3UTBD

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbD00
5CP6D 3MGPA 4H9SC 5B24B 5FUGA 1H3OA 4CSRA 2HIOD 3LZ0B 1P34D 1ID3D 4NE3A 4QLCC 3WTPB 3WKJC 1P3GC 1N1JB 5B1LC 5B33C 5B2IC 5CPKB 4EO5B 3AZHC 1U35D 5BO0B 1M19A 4AWLC 3KXBD 2NQBA 3LJAC 4H9RB 3RELB 4R8PD 4J8WD 2BYKA 4H9NB 2F8NG 4WU8B 3AN2A 4Z5TD 3C1CB 5F99B 5B24D 4XZQC 4WU9B 2RVQC 5GT3B 5GT0B 3WAAC 1BH8B 4Z66C 3MNNB 3AZID 1P3LD 2F8NK 3WTPD 5B31B 3O62D 3W96A 4JJNB 1F1EA 1P3OD 3B6GC 3B6FD 2YFWA 4XUJA 4LD9B 5JA4B 1KX5C 5AVCB 5CP6C 3RELD 3AZLA 4H9QB 4WU8D 5GT3A 3C1CD 2HIOC 2IO5B 1ID3C 4J8VB 3UTBB 5AY8A 3X1TB 5AV8D 4G91B 3AZKD 1WWIA 1ZLAA 3REHA 3TU4A 3AZGA 1P3AD 5GT0D 3MNND 3LELA 2F8NB 3VH6W 1P3PB 4KUDA 5B31D 1U35C 3AFAD 1AOID 4JJND 4X23B 4H9QA 5E5AC 4DRBA 4DRAA 2PYOA 4Z5TC 1S32D 4LD9D 3AV2D 1M1AD 5CPJB 1P3BA 4UUZA 3AZIC 3W97B 1KX4D 5G49A 4J8VD 1P3LC 5DNMC 3X1UC 3UTBD 3KWQA 5AV6C 3O62C 4G92B 4KGCA 5B0YC 5AV9A 2CV5C 1P3MB 3UTAA 4YS3B 1M18B 1P3KA 1P3OC 3X1SD 3B6FC 1EQZB 2FJ7C 3KUYB 4J8UA 2F8ND 5CPID 3REKC 1F66B 5B2JC 4YM6A 3REJC 3MVDB 1HQ3B 5GXQA 1KX3A 3AV1D 3AZJB 5AV5C 1P3FA 1TZYD 4ZBJB 5AV8C 3AZKC 4ZUXD 5AVBB 4CAYB 5CPJD 3NQUA 3MGQB 1P3AC 3AYWB 3X1VD 3C1BC 2HUEC 3AFAC 4H9SA 1AOIC 3WTPE 1HQ3A 3MGSD 3AZMC 1EQZD 3WA9C 2NZDD 1S32C 1F66D 3W98C 3W99B 3UT9B 5BNXA 4QLCA 3WKJA 5KDMA 3AV2C 5JRGB 3VH6A 1P3GA 1M1AC 3MGPB 5B0ZD 5B1LA 3AZJD 5B33A 5B2IA 5FUGB 1H3OB 1KX4C 3AZHA 4CSRB 5AVBD 5C3IC 3LJAA 3X1SC 3R45A 5CPIC 3AYWD 2AROD 3AZFC 1B6WA 3MGRD 4XZQA 3AV1C 1M19B 3VH6T 2NQBB 3REID 5B40D 5B1MC 4Z66A 2BYKB 1TZYC 2YFVA 3AN2B 4ZUXC 5JRGD 3MGPD 3B6GA 5GSUD 3X1VC 1KX5A 1ULYA 2JSSA 3A6NC 3MGSC 3W96B 2HIOA 2NZDC 1ID3A 2LY8A 2YFWB 4XUJB 1TAFB 1M19D 4Z2MH 5B0ZC 2NQBD 3NQJB 3AZLB 4J8XC 1U35A 3LZ0D 5AVBC 3AZEC 5AY8B 3LZ1A 5B32C 1ZLAB 5E5AA 4Z5TA 3REHB 3TU4B 3AZGB 3AYWC 4E44A 2AROC 3AZNC 5CPKD 3LELB 1P3IC 1JFIA 3MGRC 4KUDB 1TAFA 3W96D 3REIC 3NQJA 5B40C 3AZIA 1P3LA 5DNNA 5DNMA 4HGAB 3X1UA 5AV6A 3O62A 2PYOB 5B0YA 2CV5A 1P34C 5F99D 1P3OA 3B6FA 2FJ7A 3REKA 5GSUC 4WU9D 5B2JA 5GT3D 2BYMA 1P3BB 3REJA 4UUZB 5G49B 3KWQB 4KGCB 5AV9B 3KXBC 3UTAB 5AV5A 3REHD 3TU4D 3B0DB 4R8PC 4J8WC 5BS7C 3AZGD 1P3KB 5AV8A 3AZKA 4J8UB 3V9RA 4M6BA 4YM6B 5AVCD 1P3AA 5GXQB 5B24C 1KX3B 3B0BA 3C1BA 3AFAA 2CWEA 1P3FB 3LZ0C 1AOIA 3X1TD 3WTPC 3AZMA 3WA9A 3NQUB 1S32A 3W98A 5CPKC 3AV2A 4EO5C 5B32G 1P3PD 3KWQD 1M1AA 4NE5A 4WNNA 5AV9D 3RELC 4X23D 1KX4A 1B67A 4WU8C 3C1CC 4E45A 5F99C 5BNXB 4QLCB 4YM6D 3WKJB 5BT1D 5KDMB 3X1SA 5GXQD 1P3GB 1KX3D 5CPIA 5B1LB 4H9OA 3AZFA 4WU9C 5B33B 5GT3C 4WV4B 5B2IB 5GT0C 3W97D 3MNNC 3AZHB 5B31C 3AV1A 1BFMA 4AWLB 3LJAB 1P3MD 4JJNC 4YS3D 5B1MA 3TU4C 1M18D 1TZYA 3KUYD 3R45B 4ZUXA 4LD9C 1HTAA 1WWSA 5AVCC 3B0CW 3MVDD 1HQ3D 4XZQB 3X1VA 3WAAB 4Z66B 2IO5C 3A6NA 4J8VC 2YFVB 3UTBC 3X1TC 4G91C 3MGSA 1P3GD 3MGQD 2NZDA 5B1LD 3B6GB 5B33D 3AZHD 1P3PC 1KX5B 5CP6B 5B0ZA 2F8NH 4WZSB 4J8XA 4X23C 1BH9A 2HIOB 3WAAA 1ID3B 3W99D 3UT9D 3AZEA 5B32A 5CPJC 2RVQD 2AROA 3AZNA 1P3IA 4Z66D 3W97C 3MGRA 4KHAA 1KU5A 4G92C 1U35B 5CP6A 3REIA 1P3MC 4YS3C 1M18C 3LZ1B 1R4VA 5E5AB 1EQZC 4Z5TB 3KUYC 1P34A 1F66C 1JFIB 3MVDC 1HQ3C 5GSUA 3AZJC 3AZIB 1P3LB 5DNNB 3X1UB 5DNMB 4ZBJC 5AV6B 3O62B 3AN2D 5B0YB 2CV5B 3KXBA 4H9PA 3MGQC 4R8PA 4J8WA 5BS7A 5BNVA 1P3OB 3B6FB 2FJ7B 3REKB 5B2JB 2BYMB 3REJB 5B24A 3LZ1D 5E5AD 5AV5B 3LZ0A 3W99C 3UT9C 3WTPA 5AV8B 3AZKB 4XUJD 3V9RB 5JRGC 1N1JA 3MGPC 1P3AB 3AZLD 5CPKA 3B0CT 5DNND 5DNMD 3X1UD 3C1BB 2HUEB 5AV6D 3AFAB 5B0YD 5BO0A 2CV5D 1AOIB 4H9RA 3RELA 5AY8D 4H9NA 3AZMB 1ZLAD 4WU8A 2FJ7D 3WA9B 1S32B 4NE6A 3VH5W 3C1CA 3REKD 3W98B 5F99A 5B2JD 3REJD 3LELD 3AV2B 4KUDD 1M1AB 4WNNB 1M19C 4WU9A 2NQBC 5AV5D 5GT0A 1BH8A 4Z2MG 3MNNA 1KX4B 5B31A 2PYOD 3AN2C 5C3IB 4JJNA 3X1SB 1Q9CA 5CPIB 4H9OB 3AZFB 4LD9A 3C1BD 5JA4A 1P3BD 5AVCA 3AV1B 4KGCD 3LZ1C 5CHLB 3AZMD 3WA9D 3W96C 3UTAD 5B1MB 3W98D 1P3KD 1TZYB 4J8VA 3UTBA 3X1TA 4J8UD 4ZUXB 4XUJC 3KSYA 3AZLC 2F8NA 3X1VB 5DNNC 1P3PA 1P3FD 3A6NB 5AY8C 4X23A 3MGSB 1ZLAC 2NZDB 3REHC 3AZGC 3AZFD 4NFTA 3LELC 4KUDC 5CPJA 5B0ZB 5B1MD 4J8XB 3W97A 1BH9B 4HGAC 2PYOC 3VH5A 3AZEB 1P3MA 4QLCD 4YS3A 1M18A 3WKJD 5B32B 1EQZA 3KUYA 1F66A 2AROB 3AZNB 5B2ID 1P3IB 1P3BC 3A6ND 3MGRB 3MVDA 4KHAB 3KWQC 4KGCC 5AV9C 3LJAD 3AZJA 3REIB 5B40B 3UTAC 3B0DC 1P3KC 4J8UC 1P34B 5AVBA 4CAYA 3MGQA 3VH5T 4YM6C 5BT1C 5GXQC 4XZQD 4J8XD 1KX3C 5GSUB 3AYWA 3WAAD 1A7WA 1P3FC 3AZED 5B32D 3KXBB 4H9PB 5B40A 4R8PB 4J8WB 5BNVB 3W99A 3B6GD 3UT9A 3AZND 1P3ID 5B31G 5JRGA 2L5AA 1KX5D
