WV4 B;  5JRG D;  4J8X C;  1BH9 A;  3AV2 D;  4H9N B;  1ID3 B;  3KSY A;  4WZS B;  1ID3 D;  2Y2J A;  3W97 D;  3NQU A;  3W96 C;  4Z66 C;  3REH A;  2PYO D;  3EPH A;  2G5H C;  3UTA B;  4H9O B;  4Z2M G;  5AV9 B;  4AWL C;  3UTA D;  3AZN A;  2L5A A;  1P3A B;  4H9Q A;  5B2I B;  1P3A D;  1EQZ C;  5B2I D;  2BYM B;  1KU5 A;  3C1B A;  3MGR C;  3KXB A;  3REK C;  1F66 A;  5AV5 A;  4JJN A;  1P3F B;  3AZF B;  5C3I B;  2HUE C;  2IO5 B;  3UT9 C;  3AZF D;  5GXQ B;  5CPI B;  5CPI D;  3LZ0 A;  1M18 C;  4Z2M H;  3LJA C;  1M1A C;  4YS3 A;  1KX5 C;  2RVQ C;  2YFV A;  2ZY2 A;  1P3L D;  3UTB B;  4G92 B;  1P3P B;  1BH8 A;  1P3I A;  4XUJ A;  5JRG C;  1P3P D;  4CAY A;  3P5J B;  1P34 D;  1ID3 C;  3REI A;  4J8V D;  3V9R A;  5FUG A;  4DQY B;  3MGQ A;  3WA9 B;  3UTA C;  4WU9 A;  5AV9 C;  4H9P A;  3B6F B;  1P3A C;  5B2I C;  3B6F D;  3B6G B;  3AZG B;  5KDM A;  3R45 A;  3AZG D;  4KUD D;  1T3U A;  2ZY5 A;  2NZD B;  5CPK D;  3MNN D;  3KFU G;  3AN2 A;  5AV6 A;  4QLC D;  1P3F C;  3AZF C;  5C3I C;  1JFI B;  2NQB A;  5GXQ C;  5CPI C;  3AZL A;  2Y2L A;  5AV8 B;  1S32 D;  5GT0 D;  1AOI B;  1KX4 B;  1B6W A;  5F99 D;  1KX4 D;  5B33 B;  3X1S B;  3H0M C;  1P3B B;  5B33 D;  4EO5 B;  1P3B D;  4XZQ B;  3UTB C;  4G92 C;  4XZQ D;  1P3P C;  3REL B;  4YM6 B;  3KUY D;  5DNN A;  5B31 B;  4YM6 D;  5GT3 A;  4X23 B;  5B31 D;  3MVD A;  5AVC A;  5B2J B;  4X23 D;  5B1M B;  3A6N B;  2YFW B;  5B2J D;  5B0Z D;  3WA9 C;  3AZI A;  3MGS A;  5BT1 D;  3B6F C;  4E44 A;  3B6G C;  3AZG C;  5B0Y D;  3H0R C;  1HQ3 A;  3W98 B;  3MNN C;  2DQN C;  3W98 D;  5G49 B;  4KGC A;  2NZD C;  3X1V B;  3WAA A;  4J8W B;  2Y2M A;  3NQJ A;  4J8W D;  3REJ D;  5CP6 A;  4R8P D;  3AZE B;  4J8U A;  5DNM A;  3AYW D;  1P3O D;  1TAF A;  3AZE D;  3WTP A;  2F8N K;  3IP4 C;  3MGP D;  5AV8 C;  4J8X A;  3B0C T;  3X1T B;  2F8N B;  4Z5T B;  1AOI C;  1KX4 C;  4ZUX B;  3X1T D;  2F8N D;  4Z5T D;  5B33 C;  4ZUX D;  2F2A C;  4H9S C;  3X1S C;  3W96 A;  1P3B C;  4Z66 A;  3AZK B;  1B67 A;  3W99 D;  4EO5 C;  4XZQ C;  5JA4 A;  5E5A D;  3AZK D;  4WNN A;  3REL C;  4YM6 C;  4UPK A;  1EQZ A;  5B31 C;  3MGR A;  4UUZ A;  4X23 C;  3REK A;  1BFM A;  1A7W A;  5B2J C;  5B1M C;  3A6N C;  1KX3 B;  2FJ7 B;  2Y2I A;  4H9R A;  1KX3 D;  2CV5 A;  2FJ7 D;  5BT1 C;  3AV2 B;  1P3O B;  3W97 B;  