3UTBD

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbD00
5B32G 5JRGA 4G92C 1P3KC 3AZGC 2YFVA 3WTPA 3X1UC 3MGPD 3TU4A 4XZQB 4CSRA 4H9RB 1KX4D 3AZLD 4LD9B 4XUJB 5GSUD 3AZMB 3W99C 5GT3A 3AV1D 3AV2B 5GXQD 1WWSA 4WNNA 3MGRD 5AY8D 5B0ZB 3MGPB 3UTAD 1KX4B 4H9NA 4XUJC 3AZLB 4J8VA 5GSUB 1P3FA 1KX5D 5E5AA 3AZJA 5BO0B 3KSYA 3X1VB 3W97D 5JA4B 1F1EA 5CP6D 1P3GD 5CPKD 4KHAA 3MGRB 4ZBJC 5AY8B 5AVBA 3MGPC 3WAAB 1KX4C 3AZLC 3AZHB 1P3OD 1P3KA 5GSUC 1EQZB 3NQUB 4WU8D 5AV6B 5B1LD 3C1BD 3X1UA 3AYWA 5B31G 3AV1C 5GXQC 5CP6B 4CAYB 3MGRC 5AY8C 5CPKB 3W99A 4G91B 3UTAC 3B6FD 1TZYB 4WU8B 1KX5C 3AZND 5B1LB 4H9RA 1U35D 4XUJA 3W97C 1TAFA 1P3GC 5CPKC 4DRBA 1M19D 3WKJB 1P3OC 1ZLAB 5GT0D 4WU8C 3W98D 5B0ZA 5B1LC 3C1BC 3MGPA 3AZNB 1KX4A 3B0BA 3MGSB 3AZLA 3NQJB 1U35B 3MGQD 5GSUA 5CPJC 5BO0A 3AV1A 1M19B 5JA4A 3B6FC 5GXQA 5B31D 3MGRA 5AY8A 4Z2MG 5GT0B 3W98B 1BH9B 3AZNC 3UTAA 1HQ3D 1U35C 4WV4B 3NQUA 3MGQB 4ZUXD 1M19C 3W97A 5CP6A 4CAYA 1P3GA 5CPKA 5GT0C 3W98C 3REJB 3MVDD 1BFMA 3KXBD 1HQ3B 3VH5T 3A6ND 1P3OA 3MGQC 5AVCD 2CV5D 3R45B 4WU8A 4YS3B 3AZKD 5B1LA 1F66D 3C1BA 5B2JD 4ZUXB 4EO5C 5B2IB 5B31C 3V9RB 4NE3A 4JJND 3LZ1D 3KXBB 1BH8B 3B6FA 3A6NB 1P3PB 5AVCB 2CV5B 2AROB 3AZNA 4ZUXC 5B40B 2F8NK 4XZQD 1U35A 5B2JB 3REID 4LD9D 5BNXA 4NE5A 3AZMD 4M6BA 3MVDC 1M19A 2YFWB 3KXBC 4JJNB 3LZ1B 3A6NC 2NZDD 5CPID 3AV2D 5AVCC 2CV5C 5GT0A 3AZIB 3W98A 2IO5B 1BH9A 3AZKC 1F66C 4QLCD 5B0ZD 5B2JC 1N1JB 3AYWC 3WTPE 3REIB 3MGQA 4JJNC 3LZ1C 3X1VD 5G49B 2NZDB 5CPIB 2IO5C 5B31A 4QLCB 2LY8A 3WAAD 1HQ3A 4XZQC 3REIC 3AZHD 3W96D 4LD9C 4YS3A 1EQZD 3AZMC 5AV6D 4ZUXA 2NZDC 5CPIC 3AV2C 3C1CD 5DNMB 3V9RA 1P3MB 4QLCC 3MVDA 5B0ZC 3KXBA 1BH8A 3VH5W 4UUZB 5B33D 3A6NA 3W96B 5AVCA 2CV5A 5AV9B 1TZYD 3AZKA 1F66A 5B40A 1P3ID 5B2JA 3X1VC 1P3AB 3VH6A 1AOIB 3C1CB 3RELD 2YFWA 4JJNA 3WAAC 3LZ1A 3WKJD 3AZHC 3W96C 5B33B 1Q9CA 3O62D 1ZLAD 1EQZC 3B0CT 5DNND 5AV6C 2BYKB 1N1JA 4XZQA 1P3IB 1M18B 2PYOD 3MGSD 3REIA 4LD9A 3C1CC 3KWQD 5CP6C 1KX3B 3X1SB 3AZMA 3LJAD 5AV5B 1P34B 5KDMB 3RELB 4G91C 5G49A 3REHB 5B33C 2NZDA 3AZED 3AV2A 5CPIA 2FJ7D 3O62B 4KGCB 1TZYC 2HIOD 4QLCA 5DNNB 1P3IC 4AWLB 2PYOB 5B1MB 3KWQB 4Z66D 4E45A 3RELC 3LJAB 4Z5TD 3WKJC 3X1VA 1HTAA 1S32B 3AZEB 2NQBD 3O62C 1ZLAC 2FJ7B 5DNNC 3REJD 2HIOB 4J8UD 4AWLC 3WAAA 4UUZA 2PYOC 3MGSC 3AZHA 3W96A 4J8XD 5AV9A 3KWQC 2RVQD 1EQZA 4YS3D 4Z66B 5AV6A 3LJAC 5AV8B 5B24B 3KUYD 4Z5TB 3WA9B 3AZEC 3C1CA 2FJ7C 2NQBB 1M1AB 5B2ID 1JFIB 3X1TD 2HIOC 1H3OB 4J8UB 5B33A 3AZFD 5CHLB 1P3PD 4J8XB 3UT9D 5JRGB 1ID3D 4Z66C 2AROD 1TZYA 5C3IB 2BYKA 3KUYB 1P3IA 4Z5TC 5B40D 3B0DB 3B6GD 2NQBC 1A7WA 3REKD 4WU9B 5KDMA 3RELA 3REJC 3X1TB 4J8UC 3WKJA 5F99D 1HQ3C 5GT3B 4J8XC 3O62A 3UTBB 3AZFB 1ZLAA 2RVQC 3B0CW 3UT9B 1KU5A 4R8PD 5DNNA 4YS3C 3AZID 1R4VA 3KUYC 1ID3B 2PYOA 3MGSA 3B0DC 3NQJA 5B1MA 3B6GB 3KWQA 4H9SC 5B2IC 5FUGB 3LJAA 4J8VB 3REKB 3X1TC 1B6WA 1P3FB 3AZEA 3AZFC 2L5AA 5F99B 1P3PC 2FJ7A 3UT9C 1ID3C 1P3LD 2AROC 2F8NH 4R8PB 2HIOA 5B40C 4KHAB 3REKC 4Z66A 4Z5TA 3AZGB 5F99C 2NQBA 5DNMD 4R8PC 1JFIA 3AZIC 1P3LB 1P3MD 1B67A 1H3OA 3REJA 4J8UA 2CWEA 4J8XA 3VH6T 3R45A 5AV9D 3MNND 4E44A 3KUYA 4DRAA 5BS7A 4KUDD 4X23D 1P3AD 4H9SA 1AOID 4WU9A 2F8ND 5B2IA 1P3LC 1TAFB 3X1TA 5BT1D 3AZFA 3UTBA 4WZSB 1P3PA 3LELD 3UT9A 3AN2D 1ID3A 2AROA 3MNNB 1WWIA 4YM6D 1M18D 4ZBJB 3B6GA 4KUDB 4X23B 5DNMC 5FUGA 3REKA 1KX3D 3X1SD 2F8NB 1P3MC 5AV5D 1P34D 3REHD 5F99A 3AV1B 3LELB 4R8PA 3AN2B 5AV9C 3MNNC 3AZIA 4KGCD 5GXQB 5BNVB 4KUDC 4YM6B 4X23C 1P3AC 5B1MD 3UTAB 1AOIC 3AZGA 5B32D 1P3BD 5BT1C 1KX5B 1S32D 3LELC 3AN2C 3W97B 1P3LA 3LZ0D 1P3GB 1ULYA 5CPJD 4YM6C 1M18C 2JSSA 4J8WD 4H9QB 1KX3C 3X1SC 1P3OB 5AV5C 5AV8D 5B24D 1P34C 5B32B 3REHC 1P3BB 3C1BB 3WA9D 3AFAD 5DNMA 4H9OB 1M1AD 4KGCC 1P3MA 3LZ0B 5B0YD 5CPJB 3VH6W 5B1MC 4J8WB 5JRGD 3MNNA 2HUEB 3B6FB 5B32C 1P3BC 4KUDA 4X23A 1S32C 3WTPD 1P3AA 3AFAB 3TU4D 1AOIA 2F8NA 4WU9D 3LZ0C 5BNXB 4H9PB 5B0YB 5GT3D 3LELA 2BYMB 4J8WC 3UTBD 3AN2A 2HUEC 5AV8C 5BNVA 5B24C 4YM6A 1M18A 2YFVB 3WA9C 3AFAC 3WTPB 3TU4B 1KX3A 1M1AC 4CSRB 3X1SA 5AV5A 4J8VD 1P34A 1KX5A 5B0YC 1P3FD 3REHA 5E5AD 3AZJD 5JRGC 4KGCA 4Z2MH 4EO5B 5C3IC 5B31B 2F8NG 4WNNB 5BS7C 3WTPC 4H9QA 5AVBD 3TU4C 4H9NB 4WU9C 5B32A 1P3KD 3AZGD 1P3BA 1S32A 5GT3C 3X1UD 5E5AB 4H9OA 3AYWD 3UTBC 3AZJB 4HGAB 3LZ0A 5CPJA 4NFTA 3W99D 3MVDB 4J8WA 3B6GC 5AVBB 4J8VC 5AV8A 5B24A 4G92B 1P3KB 1P3FC 3AZKB 1F66B 3WA9A 3AFAA 5E5AC 3AZJC 3X1UB 4NE6A 3AYWB 4HGAC 3VH5A 4XUJD 1M1AA 4H9PA 5B0YA 2BYMA 3W99B 5AVBC