chains in the Genus database with same CATH superfamily
5CP6D 3A1IA 4H9SC 3MGPA 5B24B 5FUGA 1H3OA 4CSRA 2HIOD 3LZ0B 1P34D 1ID3D 4NE3A 4QLCC 3WTPB 2ZY2A 3WKJC 3IP4C 1P3GC 1N1JB 5B1LC 5B33C 5B2IC 5CPKB 4EO5B 3AZHC 1U35D 5BO0B 1M19A 4AWLC 3KXBD 2NQBA 3LJAC 4H9RB 3RELB 4R8PD 4J8WD 2BYKA 4H9NB 2F8NG 4WU8B 3AN2A 4Z5TD 3C1CB 1PZRA 5F99B 5B24D 4XZQC 4WU9B 2RVQC 5GT3B 5GT0B 3WAAC 1BH8B 1W2EA 4Z66C 3MNNB 3AZID 4UPKA 1P3LD 2F8NK 3WTPD 5B31B 3O62D 3W96A 4JJNB 1F1EA 1P3OD 3B6GC 3B6FD 2YFWA 4XUJA 4LD9B 5JA4B 1KX5C 5AVCB 5CP6C 3RELD 3AZLA 3FDDA 4H9QB 3AL0C 2BG1A 4WU8D 5GT3A 3C1CD 2HIOC 2IO5B 2ZM5A 4J8VB 1ID3C 3UTBB 5AY8A 3X1TB 5AV8D 4G91B 3AZKD 1WWIA 1ZLAA 3REHA 2F2AC 3TU4A 3AZGA 1P3AD 5GT0D 3MNND 3LELA 2F8NB 3VH6W 1P3PB 4KUDA 5B31D 1U35C 3AFAD 1AOID 4JJND 4X23B 4H9QA 5E5AC 4DRBA 4DRAA 2PYOA 4Z5TC 1S32D 4LD9D 3AV2D 1M1AD 5CPJB 1P3BA 4UUZA 3AZIC 3W97B 1KX4D 5G49A 4J8VD 1P3LC 5DNMC 3X1UC 3UTBD 3KWQA 5AV6C 3O62C 4G92B 4KGCA 5B0YC 5AV9A 2CV5C 1P3MB 3UTAA 4YS3B 1M18B 1P3KA 1P3OC 3X1SD 3B6FC 1EQZB 2FJ7C 3KUYB 4J8UA 2F8ND 5CPID 3REKC 1F66B 2G5IC 5B2JC 4YM6A 3REJC 3MVDB 1HQ3B 5GXQA 1KX3A 3AV1D 3AZJB 5AV5C 1P3FA 1TZYD 4ZBJB 5AV8C 3AZKC 4ZUXD 5AVBB 4CAYB 5CPJD 3NQUA 3MGQB 1P3AC 3AYWB 2Y2MA 3X1VD 3C1BC 2HUEC 3AFAC 4H9SA 1AOIC 3WTPE 1HQ3A 3MGSD 3AZMC 1EQZD 3WA9C 2NZDD 1S32C 1F66D 3W98C 3W99B 3UT9B 5BNXA 4QLCA 3WKJA 5KDMA 3AV2C 5JRGB 3VH6A 1P3GA 1M1AC 3MGPB 5B0ZD 5B1LA 3AZJD 2Y2GA 5B33A 5B2IA 5FUGB 1H3OB 1KX4C 3AZHA 4CSRB 5AVBD 5C3IC 3LJAA 3X1SC 3R45A 5CPIC 2Y2HA 2AROD 3AZFC 1B6WA 3AYWD 3MGRD 4XZQA 3AV1C 1M19B 3VH6T 2NQBB 3REID 5B40D 5B1MC 4Z66A 2BYKB 1TZYC 2YFVA 3AN2B 4ZUXC 5JRGD 3MGPD 3B6GA 5GSUD 3X1VC 1KX5A 2XD1A 1ULYA 2JSSA 3A6NC 3MGSC 3W96B 2HIOA 2NZDC 1ID3A 2LY8A 2YFWB 4XUJB 1TAFB 3KFUG 1M19D 3A1KA 4Z2MH 5B0ZC 2NQBD 3NQJB 3AZLB 4J8XC 1U35A 3LZ0D 5AVBC 3AZEC 5AY8B 3LZ1A 5B32C 1ZLAB 5E5AA 4Z5TA 3REHB 3TU4B 3AZGB 3AYWC 4E44A 2AROC 3AZNC 5CPKD 3LELB 1P3IC 1JFIA 3MGRC 4KUDB 1TAFA 3W96D 3REIC 3NQJA 5B40C 3AZIA 1P3LA 5DNNA 5DNMA 4HGAB 3X1UA 5AV6A 3O62A 2PYOB 5B0YA 2CV5A 1P34C 5F99D 1P3OA 3B6FA 2FJ7A 3REKA 5GSUC 4WU9D 5B2JA 5GT3D 2BYMA 1P3BB 3REJA 4UUZB 5G49B 3KWQB 4KGCB 5AV9B 3KXBC 3UTAB 5AV5A 3REHD 3TU4D 3B0DB 4R8PC 4J8WC 5BS7C 3AZGD 1P3KB 5AV8A 3AZKA 4J8UB 3V9RA 4M6BA 4YM6B 5AVCD 2VQRA 1P3AA 2Y2QA 5GXQB 5B24C 1KX3B 3EPKA 3B0BA 3C1BA 3AFAA 2CWEA 1P3FB 3LZ0C 1AOIA 3X1TD 3WTPC 3AZMA 3WA9A 3NQUB 2ZY4A 1S32A 3W98A 2Y2IA 5CPKC 3AV2A 4EO5C 5B32G 1P3PD 3KWQD 1M1AA 4NE5A 4WNNA 5AV9D 3RELC 3H0MC 4X23D 1KX4A 1B67A 4WU8C 3C1CC 4E45A 5F99C 5BNXB 4QLCB 4YM6D 2JCHA 3WKJB 5BT1D 5KDMB 3X1SA 5GXQD 1P3GB 1KX3D 5CPIA 5B1LB 4H9OA 3AZFA 4WU9C 5B33B 5GT3C 4WV4B 5B2IB 5GT0C 3W97D 3MNNC 3AZHB 2RIQA 5B31C 3AV1A 1BFMA 4AWLB 3LJAB 1P3MD 4JJNC 4YS3D 5B1MA 3TU4C 1M18D 1TZYA 3KUYD 3R45B 4DQYB 4ZUXA 4LD9C 1HTAA 2Y2OA 1WWSA 2Y2LA 5AVCC 3B0CW 3MVDD 1HQ3D 4XZQB 3X1VA 1T3UA 3WAAB 4Z66B 2IO5C 3A6NA 4J8VC 2YFVB 3UTBC 3X1TC 1Z2CB 4G91C 3MGSA 1P3GD 3MGQD 2NZDA 5B1LD 3B6GB 5B33D 3AZHD 3P5JB 1P3PC 1KX5B 5CP6B 5B0ZA 2F8NH 4WZSB 3EPLA 4J8XA 4X23C 1BH9A 2HIOB 3WAAA 1ID3B 3W99D 3UT9D 3AZEA 5B32A 3EG5B 5CPJC 2RVQD 2AROA 3AZNA 1P3IA 4Z66D 3W97C 3MGRA 4KHAA 1KU5A 4G92C 1U35B 5CP6A 3REIA 1P3MC 2Y2JA 4YS3C 1M18C 3LZ1B 1R4VA 5E5AB 1EQZC 4Z5TB 2Y2KA 3KUYC 1P34A 1F66C 1JFIB 3MVDC 1HQ3C 5GSUA 2DQNC 3AZJC 3AZIB 1P3LB 5DNNB 3X1UB 5DNMB 4ZBJC 5AV6B 3O62B 3AN2D 5B0YB 2CV5B 3KXBA 4H9PA 3MGQC 4R8PA 4J8WA 5BS7A 5BNVA 1P3OB 3B6FB 2FJ7B 3REKB 5B2JB 2BYMB 3REJB 5B24A 3LZ1D 3H0LC 5E5AD 5AV5B 3LZ0A 3W99C 2FFFB 3UT9C 3WTPA 5AV8B 3AZKB 4XUJD 3V9RB 5JRGC 1N1JA 3MGPC 1P3AB 3AZLD 5CPKA 3B0CT 5DNND 5DNMD 3X1UD 3C1BB 2HUEB 5AV6D 3AFAB 3F6TA 5B0YD 5BO0A 2CV5D 1AOIB 4H9RA 3RELA 5AY8D 4H9NA 2G5HC 3AZMB 1ZLAD 4WU8A 2FJ7D 3WA9B 1S32B 4NE6A 3VH5W 3C1CA 3REKD 3W98B 5F99A 5B2JD 3REJD 3LELD 3AV2B 4KUDD 1M1AB 4WNNB 1M19C 4WU9A 2NQBC 5AV5D 5GT0A 1BH8A 4Z2MG 3MNNA 1KX4B 5B31A 2PYOD 3AN2C 5C3IB 3EPJA 2Y2PA 4JJNA 3X1SB 1Q9CA 5CPIB 4H9OB 3AZFB 4LD9A 3C1BD 5JA4A 1P3BD 5AVCA 3AV1B 4KGCD 3LZ1C 2J8PA 5CHLB 3AZMD 3WA9D 3W96C 3UTAD 5B1MB 3W98D 2XD5A 1P3KD 1TZYB 4J8VA 3UTBA 3X1TA 4J8UD 4ZUXB 4XUJC 2UWXA 3KSYA 3AZLC 2F8NA 3X1VB 5DNNC 1P3PA 1P3FD 3A6NB 2Y2NA 5AY8C 4X23A 3MGSB 1ZLAC 2NZDB 3REHC 3AZGC 3AZFD 4NFTA 3LELC 4KUDC 5CPJA 5B0ZB 5B1MD 4J8XB 3W97A 1BH9B 4HGAC 2PYOC 3VH5A 3AZEB 1P3MA 4QLCD 4YS3A 1M18A 3WKJD 5B32B 2ZY3A 1EQZA 3KUYA 1F66A 2AROB 3AZNB 5B2ID 1P3IB 1P3BC 3A6ND 3MGRB 3MVDA 4KHAB 3KWQC 4KGCC 2JE5A 5AV9C 3LJAD 3AZJA 3REIB 5B40B 2ZY5A 3UTAC 3B0DC 1P3KC 4J8UC 1P34B 5AVBA 4CAYA 3MGQA 3VH5T 4YM6C 5BT1C 5GXQC 4XZQD 4J8XD 1KX3C 2DF4C 5GSUB 3AYWA 3WAAD 1A7WA 1P3FC 3AZED 2W8SA 3EPHA 3H0RC 5B32D 3KXBB 4H9PB 5B40A 4R8PB 4J8WB 5BNVB 3W99A 3B6GD 3UT9A 3AZND 1P3ID 5B31G 4WJ3C 5JRGA 2L5AA 1KX5D
