3UTBD

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbD00
3B0CW 3B6GD 5B32A 3MGRC 3WTPE 4XZQC 3AZLB 1P3LC 5B1MC 3X1VA 1KX5D 1P3OD 5AV9C 1M19C 3WKJB 5B1LA 3LELD 3C1CA 5B24C 4Z66B 5JA4B 5BO0A 3W98C 5JRGB 3VH5T 3AZGA 1F66D 5BS7A 5AV8C 3WAAA 1P3BC 3MGSC 4AWLB 3MGRA 5JRGC 3AZNA 3AZIC 3WAAB 3MGRB 1JFIA 4ZBJB 2CV5C 3AZNB 3KUYD 1M19A 3REKD 4X23D 5B33D 1H3OB 4R8PC 3MVDB 5BNXB 1BH9A 3LELB 3WTPA 4JJNB 3WKJD 3MVDA 1ID3A 1TAFB 5CPJD 3TU4D 3AV2D 1BFMA 3A6ND 3UTAC 1TAFA 3AZHB 5CPKA 1S32A 1P34D 1M1AC 5AV9D 3AZLD 1M18A 4KHAB 2BYKB 5KDMB 3AZJA 1P3LD 5AVCD 1ULYA 5KDMA 1AOIB 3REIB 3RELB 4JJND 3KUYB 1U35C 4QLCA 2PYOD 2AROB 4H9PA 1P3ID 3RELA 4LD9A 1TZYC 1KX3A 5GT3B 1HQ3D 3R45A 3WTPC 2CWEA 4KGCD 3MVDC 5CPJA 4CAYA 3AZED 4WV4B 1ID3C 3MNNC 1M1AA 5B31B 4X23A 5B40A 5GXQA 3LZ1C 1AOIC 4UUZB 3X1SB 3RELD 3W97A 1AOID 5E5AB 4Z5TD 4H9NB 4LD9C 3AZMD 3W97B 5AVBB 4HGAB 3O62B 4H9NA 4J8VD 3VH6T 5B32G 3KWQD 1P3AC 5AVBA 1P34B 4WU9B 3UTBD 3B6FC 1P34A 5AY8C 3X1VB 3MNNA 4KUDD 5CHLB 3MNNB 1TZYD 1P3LA 3AFAA 4J8WA 5B1LB 4J8UC 5B33B 3MGPA 3AFAB 3UTBC 3O62D 4Z66A 3WAAC 5AV8A 3AZIB 3W98A 5B33A 3KWQC 1P3AD 5B2IA 1B6WA 3AZGB 4KGCB 3W98B 2CV5A 1N1JB 4KGCA 1P34C 1P3FD 4XUJD 2NZDA 5B0ZA 1M19B 4Z2MH 3WKJC 1R4VA 2NZDB 3AZKB 3V9RB 5BNVA 3MGRD 2HIOC 3AZFC 4YS3B 2LY8A 3B0CT 3C1BA 5GT3D 3W99A 5C3IC 4NE6A 4KGCC 3X1TD 3AZJC 1A7WA 4H9QA 3AZHA 1P3BD 4J8XD 3C1CD 1P3PD 1M18B 4H9OA 1F66C 2BYKA 3AZJB 1EQZC 5F99A 3REHA 3B0DC 1KX4A 5AV6B 4QLCB 3MGQD 3RELC 3WA9A 1KX3B 1ZLAB 3C1BD 3AZKC 1P3AB 3AYWB 3AV1A 2FJ7D 4WZSB 3X1UD 2NQBC 3AYWA 3AV1B 2HUEB 3UTAB 3AZHC 3B6GC 5AV9A 4XUJA 5CPKD 4X23B 1P3KC 1P3OB 5F99C 3REHC 3KXBD 3MVDD 4ZUXD 5GT3C 3KSYA 3VH5A 5GXQC 2AROC 5B2ID 1P3MD 1AOIA 3W97D 3AZMB 3AZFD 4Z66D 5E5AC 3B6FA 4H9PB 5GT0A 4YM6A 5B32D 3A6NB 3AYWC 3AZHD 2F8NB 5GT0B 4YM6B 2YFWB 3AZMC 4WU9A 4H9SA 3A6NC 3UTAD 5G49A 3LZ1D 1P3OC 4H9RB 1P3MB 2RVQD 3AFAD 4J8UA 5B0ZD 3MGPB 4KUDA 4ZUXB 1KX3D 3KXBB 1ZLAD 3MNND 1P3IA 1F1EA 1P3MC 1S32C 1P3IB 5E5AA 3KWQA 3AZID 3LJAC 5B32B 5DNMC 5AY8D 5AV8D 5F99D 3REHD 3AZLA 1M18D 4QLCC 3NQUA 1U35D 3AZGC 4EO5C 5B24A 3V9RA 1TZYA 1KX3C 3NQUB 5B24B 3X1UC 2RVQC 3MGQB 4YS3D 3WKJA 1KX5B 2NQBB 3MGPD 5BO0B 4J8WD 5JRGA 2PYOA 4R8PB 3LZ0D 5GSUB 5AV8B 3AZIA 1P3GC 3VH6W 1KX4C 5GSUA 4YS3C 2HIOB 4WU8A 3WAAD 5CPIB 2F8NH 1KX4B 3W97C 4QLCD 4J8UD 5CPIA 5AV6A 5B40D 4DRBA 4G91C 5B0ZB 1BH8B 4Z5TA 3REID 5B0YD 3X1UA 3AZKA 5FUGA 1P3AA 1BH9B 5B1LD 3LELA 4Z5TB 3X1UB 3REKB 3REJC 1S32D 3AZEA 5GSUC 4YS3A 4DRAA 4E44A 3C1BB 1ZLAC 4YM6D 5GT0D 3B0BA 5CPKB 3X1SC 1KX4D 4XUJC 3AFAC 3UTBB 1U35A 4WU8C 3TU4C 3AV2C 4NFTA 4H9OB 1P3PA 5AVCA 3KUYA 3UT9B 2AROA 2IO5B 3NQJA 5DNNC 5GT3A 1EQZD 5B32C 3X1VC 2BYMA 4R8PD 3LZ0B 1ZLAA 3C1CB 4CAYB 3REJD 5JA4A 1ID3D 3LZ0A 5DNMD 3LZ1A 3B6FD 4CSRB 5G49B 3LZ1B 1KU5A 3MGSD 4H9RA 1P3MA 5B40B 4CSRA 4KUDB 4WNNB 3KXBA 1P3OA 5AVCC 2IO5C 5AVBC 3AZNC 4LD9D 3O62A 3LZ0C 1P3BA 3KWQB 3B6FB 5DNMA 3MGPC 1P3BB 2FJ7B 3W99D 2F8NA 5DNMB 3LJAA 4G92C 5B31G 2AROD 5B2IC 3MGQA 2NQBA 4XZQA 4ZUXC 3AN2B 3WTPD 5B1MA 5B2IB 5B2JD 3WA9D 5B1MB 4ZBJC 2CV5B 3AZFB 4J8XA 2HIOD 3X1TB 4JJNC 1P3KA 3TU4B 3AV2B 1P3GA 1M1AD 1P3GB 1HTAA 3LELC 5AV6C 3C1BC 3AZKD 5CPJC 5BNVB 5BS7C 1P3FB 3MGSA 4E45A 5CP6D 5AV5C 5BT1D 1KX5C 3W96A 3X1SA 3X1SD 5B0YB 4X23C 3AYWD 3REJA 1P3PC 2CV5D 4R8PA 3AZEC 3KUYC 1U35B 3AZJD 5JRGD 1WWSA 3AV1C 4KUDC 5F99B 3REHB 2F8NK 4WU8B 1P3PB 1P3KD 1P3IC 2L5AA 5CP6B 3UT9A 5CPKC 3W96C 3NQJB 3AN2D 1Q9CA 4J8WB 5B24D 5AV5A 4Z2MG 5CP6C 5AV5D 2BYMB 3W98D 1P3FC 2NQBD 3AZLC 5DNNA 5AY8A 4J8WC 3REKA 5DNNB 5CPID 2F8NG 3AZEB 5AV9B 5AY8B 4XUJB 5GT0C 4YM6C 3UTBA 4Z66C 4HGAC 3O62C 5B33C 4AWLC 5B2JC 4H9SC 5GXQD 5BNXA 3VH6A 5AVCB 3AZMA 4WU9C 3KXBC 2NZDC 3A6NA 5B40C 3W99B 1S32B 1HQ3B 3LJAB 4H9QB 4NE5A 4KHAA 5DNND 4EO5B 1HQ3A 3W99C 5B31D 5BT1C 1P3GD 2FJ7C 1M19D 3REIA 4XZQB 2JSSA 1JFIB 4ZUXA 5B2JA 3AZND 5AV6D 4G92B 3MGQC 3R45B 4WNNA 5B1MD 5B2JB 3WA9B 1H3OA 4J8VB 5AVBD 5CPJB 1F66A 3W96D 3WTPB 4JJNA 4J8VA 5GSUD 3TU4A 3AZGD 5E5AD 3AN2C 3AV2A 1F66B 1ID3B 3WA9C 1M18C 4J8XC 1M1AB 3AV1D 2FJ7A 3UTAA 5B31A 3LJAD 3REIC 3X1TC 1HQ3C 3B0DB 1TZYB 5C3IB 2PYOC 3MGSB 3UT9D 3X1VD 1KX5A 4G91B 5B0ZC 5B0YA 2PYOB 4J8VC 3AN2A 3B6GA 4NE3A 4LD9B 3REJB 4Z5TC 3B6GB 3VH5W 5CPIC 2HUEC 2HIOA 2YFVA 3AZFA 4J8XB 3X1TA 2YFWA 1WWIA 1P3KB 2YFVB 4WU8D 5CP6A 5B31C 1P3LB 4XZQD 1BH8A 3REKC 5FUGB 1B67A 5GXQB 5AV5B 5B1LC 4J8UB 3UT9C 1EQZA 4UUZA 3C1CC 1P3FA 2NZDD 1EQZB 3W96B 5B0YC 1N1JA 2F8ND 4WU9D 4M6BA