chains in the Genus database with same CATH superfamily
5B32G 5JRGA 4G92C 1P3KC 3AZGC 2YFVA 3WTPA 3X1UC 3MGPD 3TU4A 4XZQB 4CSRA 4H9RB 1KX4D 3AZLD 4LD9B 4XUJB 5GSUD 3AZMB 3H0MC 3W99C 5GT3A 3AV1D 3AV2B 5GXQD 1WWSA 4WNNA 3MGRD 5AY8D 5B0ZB 3MGPB 3UTAD 1KX4B 4H9NA 4XUJC 3AZLB 2G5HC 4J8VA 2VQRA 5GSUB 1P3FA 1KX5D 5E5AA 3AZJA 5BO0B 3KSYA 3X1VB 3W97D 5JA4B 1F1EA 5CP6D 1P3GD 5CPKD 4KHAA 1PZRA 2BG1A 4ZBJC 5AY8B 3MGRB 5AVBA 3MGPC 3WAAB 1KX4C 3AZLC 3AZHB 1P3OD 3A1KA 5GSUC 1P3KA 1EQZB 3NQUB 4WU8D 5AV6B 5B1LD 3C1BD 3X1UA 3AYWA 5B31G 3AV1C 5GXQC 5CP6B 4CAYB 2Y2KA 3MGRC 5AY8C 5CPKB 3W99A 4G91B 3UTAC 3B6FD 1TZYB 2JE5A 4WU8B 1KX5C 3AZND 5B1LB 4H9RA 1U35D 4XUJA 3W97C 1TAFA 1P3GC 5CPKC 4DRBA 1M19D 3WKJB 1P3OC 1ZLAB 5GT0D 4WU8C 3W98D 5B0ZA 5B1LC 3C1BC 3MGPA 3AZNB 1KX4A 3B0BA 3MGSB 3AZLA 3NQJB 1U35B 3MGQD 2G5IC 5GSUA 5CPJC 5BO0A 3AV1A 1M19B 5JA4A 3B6FC 5GXQA 5B31D 3MGRA 5AY8A 4Z2MG 5GT0B 3W98B 3EPLA 1BH9B 3AZNC 3UTAA 1HQ3D 1U35C 2ZY5A 4WV4B 3NQUA 3MGQB 4ZUXD 1M19C 3W97A 5CP6A 4CAYA 1P3GA 5CPKA 5GT0C 3W98C 2DQNC 3REJB 3MVDD 1BFMA 3KXBD 1HQ3B 3VH5T 3A6ND 1P3OA 2ZY4A 3MGQC 5AVCD 2CV5D 3R45B 4WU8A 4YS3B 3AZKD 5B1LA 1F66D 3C1BA 5B2JD 4ZUXB 4EO5C 5B2IB 5B31C 3V9RB 2Y2JA 4NE3A 4JJND 2F2AC 4WJ3C 2RIQA 3LZ1D 3KXBB 1BH8B 3B6FA 3A6NB 1P3PB 5AVCB 2CV5B 2AROB 3AZNA 4ZUXC 5B40B 2F8NK 4XZQD 1U35A 5B2JB 3REID 4LD9D 5BNXA 4NE5A 3AZMD 4M6BA 3MVDC 1M19A 2YFWB 3KXBC 4JJNB 3LZ1B 3A6NC 2NZDD 5CPID 3AV2D 5AVCC 2CV5C 5GT0A 3AZIB 3W98A 2IO5B 1BH9A 3AZKC 1F66C 4QLCD 5B0ZD 5B2JC 1N1JB 3AYWC 3KFUG 3WTPE 3REIB 3MGQA 4JJNC 3LZ1C 3X1VD 5G49B 2NZDB 2XD1A 5CPIB 2IO5C 5B31A 4QLCB 2LY8A 3WAAD 1HQ3A 4XZQC 3REIC 3AZHD 3W96D 4LD9C 4YS3A 1EQZD 3AZMC 5AV6D 4ZUXA 2NZDC 5CPIC 3AV2C 3C1CD 5DNMB 3V9RA 2Y2HA 1P3MB 4QLCC 3MVDA 5B0ZC 3KXBA 1BH8A 3VH5W 4UUZB 5B33D 3A6NA 3W96B 5AVCA 2CV5A 5AV9B 1TZYD 3AZKA 1F66A 5B40A 1P3ID 5B2JA 3EPKA 3X1VC 2J8PA 1P3AB 3VH6A 1AOIB 3C1CB 3RELD 2YFWA 4JJNA 3WAAC 3LZ1A 3WKJD 3AZHC 3W96C 5B33B 2Y2NA 1Q9CA 3O62D 1ZLAD 1EQZC 3B0CT 3P5JB 5DNND 5AV6C 2BYKB 1N1JA 4XZQA 1P3IB 1M18B 2PYOD 3MGSD 3REIA 4LD9A 3C1CC 3KWQD 5CP6C 1KX3B 3X1SB 3AZMA 3LJAD 5AV5B 1P34B 5KDMB 3RELB 4G91C 5G49A 3REHB 5B33C 2NZDA 2Y2IA 3AZED 3AV2A 5CPIA 2FJ7D 3O62B 4KGCB 1TZYC 5DNNB 2HIOD 2Y2QA 4QLCA 1P3IC 4AWLB 2PYOB 5B1MB 3KWQB 4Z66D 4E45A 3RELC 3LJAB 2UWXA 4Z5TD 3WKJC 3X1VA 1HTAA 1S32B 3EG5B 3AZEB 3O62C 1ZLAC 2NQBD 2FJ7B 5DNNC 2Y2PA 3REJD 2HIOB 4J8UD 4AWLC 3WAAA 4UUZA 2PYOC 3MGSC 3AZHA 3W96A 4J8XD 5AV9A 3KWQC 2RVQD 1EQZA 2XD5A 4Z66B 5AV6A 4YS3D 5AV8B 5B24B 3LJAC 3KUYD 4Z5TB 1T3UA 3WA9B 3AZEC 3C1CA 2FJ7C 2NQBB 1M1AB 5B2ID 1JFIB 3X1TD 2HIOC 1H3OB 4J8UB 5B33A 3AZFD 5CHLB 1P3PD 4J8XB 3UT9D 5JRGB 1ID3D 4Z66C 2AROD 1TZYA 5C3IB 2BYKA 3KUYB 1P3IA 4Z5TC 5B40D 3B0DB 3B6GD 2NQBC 1A7WA 3REKD 4WU9B 5KDMA 3RELA 3REJC 3X1TB 4J8UC 3WKJA 5F99D 1HQ3C 5GT3B 4J8XC 3O62A 3UTBB 3AZFB 1ZLAA 2RVQC 3B0CW 3UT9B 1KU5A 2ZY3A 5DNNA 4YS3C 4R8PD 1R4VA 3KUYC 3AZID 1ID3B 2PYOA 3MGSA 3B0DC 3NQJA 5B1MA 3H0RC 3B6GB 3KWQA 4H9SC 5B2IC 3H0LC 5FUGB 3LJAA 4J8VB 3REKB 3X1TC 1B6WA 1P3FB 3AZEA 3AZFC 2L5AA 5F99B 2Y2MA 1P3PC 2FJ7A 3UT9C 1ID3C 1P3LD 2AROC 2F8NH 4R8PB 2HIOA 5B40C 4KHAB 3REKC 4Z66A 4Z5TA 3AZGB 5F99C 2NQBA 5DNMD 4R8PC 1JFIA 3AZIC 1P3LB 1P3MD 1B67A 1H3OA 3REJA 4J8UA 2CWEA 3FDDA 4J8XA 3VH6T 3R45A 5AV9D 3MNND 4E44A 3KUYA 4DRAA 2W8SA 5BS7A 4KUDD 4X23D 1P3AD 4H9SA 1AOID 4WU9A 2F8ND 5B2IA 1P3LC 1TAFB 3X1TA 