chains in the Genus database with same CATH topology
5CP6D 3A1IA 4H9SC 3MGPA 5B24B 5FUGA 1H3OA 4CSRA 2HIOD 3LZ0B 1P34D 1ID3D 4NE3A 4QLCC 3WTPB 2ZY2A 3WKJC 3IP4C 1P3GC 1N1JB 5B1LC 5B33C 5B2IC 5CPKB 4EO5B 3AZHC 1U35D 5BO0B 1M19A 4AWLC 3KXBD 2NQBA 3LJAC 4H9RB 3RELB 4R8PD 4J8WD 2BYKA 4H9NB 2F8NG 4WU8B 3AN2A 4Z5TD 3C1CB 1PZRA 5F99B 5B24D 4XZQC 4WU9B 2RVQC 5GT3B 5GT0B 3WAAC 1BH8B 1W2EA 4Z66C 3MNNB 3AZID 4UPKA 1P3LD 2F8NK 3WTPD 5B31B 3O62D 3W96A 4JJNB 1F1EA 1P3OD 3B6GC 3B6FD 2YFWA 4XUJA 4LD9B 5JA4B 1KX5C 5AVCB 5CP6C 3RELD 3AZLA 3FDDA 4H9QB 3AL0C 2BG1A 4WU8D 5GT3A 3C1CD 2HIOC 2IO5B 2ZM5A 4J8VB 1ID3C 3UTBB 5AY8A 3X1TB 5AV8D 4G91B 3AZKD 1WWIA 1ZLAA 3REHA 2F2AC 3TU4A 3AZGA 1P3AD 5GT0D 3MNND 3LELA 2F8NB 3VH6W 1P3PB 4KUDA 5B31D 1U35C 3AFAD 1AOID 4JJND 4X23B 4H9QA 5E5AC 4DRBA 4DRAA 2PYOA 4Z5TC 1S32D 4LD9D 3AV2D 1M1AD 5CPJB 1P3BA 4UUZA 3AZIC 3W97B 1KX4D 5G49A 4J8VD 1P3LC 5DNMC 3X1UC 3UTBD 3KWQA 5AV6C 3O62C 4G92B 4KGCA 5B0YC 5AV9A 2CV5C 1P3MB 3UTAA 4YS3B 1M18B 1P3KA 1P3OC 3X1SD 3B6FC 1EQZB 2FJ7C 3KUYB 4J8UA 2F8ND 5CPID 3REKC 1F66B 2G5IC 5B2JC 4YM6A 3REJC 3MVDB 1HQ3B 5GXQA 1KX3A 3AV1D 3AZJB 5AV5C 1P3FA 1TZYD 4ZBJB 5AV8C 3AZKC 4ZUXD 5AVBB 4CAYB 5CPJD 3NQUA 3MGQB 1P3AC 3AYWB 2Y2MA 3X1VD 3C1BC 2HUEC 3AFAC 4H9SA 1AOIC 3WTPE 1HQ3A 3MGSD 3AZMC 1EQZD 3WA9C 2NZDD 1S32C 1F66D 3W98C 3W99B 3UT9B 5BNXA 4QLCA 3WKJA 5KDMA 3AV2C 5JRGB 3VH6A 1P3GA 1M1AC 3MGPB 5B0ZD 5B1LA 3AZJD 2Y2GA 5B33A 5B2IA 5FUGB 1H3OB 1KX4C 3AZHA 4CSRB 5AVBD 5C3IC 3LJAA 3X1SC 3R45A 5CPIC 2Y2HA 2AROD 3AZFC 1B6WA 3AYWD 3MGRD 4XZQA 3AV1C 1M19B 3VH6T 2NQBB 3REID 5B40D 5B1MC 4Z66A 2BYKB 1TZYC 2YFVA 3AN2B 4ZUXC 5JRGD 3MGPD 3B6GA 5GSUD 3X1VC 1KX5A 2XD1A 1ULYA 2JSSA 3A6NC 3MGSC 3W96B 2HIOA 2NZDC 1ID3A 2LY8A 2YFWB 4XUJB 1TAFB 3KFUG 1M19D 3A1KA 4Z2MH 5B0ZC 2NQBD 3NQJB 3AZLB 4J8XC 1U35A 3LZ0D 5AVBC 3AZEC 5AY8B 3LZ1A 5B32C 1ZLAB 5E5AA 4Z5TA 3REHB 3TU4B 3AZGB 3AYWC 4E44A 2AROC 3AZNC 5CPKD 3LELB 1P3IC 1JFIA 3MGRC 4KUDB 1TAFA 3W96D 3REIC 3NQJA 5B40C 3AZIA 1P3LA 5DNNA 5DNMA 4HGAB 3X1UA 5AV6A 3O62A 2PYOB 5B0YA 2CV5A 1P34C 5F99D 1P3OA 3B6FA 2FJ7A 3REKA 5GSUC 4WU9D 5B2JA 5GT3D 2BYMA 1P3BB 3REJA 4UUZB 5G49B 3KWQB 4KGCB 5AV9B 3KXBC 3UTAB 5AV5A 3REHD 3TU4D 3B0DB 4R8PC 4J8WC 5BS7C 3AZGD 1P3KB 5AV8A 3AZKA 4J8UB 3V9RA 4M6BA 4YM6B 5AVCD 2VQRA 1P3AA 2Y2QA 5GXQB 5B24C 1KX3B 3EPKA 3B0BA 3C1BA 3AFAA 2CWEA 1P3FB 3LZ0C 1AOIA 3X1TD 3WTPC 3AZMA 3WA9A 3NQUB 2ZY4A 1S32A 3W98A 2Y2IA 5CPKC 3AV2A 4EO5C 5B32G 1P3PD 3KWQD 1M1AA 4NE5A 4WNNA 5AV9D 3RELC 3H0MC 4X23D 1KX4A 1B67A 4WU8C 3C1CC 4E45A 5F99C 5BNXB 4QLCB 4YM6D 2JCHA 3WKJB 5BT1D 5KDMB 3X1SA 5GXQD 1P3GB 1KX3D 5CPIA 5B1LB 4H9OA 3AZFA 4WU9C 5B33B 5GT3C 4WV4B 5B2IB 5GT0C 3W97D 3MNNC 3AZHB 2RIQA 5B31C 3AV1A 1BFMA 4AWLB 3LJAB 1P3MD 4JJNC 4YS3D 5B1MA 3TU4C 1M18D 1TZYA 3KUYD 3R45B 4DQYB 4ZUXA 4LD9C 1HTAA 2Y2OA 1WWSA 2Y2LA 5AVCC 3B0CW 3MVDD 1HQ3D 4XZQB 3X1VA 1T3UA 3WAAB 4Z66B 2IO5C 3A6NA 4J8VC 2YFVB 3UTBC 3X1TC 1Z2CB 4G91C 3MGSA 1P3GD 3MGQD 2NZDA 5B1LD 3B6GB 5B33D 3AZHD 3P5JB 1P3PC 1KX5B 5CP6B 5B0ZA 2F8NH 4WZSB 3EPLA 4J8XA 4X23C 1BH9A 2HIOB 3WAAA 1ID3B 3W99D 3UT9D 3AZEA 5B32A 3EG5B 5CPJC 2RVQD 2AROA 3AZNA 1P3IA 4Z66D 3W97C 3MGRA 4KHAA 1KU5A 4G92C 1U35B 5CP6A 3REIA 1P3MC 2Y2JA 4YS3C 1M18C 3LZ1B 1R4VA 5E5AB 1EQZC 4Z5TB 2Y2KA 3KUYC 1P34A 1F66C 1JFIB 3MVDC 1HQ3C 5GSUA 2DQNC 3AZJC 3AZIB 1P3LB 5DNNB 3X1UB 5DNMB 4ZBJC 5AV6B 3O62B 3AN2D 5B0YB 2CV5B 3KXBA 4H9PA 3MGQC 4R8PA 4J8WA 5BS7A 5BNVA 1P3OB 3B6FB 2FJ7B 3REKB 5B2JB 2BYMB 3REJB 5B24A 3LZ1D 3H0LC 5E5AD 5AV5B 3LZ0A 3W99C 2FFFB 3UT9C 3WTPA 5AV8B 3AZKB 4XUJD 3V9RB 5JRGC 1N1JA 3MGPC 1P3AB 3AZLD 5CPKA 3B0CT 5DNND 5DNMD 3X1UD 3C1BB 2HUEB 5AV6D 3AFAB 3F6TA 5B0YD 5BO0A 2CV5D 1AOIB 4H9RA 3RELA 5AY8D 4H9NA 2G5HC 3AZMB 1ZLAD 4WU8A 2FJ7D 3WA9B 1S32B 4NE6A 3VH5W 3C1CA 3REKD 3W98B 5F99A 5B2JD 3REJD 3LELD 3AV2B 4KUDD 1M1AB 4WNNB 1M19C 4WU9A 2NQBC 5AV5D 5GT0A 