chains in the Genus database with same CATH superfamily
3B0CW 3B6GD 5B32A 2W8SA 3WTPE 3MGRC 4XZQC 3AZLB 1P3LC 5B1MC 3X1VA 1KX5D 1P3OD 5AV9C 1M19C 3WKJB 5B1LA 3LELD 3C1CA 5B24C 4Z66B 5JA4B 5BO0A 3W98C 5JRGB 3VH5T 3AZGA 1F66D 5BS7A 5AV8C 3WAAA 1P3BC 3MGSC 4AWLB 3MGRA 5JRGC 3AZNA 3AZIC 3WAAB 3MGRB 1JFIA 4ZBJB 2CV5C 3AZNB 3KUYD 1M19A 3REKD 4X23D 5B33D 1H3OB 4R8PC 3MVDB 2ZM5A 5BNXB 1BH9A 3LELB 3WTPA 4JJNB 3WKJD 3MVDA 1ID3A 1TAFB 5CPJD 3TU4D 3AV2D 1BFMA 3A6ND 3UTAC 1TAFA 3AZHB 5CPKA 1S32A 1P34D 1M1AC 5AV9D 3AZLD 1M18A 2Y2KA 4KHAB 2BYKB 5KDMB 3AZJA 1P3LD 5AVCD 1ULYA 5KDMA 1AOIB 3REIB 3RELB 4JJND 3KUYB 1U35C 4QLCA 2PYOD 2AROB 2Y2IA 4H9PA 1P3ID 3RELA 4LD9A 1TZYC 1KX3A 5GT3B 1HQ3D 3R45A 3WTPC 2CWEA 4KGCD 3MVDC 5CPJA 4CAYA 3AZED 4WV4B 1ID3C 3MNNC 2VQRA 1M1AA 5B31B 3EPJA 4X23A 2Y2NA 5B40A 5GXQA 3LZ1C 1AOIC 2G5HC 4UUZB 3X1SB 3RELD 3W97A 1AOID 5E5AB 4Z5TD 4H9NB 4LD9C 3AZMD 3W97B 5AVBB 4HGAB 3O62B 4H9NA 4J8VD 3VH6T 5B32G 3KWQD 1P3AC 5AVBA 1P34B 4WU9B 3UTBD 3B6FC 1P34A 5AY8C 3X1VB 3MNNA 4KUDD 5CHLB 3MNNB 1TZYD 1P3LA 3AFAA 4J8WA 5B1LB 4J8UC 5B33B 3MGPA 1T3UA 3AFAB 3UTBC 3O62D 4Z66A 3WAAC 5AV8A 3AZIB 3W98A 5B33A 3KWQC 1P3AD 5B2IA 1B6WA 3AZGB 4KGCB 3W98B 2G5IC 2Y2HA 2CV5A 1N1JB 4KGCA 1P34C 1P3FD 4XUJD 2NZDA 5B0ZA 1M19B 4Z2MH 3WKJC 1R4VA 2NZDB 3AZKB 3V9RB 5BNVA 3MGRD 2HIOC 3AZFC 4YS3B 3EPKA 2LY8A 3B0CT 3C1BA 5GT3D 3W99A 5C3IC 4NE6A 4KGCC 3X1TD 3AZJC 1A7WA 4H9QA 3AZHA 1P3BD 4J8XD 3C1CD 1P3PD 1M18B 4H9OA 1F66C 4DQYB 2BYKA 3AZJB 1EQZC 5F99A 3REHA 3B0DC 1PZRA 1KX4A 5AV6B 4QLCB 3MGQD 3RELC 3WA9A 1KX3B 1ZLAB 3C1BD 3AZKC 1P3AB 2Y2GA 3AYWB 3AV1A 2FJ7D 2JE5A 4WZSB 3X1UD 2NQBC 3AYWA 3AV1B 3KFUG 2HUEB 3UTAB 3AZHC 3B6GC 5AV9A 1W2EA 4XUJA 5CPKD 2Y2JA 4X23B 1P3KC 1P3OB 5F99C 3REHC 3KXBD 3MVDD 4ZUXD 2F2AC 5GT3C 3KSYA 3VH5A 5GXQC 2AROC 5B2ID 1P3MD 1AOIA 3W97D 3FDDA 3AZMB 3AZFD 4Z66D 5E5AC 3B6FA 4H9PB 5GT0A 4YM6A 5B32D 3A6NB 3AYWC 3AZHD 2F8NB 5GT0B 4YM6B 2YFWB 3AZMC 4WU9A 4H9SA 3A6NC 3UTAD 3H0LC 5G49A 3LZ1D 1P3OC 4H9RB 1P3MB 2RVQD 3AFAD 4J8UA 5B0ZD 3IP4C 3MGPB 4KUDA 4ZUXB 1KX3D 3KXBB 1ZLAD 3MNND 1P3IA 1F1EA 1P3MC 1S32C 1P3IB 5E5AA 3KWQA 3AZID 2Y2OA 3LJAC 5B32B 5DNMC 5AY8D 5AV8D 5F99D 3REHD 3AZLA 1M18D 4QLCC 3NQUA 1U35D 3AZGC 4EO5C 5B24A 3V9RA 1TZYA 1KX3C 2JCHA 3NQUB 5B24B 3X1UC 2RVQC 3MGQB 4YS3D 3WKJA 1KX5B 2Y2QA 2NQBB 3MGPD 5BO0B 2BG1A 4J8WD 5JRGA 2PYOA 4R8PB 3LZ0D 5GSUB 5AV8B 3AZIA 3EG5B 3VH6W 1P3GC 1KX4C 5GSUA 4YS3C 2HIOB 4WU8A 3WAAD 5CPIB 2F8NH 1KX4B 3W97C 4QLCD 4J8UD 5CPIA 5AV6A 5B40D 4DRBA 4G91C 5B0ZB 2J8PA 1BH8B 4Z5TA 3REID 5B0YD 3X1UA 3AZKA 5FUGA 3P5JB 1P3AA 1BH9B 5B1LD 3LELA 4Z5TB 2UWXA 3X1UB 3REKB 3REJC 1S32D 3AZEA 5GSUC 4YS3A 4DRAA 2ZY2A 4E44A 3C1BB 3A1KA 1ZLAC 4YM6D 5GT0D 3B0BA 5CPKB 3X1SC 1KX4D 4XUJC 3AFAC 3UTBB 1U35A 2Y2PA 4WU8C 3A1IA 3TU4C 3AV2C 4NFTA 2ZY3A 4H9OB 1P3PA 2XD1A 5AVCA 3KUYA 3UT9B 2AROA 2IO5B 3NQJA 5DNNC 5GT3A 1EQZD 5B32C 3X1VC 2BYMA 4R8PD 3LZ0B 1ZLAA 3C1CB 4CAYB 3REJD 5JA4A 1ID3D 3LZ0A 5DNMD 3LZ1A 3B6FD 2DQNC 4CSRB 5G49B 3LZ1B 1KU5A 3MGSD 4H9RA 1P3MA 5B40B 4CSRA 4KUDB 4WNNB 3KXBA 1P3OA 5AVCC 3F6TA 2IO5C 5AVBC 3AZNC 4LD9D 3O62A 2ZY5A 3LZ0C 1P3BA 3KWQB 3B6FB 5DNMA 3MGPC 1P3BB 2FJ7B 3W99D 3H0RC 3EPLA 2F8NA 5DNMB 3LJAA 4G92C 5B31G 2AROD 5B2IC 3MGQA 2NQBA 4XZQA 4ZUXC 3AN2B 3WTPD 5B1MA 2RIQA 5B2IB 5B2JD 3WA9D 5B1MB 4ZBJC 2CV5B 3AZFB 4J8XA 2HIOD 3X1TB 4JJNC 1P3KA 3TU4B 3AV2B 1P3GA 1M1AD 1P3GB 1HTAA 3LELC 5AV6C 3C1BC 3AZKD 5CPJC 4UPKA 5BNVB 1Z2CB 5BS7C 1P3FB 3MGSA 4E45A 5AV5C 5CP6D 5BT1D 1KX5C 3W96A 3X1SA 3X1SD 2XD5A 5B0YB 4X23C 3AYWD 3REJA 1P3PC 2CV5D 4R8PA 3AZEC 3KUYC 1U35B 3AZJD 5JRGD 1WWSA 3AV1C 4KUDC 5F99B 3REHB 2F8NK 4WU8B 1P3PB 1P3KD 1P3IC 2L5AA 5CP6B 3UT9A 5CPKC 3W96C 3NQJB 3AN2D 1Q9CA 4J8WB 5B24D 5AV5A 4Z2MG 5CP6C 5AV5D 2BYMB 3W98D 1P3FC 2NQBD 3AZLC 5DNNA 5AY8A 4WJ3C 4J8WC 3REKA 5DNNB 5CPID 2F8NG 3AZEB 5AV9B 5AY8B 4XUJB 5GT0C 4YM6C 3UTBA 4Z66C 4HGAC 3O62C 5B33C 4AWLC 5B2JC 4H9SC 5GXQD 5BNXA 3VH6A 3EPHA 5AVCB 3AZMA 4WU9C 3AL0C 3KXBC 2NZDC 3A6NA 2ZY4A 5B40C 3W99B 1S32B 2Y2LA 1HQ3B 3LJAB 4H9QB 4NE5A 4KHAA 5DNND 4EO5B 1HQ3A 3W99C 5B31D 5BT1C 1P3GD 2FJ7C 1M19D 3REIA 4XZQB 2JSSA 1JFIB 4ZUXA 5B2JA 3AZND 5AV6D 4G92B 3MGQC 3R45B 4WNNA 5B1MD 5B2JB 3WA9B 1H3OA 4J8VB 5AVBD 5CPJB 1F66A 3W96D 3WTPB 4JJNA 4J8VA 5GSUD 3TU4A 3AZGD 5E5AD 3AN2C 3AV2A 1F66B 1ID3B 3WA9C 1M18C 4J8XC 1M1AB 3AV1D 2FJ7A 3UTAA 5B31A 3LJAD 3REIC 3X1TC 2Y2MA 1HQ3C 3B0DB 1TZYB 5C3IB 2PYOC 3MGSB 3UT9D 2FFFB 3X1VD 1KX5A 5B0ZC 4G91B 5B0YA 2PYOB 4J8VC 3AN2A 3B6GA 4NE3A 4LD9B 3REJB 4Z5TC 3B6GB 3VH5W 5CPIC 2HUEC 2HIOA 2YFVA 3H0MC 3AZFA 4J8XB 3X1TA 2YFWA 1WWIA 1P3KB 2YFVB 4WU8D 5CP6A 5B31C 1P3LB 4XZQD 1BH8A 3REKC 5FUGB 1B67A 5GXQB 5AV5B 2DF4C 5B1LC 4J8UB 3UT9C 4UUZA 1EQZA 3C1CC 1P3FA 2NZDD 1EQZB 3W96B 5B0YC 1N1JA 2F8ND 4WU9D 4M6BA