3AV1 B;  2Y2N A;  5BO0 A;  3KWQ D;  1M19 D;  3AV1 D;  2PYO B;  3W98 C;  1TZY B;  2ARO B;  3FDD A;  5BNX B;  3LJA A;  1M1A A;  1TZY D;  2ARO D;  3X1V C;  4J8W C;  1KX5 A;  3C1C B;  1P3O C;  3AZE C;  3REH D;  3C1C D;  3MGP C;  5JRG A;  3LEL B;  3AZN D;  1H3O B;  2HIO B;  3LEL D;  2HIO D;  4H9N A;  3X1T C;  4Z5T C;  1ID3 A;  3C1B D;  4ZUX C;  3KXB D;  2ZY3 A;  1F66 D;  5AV5 D;  3AZK C;  3EPL A;  4JJN D;  3UTA A;  4H9O A;  5AV9 A;  2XD1 A;  5AVB B;  4WU8 A;  1WWS A;  5AVB D;  1P3A A;  2RIQ A;  2CWE A;  3LZ0 D;  2BYM A;  5B40 B;  2XD5 A;  1HTA A;  3X1U A;  1P3L B;  3TU4 B;  5B40 D;  3AZH B;  3TU4 D;  1KX3 C;  2FJ7 C;  2Y2O A;  3AZH D;  2JE5 A;  3VH5 A;  1P3F A;  3AZF A;  3AV2 C;  1P34 B;  1P3M B;  5GXQ A;  3O62 B;  4G91 B;  4J8V B;  5CPI A;  3VH6 A;  1P3M D;  3AV1 C;  3O62 D;  3W97 C;  1P3I D;  2W8S A;  4CAY B;  2PYO C;  1TZY C;  2ARO C;  4NE3 A;  5B32 B;  3AFA B;  3EPJ A;  5B32 D;  3AFA D;  3B0B A;  3C1C C;  4E45 A;  4NE5 A;  3UTB A;  4KUD B;  4WU9 D;  1P3P A;  3LEL C;  5CPK B;  3MNN B;  2HIO C;  1W2E A;  1U35 B;  4QLC B;  1U35 D;  4NE6 A;  4KHA B;  4LD9 B;  4JJN C;  1S32 B;  4LD9 D;  3WA9 A;  2NQB D;  5AVB C;  5GT0 B;  3B6F A;  5CPJ A;  5F99 B;  3B6G A;  2BG1 A;  5B40 C;  1P3L C;  2ZY4 A;  3TU4 C;  3AZH C;  2NZD A;  2LY8 A;  3AZM C;  1P3G B;  3KUY B;  1JFI A;  1P3G D;  1P34 C;  1P3M C;  3O62 C;  4G91 C;  4J8V C;  3WKJ B;  5AV8 A;  3WKJ D;  5B0Z B;  3AZJ A;  1Q9C A;  2J8P A;  5B32 C;  3AFA C;  1KX4 A;  1AOI A;  5GT3 D;  1N1J B;  3MVD D;  3AZM A;  1P3K A;  3X1S A;  5B33 A;  5B31 G;  4H9S A;  5AVC D;  1P3B A;  5B0Y B;  3AL0 C;  4KUD C;  1ZLA B;  3LZ1 B;  3MGS D;  3REL A;  3LZ1 D;  5CPK C;  1ZLA D;  4YM6 A;  1U35 C;  4QLC C;  5B31 A;  4CSR B;  3REJ B;  4R8P B;  3AYW B;  1HQ3 D;  5B2J A;  1PZR A;  5B1M A;  3A6N A;  4LD9 C;  3MGP B;  2YFW A;  5AY8 B;  3WAA D;  1S32 C;  3NQJ B;  5AY8 D;  5GT0 C;  5CP6 D;  4J8U D;  5DNM D;  5F99 C;  3W99 B;  2BYK B;  4J8X D;  5E5A B;  5B24 B;  3X1V A;  5B24 D;  1P3G C;  2F8N G;  3VH5 W;  3KUY C;  1P3O A;  3W96 D;  4Z66 D;  3AZE A;  3WKJ C;  4NFT A;  5GSU B;  5B0Z C;  5B1L B;  5GSU D;  3A1K A;  5BNV A;  3MVD C;  4Z5T A;  3X1T A;  2VQR A;  1EQZ D;  5B1L D;  2F8N A;  4ZUX A;  1WWI A;  3UT9 A;  5BS7 C;  3AZK A;  3KWQ B;  4DRA A;  1M19 B;  