1BH8A 4Z2MG 3MNNA 1KX4B 5B31A 2PYOD 3AN2C 5C3IB 3EPJA 2Y2PA 4JJNA 3X1SB 1Q9CA 5CPIB 4H9OB 3AZFB 4LD9A 3C1BD 5JA4A 1P3BD 5AVCA 3AV1B 4KGCD 3LZ1C 2J8PA 5CHLB 3AZMD 3WA9D 3W96C 3UTAD 5B1MB 3W98D 2XD5A 1P3KD 1TZYB 4J8VA 3UTBA 3X1TA 4J8UD 4ZUXB 4XUJC 2UWXA 3KSYA 3AZLC 2F8NA 3X1VB 5DNNC 1P3PA 1P3FD 3A6NB 2Y2NA 5AY8C 4X23A 3MGSB 1ZLAC 2NZDB 3REHC 3AZGC 3AZFD 4NFTA 3LELC 4KUDC 5CPJA 5B0ZB 5B1MD 4J8XB 3W97A 1BH9B 4HGAC 2PYOC 3VH5A 3AZEB 1P3MA 4QLCD 4YS3A 1M18A 3WKJD 5B32B 2ZY3A 1EQZA 3KUYA 1F66A 2AROB 3AZNB 5B2ID 1P3IB 1P3BC 3A6ND 3MGRB 3MVDA 4KHAB 3KWQC 4KGCC 2JE5A 5AV9C 3LJAD 3AZJA 3REIB 5B40B 2ZY5A 3UTAC 3B0DC 1P3KC 4J8UC 1P34B 5AVBA 4CAYA 3MGQA 3VH5T 4YM6C 5BT1C 5GXQC 4XZQD 4J8XD 1KX3C 2DF4C 5GSUB 3AYWA 3WAAD 1A7WA 1P3FC 3AZED 2W8SA 3EPHA 3H0RC 5B32D 3KXBB 4H9PB 5B40A 4R8PB 4J8WB 5BNVB 3W99A 3B6GD 3UT9A 3AZND 1P3ID 5B31G 4WJ3C 5JRGA 2L5AA 1KX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 D;  3MGP A;  4H9S C;  5B24 B;  5FUG A;  1H3O A;  4CSR A;  2HIO D;  3LZ0 B;  1P34 D;  1ID3 D;  4NE3 A;  4QLC C;  3WTP B;  3WKJ C;  1P3G C;  1N1J B;  5B1L C;  5B33 C;  5B2I C;  5CPK B;  4EO5 B;  3AZH C;  1U35 D;  5BO0 B;  1M19 A;  4AWL C;  3KXB D;  2NQB A;  3LJA C;  4H9R B;  3REL B;  4R8P D;  4J8W D;  2BYK A;  4H9N B;  2F8N G;  4WU8 B;  3AN2 A;  4Z5T D;  3C1C B;  5F99 B;  5B24 D;  4XZQ C;  4WU9 B;  2RVQ C;  5GT3 B;  5GT0 B;  3WAA C;  1BH8 B;  4Z66 C;  3MNN B;  3AZI D;  1P3L D;  2F8N K;  3WTP D;  5B31 B;  3O62 D;  3W96 A;  4JJN B;  1F1E A;  1P3O D;  3B6G C;  3B6F D;  2YFW A;  4XUJ A;  4LD9 B;  5JA4 B;  1KX5 C;  5AVC B;  5CP6 C;  3REL D;  3AZL A;  4H9Q B;  4WU8 D;  5GT3 A;  3C1C D;  2HIO C;  2IO5 B;  1ID3 C;  4J8V B;  3UTB B;  5AY8 A;  3X1T B;  5AV8 D;  4G91 B;  3AZK D;  1WWI A;  1ZLA A;  3REH A;  3TU4 A;  3AZG A;  1P3A D;  5GT0 D;  3MNN D;  3LEL A;  2F8N B;  3VH6 W;  1P3P B;  4KUD A;  5B31 D;  1U35 C;  3AFA D;  1AOI D;  4JJN D;  4X23 B;  4H9Q A;  5E5A C;  4DRB A;  4DRA A;  2PYO A;  4Z5T C;  1S32 D;  4LD9 D;  3AV2 D;  1M1A D;  5CPJ B;  1P3B A;  4UUZ A;  3AZI C;  3W97 B;  1KX4 D;  5G49 A;  4J8V D;  1P3L C;  5DNM C;  3X1U C;  3UTB D;  3KWQ A;  5AV6 C;  3O62 C;  4G92 B;  4KGC A;  5B0Y C;  5AV9 A;  2CV5 C;  1P3M B;  3UTA A;  4YS3 B;  1M18 B;  1P3K A;  1P3O C;  3X1S D;  3B6F C;  1EQZ B;  2FJ7 C;  3KUY B;  4J8U A;  2F8N D;  5CPI D;  3REK C;  1F66 B;  5B2J C;  4YM6 A;  3REJ C;  3MVD B;  1HQ3 B;  5GXQ A;  1KX3 A;  3AV1 D;  3AZJ B;  5AV5 C;  1P3F A;  1TZY D;  4ZBJ B;  5AV8 C;  3AZK C;  4ZUX D;  5AVB B;  4CAY B;  5CPJ D;  3NQU A;  3MGQ B;  1P3A C;  3AYW B;  3X1V D;  3C1B C;  2HUE C;  3AFA C;  4H9S A;  1AOI C;  3WTP E;  1HQ3 A;  3MGS D;  3AZM C;  1EQZ D;  3WA9 C;  2NZD D;  1S32 C;  1F66 D;  3W98 C;  3W99 B;  3UT9 B;  5BNX A;  4QLC A;  3WKJ A;  5KDM A;  3AV2 C;  5JRG B;  3VH6 A;  1P3G A;  1M1A C;  3MGP B;  5B0Z D;  5B1L A;  3AZJ D;  5B33 A;  5B2I A;  5FUG B;  1H3O B;  1KX4 C;  3AZH A;  4CSR B;  5AVB D;  5C3I C;  3LJA A;  3X1S C;  3R45 A;  5CPI C;  3AYW D;  2ARO D;  3AZF C;  1B6W A;  3MGR D;  4XZQ A;  3AV1 C;  1M19 B;  3VH6 T;  2NQB B;  3REI D;  5B40 D;  5B1M C;  4Z66 A;  2BYK B;  1TZY C;  2YFV A;  3AN2 B;  4ZUX C;  5JRG D;  3MGP D;  3B6G A;  5GSU D;  3X1V C;  1KX5 A;  1ULY A;  2JSS A;  3A6N C;  3MGS C;  3W96 B;  2HIO A;  2NZD C;  1ID3 A;  2LY8 A;  2YFW B;  4XUJ B;  1TAF B;  1M19 D;  4Z2M H;  5B0Z C;  2NQB D;  3NQJ B;  3AZL B;  4J8X C;  1U35 A;  3LZ0 D;  5AVB C;  3AZE C;  5AY8 B;  3LZ1 A;  5B32 C;  1ZLA B;  5E5A A;  4Z5T A;  3REH B;  3TU4 B;  3AZG B;  3AYW C;  4E44 A;  2ARO C;  3AZN C;  5CPK D;  3LEL B;  1P3I C;  1JFI A;  3MGR C;  4KUD B;  1TAF A;  3W96 D;  3REI C;  3NQJ A;  5B40 C;  3AZI A;  1P3L A;  5DNN A;  5DNM A;  4HGA B;  3X1U A;  5AV6 A;  3O62 A;  2PYO B;  5B0Y A;  2CV5 A;  1P34 C;  5F99 D;  1P3O A;  3B6F A;  2FJ7 A;  3REK A;  5GSU C;  4WU9 D;  5B2J A;  5GT3 D;  2BYM A;  1P3B B;  3REJ A;  4UUZ B;  5G49 B;  3KWQ B;  4KGC B;  5AV9 B;  3KXB C;  3UTA B;  5AV5 A;  3REH D;  3TU4 D;  3B0D B;  4R8P C;  4J8W C;  5BS7 C;  3AZG D;  1P3K B;  5AV8 A;  3AZK A;  4J8U B;  3V9R A;  4M6B A;  4YM6 B;  5AVC D;  1P3A A;  5GXQ B;  5B24 C;  1KX3 B;  3B0B A;  3C1B A;  3AFA A;  2CWE A;  1P3F B;  3LZ0 C;  1AOI A;  3X1T D;  3WTP C;  3AZM A;  3WA9 A;  3NQU B;  1S32 A;  3W98 A;  5CPK C;  3AV2 A;  4EO5 C;  5B32 G;  1P3P D;  3KWQ D;  1M1A