chains in the Genus database with same CATH topology
3B0CW 3B6GD 5B32A 2W8SA 3WTPE 3MGRC 4XZQC 3AZLB 1P3LC 5B1MC 3X1VA 1KX5D 1P3OD 5AV9C 1M19C 3WKJB 5B1LA 3LELD 3C1CA 5B24C 4Z66B 5JA4B 5BO0A 3W98C 5JRGB 3VH5T 3AZGA 1F66D 5BS7A 5AV8C 3WAAA 1P3BC 3MGSC 4AWLB 3MGRA 5JRGC 3AZNA 3AZIC 3WAAB 3MGRB 1JFIA 4ZBJB 2CV5C 3AZNB 3KUYD 1M19A 3REKD 4X23D 5B33D 1H3OB 4R8PC 3MVDB 2ZM5A 5BNXB 1BH9A 3LELB 3WTPA 4JJNB 3WKJD 3MVDA 1ID3A 1TAFB 5CPJD 3TU4D 3AV2D 1BFMA 3A6ND 3UTAC 1TAFA 3AZHB 5CPKA 1S32A 1P34D 1M1AC 5AV9D 3AZLD 1M18A 2Y2KA 4KHAB 2BYKB 5KDMB 3AZJA 1P3LD 5AVCD 1ULYA 5KDMA 1AOIB 3REIB 3RELB 4JJND 3KUYB 1U35C 4QLCA 2PYOD 2AROB 2Y2IA 4H9PA 1P3ID 3RELA 4LD9A 1TZYC 1KX3A 5GT3B 1HQ3D 3R45A 3WTPC 2CWEA 4KGCD 3MVDC 5CPJA 4CAYA 3AZED 4WV4B 1ID3C 3MNNC 2VQRA 1M1AA 5B31B 3EPJA 4X23A 2Y2NA 5B40A 5GXQA 3LZ1C 1AOIC 2G5HC 4UUZB 3X1SB 3RELD 3W97A 1AOID 5E5AB 4Z5TD 4H9NB 4LD9C 3AZMD 3W97B 5AVBB 4HGAB 3O62B 4H9NA 4J8VD 3VH6T 5B32G 3KWQD 1P3AC 5AVBA 1P34B 4WU9B 3UTBD 3B6FC 1P34A 5AY8C 3X1VB 3MNNA 4KUDD 5CHLB 3MNNB 1TZYD 1P3LA 3AFAA 4J8WA 5B1LB 4J8UC 5B33B 3MGPA 1T3UA 3AFAB 3UTBC 3O62D 4Z66A 3WAAC 5AV8A 3AZIB 3W98A 5B33A 3KWQC 1P3AD 5B2IA 1B6WA 3AZGB 4KGCB 3W98B 2G5IC 2Y2HA 2CV5A 1N1JB 4KGCA 1P34C 1P3FD 4XUJD 2NZDA 5B0ZA 1M19B 4Z2MH 3WKJC 1R4VA 2NZDB 3AZKB 3V9RB 5BNVA 3MGRD 2HIOC 3AZFC 4YS3B 3EPKA 2LY8A 3B0CT 3C1BA 5GT3D 3W99A 5C3IC 4NE6A 4KGCC 3X1TD 3AZJC 1A7WA 4H9QA 3AZHA 1P3BD 4J8XD 3C1CD 1P3PD 1M18B 4H9OA 1F66C 4DQYB 2BYKA 3AZJB 1EQZC 5F99A 3REHA 3B0DC 1PZRA 1KX4A 5AV6B 4QLCB 3MGQD 3RELC 3WA9A 1KX3B 1ZLAB 3C1BD 3AZKC 1P3AB 2Y2GA 3AYWB 3AV1A 2FJ7D 2JE5A 4WZSB 3X1UD 2NQBC 3AYWA 3AV1B 3KFUG 2HUEB 3UTAB 3AZHC 3B6GC 5AV9A 1W2EA 4XUJA 5CPKD 2Y2JA 4X23B 1P3KC 1P3OB 5F99C 3REHC 3KXBD 3MVDD 4ZUXD 2F2AC 5GT3C 3KSYA 3VH5A 5GXQC 2AROC 5B2ID 1P3MD 1AOIA 3W97D 3FDDA 3AZMB 3AZFD 4Z66D 5E5AC 3B6FA 4H9PB 5GT0A 4YM6A 5B32D 3A6NB 3AYWC 3AZHD 2F8NB 5GT0B 4YM6B 2YFWB 3AZMC 4WU9A 4H9SA 3A6NC 3UTAD 3H0LC 5G49A 3LZ1D 1P3OC 4H9RB 1P3MB 2RVQD 3AFAD 4J8UA 5B0ZD 3IP4C 3MGPB 4KUDA 4ZUXB 1KX3D 3KXBB 1ZLAD 3MNND 1P3IA 1F1EA 1P3MC 1S32C 1P3IB 5E5AA 3KWQA 3AZID 2Y2OA 3LJAC 5B32B 5DNMC 5AY8D 5AV8D 5F99D 3REHD 3AZLA 1M18D 4QLCC 3NQUA 1U35D 3AZGC 4EO5C 5B24A 3V9RA 1TZYA 1KX3C 2JCHA 3NQUB 5B24B 3X1UC 2RVQC 3MGQB 4YS3D 3WKJA 1KX5B 2Y2QA 2NQBB 3MGPD 5BO0B 2BG1A 4J8WD 5JRGA 2PYOA 4R8PB 3LZ0D 5GSUB 5AV8B 3AZIA 3EG5B 3VH6W 1P3GC 1KX4C 5GSUA 4YS3C 2HIOB 4WU8A 3WAAD 5CPIB 2F8NH 1KX4B 3W97C 4QLCD 4J8UD 5CPIA 5AV6A 5B40D 4DRBA 4G91C 5B0ZB 2J8PA 1BH8B 4Z5TA 3REID 5B0YD 3X1UA 3AZKA 5FUGA 3P5JB 1P3AA 1BH9B 5B1LD 3LELA 4Z5TB 2UWXA 3X1UB 3REKB 3REJC 1S32D 3AZEA 5GSUC 4YS3A 4DRAA 2ZY2A 4E44A 3C1BB 3A1KA 1ZLAC 4YM6D 5GT0D 3B0BA 5CPKB 3X1SC 1KX4D 4XUJC 3AFAC 3UTBB 1U35A 2Y2PA 4WU8C 3A1IA 3TU4C 3AV2C 4NFTA 2ZY3A 4H9OB 1P3PA 2XD1A 5AVCA 3KUYA 3UT9B 2AROA 2IO5B 3NQJA 5DNNC 5GT3A 1EQZD 5B32C 3X1VC 2BYMA 4R8PD 3LZ0B 1ZLAA 3C1CB 4CAYB 3REJD 5JA4A 1ID3D 3LZ0A 5DNMD 3LZ1A 3B6FD 2DQNC 4CSRB 5G49B 3LZ1B 1KU5A 3MGSD 4H9RA 1P3MA 5B40B 4CSRA 4KUDB 4WNNB 3KXBA 1P3OA 5AVCC 3F6TA 2IO5C 5AVBC 3AZNC 4LD9D 3O62A 2ZY5A 3LZ0C 1P3BA 3KWQB 3B6FB 5DNMA 3MGPC 1P3BB 2FJ7B 3W99D 3H0RC 3EPLA 2F8NA 5DNMB 3LJAA 4G92C 5B31G 2AROD 5B2IC 3MGQA 2NQBA 4XZQA 4ZUXC 3AN2B 3WTPD 5B1MA 2RIQA 5B2IB 5B2JD 3WA9D 5B1MB 4ZBJC 2CV5B 3AZFB 4J8XA 2HIOD 3X1TB 4JJNC 1P3KA 3TU4B 3AV2B 1P3GA 1M1AD 1P3GB 1HTAA 3LELC 5AV6C 3C1BC 3AZKD 5CPJC 4UPKA 5BNVB 1Z2CB 5BS7C 1P3FB 3MGSA 4E45A 5AV5C 5CP6D 5BT1D 1KX5C 3W96A 3X1SA 3X1SD 2XD5A 5B0YB 4X23C 3AYWD 3REJA 1P3PC 2CV5D 4R8PA 3AZEC 3KUYC 1U35B 3AZJD 5JRGD 1WWSA 3AV1C 4KUDC 5F99B 3REHB 2F8NK 4WU8B 1P3PB 1P3KD 1P3IC 2L5AA 5CP6B 3UT9A 5CPKC 3W96C 3NQJB 3AN2D 1Q9CA 4J8WB 5B24D 5AV5A 4Z2MG 5CP6C 5AV5D 2BYMB 3W98D 1P3FC 2NQBD 3AZLC 5DNNA 5AY8A 4WJ3C 4J8WC 3REKA 5DNNB 5CPID 2F8NG 3AZEB 5AV9B 5AY8B 4XUJB 5GT0C 4YM6C 3UTBA 4Z66C 