3A1IA 5BT1D 3AZFA 3UTBA 4WZSB 1P3PA 3LELD 3UT9A 3AN2D 1ID3A 2AROA 3MNNB 1WWIA 4YM6D 1M18D 4ZBJB 3B6GA 1W2EA 4KUDB 4X23B 5DNMC 5FUGA 3REKA 1KX3D 3X1SD 2F8NB 1P3MC 5AV5D 1P34D 3REHD 5F99A 4UPKA 3LELB 3AV1B 4R8PA 3AN2B 5AV9C 3MNNC 3AZIA 4KGCD 5GXQB 4DQYB 2Y2LA 5BNVB 4KUDC 2ZM5A 4YM6B 4X23C 1P3AC 5B1MD 3UTAB 1AOIC 1Z2CB 3AZGA 5B32D 1P3BD 5BT1C 1KX5B 1S32D 3LELC 3AN2C 3W97B 1P3LA 3LZ0D 1P3GB 1ULYA 5CPJD 4YM6C 1M18C 2JSSA 4J8WD 4H9QB 1KX3C 3X1SC 1P3OB 5AV5C 5AV8D 5B24D 1P34C 5B32B 3REHC 1P3BB 3C1BB 3WA9D 3AFAD 5DNMA 4H9OB 1M1AD 4KGCC 1P3MA 3IP4C 3LZ0B 5B0YD 3AL0C 5CPJB 3VH6W 5B1MC 4J8WB 5JRGD 3MNNA 2HUEB 2DF4C 3B6FB 2Y2GA 5B32C 3EPHA 1P3BC 4KUDA 4X23A 1S32C 3WTPD 1P3AA 3AFAB 3TU4D 1AOIA 2F8NA 4WU9D 3LZ0C 5BNXB 4H9PB 3F6TA 5B0YB 5GT3D 3LELA 2BYMB 4J8WC 3UTBD 3AN2A 2HUEC 5AV8C 5BNVA 5B24C 4YM6A 1M18A 2JCHA 2YFVB 3WA9C 3AFAC 3WTPB 3TU4B 1KX3A 3EPJA 4CSRB 3X1SA 1M1AC 5AV5A 4J8VD 1P34A 1KX5A 5B0YC 1P3FD 3REHA 5E5AD 3AZJD 5JRGC 4KGCA 4Z2MH 4EO5B 5C3IC 5B31B 2F8NG 4WNNB 5BS7C 3WTPC 4H9QA 5AVBD 3TU4C 4H9NB 4WU9C 2ZY2A 5B32A 1P3KD 3AZGD 1P3BA 1S32A 5GT3C 3X1UD 5E5AB 4H9OA 3AYWD 3UTBC 3AZJB 4HGAB 3LZ0A 5CPJA 4NFTA 3W99D 3MVDB 4J8WA 3B6GC 5AVBB 4J8VC 5AV8A 5B24A 4G92B 1P3KB 1P3FC 3AZKB 1F66B 3WA9A 3AFAA 5E5AC 3AZJC 3X1UB 4NE6A 3AYWB 4HGAC 3VH5A 4XUJD 1M1AA 2Y2OA 2FFFB 4H9PA 5B0YA 2BYMA 3W99B 5AVBC
chains in the Genus database with same CATH topology
5B32G 5JRGA 4G92C 1P3KC 3AZGC 2YFVA 3WTPA 3X1UC 3MGPD 3TU4A 4XZQB 4CSRA 4H9RB 1KX4D 3AZLD 4LD9B 4XUJB 5GSUD 3AZMB 3H0MC 3W99C 5GT3A 3AV1D 3AV2B 5GXQD 1WWSA 4WNNA 3MGRD 5AY8D 5B0ZB 3MGPB 3UTAD 1KX4B 4H9NA 4XUJC 3AZLB 2G5HC 4J8VA 2VQRA 5GSUB 1P3FA 1KX5D 5E5AA 3AZJA 5BO0B 3KSYA 3X1VB 3W97D 5JA4B 1F1EA 5CP6D 1P3GD 5CPKD 4KHAA 1PZRA 2BG1A 4ZBJC 5AY8B 3MGRB 5AVBA 3MGPC 3WAAB 1KX4C 3AZLC 3AZHB 1P3OD 3A1KA 5GSUC 1P3KA 1EQZB 3NQUB 4WU8D 5AV6B 5B1LD 3C1BD 3X1UA 3AYWA 5B31G 3AV1C 5GXQC 5CP6B 4CAYB 2Y2KA 3MGRC 5AY8C 5CPKB 3W99A 4G91B 3UTAC 3B6FD 1TZYB 2JE5A 4WU8B 1KX5C 3AZND 5B1LB 4H9RA 1U35D 4XUJA 3W97C 1TAFA 1P3GC 5CPKC 4DRBA 1M19D 3WKJB 1P3OC 1ZLAB 5GT0D 4WU8C 3W98D 5B0ZA 5B1LC 3C1BC 3MGPA 3AZNB 1KX4A 3B0BA 3MGSB 3AZLA 3NQJB 1U35B 3MGQD 2G5IC 5GSUA 5CPJC 5BO0A 3AV1A 1M19B 5JA4A 3B6FC 5GXQA 5B31D 3MGRA 5AY8A 4Z2MG 5GT0B 3W98B 3EPLA 1BH9B 3AZNC 3UTAA 1HQ3D 1U35C 2ZY5A 4WV4B 3NQUA 3MGQB 4ZUXD 1M19C 3W97A 5CP6A 4CAYA 1P3GA 5CPKA 5GT0C 3W98C 2DQNC 3REJB 3MVDD 1BFMA 3KXBD 1HQ3B 3VH5T 3A6ND 1P3OA 2ZY4A 3MGQC 5AVCD 2CV5D 3R45B 4WU8A 4YS3B 3AZKD 5B1LA 1F66D 3C1BA 5B2JD 4ZUXB 4EO5C 5B2IB 5B31C 3V9RB 2Y2JA 4NE3A 4JJND 2F2AC 4WJ3C 2RIQA 3LZ1D 3KXBB 1BH8B 3B6FA 3A6NB 1P3PB 5AVCB 2CV5B 2AROB 3AZNA 4ZUXC 5B40B 2F8NK 4XZQD 1U35A 5B2JB 3REID 4LD9D 5BNXA 4NE5A 3AZMD 4M6BA 3MVDC 1M19A 2YFWB 3KXBC 4JJNB 3LZ1B 3A6NC 2NZDD 5CPID 3AV2D 5AVCC 2CV5C 5GT0A 3AZIB 3W98A 2IO5B 1BH9A 3AZKC 1F66C 4QLCD 5B0ZD 5B2JC 1N1JB 3AYWC 3KFUG 3WTPE 3REIB 3MGQA 4JJNC 3LZ1C 3X1VD 5G49B 2NZDB 2XD1A 5CPIB 2IO5C 5B31A 4QLCB 2LY8A 3WAAD 1HQ3A 4XZQC 3REIC 3AZHD 3W96D 4LD9C 4YS3A 1EQZD 3AZMC 5AV6D 4ZUXA 2NZDC 5CPIC 3AV2C 3C1CD 5DNMB 3V9RA 2Y2HA 1P3MB 4QLCC 3MVDA 5B0ZC 3KXBA 1BH8A 3VH5W 4UUZB 5B33D 3A6NA 3W96B 5AVCA 2CV5A 5AV9B 1TZYD 3AZKA 1F66A 5B40A 1P3ID 5B2JA 3EPKA 3X1VC 2J8PA 1P3AB 3VH6A 1AOIB 3C1CB 3RELD 2YFWA 4JJNA 3WAAC 3LZ1A 3WKJD 3AZHC 3W96C 5B33B 2Y2NA 1Q9CA 3O62D 1ZLAD 1EQZC 3B0CT 3P5JB 5DNND 5AV6C 2BYKB 1N1JA 4XZQA 1P3IB 1M18B 2PYOD 3MGSD 3REIA 4LD9A 3C1CC 3KWQD 5CP6C 1KX3B 3X1SB 3AZMA 3LJAD 5AV5B 1P34B 5KDMB 3RELB 4G91C 5G49A 3REHB 5B33C 2NZDA 2Y2IA 3AZED 3AV2A 5CPIA 2FJ7D 3O62B 4KGCB 1TZYC 5DNNB 2HIOD 2Y2QA 4QLCA 1P3IC 4AWLB 2PYOB 5B1MB 3KWQB 4Z66D 4E45A 3RELC 3LJAB 2UWXA 4Z5TD 3WKJC 3X1VA 1HTAA 1S32B 3EG5B 3AZEB 3O62C 1ZLAC 2NQBD 2FJ7B 5DNNC 2Y2PA 3REJD 2HIOB 4J8UD 4AWLC 3WAAA 4UUZA 2PYOC 3MGSC 3AZHA 3W96A 4J8XD 5AV9A 3KWQC 2RVQD 1EQZA 2XD5A 4Z66B 5AV6A 4YS3D 5AV8B 5B24B 3LJAC 3KUYD 4Z5TB 