A;  4NE5 A;  4WNN A;  5AV9 D;  3REL C;  4X23 D;  1KX4 A;  1B67 A;  4WU8 C;  3C1C C;  4E45 A;  5F99 C;  5BNX B;  4QLC B;  4YM6 D;  3WKJ B;  5BT1 D;  5KDM B;  3X1S A;  5GXQ D;  1P3G B;  1KX3 D;  5CPI A;  5B1L B;  4H9O A;  3AZF A;  4WU9 C;  5B33 B;  5GT3 C;  4WV4 B;  5B2I B;  5GT0 C;  3W97 D;  3MNN C;  3AZH B;  5B31 C;  3AV1 A;  1BFM A;  4AWL B;  3LJA B;  1P3M D;  4JJN C;  4YS3 D;  5B1M A;  3TU4 C;  1M18 D;  1TZY A;  3KUY D;  3R45 B;  4ZUX A;  4LD9 C;  1HTA A;  1WWS A;  5AVC C;  3B0C W;  3MVD D;  1HQ3 D;  4XZQ B;  3X1V A;  3WAA B;  4Z66 B;  2IO5 C;  3A6N A;  4J8V C;  2YFV B;  3UTB C;  3X1T C;  4G91 C;  3MGS A;  1P3G D;  3MGQ D;  2NZD A;  5B1L D;  3B6G B;  5B33 D;  3AZH D;  1P3P C;  1KX5 B;  5CP6 B;  5B0Z A;  2F8N H;  4WZS B;  4J8X A;  4X23 C;  1BH9 A;  2HIO B;  3WAA A;  1ID3 B;  3W99 D;  3UT9 D;  3AZE A;  5B32 A;  5CPJ C;  2RVQ D;  2ARO A;  3AZN A;  1P3I A;  4Z66 D;  3W97 C;  3MGR A;  4KHA A;  1KU5 A;  4G92 C;  1U35 B;  5CP6 A;  3REI A;  1P3M C;  4YS3 C;  1M18 C;  3LZ1 B;  1R4V A;  5E5A B;  1EQZ C;  4Z5T B;  3KUY C;  1P34 A;  1F66 C;  1JFI B;  3MVD C;  1HQ3 C;  5GSU A;  3AZJ C;  3AZI B;  1P3L B;  5DNN B;  3X1U B;  5DNM B;  4ZBJ C;  5AV6 B;  3O62 B;  3AN2 D;  5B0Y B;  2CV5 B;  3KXB A;  4H9P A;  3MGQ C;  4R8P A;  4J8W A;  5BS7 A;  5BNV A;  1P3O B;  3B6F B;  2FJ7 B;  3REK B;  5B2J B;  2BYM B;  3REJ B;  5B24 A;  3LZ1 D;  5E5A D;  5AV5 B;  3LZ0 A;  3W99 C;  3UT9 C;  3WTP A;  5AV8 B;  3AZK B;  4XUJ D;  3V9R B;  5JRG C;  1N1J A;  3MGP C;  1P3A B;  3AZL D;  5CPK A;  3B0C T;  5DNN D;  5DNM D;  3X1U D;  3C1B B;  2HUE B;  5AV6 D;  3AFA B;  5B0Y D;  5BO0 A;  2CV5 D;  1AOI B;  4H9R A;  3REL A;  5AY8 D;  4H9N A;  3AZM B;  1ZLA D;  4WU8 A;  2FJ7 D;  3WA9 B;  1S32 B;  4NE6 A;  3VH5 W;  3C1C A;  3REK D;  3W98 B;  5F99 A;  5B2J D;  3REJ D;  3LEL D;  3AV2 B;  4KUD D;  1M1A B;  4WNN B;  1M19 C;  4WU9 A;  2NQB C;  5AV5 D;  5GT0 A;  1BH8 A;  4Z2M G;  3MNN A;  1KX4 B;  5B31 A;  2PYO D;  3AN2 C;  5C3I B;  4JJN A;  3X1S B;  1Q9C A;  5CPI B;  4H9O B;  3AZF B;  4LD9 A;  3C1B D;  5JA4 A;  1P3B D;  5AVC A;  3AV1 B;  4KGC D;  3LZ1 C;  5CHL B;  3AZM D;  3WA9 D;  3W96 C;  3UTA D;  5B1M B;  3W98 D;  1P3K D;  1TZY B;  4J8V A;  3UTB A;  3X1T A;  4J8U D;  4ZUX B;  4XUJ C;  3KSY A;  3AZL C;  2F8N A;  3X1V B;  5DNN C;  1P3P A;  1P3F D;  3A6N B;  5AY8 C;  4X23 A;  3MGS B;  1ZLA C;  2NZD B;  3REH C;  3AZG C;  3AZF D;  4NFT A;  3LEL C;  4KUD C;  5CPJ A;  5B0Z B;  5B1M D;  4J8X B;  3W97 A;  1BH9 B;  4HGA C;  2PYO C;  3VH5 A;  3AZE B;  1P3M A;  4QLC D;  4YS3 A;  1M18 A;  3WKJ D;  5B32 B;  1EQZ A;  3KUY A;  1F66 A;  2ARO B;  3AZN B;  5B2I D;  1P3I B;  1P3B C;  3A6N D;  3MGR B;  3MVD A;  4KHA B;  3KWQ C;  4KGC C;  5AV9 C;  3LJA D;  3AZJ A;  3REI B;  5B40 B;  3UTA C;  3B0D C;  1P3K C;  4J8U C;  1P34 B;  5AVB A;  4CAY A;  3MGQ A;  3VH5 T;  4YM6 C;  5BT1 C;  5GXQ C;  4XZQ D;  4J8X D;  1KX3 C;  5GSU B;  3AYW A;  3WAA D;  1A7W A;  1P3F C;  3AZE D;  5B32 D;  3KXB B;  4H9P B;  5B40 A;  4R8P B;  4J8W B;  5BNV B;  3W99 A;  3B6G D;  3UT9 A;  3AZN D;  1P3I D;  5B31 G;  5JRG A;  2L5A A;  1KX5 D; 
#chains in the Genus database with same CATH topology
 5CP6 D;  3A1I A;  4H9S C;  3MGP A;  5B24 B;  5FUG A;  1H3O A;  4CSR A;  2HIO D;  3LZ0 B;  1P34 D;  1ID3 D;  4NE3 A;  4QLC C;  3WTP B;  2ZY2 A;  3WKJ C;  3IP4 C;  1P3G C;  1N1J B;  5B1L C;  5B33 C;  5B2I C;  5CPK B;  4EO5 B;  3AZH C;  1U35 D;  5BO0 B;  1M19 A;  4AWL C;  3KXB D;  2NQB A;  3LJA C;  4H9R B;  3REL B;  4R8P D;  4J8W D;  2BYK A;  4H9N B;  2F8N G;  4WU8 B;  3AN2 A;  4Z5T D;  3C1C B;  1PZR A;  5F99 B;  5B24 D;  4XZQ C;  4WU9 B;  2RVQ C;  5GT3 B;  5GT0 B;  3WAA C;  1BH8 B;  1W2E A;  4Z66 C;  3MNN B;  3AZI D;  4UPK A;  1P3L D;  2F8N K;  3WTP D;  5B31 B;  3O62 D;  3W96 A;  4JJN B;  1F1E A;  1P3O D;  3B6G C;  3B6F D;  2YFW A;  4XUJ A;  4LD9 B;  5JA4 B;  1KX5 C;  5AVC B;  5CP6 C;  3REL D;  3AZL A;  3FDD A;  4H9Q B;  3AL0 C;  2BG1 A;  4WU8 D;  5GT3 A;  3C1C D;  2HIO C;  2IO5 B;  2ZM5 A;  4J8V B;  1ID3 C;  3UTB B;  5AY8 A;  3X1T B;  5AV8 D;  4G91 B;  3AZK D;  1WWI A;  1ZLA A;  3REH A;  2F2A C;  3TU4 A;  3AZG A;  1P3A D;  5GT0 D;  3MNN D;  3LEL A;  2F8N B;  3VH6 W;  1P3P B;  4KUD A;  5B31 D;  1U35 C;  3AFA D;  1AOI D;  4JJN D;  4X23 B;  4H9Q A;  5E5A C;  4DRB A;  4DRA A;  2PYO A;  4Z5T C;  1S32 D;  