4HGAC 3O62C 5B33C 4AWLC 5B2JC 4H9SC 5GXQD 5BNXA 3VH6A 3EPHA 5AVCB 3AZMA 4WU9C 3AL0C 3KXBC 2NZDC 3A6NA 2ZY4A 5B40C 3W99B 1S32B 2Y2LA 1HQ3B 3LJAB 4H9QB 4NE5A 4KHAA 5DNND 4EO5B 1HQ3A 3W99C 5B31D 5BT1C 1P3GD 2FJ7C 1M19D 3REIA 4XZQB 2JSSA 1JFIB 4ZUXA 5B2JA 3AZND 5AV6D 4G92B 3MGQC 3R45B 4WNNA 5B1MD 5B2JB 3WA9B 1H3OA 4J8VB 5AVBD 5CPJB 1F66A 3W96D 3WTPB 4JJNA 4J8VA 5GSUD 3TU4A 3AZGD 5E5AD 3AN2C 3AV2A 1F66B 1ID3B 3WA9C 1M18C 4J8XC 1M1AB 3AV1D 2FJ7A 3UTAA 5B31A 3LJAD 3REIC 3X1TC 2Y2MA 1HQ3C 3B0DB 1TZYB 5C3IB 2PYOC 3MGSB 3UT9D 2FFFB 3X1VD 1KX5A 5B0ZC 4G91B 5B0YA 2PYOB 4J8VC 3AN2A 3B6GA 4NE3A 4LD9B 3REJB 4Z5TC 3B6GB 3VH5W 5CPIC 2HUEC 2HIOA 2YFVA 3H0MC 3AZFA 4J8XB 3X1TA 2YFWA 1WWIA 1P3KB 2YFVB 4WU8D 5CP6A 5B31C 1P3LB 4XZQD 1BH8A 3REKC 5FUGB 1B67A 5GXQB 5AV5B 2DF4C 5B1LC 4J8UB 3UT9C 4UUZA 1EQZA 3C1CC 1P3FA 2NZDD 1EQZB 3W96B 5B0YC 1N1JA 2F8ND 4WU9D 4M6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0C W;  3B6G D;  5B32 A;  3MGR C;  3WTP E;  4XZQ C;  3AZL B;  1P3L C;  5B1M C;  3X1V A;  1KX5 D;  1P3O D;  5AV9 C;  1M19 C;  3WKJ B;  5B1L A;  3LEL D;  3C1C A;  5B24 C;  4Z66 B;  5JA4 B;  5BO0 A;  3W98 C;  5JRG B;  3VH5 T;  3AZG A;  1F66 D;  5BS7 A;  5AV8 C;  3WAA A;  1P3B C;  3MGS C;  4AWL B;  3MGR A;  5JRG C;  3AZN A;  3AZI C;  3WAA B;  3MGR B;  1JFI A;  4ZBJ B;  2CV5 C;  3AZN B;  3KUY D;  1M19 A;  3REK D;  4X23 D;  5B33 D;  1H3O B;  4R8P C;  3MVD B;  5BNX B;  1BH9 A;  3LEL B;  3WTP A;  4JJN B;  3WKJ D;  3MVD A;  1ID3 A;  1TAF B;  5CPJ D;  3TU4 D;  3AV2 D;  1BFM A;  3A6N D;  3UTA C;  1TAF A;  3AZH B;  5CPK A;  1S32 A;  1P34 D;  1M1A C;  5AV9 D;  3AZL D;  1M18 A;  4KHA B;  2BYK B;  5KDM B;  3AZJ A;  1P3L D;  5AVC D;  1ULY A;  5KDM A;  1AOI B;  3REI B;  3REL B;  4JJN D;  3KUY B;  1U35 C;  4QLC A;  2PYO D;  2ARO B;  4H9P A;  1P3I D;  3REL A;  4LD9 A;  1TZY C;  1KX3 A;  5GT3 B;  1HQ3 D;  3R45 A;  3WTP C;  2CWE A;  4KGC D;  3MVD C;  5CPJ A;  4CAY A;  3AZE D;  4WV4 B;  1ID3 C;  3MNN C;  1M1A A;  5B31 B;  4X23 A;  5B40 A;  5GXQ A;  3LZ1 C;  1AOI C;  4UUZ B;  3X1S B;  3REL D;  3W97 A;  1AOI D;  5E5A B;  4Z5T D;  4H9N B;  4LD9 C;  3AZM D;  3W97 B;  5AVB B;  4HGA B;  3O62 B;  4H9N A;  4J8V D;  3VH6 T;  5B32 G;  3KWQ D;  1P3A C;  5AVB A;  1P34 B;  4WU9 B;  3UTB D;  3B6F C;  1P34 A;  5AY8 C;  3X1V B;  3MNN A;  4KUD D;  5CHL B;  3MNN B;  1TZY D;  1P3L A;  3AFA A;  4J8W A;  5B1L B;  4J8U C;  5B33 B;  3MGP A;  3AFA B;  3UTB C;  3O62 D;  4Z66 A;  3WAA C;  5AV8 A;  3AZI B;  3W98 A;  5B33 A;  3KWQ C;  1P3A D;  5B2I A;  1B6W A;  3AZG B;  4KGC B;  3W98 B;  2CV5 A;  1N1J B;  4KGC A;  1P34 C;  1P3F D;  4XUJ D;  2NZD A;  5B0Z A;  1M19 B;  4Z2M H;  3WKJ C;  1R4V A;  2NZD B;  3AZK B;  3V9R B;  5BNV A;  3MGR D;  2HIO C;  3AZF C;  4YS3 B;  2LY8 A;  3B0C T;  3C1B A;  5GT3 D;  3W99 A;  5C3I C;  4NE6 A;  4KGC C;  3X1T D;  3AZJ C;  1A7W A;  4H9Q A;  3AZH A;  1P3B D;  4J8X D;  3C1C D;  1P3P D;  1M18 B;  4H9O A;  1F66 C;  2BYK A;  3AZJ B;  1EQZ C;  5F99 A;  3REH A;  3B0D C;  1KX4 A;  5AV6 B;  4QLC B;  3MGQ D;  3REL C;  3WA9 A;  1KX3 B;  1ZLA B;  3C1B D;  3AZK C;  1P3A B;  3AYW B;  3AV1 A;  2FJ7 D;  4WZS B;  3X1U D;  2NQB C;  3AYW A;  3AV1 B;  2HUE B;  3UTA B;  3AZH C;  3B6G C;  5AV9 A;  4XUJ A;  5CPK D;  4X23 B;  1P3K C;  1P3O B;  5F99 C;  3REH C;  3KXB D;  3MVD D;  4ZUX D;  5GT3 C;  3KSY A;  3VH5 A;  5GXQ C;  2ARO C;  5B2I D;  1P3M D;  1AOI A;  3W97 D;  3AZM B;  3AZF D;  4Z66 D;  5E5A C;  3B6F A;  4H9P B;  5GT0 A;  4YM6 A;  5B32 D;  3A6N B;  3AYW C;  3AZH D;  2F8N B;  5GT0 B;  4YM6 B;  2YFW B;  3AZM C;  4WU9 A;  4H9S A;  3A6N C;  3UTA D;  5G49 A;  3LZ1 D;  1P3O C;  4H9R B;  1P3M B;  2RVQ D;  3AFA D;  4J8U A;  5B0Z D;  3MGP B;  4KUD A;  4ZUX B;  1KX3 D;  3KXB B;  1ZLA D;  3MNN D;  1P3I A;  1F1E A;  1P3M C;  1S32 C;  1P3I B;  5E5A A;  3KWQ A;  3AZI D;  3LJA C;  5B32 B;  5DNM C;  5AY8 D;  5AV8 D;  5F99 D;  3REH D;  3AZL A;  1M18 D;  4QLC C;  3NQU A;  1U35 D;  3AZG C;  4EO5 C;  5B24 A;  3V9R A;  1TZY A;  1KX3 C;  3NQU B;  5B24 B;  3X1U C;  2RVQ C;  3MGQ B;  4YS3 D;  3WKJ A;  1KX5 B;  2NQB B;  3MGP D;  5BO0 B;  4J8W D;  5JRG A;  2PYO A;  4R8P B;  3LZ0 D;  5GSU B;  5AV8 B;  3AZI A;  1P3G C;  3VH6 W;  1KX4 C;  5GSU A;  4YS3 C;  2HIO B;  4WU8 A;  3WAA D;  5CPI B;  2F8N H;  1KX4 B;  3W97 C;  4QLC D;  4J8U D;  5CPI A;  5AV6 A;  5B40 D;  4DRB