1T3UA 3WA9B 3AZEC 3C1CA 2FJ7C 2NQBB 1M1AB 5B2ID 1JFIB 3X1TD 2HIOC 1H3OB 4J8UB 5B33A 3AZFD 5CHLB 1P3PD 4J8XB 3UT9D 5JRGB 1ID3D 4Z66C 2AROD 1TZYA 5C3IB 2BYKA 3KUYB 1P3IA 4Z5TC 5B40D 3B0DB 3B6GD 2NQBC 1A7WA 3REKD 4WU9B 5KDMA 3RELA 3REJC 3X1TB 4J8UC 3WKJA 5F99D 1HQ3C 5GT3B 4J8XC 3O62A 3UTBB 3AZFB 1ZLAA 2RVQC 3B0CW 3UT9B 1KU5A 2ZY3A 5DNNA 4YS3C 4R8PD 1R4VA 3KUYC 3AZID 1ID3B 2PYOA 3MGSA 3B0DC 3NQJA 5B1MA 3H0RC 3B6GB 3KWQA 4H9SC 5B2IC 3H0LC 5FUGB 3LJAA 4J8VB 3REKB 3X1TC 1B6WA 1P3FB 3AZEA 3AZFC 2L5AA 5F99B 2Y2MA 1P3PC 2FJ7A 3UT9C 1ID3C 1P3LD 2AROC 2F8NH 4R8PB 2HIOA 5B40C 4KHAB 3REKC 4Z66A 4Z5TA 3AZGB 5F99C 2NQBA 5DNMD 4R8PC 1JFIA 3AZIC 1P3LB 1P3MD 1B67A 1H3OA 3REJA 4J8UA 2CWEA 3FDDA 4J8XA 3VH6T 3R45A 5AV9D 3MNND 4E44A 3KUYA 4DRAA 2W8SA 5BS7A 4KUDD 4X23D 1P3AD 4H9SA 1AOID 4WU9A 2F8ND 5B2IA 1P3LC 1TAFB 3X1TA 3A1IA 5BT1D 3AZFA 3UTBA 4WZSB 1P3PA 3LELD 3UT9A 3AN2D 1ID3A 2AROA 3MNNB 1WWIA 4YM6D 1M18D 4ZBJB 3B6GA 1W2EA 4KUDB 4X23B 5DNMC 5FUGA 3REKA 1KX3D 3X1SD 2F8NB 1P3MC 5AV5D 1P34D 3REHD 5F99A 4UPKA 3LELB 3AV1B 4R8PA 3AN2B 5AV9C 3MNNC 3AZIA 4KGCD 5GXQB 4DQYB 2Y2LA 5BNVB 4KUDC 2ZM5A 4YM6B 4X23C 1P3AC 5B1MD 3UTAB 1AOIC 1Z2CB 3AZGA 5B32D 1P3BD 5BT1C 1KX5B 1S32D 3LELC 3AN2C 3W97B 1P3LA 3LZ0D 1P3GB 1ULYA 5CPJD 4YM6C 1M18C 2JSSA 4J8WD 4H9QB 1KX3C 3X1SC 1P3OB 5AV5C 5AV8D 5B24D 1P34C 5B32B 3REHC 1P3BB 3C1BB 3WA9D 3AFAD 5DNMA 4H9OB 1M1AD 4KGCC 1P3MA 3IP4C 3LZ0B 5B0YD 3AL0C 5CPJB 3VH6W 5B1MC 4J8WB 5JRGD 3MNNA 2HUEB 2DF4C 3B6FB 2Y2GA 5B32C 3EPHA 1P3BC 4KUDA 4X23A 1S32C 3WTPD 1P3AA 3AFAB 3TU4D 1AOIA 2F8NA 4WU9D 3LZ0C 5BNXB 4H9PB 3F6TA 5B0YB 5GT3D 3LELA 2BYMB 4J8WC 3UTBD 3AN2A 2HUEC 5AV8C 5BNVA 5B24C 4YM6A 1M18A 2JCHA 2YFVB 3WA9C 3AFAC 3WTPB 3TU4B 1KX3A 3EPJA 4CSRB 3X1SA 1M1AC 5AV5A 4J8VD 1P34A 1KX5A 5B0YC 1P3FD 3REHA 5E5AD 3AZJD 5JRGC 4KGCA 4Z2MH 4EO5B 5C3IC 5B31B 2F8NG 4WNNB 5BS7C 3WTPC 4H9QA 5AVBD 3TU4C 4H9NB 4WU9C 2ZY2A 5B32A 1P3KD 3AZGD 1P3BA 1S32A 5GT3C 3X1UD 5E5AB 4H9OA 3AYWD 3UTBC 3AZJB 4HGAB 3LZ0A 5CPJA 4NFTA 3W99D 3MVDB 4J8WA 3B6GC 5AVBB 4J8VC 5AV8A 5B24A 4G92B 1P3KB 1P3FC 3AZKB 1F66B 3WA9A 3AFAA 5E5AC 3AZJC 3X1UB 4NE6A 3AYWB 4HGAC 3VH5A 4XUJD 1M1AA 2Y2OA 2FFFB 4H9PA 5B0YA 2BYMA 3W99B 5AVBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 G;  5JRG A;  4G92 C;  1P3K C;  3AZG C;  2YFV A;  3WTP A;  3X1U C;  3MGP D;  3TU4 A;  4XZQ B;  4CSR A;  4H9R B;  1KX4 D;  3AZL D;  4LD9 B;  4XUJ B;  5GSU D;  3AZM B;  3W99 C;  5GT3 A;  3AV1 D;  3AV2 B;  5GXQ D;  1WWS A;  4WNN A;  3MGR D;  5AY8 D;  5B0Z B;  3MGP B;  3UTA D;  1KX4 B;  4H9N A;  4XUJ C;  3AZL B;  4J8V A;  5GSU B;  1P3F A;  1KX5 D;  5E5A A;  3AZJ A;  5BO0 B;  3KSY A;  3X1V B;  3W97 D;  5JA4 B;  1F1E A;  5CP6 D;  1P3G D;  5CPK D;  4KHA A;  3MGR B;  4ZBJ C;  5AY8 B;  5AVB A;  3MGP C;  3WAA B;  1KX4 C;  3AZL C;  3AZH B;  1P3O D;  1P3K A;  5GSU C;  1EQZ B;  3NQU B;  4WU8 D;  5AV6 B;  5B1L D;  3C1B D;  3X1U A;  3AYW A;  5B31 G;  3AV1 C;  5GXQ C;  5CP6 B;  4CAY B;  3MGR C;  5AY8 C;  5CPK B;  3W99 A;  4G91 B;  3UTA C;  3B6F D;  1TZY B;  4WU8 B;  1KX5 C;  3AZN D;  5B1L B;  4H9R A;  1U35 D;  4XUJ A;  3W97 C;  1TAF A;  1P3G C;  5CPK C;  4DRB A;  1M19 D;  3WKJ B;  1P3O C;  1ZLA B;  5GT0 D;  4WU8 C;  3W98 D;  5B0Z A;  5B1L C;  3C1B C;  3MGP A;  3AZN B;  1KX4 A;  3B0B A;  3MGS B;  3AZL A;  3NQJ B;  1U35 B;  3MGQ D;  5GSU A;  5CPJ C;  5BO0 A;  3AV1 A;  1M19 B;  5JA4 A;  3B6F C;  5GXQ A;  5B31 D;  3MGR A;  5AY8 A;  4Z2M G;  5GT0 B;  3W98 B;  1BH9 B;  3AZN C;  3UTA A;  1HQ3 D;  1U35 C;  4WV4 B;  3NQU A;  3MGQ B;  4ZUX D;  1M19 C;  3W97 A;  5CP6 A;  4CAY A;  1P3G A;  5CPK A;  5GT0 C;  3W98 C;  3REJ B;  3MVD D;  1BFM A;  3KXB D;  1HQ3 B;  3VH5 T;  3A6N D;  1P3O A;  3MGQ C;  5AVC D;  2CV5 D;  3R45 B;  4WU8 A;  4YS3 B;  3AZK D;  5B1L A;  1F66 D;  3C1B A;  5B2J D;  4ZUX B;  4EO5 C;  5B2I B;  5B31 C;  3V9R B;  4NE3 A;  4JJN D;  3LZ1 D;  3KXB B;  1BH8 B;  3B6F A;  