4LD9 D;  3AV2 D;  1M1A D;  5CPJ B;  1P3B A;  4UUZ A;  3AZI C;  3W97 B;  1KX4 D;  5G49 A;  4J8V D;  1P3L C;  5DNM C;  3X1U C;  3UTB D;  3KWQ A;  5AV6 C;  3O62 C;  4G92 B;  4KGC A;  5B0Y C;  5AV9 A;  2CV5 C;  1P3M B;  3UTA A;  4YS3 B;  1M18 B;  1P3K A;  1P3O C;  3X1S D;  3B6F C;  1EQZ B;  2FJ7 C;  3KUY B;  4J8U A;  2F8N D;  5CPI D;  3REK C;  1F66 B;  2G5I C;  5B2J C;  4YM6 A;  3REJ C;  3MVD B;  1HQ3 B;  5GXQ A;  1KX3 A;  3AV1 D;  3AZJ B;  5AV5 C;  1P3F A;  1TZY D;  4ZBJ B;  5AV8 C;  3AZK C;  4ZUX D;  5AVB B;  4CAY B;  5CPJ D;  3NQU A;  3MGQ B;  1P3A C;  3AYW B;  2Y2M A;  3X1V D;  3C1B C;  2HUE C;  3AFA C;  4H9S A;  1AOI C;  3WTP E;  1HQ3 A;  3MGS D;  3AZM C;  1EQZ D;  3WA9 C;  2NZD D;  1S32 C;  1F66 D;  3W98 C;  3W99 B;  3UT9 B;  5BNX A;  4QLC A;  3WKJ A;  5KDM A;  3AV2 C;  5JRG B;  3VH6 A;  1P3G A;  1M1A C;  3MGP B;  5B0Z D;  5B1L A;  3AZJ D;  2Y2G A;  5B33 A;  5B2I A;  5FUG B;  1H3O B;  1KX4 C;  3AZH A;  4CSR B;  5AVB D;  5C3I C;  3LJA A;  3X1S C;  3R45 A;  5CPI C;  2Y2H A;  2ARO D;  3AZF C;  1B6W A;  3AYW D;  3MGR D;  4XZQ A;  3AV1 C;  1M19 B;  3VH6 T;  2NQB B;  3REI D;  5B40 D;  5B1M C;  4Z66 A;  2BYK B;  1TZY C;  2YFV A;  3AN2 B;  4ZUX C;  5JRG D;  3MGP D;  3B6G A;  5GSU D;  3X1V C;  1KX5 A;  2XD1 A;  1ULY A;  2JSS A;  3A6N C;  3MGS C;  3W96 B;  2HIO A;  2NZD C;  1ID3 A;  2LY8 A;  2YFW B;  4XUJ B;  1TAF B;  3KFU G;  1M19 D;  3A1K A;  4Z2M H;  5B0Z C;  2NQB D;  3NQJ B;  3AZL B;  4J8X C;  1U35 A;  3LZ0 D;  5AVB C;  3AZE C;  5AY8 B;  3LZ1 A;  5B32 C;  1ZLA B;  5E5A A;  4Z5T A;  3REH B;  3TU4 B;  3AZG B;  3AYW C;  4E44 A;  2ARO C;  3AZN C;  5CPK D;  3LEL B;  1P3I C;  1JFI A;  3MGR C;  4KUD B;  1TAF A;  3W96 D;  3REI C;  3NQJ A;  5B40 C;  3AZI A;  1P3L A;  5DNN A;  5DNM A;  4HGA B;  3X1U A;  5AV6 A;  3O62 A;  2PYO B;  5B0Y A;  2CV5 A;  1P34 C;  5F99 D;  1P3O A;  3B6F A;  2FJ7 A;  3REK A;  5GSU C;  4WU9 D;  5B2J A;  5GT3 D;  2BYM A;  1P3B B;  3REJ A;  4UUZ B;  5G49 B;  3KWQ B;  4KGC B;  5AV9 B;  3KXB C;  3UTA B;  5AV5 A;  3REH D;  3TU4 D;  3B0D B;  4R8P C;  4J8W C;  5BS7 C;  3AZG D;  1P3K B;  5AV8 A;  3AZK A;  4J8U B;  3V9R A;  4M6B A;  4YM6 B;  5AVC D;  2VQR A;  1P3A A;  2Y2Q A;  5GXQ B;  5B24 C;  1KX3 B;  3EPK A;  3B0B A;  3C1B A;  3AFA A;  2CWE A;  1P3F B;  3LZ0 C;  1AOI A;  3X1T D;  3WTP C;  3AZM A;  3WA9 A;  3NQU B;  2ZY4 A;  1S32 A;  3W98 A;  2Y2I A;  5CPK C;  3AV2 A;  4EO5 C;  5B32 G;  1P3P D;  3KWQ D;  1M1A A;  4NE5 A;  4WNN A;  5AV9 D;  3REL C;  3H0M C;  4X23 D;  1KX4 A;  1B67 A;  4WU8 C;  3C1C C;  4E45 A;  5F99 C;  5BNX B;  4QLC B;  4YM6 D;  2JCH A;  3WKJ B;  5BT1 D;  5KDM B;  3X1S A;  5GXQ D;  1P3G B;  1KX3 D;  5CPI A;  5B1L B;  4H9O A;  3AZF A;  4WU9 C;  5B33 B;  5GT3 C;  4WV4 B;  5B2I B;  5GT0 C;  3W97 D;  3MNN C;  3AZH B;  2RIQ A;  5B31 C;  3AV1 A;  1BFM A;  4AWL B;  3LJA B;  1P3M D;  4JJN C;  4YS3 D;  5B1M A;  3TU4 C;  1M18 D;  1TZY A;  3KUY D;  3R45 B;  4DQY B;  4ZUX A;  4LD9 C;  1HTA A;  2Y2O A;  1WWS A;  2Y2L A;  5AVC C;  3B0C W;  3MVD D;  1HQ3 D;  4XZQ B;  3X1V A;  1T3U A;  3WAA B;  4Z66 B;  2IO5 C;  3A6N A;  4J8V C;  2YFV B;  3UTB C;  3X1T C;  1Z2C B;  4G91 C;  3MGS A;  1P3G D;  3MGQ D;  2NZD A;  5B1L D;  3B6G B;  5B33 D;  3AZH D;  3P5J B;  1P3P C;  1KX5 B;  5CP6 B;  5B0Z A;  2F8N H;  4WZS B;  3EPL A;  4J8X A;  4X23 C;  1BH9 A;  2HIO B;  3WAA A;  1ID3 B;  3W99 D;  3UT9 D;  3AZE A;  5B32 A;  3EG5 B;  5CPJ C;  2RVQ D;  2ARO A;  3AZN A;  1P3I A;  4Z66 D;  3W97 C;  3MGR A;  4KHA A;  1KU5 A;  4G92 C;  1U35 B;  5CP6 A;  3REI A;  1P3M C;  2Y2J A;  4YS3 C;  1M18 C;  3LZ1 B;  1R4V A;  5E5A B;  1EQZ C;  4Z5T B;  2Y2K A;  3KUY C;  1P34 A;  1F66 C;  1JFI B;  3MVD C;  1HQ3 C;  5GSU A;  2DQN C;  3AZJ C;  3AZI B;  1P3L B;  5DNN B;  3X1U B;  5DNM B;  4ZBJ C;  5AV6 B;  3O62 B;  3AN2 D;  5B0Y B;  2CV5 B;  3KXB A;  4H9P A;  3MGQ C;  4R8P A;  4J8W A;  5BS7 A;  5BNV A;  1P3O B;  3B6F B;  2FJ7 B;  3REK B;  5B2J B;  2BYM B;  3REJ B;  5B24 A;  3LZ1 D;  3H0L C;  5E5A D;  5AV5 B;  3LZ0 A;  3W99 C;  2FFF B;  3UT9 C;  3WTP A;  5AV8 B;  3AZK B;  4XUJ D;  3V9R B;  5JRG C;  1N1J A;  3MGP C;  1P3A B;  3AZL D;  5CPK A;  3B0C T;  5DNN D;  5DNM D;  3X1U D;  3C1B B;  2HUE B;  5AV6 D;  3AFA B;  3F6T A;  5B0Y D;  5BO0 A;  2CV5 D;  1AOI B;  4H9R A;  3REL A;  5AY8 D;  4H9N A;  2G5H C;  3AZM B;  1ZLA D;  4WU8 