A;  4G91 C;  5B0Z B;  1BH8 B;  4Z5T A;  3REI D;  5B0Y D;  3X1U A;  3AZK A;  5FUG A;  1P3A A;  1BH9 B;  5B1L D;  3LEL A;  4Z5T B;  3X1U B;  3REK B;  3REJ C;  1S32 D;  3AZE A;  5GSU C;  4YS3 A;  4DRA A;  4E44 A;  3C1B B;  1ZLA C;  4YM6 D;  5GT0 D;  3B0B A;  5CPK B;  3X1S C;  1KX4 D;  4XUJ C;  3AFA C;  3UTB B;  1U35 A;  4WU8 C;  3TU4 C;  3AV2 C;  4NFT A;  4H9O B;  1P3P A;  5AVC A;  3KUY A;  3UT9 B;  2ARO A;  2IO5 B;  3NQJ A;  5DNN C;  5GT3 A;  1EQZ D;  5B32 C;  3X1V C;  2BYM A;  4R8P D;  3LZ0 B;  1ZLA A;  3C1C B;  4CAY B;  3REJ D;  5JA4 A;  1ID3 D;  3LZ0 A;  5DNM D;  3LZ1 A;  3B6F D;  4CSR B;  5G49 B;  3LZ1 B;  1KU5 A;  3MGS D;  4H9R A;  1P3M A;  5B40 B;  4CSR A;  4KUD B;  4WNN B;  3KXB A;  1P3O A;  5AVC C;  2IO5 C;  5AVB C;  3AZN C;  4LD9 D;  3O62 A;  3LZ0 C;  1P3B A;  3KWQ B;  3B6F B;  5DNM A;  3MGP C;  1P3B B;  2FJ7 B;  3W99 D;  2F8N A;  5DNM B;  3LJA A;  4G92 C;  5B31 G;  2ARO D;  5B2I C;  3MGQ A;  2NQB A;  4XZQ A;  4ZUX C;  3AN2 B;  3WTP D;  5B1M A;  5B2I B;  5B2J D;  3WA9 D;  5B1M B;  4ZBJ C;  2CV5 B;  3AZF B;  4J8X A;  2HIO D;  3X1T B;  4JJN C;  1P3K A;  3TU4 B;  3AV2 B;  1P3G A;  1M1A D;  1P3G B;  1HTA A;  3LEL C;  5AV6 C;  3C1B C;  3AZK D;  5CPJ C;  5BNV B;  5BS7 C;  1P3F B;  3MGS A;  4E45 A;  5CP6 D;  5AV5 C;  5BT1 D;  1KX5 C;  3W96 A;  3X1S A;  3X1S D;  5B0Y B;  4X23 C;  3AYW D;  3REJ A;  1P3P C;  2CV5 D;  4R8P A;  3AZE C;  3KUY C;  1U35 B;  3AZJ D;  5JRG D;  1WWS A;  3AV1 C;  4KUD C;  5F99 B;  3REH B;  2F8N K;  4WU8 B;  1P3P B;  1P3K D;  1P3I C;  2L5A A;  5CP6 B;  3UT9 A;  5CPK C;  3W96 C;  3NQJ B;  3AN2 D;  1Q9C A;  4J8W B;  5B24 D;  5AV5 A;  4Z2M G;  5CP6 C;  5AV5 D;  2BYM B;  3W98 D;  1P3F C;  2NQB D;  3AZL C;  5DNN A;  5AY8 A;  4J8W C;  3REK A;  5DNN B;  5CPI D;  2F8N G;  3AZE B;  5AV9 B;  5AY8 B;  4XUJ B;  5GT0 C;  4YM6 C;  3UTB A;  4Z66 C;  4HGA C;  3O62 C;  5B33 C;  4AWL C;  5B2J C;  4H9S C;  5GXQ D;  5BNX A;  3VH6 A;  5AVC B;  3AZM A;  4WU9 C;  3KXB C;  2NZD C;  3A6N A;  5B40 C;  3W99 B;  1S32 B;  1HQ3 B;  3LJA B;  4H9Q B;  4NE5 A;  4KHA A;  5DNN D;  4EO5 B;  1HQ3 A;  3W99 C;  5B31 D;  5BT1 C;  1P3G D;  2FJ7 C;  1M19 D;  3REI A;  4XZQ B;  2JSS A;  1JFI B;  4ZUX A;  5B2J A;  3AZN D;  5AV6 D;  4G92 B;  3MGQ C;  3R45 B;  4WNN A;  5B1M D;  5B2J B;  3WA9 B;  1H3O A;  4J8V B;  5AVB D;  5CPJ B;  1F66 A;  3W96 D;  3WTP B;  4JJN A;  4J8V A;  5GSU D;  3TU4 A;  3AZG D;  5E5A D;  3AN2 C;  3AV2 A;  1F66 B;  1ID3 B;  3WA9 C;  1M18 C;  4J8X C;  1M1A B;  3AV1 D;  2FJ7 A;  3UTA A;  5B31 A;  3LJA D;  3REI C;  3X1T C;  1HQ3 C;  3B0D B;  1TZY B;  5C3I B;  2PYO C;  3MGS B;  3UT9 D;  3X1V D;  1KX5 A;  4G91 B;  5B0Z C;  5B0Y A;  2PYO B;  4J8V C;  3AN2 A;  3B6G A;  4NE3 A;  4LD9 B;  3REJ B;  4Z5T C;  3B6G B;  3VH5 W;  5CPI C;  2HUE C;  2HIO A;  2YFV A;  3AZF A;  4J8X B;  3X1T A;  2YFW A;  1WWI A;  1P3K B;  2YFV B;  4WU8 D;  5CP6 A;  5B31 C;  1P3L B;  4XZQ D;  1BH8 A;  3REK C;  5FUG B;  1B67 A;  5GXQ B;  5AV5 B;  5B1L C;  4J8U B;  3UT9 C;  1EQZ A;  4UUZ A;  3C1C C;  1P3F A;  2NZD D;  1EQZ B;  3W96 B;  5B0Y C;  1N1J A;  2F8N D;  4WU9 D;  4M6B A; 
#chains in the Genus database with same CATH topology
 3B0C W;  3B6G D;  5B32 A;  2W8S A;  3WTP E;  3MGR C;  4XZQ C;  3AZL B;  1P3L C;  5B1M C;  3X1V A;  1KX5 D;  1P3O D;  5AV9 C;  1M19 C;  3WKJ B;  5B1L A;  3LEL D;  3C1C A;  5B24 C;  4Z66 B;  5JA4 B;  5BO0 A;  3W98 C;  5JRG B;  3VH5 T;  3AZG A;  1F66 D;  5BS7 A;  5AV8 C;  3WAA A;  1P3B C;  3MGS C;  4AWL B;  3MGR A;  5JRG C;  3AZN A;  3AZI C;  3WAA B;  3MGR B;  1JFI A;  4ZBJ B;  2CV5 C;  3AZN B;  3KUY D;  1M19 A;  3REK D;  4X23 D;  5B33 D;  1H3O B;  4R8P C;  3MVD B;  2ZM5 A;  5BNX B;  1BH9 A;  3LEL B;  3WTP A;  4JJN B;  3WKJ D;  3MVD A;  1ID3 A;  1TAF B;  5CPJ D;  3TU4 D;  3AV2 D;  1BFM A;  3A6N D;  3UTA C;  1TAF A;  3AZH B;  5CPK A;  1S32 A;  1P34 D;  1M1A C;  5AV9 D;  3AZL D;  1M18 A;  2Y2K A;  4KHA B;  2BYK B;  5KDM B;  3AZJ A;  1P3L D;  5AVC D;  1ULY A;  5KDM A;  1AOI B;  3REI B;  3REL B;  4JJN D;  3KUY B;  1U35 C;  4QLC A;  2PYO D;  2ARO B;  2Y2I A;  4H9P A;  1P3I D;  3REL A;  4LD9 A;  1TZY C;  1KX3 A;  5GT3 B;  1HQ3 D;  3R45 A;  3WTP C;  2CWE A;  4KGC D;  3MVD C;  5CPJ A;  4CAY A;  3AZE D;  4WV4 B;  1ID3 C;  3MNN C;  2VQR A;  1M1A A;  5B31 B;  3EPJ A;  4X23 A;  2Y2N A;  5B40 A;  5GXQ A;  3LZ1 C;  