3A6N B;  1P3P B;  5AVC B;  2CV5 B;  2ARO B;  3AZN A;  4ZUX C;  5B40 B;  2F8N K;  4XZQ D;  1U35 A;  5B2J B;  3REI D;  4LD9 D;  5BNX A;  4NE5 A;  3AZM D;  4M6B A;  3MVD C;  1M19 A;  2YFW B;  3KXB C;  4JJN B;  3LZ1 B;  3A6N C;  2NZD D;  5CPI D;  3AV2 D;  5AVC C;  2CV5 C;  5GT0 A;  3AZI B;  3W98 A;  2IO5 B;  1BH9 A;  3AZK C;  1F66 C;  4QLC D;  5B0Z D;  5B2J C;  1N1J B;  3AYW C;  3WTP E;  3REI B;  3MGQ A;  4JJN C;  3LZ1 C;  3X1V D;  5G49 B;  2NZD B;  5CPI B;  2IO5 C;  5B31 A;  4QLC B;  2LY8 A;  3WAA D;  1HQ3 A;  4XZQ C;  3REI C;  3AZH D;  3W96 D;  4LD9 C;  4YS3 A;  1EQZ D;  3AZM C;  5AV6 D;  4ZUX A;  2NZD C;  5CPI C;  3AV2 C;  3C1C D;  5DNM B;  3V9R A;  1P3M B;  4QLC C;  3MVD A;  5B0Z C;  3KXB A;  1BH8 A;  3VH5 W;  4UUZ B;  5B33 D;  3A6N A;  3W96 B;  5AVC A;  2CV5 A;  5AV9 B;  1TZY D;  3AZK A;  1F66 A;  5B40 A;  1P3I D;  5B2J A;  3X1V C;  1P3A B;  3VH6 A;  1AOI B;  3C1C B;  3REL D;  2YFW A;  4JJN A;  3WAA C;  3LZ1 A;  3WKJ D;  3AZH C;  3W96 C;  5B33 B;  1Q9C A;  3O62 D;  1ZLA D;  1EQZ C;  3B0C T;  5DNN D;  5AV6 C;  2BYK B;  1N1J A;  4XZQ A;  1P3I B;  1M18 B;  2PYO D;  3MGS D;  3REI A;  4LD9 A;  3C1C C;  3KWQ D;  5CP6 C;  1KX3 B;  3X1S B;  3AZM A;  3LJA D;  5AV5 B;  1P34 B;  5KDM B;  3REL B;  4G91 C;  5G49 A;  3REH B;  5B33 C;  2NZD A;  3AZE D;  3AV2 A;  5CPI A;  2FJ7 D;  3O62 B;  4KGC B;  1TZY C;  2HIO D;  4QLC A;  5DNN B;  1P3I C;  4AWL B;  2PYO B;  5B1M B;  3KWQ B;  4Z66 D;  4E45 A;  3REL C;  3LJA B;  4Z5T D;  3WKJ C;  3X1V A;  1HTA A;  1S32 B;  3AZE B;  2NQB D;  3O62 C;  1ZLA C;  2FJ7 B;  5DNN C;  3REJ D;  2HIO B;  4J8U D;  4AWL C;  3WAA A;  4UUZ A;  2PYO C;  3MGS C;  3AZH A;  3W96 A;  4J8X D;  5AV9 A;  3KWQ C;  2RVQ D;  1EQZ A;  4YS3 D;  4Z66 B;  5AV6 A;  3LJA C;  5AV8 B;  5B24 B;  3KUY D;  4Z5T B;  3WA9 B;  3AZE C;  3C1C A;  2FJ7 C;  2NQB B;  1M1A B;  5B2I D;  1JFI B;  3X1T D;  2HIO C;  1H3O B;  4J8U B;  5B33 A;  3AZF D;  5CHL B;  1P3P D;  4J8X B;  3UT9 D;  5JRG B;  1ID3 D;  4Z66 C;  2ARO D;  1TZY A;  5C3I B;  2BYK A;  3KUY B;  1P3I A;  4Z5T C;  5B40 D;  3B0D B;  3B6G D;  2NQB C;  1A7W A;  3REK D;  4WU9 B;  5KDM A;  3REL A;  3REJ C;  3X1T B;  4J8U C;  3WKJ A;  5F99 D;  1HQ3 C;  5GT3 B;  4J8X C;  3O62 A;  3UTB B;  3AZF B;  1ZLA A;  2RVQ C;  3B0C W;  3UT9 B;  1KU5 A;  4R8P D;  5DNN A;  4YS3 C;  3AZI D;  1R4V A;  3KUY C;  1ID3 B;  2PYO A;  3MGS A;  3B0D C;  3NQJ A;  5B1M A;  3B6G B;  3KWQ A;  4H9S C;  5B2I C;  5FUG B;  3LJA A;  4J8V B;  3REK B;  3X1T C;  1B6W A;  1P3F B;  3AZE A;  3AZF C;  2L5A A;  5F99 B;  1P3P C;  2FJ7 A;  3UT9 C;  1ID3 C;  1P3L D;  2ARO C;  2F8N H;  4R8P B;  2HIO A;  5B40 C;  4KHA B;  3REK C;  4Z66 A;  4Z5T A;  3AZG B;  5F99 C;  2NQB A;  5DNM D;  4R8P C;  1JFI A;  3AZI C;  1P3L B;  1P3M D;  1B67 A;  1H3O A;  3REJ A;  4J8U A;  2CWE A;  4J8X A;  3VH6 T;  3R45 A;  5AV9 D;  3MNN D;  4E44 A;  3KUY A;  4DRA A;  5BS7 A;  4KUD D;  4X23 D;  1P3A D;  4H9S A;  1AOI D;  4WU9 A;  2F8N D;  5B2I A;  1P3L C;  1TAF B;  3X1T A;  5BT1 D;  3AZF A;  3UTB A;  4WZS B;  1P3P A;  3LEL D;  3UT9 A;  3AN2 D;  1ID3 A;  2ARO A;  3MNN B;  1WWI A;  4YM6 D;  1M18 D;  4ZBJ B;  3B6G A;  4KUD B;  4X23 B;  5DNM C;  5FUG A;  3REK A;  1KX3 D;  3X1S D;  2F8N B;  1P3M C;  5AV5 D;  1P34 D;  3REH D;  5F99 A;  3AV1 B;  3LEL B;  4R8P A;  3AN2 B;  5AV9 C;  3MNN C;  3AZI A;  4KGC D;  5GXQ B;  5BNV B;  4KUD C;  4YM6 B;  4X23 C;  1P3A C;  5B1M D;  3UTA B;  1AOI C;  3AZG A;  5B32 D;  1P3B D;  5BT1 C;  1KX5 B;  1S32 D;  3LEL C;  3AN2 C;  3W97 B;  1P3L A;  3LZ0 D;  1P3G B;  1ULY A;  5CPJ D;  4YM6 C;  1M18 C;  2JSS A;  4J8W D;  4H9Q B;  1KX3 C;  3X1S C;  1P3O B;  5AV5 C;  5AV8 D;  5B24 D;  1P34 C;  5B32 B;  3REH C;  1P3B B;  3C1B B;  3WA9 D;  3AFA D;  5DNM A;  4H9O B;  1M1A D;  4KGC C;  1P3M A;  3LZ0 B;  5B0Y D;  5CPJ B;  3VH6 W;  5B1M C;  4J8W B;  5JRG D;  3MNN A;  2HUE B;  3B6F B;  5B32 C;  1P3B C;  4KUD A;  