A;  2FJ7 D;  3WA9 B;  1S32 B;  4NE6 A;  3VH5 W;  3C1C A;  3REK D;  3W98 B;  5F99 A;  5B2J D;  3REJ D;  3LEL D;  3AV2 B;  4KUD D;  1M1A B;  4WNN B;  1M19 C;  4WU9 A;  2NQB C;  5AV5 D;  5GT0 A;  1BH8 A;  4Z2M G;  3MNN A;  1KX4 B;  5B31 A;  2PYO D;  3AN2 C;  5C3I B;  3EPJ A;  2Y2P A;  4JJN A;  3X1S B;  1Q9C A;  5CPI B;  4H9O B;  3AZF B;  4LD9 A;  3C1B D;  5JA4 A;  1P3B D;  5AVC A;  3AV1 B;  4KGC D;  3LZ1 C;  2J8P A;  5CHL B;  3AZM D;  3WA9 D;  3W96 C;  3UTA D;  5B1M B;  3W98 D;  2XD5 A;  1P3K D;  1TZY B;  4J8V A;  3UTB A;  3X1T A;  4J8U D;  4ZUX B;  4XUJ C;  2UWX A;  3KSY A;  3AZL C;  2F8N A;  3X1V B;  5DNN C;  1P3P A;  1P3F D;  3A6N B;  2Y2N A;  5AY8 C;  4X23 A;  3MGS B;  1ZLA C;  2NZD B;  3REH C;  3AZG C;  3AZF D;  4NFT A;  3LEL C;  4KUD C;  5CPJ A;  5B0Z B;  5B1M D;  4J8X B;  3W97 A;  1BH9 B;  4HGA C;  2PYO C;  3VH5 A;  3AZE B;  1P3M A;  4QLC D;  4YS3 A;  1M18 A;  3WKJ D;  5B32 B;  2ZY3 A;  1EQZ A;  3KUY A;  1F66 A;  2ARO B;  3AZN B;  5B2I D;  1P3I B;  1P3B C;  3A6N D;  3MGR B;  3MVD A;  4KHA B;  3KWQ C;  4KGC C;  2JE5 A;  5AV9 C;  3LJA D;  3AZJ A;  3REI B;  5B40 B;  2ZY5 A;  3UTA C;  3B0D C;  1P3K C;  4J8U C;  1P34 B;  5AVB A;  4CAY A;  3MGQ A;  3VH5 T;  4YM6 C;  5BT1 C;  5GXQ C;  4XZQ D;  4J8X D;  1KX3 C;  2DF4 C;  5GSU B;  3AYW A;  3WAA D;  1A7W A;  1P3F C;  3AZE D;  2W8S A;  3EPH A;  3H0R C;  5B32 D;  3KXB B;  4H9P B;  5B40 A;  4R8P B;  4J8W B;  5BNV B;  3W99 A;  3B6G D;  3UT9 A;  3AZN D;  1P3I D;  5B31 G;  4WJ3 C;  5JRG A;  2L5A A;  1KX5 D; 
#chains in the Genus database with same CATH homology
 5CP6 D;  3A1I A;  4H9S C;  3MGP A;  5B24 B;  5FUG A;  1H3O A;  4CSR A;  2HIO D;  3LZ0 B;  1P34 D;  1ID3 D;  4NE3 A;  4QLC C;  3WTP B;  2ZY2 A;  3WKJ C;  3IP4 C;  1P3G C;  1N1J B;  5B1L C;  5B33 C;  5B2I C;  5CPK B;  4EO5 B;  3AZH C;  1U35 D;  5BO0 B;  1M19 A;  4AWL C;  3KXB D;  2NQB A;  3LJA C;  4H9R B;  3REL B;  4R8P D;  4J8W D;  2BYK A;  4H9N B;  2F8N G;  4WU8 B;  3AN2 A;  4Z5T D;  3C1C B;  1PZR A;  5F99 B;  5B24 D;  4XZQ C;  4WU9 B;  2RVQ C;  5GT3 B;  5GT0 B;  3WAA C;  1BH8 B;  1W2E A;  4Z66 C;  3MNN B;  3AZI D;  4UPK A;  1P3L D;  2F8N K;  3WTP D;  5B31 B;  3O62 D;  3W96 A;  4JJN B;  1F1E A;  1P3O D;  3B6G C;  3B6F D;  2YFW A;  4XUJ A;  4LD9 B;  5JA4 B;  1KX5 C;  5AVC B;  5CP6 C;  3REL D;  3AZL A;  3FDD A;  4H9Q B;  3AL0 C;  2BG1 A;  4WU8 D;  5GT3 A;  3C1C D;  2HIO C;  2IO5 B;  2ZM5 A;  4J8V B;  1ID3 C;  3UTB B;  5AY8 A;  3X1T B;  5AV8 D;  4G91 B;  3AZK D;  1WWI A;  1ZLA A;  3REH A;  2F2A C;  3TU4 A;  3AZG A;  1P3A D;  5GT0 D;  3MNN D;  3LEL A;  2F8N B;  3VH6 W;  1P3P B;  4KUD A;  5B31 D;  1U35 C;  3AFA D;  1AOI D;  4JJN D;  4X23 B;  4H9Q A;  5E5A C;  4DRB A;  4DRA A;  2PYO A;  4Z5T C;  1S32 D;  4LD9 D;  3AV2 D;  1M1A D;  5CPJ B;  1P3B A;  4UUZ A;  3AZI C;  3W97 B;  1KX4 D;  5G49 A;  4J8V D;  1P3L C;  5DNM C;  3X1U C;  3UTB D;  3KWQ A;  5AV6 C;  3O62 C;  4G92 B;  4KGC A;  5B0Y C;  5AV9 A;  2CV5 C;  1P3M B;  3UTA A;  4YS3 B;  1M18 B;  1P3K A;  1P3O C;  3X1S D;  3B6F C;  1EQZ B;  2FJ7 C;  3KUY B;  4J8U A;  2F8N D;  5CPI D;  3REK C;  1F66 B;  2G5I C;  5B2J C;  4YM6 A;  3REJ C;  3MVD B;  1HQ3 B;  5GXQ A;  1KX3 A;  3AV1 D;  3AZJ B;  5AV5 C;  1P3F A;  1TZY D;  4ZBJ B;  5AV8 C;  3AZK C;  4ZUX D;  5AVB B;  4CAY B;  5CPJ D;  3NQU A;  3MGQ B;  1P3A C;  3AYW B;  2Y2M A;  3X1V D;  3C1B C;  2HUE C;  3AFA C;  4H9S A;  1AOI C;  3WTP E;  1HQ3 A;  3MGS D;  3AZM C;  1EQZ D;  3WA9 C;  2NZD D;  1S32 C;  1F66 D;  3W98 C;  3W99 B;  3UT9 B;  5BNX A;  4QLC A;  3WKJ A;  5KDM A;  3AV2 C;  5JRG B;  3VH6 A;  1P3G A;  1M1A C;  3MGP B;  5B0Z D;  5B1L A;  3AZJ D;  2Y2G A;  5B33 A;  5B2I A;  5FUG B;  1H3O B;  1KX4 C;  3AZH A;  4CSR B;  5AVB D;  5C3I C;  3LJA A;  3X1S C;  3R45 A;  5CPI C;  2Y2H A;  2ARO D;  3AZF C;  1B6W A;  3AYW D;  3MGR D;  4XZQ A;  3AV1 C;  1M19 B;  3VH6 T;  2NQB B;  3REI D;  5B40 D;  5B1M C;  4Z66 A;  2BYK B;  1TZY C;  2YFV A;  3AN2 B;  4ZUX C;  5JRG D;  3MGP D;  3B6G A;  5GSU D;  3X1V C;  1KX5 A;  2XD1 A;  1ULY A;  2JSS A;  3A6N C;  3MGS C;  3W96 B;  2HIO A;  2NZD C;  1ID3 A;  2LY8 A;  2YFW B;  4XUJ B;  1TAF B;  3KFU G;  1M19 D;  3A1K A;  4Z2M H;  5B0Z C;  2NQB D;  3NQJ B;  3AZL B;  4J8X C;  1U35 A;  3LZ0 D;  5AVB C;  3AZE C;  5AY8 B;  3LZ1 A;  5B32 C;  1ZLA B;  5E5A A;  4Z5T A;  3REH B;  3TU4 B;  