1AOI C;  2G5H C;  4UUZ B;  3X1S B;  3REL D;  3W97 A;  1AOI D;  5E5A B;  4Z5T D;  4H9N B;  4LD9 C;  3AZM D;  3W97 B;  5AVB B;  4HGA B;  3O62 B;  4H9N A;  4J8V D;  3VH6 T;  5B32 G;  3KWQ D;  1P3A C;  5AVB A;  1P34 B;  4WU9 B;  3UTB D;  3B6F C;  1P34 A;  5AY8 C;  3X1V B;  3MNN A;  4KUD D;  5CHL B;  3MNN B;  1TZY D;  1P3L A;  3AFA A;  4J8W A;  5B1L B;  4J8U C;  5B33 B;  3MGP A;  1T3U A;  3AFA B;  3UTB C;  3O62 D;  4Z66 A;  3WAA C;  5AV8 A;  3AZI B;  3W98 A;  5B33 A;  3KWQ C;  1P3A D;  5B2I A;  1B6W A;  3AZG B;  4KGC B;  3W98 B;  2G5I C;  2Y2H A;  2CV5 A;  1N1J B;  4KGC A;  1P34 C;  1P3F D;  4XUJ D;  2NZD A;  5B0Z A;  1M19 B;  4Z2M H;  3WKJ C;  1R4V A;  2NZD B;  3AZK B;  3V9R B;  5BNV A;  3MGR D;  2HIO C;  3AZF C;  4YS3 B;  3EPK A;  2LY8 A;  3B0C T;  3C1B A;  5GT3 D;  3W99 A;  5C3I C;  4NE6 A;  4KGC C;  3X1T D;  3AZJ C;  1A7W A;  4H9Q A;  3AZH A;  1P3B D;  4J8X D;  3C1C D;  1P3P D;  1M18 B;  4H9O A;  1F66 C;  4DQY B;  2BYK A;  3AZJ B;  1EQZ C;  5F99 A;  3REH A;  3B0D C;  1PZR A;  1KX4 A;  5AV6 B;  4QLC B;  3MGQ D;  3REL C;  3WA9 A;  1KX3 B;  1ZLA B;  3C1B D;  3AZK C;  1P3A B;  2Y2G A;  3AYW B;  3AV1 A;  2FJ7 D;  2JE5 A;  4WZS B;  3X1U D;  2NQB C;  3AYW A;  3AV1 B;  3KFU G;  2HUE B;  3UTA B;  3AZH C;  3B6G C;  5AV9 A;  1W2E A;  4XUJ A;  5CPK D;  2Y2J A;  4X23 B;  1P3K C;  1P3O B;  5F99 C;  3REH C;  3KXB D;  3MVD D;  4ZUX D;  2F2A C;  5GT3 C;  3KSY A;  3VH5 A;  5GXQ C;  2ARO C;  5B2I D;  1P3M D;  1AOI A;  3W97 D;  3FDD A;  3AZM B;  3AZF D;  4Z66 D;  5E5A C;  3B6F A;  4H9P B;  5GT0 A;  4YM6 A;  5B32 D;  3A6N B;  3AYW C;  3AZH D;  2F8N B;  5GT0 B;  4YM6 B;  2YFW B;  3AZM C;  4WU9 A;  4H9S A;  3A6N C;  3UTA D;  3H0L C;  5G49 A;  3LZ1 D;  1P3O C;  4H9R B;  1P3M B;  2RVQ D;  3AFA D;  4J8U A;  5B0Z D;  3IP4 C;  3MGP B;  4KUD A;  4ZUX B;  1KX3 D;  3KXB B;  1ZLA D;  3MNN D;  1P3I A;  1F1E A;  1P3M C;  1S32 C;  1P3I B;  5E5A A;  3KWQ A;  3AZI D;  2Y2O A;  3LJA C;  5B32 B;  5DNM C;  5AY8 D;  5AV8 D;  5F99 D;  3REH D;  3AZL A;  1M18 D;  4QLC C;  3NQU A;  1U35 D;  3AZG C;  4EO5 C;  5B24 A;  3V9R A;  1TZY A;  1KX3 C;  2JCH A;  3NQU B;  5B24 B;  3X1U C;  2RVQ C;  3MGQ B;  4YS3 D;  3WKJ A;  1KX5 B;  2Y2Q A;  2NQB B;  3MGP D;  5BO0 B;  2BG1 A;  4J8W D;  5JRG A;  2PYO A;  4R8P B;  3LZ0 D;  5GSU B;  5AV8 B;  3AZI A;  3EG5 B;  3VH6 W;  1P3G C;  1KX4 C;  5GSU A;  4YS3 C;  2HIO B;  4WU8 A;  3WAA D;  5CPI B;  2F8N H;  1KX4 B;  3W97 C;  4QLC D;  4J8U D;  5CPI A;  5AV6 A;  5B40 D;  4DRB A;  4G91 C;  5B0Z B;  2J8P A;  1BH8 B;  4Z5T A;  3REI D;  5B0Y D;  3X1U A;  3AZK A;  5FUG A;  3P5J B;  1P3A A;  1BH9 B;  5B1L D;  3LEL A;  4Z5T B;  2UWX A;  3X1U B;  3REK B;  3REJ C;  1S32 D;  3AZE A;  5GSU C;  4YS3 A;  4DRA A;  2ZY2 A;  4E44 A;  3C1B B;  3A1K A;  1ZLA C;  4YM6 D;  5GT0 D;  3B0B A;  5CPK B;  3X1S C;  1KX4 D;  4XUJ C;  3AFA C;  3UTB B;  1U35 A;  2Y2P A;  4WU8 C;  3A1I A;  3TU4 C;  3AV2 C;  4NFT A;  2ZY3 A;  4H9O B;  1P3P A;  2XD1 A;  5AVC A;  3KUY A;  3UT9 B;  2ARO A;  2IO5 B;  3NQJ A;  5DNN C;  5GT3 A;  1EQZ D;  5B32 C;  3X1V C;  2BYM A;  4R8P D;  3LZ0 B;  1ZLA A;  3C1C B;  4CAY B;  3REJ D;  5JA4 A;  1ID3 D;  3LZ0 A;  5DNM D;  3LZ1 A;  3B6F D;  2DQN C;  4CSR B;  5G49 B;  3LZ1 B;  1KU5 A;  3MGS D;  4H9R A;  1P3M A;  5B40 B;  4CSR A;  4KUD B;  4WNN B;  3KXB A;  1P3O A;  5AVC C;  3F6T A;  2IO5 C;  5AVB C;  3AZN C;  4LD9 D;  3O62 A;  2ZY5 A;  3LZ0 C;  1P3B A;  3KWQ B;  3B6F B;  5DNM A;  3MGP C;  1P3B B;  2FJ7 B;  3W99 D;  3H0R C;  3EPL A;  2F8N A;  5DNM B;  3LJA A;  4G92 C;  5B31 G;  2ARO D;  5B2I C;  3MGQ A;  2NQB A;  4XZQ A;  4ZUX C;  3AN2 B;  3WTP D;  5B1M A;  2RIQ A;  5B2I B;  5B2J D;  3WA9 D;  5B1M B;  4ZBJ C;  2CV5 B;  3AZF B;  4J8X A;  2HIO D;  3X1T B;  4JJN C;  1P3K A;  3TU4 B;  3AV2 B;  1P3G A;  1M1A D;  1P3G B;  1HTA A;  3LEL C;  5AV6 C;  3C1B C;  3AZK D;  5CPJ C;  4UPK A;  5BNV B;  1Z2C B;  5BS7 C;  1P3F B;  3MGS A;  4E45 A;  5AV5 C;  5CP6 D;  5BT1 D;  1KX5 C;  3W96 A;  3X1S A;  3X1S D;  2XD5 A;  5B0Y B;  4X23 C;  3AYW D;  3REJ A;  1P3P C;  2CV5 D;  4R8P A;  3AZE C;  3KUY C;  1U35 B;  3AZJ D;  5JRG D;  1WWS A;  3AV1 C;  4KUD C;  5F99 B;  3REH B;  2F8N K;  4WU8 B;  1P3P B;  1P3K D;  1P3I C;  2L5A A;  5CP6 B;  3UT9 A;  5CPK C;  3W96 C;  3NQJ B;  3AN2 D;  1Q9C A;  4J8W B;  5B24 D;  5AV5 A;  4Z2M G;  5CP6 C;  5AV5 