4X23 A;  1S32 C;  3WTP D;  1P3A A;  3AFA B;  3TU4 D;  1AOI A;  2F8N A;  4WU9 D;  3LZ0 C;  5BNX B;  4H9P B;  5B0Y B;  5GT3 D;  3LEL A;  2BYM B;  4J8W C;  3UTB D;  3AN2 A;  2HUE C;  5AV8 C;  5BNV A;  5B24 C;  4YM6 A;  1M18 A;  2YFV B;  3WA9 C;  3AFA C;  3WTP B;  3TU4 B;  1KX3 A;  1M1A C;  4CSR B;  3X1S A;  5AV5 A;  4J8V D;  1P34 A;  1KX5 A;  5B0Y C;  1P3F D;  3REH A;  5E5A D;  3AZJ D;  5JRG C;  4KGC A;  4Z2M H;  4EO5 B;  5C3I C;  5B31 B;  2F8N G;  4WNN B;  5BS7 C;  3WTP C;  4H9Q A;  5AVB D;  3TU4 C;  4H9N B;  4WU9 C;  5B32 A;  1P3K D;  3AZG D;  1P3B A;  1S32 A;  5GT3 C;  3X1U D;  5E5A B;  4H9O A;  3AYW D;  3UTB C;  3AZJ B;  4HGA B;  3LZ0 A;  5CPJ A;  4NFT A;  3W99 D;  3MVD B;  4J8W A;  3B6G C;  5AVB B;  4J8V C;  5AV8 A;  5B24 A;  4G92 B;  1P3K B;  1P3F C;  3AZK B;  1F66 B;  3WA9 A;  3AFA A;  5E5A C;  3AZJ C;  3X1U B;  4NE6 A;  3AYW B;  4HGA C;  3VH5 A;  4XUJ D;  1M1A A;  4H9P A;  5B0Y A;  2BYM A;  3W99 B;  5AVB C; 
#chains in the Genus database with same CATH topology
 5B32 G;  5JRG A;  4G92 C;  1P3K C;  3AZG C;  2YFV A;  3WTP A;  3X1U C;  3MGP D;  3TU4 A;  4XZQ B;  4CSR A;  4H9R B;  1KX4 D;  3AZL D;  4LD9 B;  4XUJ B;  5GSU D;  3AZM B;  3H0M C;  3W99 C;  5GT3 A;  3AV1 D;  3AV2 B;  5GXQ D;  1WWS A;  4WNN A;  3MGR D;  5AY8 D;  5B0Z B;  3MGP B;  3UTA D;  1KX4 B;  4H9N A;  4XUJ C;  3AZL B;  2G5H C;  4J8V A;  2VQR A;  5GSU B;  1P3F A;  1KX5 D;  5E5A A;  3AZJ A;  5BO0 B;  3KSY A;  3X1V B;  3W97 D;  5JA4 B;  1F1E A;  5CP6 D;  1P3G D;  5CPK D;  4KHA A;  1PZR A;  2BG1 A;  4ZBJ C;  5AY8 B;  3MGR B;  5AVB A;  3MGP C;  3WAA B;  1KX4 C;  3AZL C;  3AZH B;  1P3O D;  3A1K A;  5GSU C;  1P3K A;  1EQZ B;  3NQU B;  4WU8 D;  5AV6 B;  5B1L D;  3C1B D;  3X1U A;  3AYW A;  5B31 G;  3AV1 C;  5GXQ C;  5CP6 B;  4CAY B;  2Y2K A;  3MGR C;  5AY8 C;  5CPK B;  3W99 A;  4G91 B;  3UTA C;  3B6F D;  1TZY B;  2JE5 A;  4WU8 B;  1KX5 C;  3AZN D;  5B1L B;  4H9R A;  1U35 D;  4XUJ A;  3W97 C;  1TAF A;  1P3G C;  5CPK C;  4DRB A;  1M19 D;  3WKJ B;  1P3O C;  1ZLA B;  5GT0 D;  4WU8 C;  3W98 D;  5B0Z A;  5B1L C;  3C1B C;  3MGP A;  3AZN B;  1KX4 A;  3B0B A;  3MGS B;  3AZL A;  3NQJ B;  1U35 B;  3MGQ D;  2G5I C;  5GSU A;  5CPJ C;  5BO0 A;  3AV1 A;  1M19 B;  5JA4 A;  3B6F C;  5GXQ A;  5B31 D;  3MGR A;  5AY8 A;  4Z2M G;  5GT0 B;  3W98 B;  3EPL A;  1BH9 B;  3AZN C;  3UTA A;  1HQ3 D;  1U35 C;  2ZY5 A;  4WV4 B;  3NQU A;  3MGQ B;  4ZUX D;  1M19 C;  3W97 A;  5CP6 A;  4CAY A;  1P3G A;  5CPK A;  5GT0 C;  3W98 C;  2DQN C;  3REJ B;  3MVD D;  1BFM A;  3KXB D;  1HQ3 B;  3VH5 T;  3A6N D;  1P3O A;  2ZY4 A;  3MGQ C;  5AVC D;  2CV5 D;  3R45 B;  4WU8 A;  4YS3 B;  3AZK D;  5B1L A;  1F66 D;  3C1B A;  5B2J D;  4ZUX B;  4EO5 C;  5B2I B;  5B31 C;  3V9R B;  2Y2J A;  4NE3 A;  4JJN D;  2F2A C;  4WJ3 C;  2RIQ A;  3LZ1 D;  3KXB B;  1BH8 B;  3B6F A;  3A6N B;  1P3P B;  5AVC B;  2CV5 B;  2ARO B;  3AZN A;  4ZUX C;  5B40 B;  2F8N K;  4XZQ D;  1U35 A;  5B2J B;  3REI D;  4LD9 D;  5BNX A;  4NE5 A;  3AZM D;  4M6B A;  3MVD C;  1M19 A;  2YFW B;  3KXB C;  4JJN B;  3LZ1 B;  3A6N C;  2NZD D;  5CPI D;  3AV2 D;  5AVC C;  2CV5 C;  5GT0 A;  3AZI B;  3W98 A;  2IO5 B;  1BH9 A;  3AZK C;  1F66 C;  4QLC D;  5B0Z D;  5B2J C;  1N1J B;  3AYW C;  3KFU G;  3WTP E;  3REI B;  3MGQ A;  4JJN C;  3LZ1 C;  3X1V D;  5G49 B;  2NZD B;  2XD1 A;  5CPI B;  2IO5 C;  5B31 A;  4QLC B;  2LY8 A;  3WAA D;  1HQ3 A;  4XZQ C;  3REI C;  3AZH D;  3W96 D;  4LD9 C;  4YS3 A;  1EQZ D;  3AZM C;  5AV6 D;  4ZUX A;  2NZD C;  5CPI C;  3AV2 C;  3C1C D;  5DNM B;  3V9R A;  2Y2H A;  1P3M B;  4QLC C;  3MVD A;  5B0Z C;  3KXB A;  1BH8 A;  3VH5 W;  4UUZ B;  5B33 D;  3A6N A;  3W96 B;  5AVC A;  2CV5 A;  5AV9 B;  1TZY D;  3AZK A;  1F66 A;  5B40 A;  1P3I D;  5B2J A;  3EPK A;  3X1V C;  2J8P A;  1P3A B;  3VH6 A;  1AOI B;  3C1C B;  3REL D;  2YFW A;  4JJN A;  3WAA C;  3LZ1 A;  3WKJ D;  3AZH C;  3W96 C;  5B33 B;  2Y2N A;  1Q9C A;  