3AZG B;  3AYW C;  4E44 A;  2ARO C;  3AZN C;  5CPK D;  3LEL B;  1P3I C;  1JFI A;  3MGR C;  4KUD B;  1TAF A;  3W96 D;  3REI C;  3NQJ A;  5B40 C;  3AZI A;  1P3L A;  5DNN A;  5DNM A;  4HGA B;  3X1U A;  5AV6 A;  3O62 A;  2PYO B;  5B0Y A;  2CV5 A;  1P34 C;  5F99 D;  1P3O A;  3B6F A;  2FJ7 A;  3REK A;  5GSU C;  4WU9 D;  5B2J A;  5GT3 D;  2BYM A;  1P3B B;  3REJ A;  4UUZ B;  5G49 B;  3KWQ B;  4KGC B;  5AV9 B;  3KXB C;  3UTA B;  5AV5 A;  3REH D;  3TU4 D;  3B0D B;  4R8P C;  4J8W C;  5BS7 C;  3AZG D;  1P3K B;  5AV8 A;  3AZK A;  4J8U B;  3V9R A;  4M6B A;  4YM6 B;  5AVC D;  2VQR A;  1P3A A;  2Y2Q A;  5GXQ B;  5B24 C;  1KX3 B;  3EPK A;  3B0B A;  3C1B A;  3AFA A;  2CWE A;  1P3F B;  3LZ0 C;  1AOI A;  3X1T D;  3WTP C;  3AZM A;  3WA9 A;  3NQU B;  2ZY4 A;  1S32 A;  3W98 A;  2Y2I A;  5CPK C;  3AV2 A;  4EO5 C;  5B32 G;  1P3P D;  3KWQ D;  1M1A A;  4NE5 A;  4WNN A;  5AV9 D;  3REL C;  3H0M C;  4X23 D;  1KX4 A;  1B67 A;  4WU8 C;  3C1C C;  4E45 A;  5F99 C;  5BNX B;  4QLC B;  4YM6 D;  2JCH A;  3WKJ B;  5BT1 D;  5KDM B;  3X1S A;  5GXQ D;  1P3G B;  1KX3 D;  5CPI A;  5B1L B;  4H9O A;  3AZF A;  4WU9 C;  5B33 B;  5GT3 C;  4WV4 B;  5B2I B;  5GT0 C;  3W97 D;  3MNN C;  3AZH B;  2RIQ A;  5B31 C;  3AV1 A;  1BFM A;  4AWL B;  3LJA B;  1P3M D;  4JJN C;  4YS3 D;  5B1M A;  3TU4 C;  1M18 D;  1TZY A;  3KUY D;  3R45 B;  4DQY B;  4ZUX A;  4LD9 C;  1HTA A;  2Y2O A;  1WWS A;  2Y2L A;  5AVC C;  3B0C W;  3MVD D;  1HQ3 D;  4XZQ B;  3X1V A;  1T3U A;  3WAA B;  4Z66 B;  2IO5 C;  3A6N A;  4J8V C;  2YFV B;  3UTB C;  3X1T C;  1Z2C B;  4G91 C;  3MGS A;  1P3G D;  3MGQ D;  2NZD A;  5B1L D;  3B6G B;  5B33 D;  3AZH D;  3P5J B;  1P3P C;  1KX5 B;  5CP6 B;  5B0Z A;  2F8N H;  4WZS B;  3EPL A;  4J8X A;  4X23 C;  1BH9 A;  2HIO B;  3WAA A;  1ID3 B;  3W99 D;  3UT9 D;  3AZE A;  5B32 A;  3EG5 B;  5CPJ C;  2RVQ D;  2ARO A;  3AZN A;  1P3I A;  4Z66 D;  3W97 C;  3MGR A;  4KHA A;  1KU5 A;  4G92 C;  1U35 B;  5CP6 A;  3REI A;  1P3M C;  2Y2J A;  4YS3 C;  1M18 C;  3LZ1 B;  1R4V A;  5E5A B;  1EQZ C;  4Z5T B;  2Y2K A;  3KUY C;  1P34 A;  1F66 C;  1JFI B;  3MVD C;  1HQ3 C;  5GSU A;  2DQN C;  3AZJ C;  3AZI B;  1P3L B;  5DNN B;  3X1U B;  5DNM B;  4ZBJ C;  5AV6 B;  3O62 B;  3AN2 D;  5B0Y B;  2CV5 B;  3KXB A;  4H9P A;  3MGQ C;  4R8P A;  4J8W A;  5BS7 A;  5BNV A;  1P3O B;  3B6F B;  2FJ7 B;  3REK B;  5B2J B;  2BYM B;  3REJ B;  5B24 A;  3LZ1 D;  3H0L C;  5E5A D;  5AV5 B;  3LZ0 A;  3W99 C;  2FFF B;  3UT9 C;  3WTP A;  5AV8 B;  3AZK B;  4XUJ D;  3V9R B;  5JRG C;  1N1J A;  3MGP C;  1P3A B;  3AZL D;  5CPK A;  3B0C T;  5DNN D;  5DNM D;  3X1U D;  3C1B B;  2HUE B;  5AV6 D;  3AFA B;  3F6T A;  5B0Y D;  5BO0 A;  2CV5 D;  1AOI B;  4H9R A;  3REL A;  5AY8 D;  4H9N A;  2G5H C;  3AZM B;  1ZLA D;  4WU8 A;  2FJ7 D;  3WA9 B;  1S32 B;  4NE6 A;  3VH5 W;  3C1C A;  3REK D;  3W98 B;  5F99 A;  5B2J D;  3REJ D;  3LEL D;  3AV2 B;  4KUD D;  1M1A B;  4WNN B;  1M19 C;  4WU9 A;  2NQB C;  5AV5 D;  5GT0 A;  1BH8 A;  4Z2M G;  3MNN A;  1KX4 B;  5B31 A;  2PYO D;  3AN2 C;  5C3I B;  3EPJ A;  2Y2P A;  4JJN A;  3X1S B;  1Q9C A;  5CPI B;  4H9O B;  3AZF B;  4LD9 A;  3C1B D;  5JA4 A;  1P3B D;  5AVC A;  3AV1 B;  4KGC D;  3LZ1 C;  2J8P A;  5CHL B;  3AZM D;  3WA9 D;  3W96 C;  3UTA D;  5B1M B;  3W98 D;  2XD5 A;  1P3K D;  1TZY B;  4J8V A;  3UTB A;  3X1T A;  4J8U D;  4ZUX B;  4XUJ C;  2UWX A;  3KSY A;  3AZL C;  2F8N A;  3X1V B;  5DNN C;  1P3P A;  1P3F D;  3A6N B;  2Y2N A;  5AY8 C;  4X23 A;  3MGS B;  1ZLA C;  2NZD B;  3REH C;  3AZG C;  3AZF D;  4NFT A;  3LEL C;  4KUD C;  5CPJ A;  5B0Z B;  5B1M D;  4J8X B;  3W97 A;  1BH9 B;  4HGA C;  2PYO C;  3VH5 A;  3AZE B;  1P3M A;  4QLC D;  4YS3 A;  1M18 A;  3WKJ D;  5B32 B;  2ZY3 A;  1EQZ A;  3KUY A;  1F66 A;  2ARO B;  3AZN B;  5B2I D;  1P3I B;  1P3B C;  3A6N D;  3MGR B;  3MVD A;  4KHA B;  3KWQ C;  4KGC C;  2JE5 A;  5AV9 C;  3LJA D;  3AZJ A;  3REI B;  5B40 B;  2ZY5 A;  3UTA C;  3B0D C;  1P3K C;  4J8U C;  1P34 B;  5AVB A;  4CAY A;  3MGQ A;  3VH5 T;  4YM6 C;  5BT1 C;  5GXQ C;  4XZQ D;  4J8X D;  1KX3 C;  2DF4 C;  5GSU B;  3AYW A;  3WAA D;  1A7W A;  1P3F C;  3AZE D;  2W8S A;  3EPH A;  3H0R C;  5B32 D;  3KXB B;  4H9P B;  5B40 A;  4R8P B;  4J8W B;  5BNV B;  3W99 A;  3B6G D;  3UT9 A;  3AZN D;  1P3I D;  5B31 G;  4WJ3 C;  5JRG A;  2L5A A;  1KX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...