D;  2BYM B;  3W98 D;  1P3F C;  2NQB D;  3AZL C;  5DNN A;  5AY8 A;  4WJ3 C;  4J8W C;  3REK A;  5DNN B;  5CPI D;  2F8N G;  3AZE B;  5AV9 B;  5AY8 B;  4XUJ B;  5GT0 C;  4YM6 C;  3UTB A;  4Z66 C;  4HGA C;  3O62 C;  5B33 C;  4AWL C;  5B2J C;  4H9S C;  5GXQ D;  5BNX A;  3VH6 A;  3EPH A;  5AVC B;  3AZM A;  4WU9 C;  3AL0 C;  3KXB C;  2NZD C;  3A6N A;  2ZY4 A;  5B40 C;  3W99 B;  1S32 B;  2Y2L A;  1HQ3 B;  3LJA B;  4H9Q B;  4NE5 A;  4KHA A;  5DNN D;  4EO5 B;  1HQ3 A;  3W99 C;  5B31 D;  5BT1 C;  1P3G D;  2FJ7 C;  1M19 D;  3REI A;  4XZQ B;  2JSS A;  1JFI B;  4ZUX A;  5B2J A;  3AZN D;  5AV6 D;  4G92 B;  3MGQ C;  3R45 B;  4WNN A;  5B1M D;  5B2J B;  3WA9 B;  1H3O A;  4J8V B;  5AVB D;  5CPJ B;  1F66 A;  3W96 D;  3WTP B;  4JJN A;  4J8V A;  5GSU D;  3TU4 A;  3AZG D;  5E5A D;  3AN2 C;  3AV2 A;  1F66 B;  1ID3 B;  3WA9 C;  1M18 C;  4J8X C;  1M1A B;  3AV1 D;  2FJ7 A;  3UTA A;  5B31 A;  3LJA D;  3REI C;  3X1T C;  2Y2M A;  1HQ3 C;  3B0D B;  1TZY B;  5C3I B;  2PYO C;  3MGS B;  3UT9 D;  2FFF B;  3X1V D;  1KX5 A;  5B0Z C;  4G91 B;  5B0Y A;  2PYO B;  4J8V C;  3AN2 A;  3B6G A;  4NE3 A;  4LD9 B;  3REJ B;  4Z5T C;  3B6G B;  3VH5 W;  5CPI C;  2HUE C;  2HIO A;  2YFV A;  3H0M C;  3AZF A;  4J8X B;  3X1T A;  2YFW A;  1WWI A;  1P3K B;  2YFV B;  4WU8 D;  5CP6 A;  5B31 C;  1P3L B;  4XZQ D;  1BH8 A;  3REK C;  5FUG B;  1B67 A;  5GXQ B;  5AV5 B;  2DF4 C;  5B1L C;  4J8U B;  3UT9 C;  4UUZ A;  1EQZ A;  3C1C C;  1P3F A;  2NZD D;  1EQZ B;  3W96 B;  5B0Y C;  1N1J A;  2F8N D;  4WU9 D;  4M6B A; 
#chains in the Genus database with same CATH homology
 3B0C W;  3B6G D;  5B32 A;  2W8S A;  3WTP E;  3MGR C;  4XZQ C;  3AZL B;  1P3L C;  5B1M C;  3X1V A;  1KX5 D;  1P3O D;  5AV9 C;  1M19 C;  3WKJ B;  5B1L A;  3LEL D;  3C1C A;  5B24 C;  4Z66 B;  5JA4 B;  5BO0 A;  3W98 C;  5JRG B;  3VH5 T;  3AZG A;  1F66 D;  5BS7 A;  5AV8 C;  3WAA A;  1P3B C;  3MGS C;  4AWL B;  3MGR A;  5JRG C;  3AZN A;  3AZI C;  3WAA B;  3MGR B;  1JFI A;  4ZBJ B;  2CV5 C;  3AZN B;  3KUY D;  1M19 A;  3REK D;  4X23 D;  5B33 D;  1H3O B;  4R8P C;  3MVD B;  2ZM5 A;  5BNX B;  1BH9 A;  3LEL B;  3WTP A;  4JJN B;  3WKJ D;  3MVD A;  1ID3 A;  1TAF B;  5CPJ D;  3TU4 D;  3AV2 D;  1BFM A;  3A6N D;  3UTA C;  1TAF A;  3AZH B;  5CPK A;  1S32 A;  1P34 D;  1M1A C;  5AV9 D;  3AZL D;  1M18 A;  2Y2K A;  4KHA B;  2BYK B;  5KDM B;  3AZJ A;  1P3L D;  5AVC D;  1ULY A;  5KDM A;  1AOI B;  3REI B;  3REL B;  4JJN D;  3KUY B;  1U35 C;  4QLC A;  2PYO D;  2ARO B;  2Y2I A;  4H9P A;  1P3I D;  3REL A;  4LD9 A;  1TZY C;  1KX3 A;  5GT3 B;  1HQ3 D;  3R45 A;  3WTP C;  2CWE A;  4KGC D;  3MVD C;  5CPJ A;  4CAY A;  3AZE D;  4WV4 B;  1ID3 C;  3MNN C;  2VQR A;  1M1A A;  5B31 B;  3EPJ A;  4X23 A;  2Y2N A;  5B40 A;  5GXQ A;  3LZ1 C;  1AOI C;  2G5H C;  4UUZ B;  3X1S B;  3REL D;  3W97 A;  1AOI D;  5E5A B;  4Z5T D;  4H9N B;  4LD9 C;  3AZM D;  3W97 B;  5AVB B;  4HGA B;  3O62 B;  4H9N A;  4J8V D;  3VH6 T;  5B32 G;  3KWQ D;  1P3A C;  5AVB A;  1P34 B;  4WU9 B;  3UTB D;  3B6F C;  1P34 A;  5AY8 C;  3X1V B;  3MNN A;  4KUD D;  5CHL B;  3MNN B;  1TZY D;  1P3L A;  3AFA A;  4J8W A;  5B1L B;  4J8U C;  5B33 B;  3MGP A;  1T3U A;  3AFA B;  3UTB C;  3O62 D;  4Z66 A;  3WAA C;  5AV8 A;  3AZI B;  3W98 A;  5B33 A;  3KWQ C;  1P3A D;  5B2I A;  1B6W A;  3AZG B;  4KGC B;  3W98 B;  2G5I C;  2Y2H A;  2CV5 A;  1N1J B;  4KGC A;  1P34 C;  1P3F D;  4XUJ D;  2NZD A;  5B0Z A;  1M19 B;  4Z2M H;  3WKJ C;  1R4V A;  2NZD B;  3AZK B;  3V9R B;  5BNV A;  3MGR D;  2HIO C;  3AZF C;  4YS3 B;  3EPK A;  2LY8 A;  3B0C T;  3C1B A;  5GT3 D;  3W99 A;  5C3I C;  4NE6 A;  4KGC C;  3X1T D;  3AZJ C;  1A7W A;  4H9Q A;  3AZH A;  1P3B D;  4J8X D;  3C1C D;  1P3P D;  1M18 B;  4H9O A;  1F66 C;  4DQY B;  2BYK A;  3AZJ B;  1EQZ C;  5F99 A;  3REH A;  3B0D C;  1PZR A;  1KX4 A;  5AV6 B;  4QLC B;  3MGQ D;  3REL C;  3WA9 A;  1KX3 B;  1ZLA B;  3C1B D;  3AZK C;  1P3A B;  2Y2G A;  3AYW B;  3AV1 A;  2FJ7 D;  2JE5 A;  4WZS B;  3X1U D;  2NQB C;  3AYW A;  3AV1 B;  3KFU G;  2HUE B;  3UTA B;  3AZH C;  3B6G C;  5AV9 A;  1W2E A;  4XUJ A;  5CPK D;  2Y2J A;  4X23 B;  1P3K C;  1P3O B;  5F99 C;  3REH C;  3KXB D;  3MVD D;  4ZUX D;  2F2A C;  5GT3 C;  3KSY A;  3VH5 A;  5GXQ C;  2ARO C;  5B2I D;  1P3M D;  1AOI A;  3W97 D;  3FDD A;  3AZM B;  3AZF D;  4Z66 D;  5E5A C;  3B6F A;  4H9P B;  5GT0 A;  4YM6 A;  5B32 D;  