3O62 D;  1ZLA D;  1EQZ C;  3B0C T;  3P5J B;  5DNN D;  5AV6 C;  2BYK B;  1N1J A;  4XZQ A;  1P3I B;  1M18 B;  2PYO D;  3MGS D;  3REI A;  4LD9 A;  3C1C C;  3KWQ D;  5CP6 C;  1KX3 B;  3X1S B;  3AZM A;  3LJA D;  5AV5 B;  1P34 B;  5KDM B;  3REL B;  4G91 C;  5G49 A;  3REH B;  5B33 C;  2NZD A;  2Y2I A;  3AZE D;  3AV2 A;  5CPI A;  2FJ7 D;  3O62 B;  4KGC B;  1TZY C;  5DNN B;  2HIO D;  2Y2Q A;  4QLC A;  1P3I C;  4AWL B;  2PYO B;  5B1M B;  3KWQ B;  4Z66 D;  4E45 A;  3REL C;  3LJA B;  2UWX A;  4Z5T D;  3WKJ C;  3X1V A;  1HTA A;  1S32 B;  3EG5 B;  3AZE B;  3O62 C;  1ZLA C;  2NQB D;  2FJ7 B;  5DNN C;  2Y2P A;  3REJ D;  2HIO B;  4J8U D;  4AWL C;  3WAA A;  4UUZ A;  2PYO C;  3MGS C;  3AZH A;  3W96 A;  4J8X D;  5AV9 A;  3KWQ C;  2RVQ D;  1EQZ A;  2XD5 A;  4Z66 B;  5AV6 A;  4YS3 D;  5AV8 B;  5B24 B;  3LJA C;  3KUY D;  4Z5T B;  1T3U A;  3WA9 B;  3AZE C;  3C1C A;  2FJ7 C;  2NQB B;  1M1A B;  5B2I D;  1JFI B;  3X1T D;  2HIO C;  1H3O B;  4J8U B;  5B33 A;  3AZF D;  5CHL B;  1P3P D;  4J8X B;  3UT9 D;  5JRG B;  1ID3 D;  4Z66 C;  2ARO D;  1TZY A;  5C3I B;  2BYK A;  3KUY B;  1P3I A;  4Z5T C;  5B40 D;  3B0D B;  3B6G D;  2NQB C;  1A7W A;  3REK D;  4WU9 B;  5KDM A;  3REL A;  3REJ C;  3X1T B;  4J8U C;  3WKJ A;  5F99 D;  1HQ3 C;  5GT3 B;  4J8X C;  3O62 A;  3UTB B;  3AZF B;  1ZLA A;  2RVQ C;  3B0C W;  3UT9 B;  1KU5 A;  2ZY3 A;  5DNN A;  4YS3 C;  4R8P D;  1R4V A;  3KUY C;  3AZI D;  1ID3 B;  2PYO A;  3MGS A;  3B0D C;  3NQJ A;  5B1M A;  3H0R C;  3B6G B;  3KWQ A;  4H9S C;  5B2I C;  3H0L C;  5FUG B;  3LJA A;  4J8V B;  3REK B;  3X1T C;  1B6W A;  1P3F B;  3AZE A;  3AZF C;  2L5A A;  5F99 B;  2Y2M A;  1P3P C;  2FJ7 A;  3UT9 C;  1ID3 C;  1P3L D;  2ARO C;  2F8N H;  4R8P B;  2HIO A;  5B40 C;  4KHA B;  3REK C;  4Z66 A;  4Z5T A;  3AZG B;  5F99 C;  2NQB A;  5DNM D;  4R8P C;  1JFI A;  3AZI C;  1P3L B;  1P3M D;  1B67 A;  1H3O A;  3REJ A;  4J8U A;  2CWE A;  3FDD A;  4J8X A;  3VH6 T;  3R45 A;  5AV9 D;  3MNN D;  4E44 A;  3KUY A;  4DRA A;  2W8S A;  5BS7 A;  4KUD D;  4X23 D;  1P3A D;  4H9S A;  1AOI D;  4WU9 A;  2F8N D;  5B2I A;  1P3L C;  1TAF B;  3X1T A;  3A1I A;  5BT1 D;  3AZF A;  3UTB A;  4WZS B;  1P3P A;  3LEL D;  3UT9 A;  3AN2 D;  1ID3 A;  2ARO A;  3MNN B;  1WWI A;  4YM6 D;  1M18 D;  4ZBJ B;  3B6G A;  1W2E A;  4KUD B;  4X23 B;  5DNM C;  5FUG A;  3REK A;  1KX3 D;  3X1S D;  2F8N B;  1P3M C;  5AV5 D;  1P34 D;  3REH D;  5F99 A;  4UPK A;  3LEL B;  3AV1 B;  4R8P A;  3AN2 B;  5AV9 C;  3MNN C;  3AZI A;  4KGC D;  5GXQ B;  4DQY B;  2Y2L A;  5BNV B;  4KUD C;  2ZM5 A;  4YM6 B;  4X23 C;  1P3A C;  5B1M D;  3UTA B;  1AOI C;  1Z2C B;  3AZG A;  5B32 D;  1P3B D;  5BT1 C;  1KX5 B;  1S32 D;  3LEL C;  3AN2 C;  3W97 B;  1P3L A;  3LZ0 D;  1P3G B;  1ULY A;  5CPJ D;  4YM6 C;  1M18 C;  2JSS A;  4J8W D;  4H9Q B;  1KX3 C;  3X1S C;  1P3O B;  5AV5 C;  5AV8 D;  5B24 D;  1P34 C;  5B32 B;  3REH C;  1P3B B;  3C1B B;  3WA9 D;  3AFA D;  5DNM A;  4H9O B;  1M1A D;  4KGC C;  1P3M A;  3IP4 C;  3LZ0 B;  5B0Y D;  3AL0 C;  5CPJ B;  3VH6 W;  5B1M C;  4J8W B;  5JRG D;  3MNN A;  2HUE B;  2DF4 C;  3B6F B;  2Y2G A;  5B32 C;  3EPH A;  1P3B C;  4KUD A;  4X23 A;  1S32 C;  3WTP D;  1P3A A;  3AFA B;  3TU4 D;  1AOI A;  2F8N A;  4WU9 D;  3LZ0 C;  5BNX B;  4H9P B;  3F6T A;  5B0Y B;  5GT3 D;  3LEL A;  2BYM B;  4J8W C;  3UTB D;  3AN2 A;  2HUE C;  5AV8 C;  5BNV A;  5B24 C;  4YM6 A;  1M18 A;  2JCH A;  2YFV B;  3WA9 C;  3AFA C;  3WTP B;  3TU4 B;  1KX3 A;  3EPJ A;  4CSR B;  3X1S A;  1M1A C;  5AV5 A;  4J8V D;  1P34 A;  1KX5 A;  5B0Y C;  1P3F D;  3REH A;  5E5A D;  3AZJ D;  5JRG C;  4KGC A;  4Z2M H;  4EO5 B;  5C3I C;  5B31 B;  2F8N G;  4WNN B;  5BS7 C;  3WTP C;  4H9Q A;  5AVB D;  3TU4 C;  4H9N B;  4WU9 C;  2ZY2 A;  5B32 A;  1P3K D;  3AZG D;  1P3B A;  1S32 A;  5GT3 C;  3X1U D;  5E5A B;  4H9O A;  3AYW D;  3UTB C;  3AZJ B;  4HGA B;  3LZ0 A;  5CPJ A;  4NFT A;  3W99 D;  3MVD B;  4J8W A;  3B6G C;  5AVB B;  4J8V C;  5AV8 A;  5B24 A;  4G92 B;  1P3K B;  1P3F C;  3AZK B;  1F66 B;  3WA9 A;  3AFA A;  5E5A C;  3AZJ C;  3X1U B;  4NE6 A;  3AYW B;  4HGA C;  3VH5 A;  4XUJ D;  1M1A A;  2Y2O A;  2FFF B;  4H9P A;  5B0Y A;  2BYM A;  3W99 B;  5AVB C; 