5B0Y C;  2CV5 D;  1BH9 B;  1ZLA C;  3LZ1 C;  1M18 A;  3WTP E;  3NQU B;  2F8N H;  3REJ C;  4R8P C;  3REH B;  3EPK A;  3AYW C;  3LJA D;  1KX3 A;  5AY8 C;  3AZN B;  2FJ7 A;  1Z2C B;  4H9Q B;  3AV2 A;  2RVQ D;  3C1B B;  3KXB B;  3W97 A;  3AV1 A;  1F66 B;  5AV5 B;  2UWX A;  3W99 C;  2PYO A;  4JJN B;  1TZY A;  2ARO A;  5BNX A;  5E5A C;  5B24 C;  3C1C A;  5B2I A;  3LZ0 B;  4WU8 B;  5AV9 D;  4WU8 D;  3LEL A;  4YS3 B;  2Y2Q A;  1H3O A;  5GSU C;  2HIO A;  4YS3 D;  5B1L C;  3X1U B;  2YFV B;  3X1U D;  3EG5 B;  1ULY A;  1BH8 B;  4HGA B;  4XUJ B;  3KWQ C;  2CV5 C;  1P3I B;  1M19 C;  1P3F D;  4XUJ D;  5AVB A;  2Y2K A;  3REI B;  5GXQ D;  3V9R B;  3REI D;  5FUG B;  5B40 A;  4WJ3 C;  3REH C;  3MGQ B;  1P3L A;  3TU4 A;  4WU9 B;  3MGQ D;  2FFF B;  4H9P B;  3AZH A;  3AZN C;  2JSS A;  5B32 G;  1P34 A;  5KDM B;  3R45 B;  1P3M A;  3O62 A;  3C1B C;  4J8V A;  3KXB C;  3UTB D;  1F66 C;  5AV5 C;  3B0D B;  3AN2 B;  5AV6 B;  2NQB B;  5B32 A;  3AFA A;  3AN2 D;  5AV6 D;  2Y2P A;  3AZL B;  5CHL B;  1F1E A;  3LZ0 C;  3AZL D;  3AZG A;  3WA9 D;  4WU8 C;  4KUD A;  5CPJ B;  2ZM5 A;  4YS3 C;  5CPK A;  5CPJ D;  3MNN A;  1U35 A;  3B6G D;  4QLC A;  3X1U C;  4DRB A;  4KHA A;  4LD9 A;  2NZD D;  4HGA C;  4XUJ C;  1S32 A;  1P3I C;  2IO5 C;  5DNN B;  2DF4 C;  5GT0 A;  5DNN D;  3REI C;  3F6T A;  5GT3 B;  3MVD B;  5F99 A;  5AVC B;  5AV8 D;  3AZJ B;  4ZBJ B;  1R4V A;  3MGQ C;  3AZJ D;  3AZM B;  4XZQ A;  4WU9 C;  3AZI B;  1P3K B;  1AOI D;  3MGS B;  3AZM D;  3H0L C;  1P3K D;  3AZI D;  1P3G A;  3X1S D;  3KUY A;  1HQ3 B;  3WKJ A;  4X23 A;  4KGC B;  3B0D C;  3REL D;  3WAA B;  5B0Z A;  2Y2G A;  3AN2 C;  4KGC D;  5AV6 C;  2NQB C;  5CP6 B;  1N1J A;  2G5I C;  5DNM B;  4J8U B;  5BS7 A;  1TAF B;  3WTP B;  5B1M D;  3A6N D;  3AZL C;  3WTP D;  5B0Y A;  4J8X B;  1ZLA A;  3LZ1 A;  5CPJ C;  3W98 A;  5G49 A;  2Y2H A;  3B0C W;  4CSR A;  3W96 B;  4J8W A;  4Z66 B;  3REJ A;  4R8P A;  3AYW A;  5JA4 B;  3MGP A;  4AWL B;  5AY8 A;  3X1V D;  4WNN B;  3VH6 W;  5DNN C;  1EQZ B;  3MGR B;  5GT3 C;  4UUZ B;  3REK B;  5AVC C;  3MGR D;  3REK D;  4M6B A;  3AZJ C;  3W99 A;  4ZBJ C;  5BNV B;  2BYK A;  4H9R B;  2CV5 B;  5E5A A;  3VH5 T;  2HUE B;  5B24 A;  3UT9 B;  1P3K C;  3AZI C;  3MGS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...