3A6N B;  3AYW C;  3AZH D;  2F8N B;  5GT0 B;  4YM6 B;  2YFW B;  3AZM C;  4WU9 A;  4H9S A;  3A6N C;  3UTA D;  3H0L C;  5G49 A;  3LZ1 D;  1P3O C;  4H9R B;  1P3M B;  2RVQ D;  3AFA D;  4J8U A;  5B0Z D;  3IP4 C;  3MGP B;  4KUD A;  4ZUX B;  1KX3 D;  3KXB B;  1ZLA D;  3MNN D;  1P3I A;  1F1E A;  1P3M C;  1S32 C;  1P3I B;  5E5A A;  3KWQ A;  3AZI D;  2Y2O A;  3LJA C;  5B32 B;  5DNM C;  5AY8 D;  5AV8 D;  5F99 D;  3REH D;  3AZL A;  1M18 D;  4QLC C;  3NQU A;  1U35 D;  3AZG C;  4EO5 C;  5B24 A;  3V9R A;  1TZY A;  1KX3 C;  2JCH A;  3NQU B;  5B24 B;  3X1U C;  2RVQ C;  3MGQ B;  4YS3 D;  3WKJ A;  1KX5 B;  2Y2Q A;  2NQB B;  3MGP D;  5BO0 B;  2BG1 A;  4J8W D;  5JRG A;  2PYO A;  4R8P B;  3LZ0 D;  5GSU B;  5AV8 B;  3AZI A;  3EG5 B;  3VH6 W;  1P3G C;  1KX4 C;  5GSU A;  4YS3 C;  2HIO B;  4WU8 A;  3WAA D;  5CPI B;  2F8N H;  1KX4 B;  3W97 C;  4QLC D;  4J8U D;  5CPI A;  5AV6 A;  5B40 D;  4DRB A;  4G91 C;  5B0Z B;  2J8P A;  1BH8 B;  4Z5T A;  3REI D;  5B0Y D;  3X1U A;  3AZK A;  5FUG A;  3P5J B;  1P3A A;  1BH9 B;  5B1L D;  3LEL A;  4Z5T B;  2UWX A;  3X1U B;  3REK B;  3REJ C;  1S32 D;  3AZE A;  5GSU C;  4YS3 A;  4DRA A;  2ZY2 A;  4E44 A;  3C1B B;  3A1K A;  1ZLA C;  4YM6 D;  5GT0 D;  3B0B A;  5CPK B;  3X1S C;  1KX4 D;  4XUJ C;  3AFA C;  3UTB B;  1U35 A;  2Y2P A;  4WU8 C;  3A1I A;  3TU4 C;  3AV2 C;  4NFT A;  2ZY3 A;  4H9O B;  1P3P A;  2XD1 A;  5AVC A;  3KUY A;  3UT9 B;  2ARO A;  2IO5 B;  3NQJ A;  5DNN C;  5GT3 A;  1EQZ D;  5B32 C;  3X1V C;  2BYM A;  4R8P D;  3LZ0 B;  1ZLA A;  3C1C B;  4CAY B;  3REJ D;  5JA4 A;  1ID3 D;  3LZ0 A;  5DNM D;  3LZ1 A;  3B6F D;  2DQN C;  4CSR B;  5G49 B;  3LZ1 B;  1KU5 A;  3MGS D;  4H9R A;  1P3M A;  5B40 B;  4CSR A;  4KUD B;  4WNN B;  3KXB A;  1P3O A;  5AVC C;  3F6T A;  2IO5 C;  5AVB C;  3AZN C;  4LD9 D;  3O62 A;  2ZY5 A;  3LZ0 C;  1P3B A;  3KWQ B;  3B6F B;  5DNM A;  3MGP C;  1P3B B;  2FJ7 B;  3W99 D;  3H0R C;  3EPL A;  2F8N A;  5DNM B;  3LJA A;  4G92 C;  5B31 G;  2ARO D;  5B2I C;  3MGQ A;  2NQB A;  4XZQ A;  4ZUX C;  3AN2 B;  3WTP D;  5B1M A;  2RIQ A;  5B2I B;  5B2J D;  3WA9 D;  5B1M B;  4ZBJ C;  2CV5 B;  3AZF B;  4J8X A;  2HIO D;  3X1T B;  4JJN C;  1P3K A;  3TU4 B;  3AV2 B;  1P3G A;  1M1A D;  1P3G B;  1HTA A;  3LEL C;  5AV6 C;  3C1B C;  3AZK D;  5CPJ C;  4UPK A;  5BNV B;  1Z2C B;  5BS7 C;  1P3F B;  3MGS A;  4E45 A;  5AV5 C;  5CP6 D;  5BT1 D;  1KX5 C;  3W96 A;  3X1S A;  3X1S D;  2XD5 A;  5B0Y B;  4X23 C;  3AYW D;  3REJ A;  1P3P C;  2CV5 D;  4R8P A;  3AZE C;  3KUY C;  1U35 B;  3AZJ D;  5JRG D;  1WWS A;  3AV1 C;  4KUD C;  5F99 B;  3REH B;  2F8N K;  4WU8 B;  1P3P B;  1P3K D;  1P3I C;  2L5A A;  5CP6 B;  3UT9 A;  5CPK C;  3W96 C;  3NQJ B;  3AN2 D;  1Q9C A;  4J8W B;  5B24 D;  5AV5 A;  4Z2M G;  5CP6 C;  5AV5 D;  2BYM B;  3W98 D;  1P3F C;  2NQB D;  3AZL C;  5DNN A;  5AY8 A;  4WJ3 C;  4J8W C;  3REK A;  5DNN B;  5CPI D;  2F8N G;  3AZE B;  5AV9 B;  5AY8 B;  4XUJ B;  5GT0 C;  4YM6 C;  3UTB A;  4Z66 C;  4HGA C;  3O62 C;  5B33 C;  4AWL C;  5B2J C;  4H9S C;  5GXQ D;  5BNX A;  3VH6 A;  3EPH A;  5AVC B;  3AZM A;  4WU9 C;  3AL0 C;  3KXB C;  2NZD C;  3A6N A;  2ZY4 A;  5B40 C;  3W99 B;  1S32 B;  2Y2L A;  1HQ3 B;  3LJA B;  4H9Q B;  4NE5 A;  4KHA A;  5DNN D;  4EO5 B;  1HQ3 A;  3W99 C;  5B31 D;  5BT1 C;  1P3G D;  2FJ7 C;  1M19 D;  3REI A;  4XZQ B;  2JSS A;  1JFI B;  4ZUX A;  5B2J A;  3AZN D;  5AV6 D;  4G92 B;  3MGQ C;  3R45 B;  4WNN A;  5B1M D;  5B2J B;  3WA9 B;  1H3O A;  4J8V B;  5AVB D;  5CPJ B;  1F66 A;  3W96 D;  3WTP B;  4JJN A;  4J8V A;  5GSU D;  3TU4 A;  3AZG D;  5E5A D;  3AN2 C;  3AV2 A;  1F66 B;  1ID3 B;  3WA9 C;  1M18 C;  4J8X C;  1M1A B;  3AV1 D;  2FJ7 A;  3UTA A;  5B31 A;  3LJA D;  3REI C;  3X1T C;  2Y2M A;  1HQ3 C;  3B0D B;  1TZY B;  5C3I B;  2PYO C;  3MGS B;  3UT9 D;  2FFF B;  3X1V D;  1KX5 A;  5B0Z C;  4G91 B;  5B0Y A;  2PYO B;  4J8V C;  3AN2 A;  3B6G A;  4NE3 A;  4LD9 B;  3REJ B;  4Z5T C;  3B6G B;  3VH5 W;  5CPI C;  2HUE C;  2HIO A;  2YFV A;  3H0M C;  3AZF A;  4J8X B;  3X1T A;  2YFW A;  1WWI A;  1P3K B;  2YFV B;  4WU8 D;  5CP6 A;  5B31 C;  1P3L B;  4XZQ D;  1BH8 A;  3REK C;  5FUG B;  1B67 A;  5GXQ B;  5AV5 B;  2DF4 C;  5B1L C;  4J8U B;  3UT9 C;  4UUZ A;  1EQZ A;  3C1C C;  1P3F A;  2NZD D;  1EQZ B;  3W96 B;  5B0Y C;  1N1J A;  2F8N D;  4WU9 D;  4M6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...