#chains in the Genus database with same CATH homology
 5B32 G;  5JRG A;  4G92 C;  1P3K C;  3AZG C;  2YFV A;  3WTP A;  3X1U C;  3MGP D;  3TU4 A;  4XZQ B;  4CSR A;  4H9R B;  1KX4 D;  3AZL D;  4LD9 B;  4XUJ B;  5GSU D;  3AZM B;  3H0M C;  3W99 C;  5GT3 A;  3AV1 D;  3AV2 B;  5GXQ D;  1WWS A;  4WNN A;  3MGR D;  5AY8 D;  5B0Z B;  3MGP B;  3UTA D;  1KX4 B;  4H9N A;  4XUJ C;  3AZL B;  2G5H C;  4J8V A;  2VQR A;  5GSU B;  1P3F A;  1KX5 D;  5E5A A;  3AZJ A;  5BO0 B;  3KSY A;  3X1V B;  3W97 D;  5JA4 B;  1F1E A;  5CP6 D;  1P3G D;  5CPK D;  4KHA A;  1PZR A;  2BG1 A;  4ZBJ C;  5AY8 B;  3MGR B;  5AVB A;  3MGP C;  3WAA B;  1KX4 C;  3AZL C;  3AZH B;  1P3O D;  3A1K A;  5GSU C;  1P3K A;  1EQZ B;  3NQU B;  4WU8 D;  5AV6 B;  5B1L D;  3C1B D;  3X1U A;  3AYW A;  5B31 G;  3AV1 C;  5GXQ C;  5CP6 B;  4CAY B;  2Y2K A;  3MGR C;  5AY8 C;  5CPK B;  3W99 A;  4G91 B;  3UTA C;  3B6F D;  1TZY B;  2JE5 A;  4WU8 B;  1KX5 C;  3AZN D;  5B1L B;  4H9R A;  1U35 D;  4XUJ A;  3W97 C;  1TAF A;  1P3G C;  5CPK C;  4DRB A;  1M19 D;  3WKJ B;  1P3O C;  1ZLA B;  5GT0 D;  4WU8 C;  3W98 D;  5B0Z A;  5B1L C;  3C1B C;  3MGP A;  3AZN B;  1KX4 A;  3B0B A;  3MGS B;  3AZL A;  3NQJ B;  1U35 B;  3MGQ D;  2G5I C;  5GSU A;  5CPJ C;  5BO0 A;  3AV1 A;  1M19 B;  5JA4 A;  3B6F C;  5GXQ A;  5B31 D;  3MGR A;  5AY8 A;  4Z2M G;  5GT0 B;  3W98 B;  3EPL A;  1BH9 B;  3AZN C;  3UTA A;  1HQ3 D;  1U35 C;  2ZY5 A;  4WV4 B;  3NQU A;  3MGQ B;  4ZUX D;  1M19 C;  3W97 A;  5CP6 A;  4CAY A;  1P3G A;  5CPK A;  5GT0 C;  3W98 C;  2DQN C;  3REJ B;  3MVD D;  1BFM A;  3KXB D;  1HQ3 B;  3VH5 T;  3A6N D;  1P3O A;  2ZY4 A;  3MGQ C;  5AVC D;  2CV5 D;  3R45 B;  4WU8 A;  4YS3 B;  3AZK D;  5B1L A;  1F66 D;  3C1B A;  5B2J D;  4ZUX B;  4EO5 C;  5B2I B;  5B31 C;  3V9R B;  2Y2J A;  4NE3 A;  4JJN D;  2F2A C;  4WJ3 C;  2RIQ A;  3LZ1 D;  3KXB B;  1BH8 B;  3B6F A;  3A6N B;  1P3P B;  5AVC B;  2CV5 B;  2ARO B;  3AZN A;  4ZUX C;  5B40 B;  2F8N K;  4XZQ D;  1U35 A;  5B2J B;  3REI D;  4LD9 D;  5BNX A;  4NE5 A;  3AZM D;  4M6B A;  3MVD C;  1M19 A;  2YFW B;  3KXB C;  4JJN B;  3LZ1 B;  3A6N C;  2NZD D;  5CPI D;  3AV2 D;  5AVC C;  2CV5 C;  5GT0 A;  3AZI B;  3W98 A;  2IO5 B;  1BH9 A;  3AZK C;  1F66 C;  4QLC D;  5B0Z D;  5B2J C;  1N1J B;  3AYW C;  3KFU G;  3WTP E;  3REI B;  3MGQ A;  4JJN C;  3LZ1 C;  3X1V D;  5G49 B;  2NZD B;  2XD1 A;  5CPI B;  2IO5 C;  5B31 A;  4QLC B;  2LY8 A;  3WAA D;  1HQ3 A;  4XZQ C;  3REI C;  3AZH D;  3W96 D;  4LD9 C;  4YS3 A;  1EQZ D;  3AZM C;  5AV6 D;  4ZUX A;  2NZD C;  5CPI C;  3AV2 C;  3C1C D;  5DNM B;  3V9R A;  2Y2H A;  1P3M B;  4QLC C;  3MVD A;  5B0Z C;  3KXB A;  1BH8 A;  3VH5 W;  4UUZ B;  5B33 D;  3A6N A;  3W96 B;  5AVC A;  2CV5 A;  5AV9 B;  1TZY D;  3AZK A;  1F66 A;  5B40 A;  1P3I D;  5B2J A;  3EPK A;  3X1V C;  2J8P A;  1P3A B;  3VH6 A;  1AOI B;  3C1C B;  3REL D;  2YFW A;  4JJN A;  3WAA C;  3LZ1 A;  3WKJ D;  3AZH C;  3W96 C;  5B33 B;  2Y2N A;  1Q9C A;  3O62 D;  1ZLA D;  1EQZ C;  3B0C T;  3P5J B;  5DNN D;  5AV6 C;  2BYK B;  1N1J A;  4XZQ A;  1P3I B;  1M18 B;  2PYO D;  3MGS D;  3REI A;  4LD9 A;  3C1C C;  3KWQ D;  5CP6 C;  1KX3 B;  3X1S B;  3AZM A;  3LJA D;  5AV5 B;  1P34 B;  5KDM B;  3REL B;  4G91 C;  5G49 A;  3REH B;  5B33 C;  2NZD A;  2Y2I A;  3AZE D;  3AV2 A;  5CPI A;  2FJ7 D;  3O62 B;  4KGC B;  1TZY C;  5DNN B;  2HIO D;  2Y2Q A;  4QLC A;  1P3I C;  4AWL B;  2PYO B;  5B1M B;  3KWQ B;  4Z66 D;  4E45 A;  3REL C;  3LJA B;  2UWX A;  4Z5T D;  3WKJ C;  3X1V A;  1HTA A;  1S32 B;  3EG5 B;  3AZE B;  3O62 C;  1ZLA C;  2NQB D;  2FJ7 B;  5DNN C;  2Y2P A;  3REJ D;  2HIO B;  4J8U D;  4AWL C;  3WAA A;  4UUZ A;  2PYO C;  3MGS C;  3AZH A;  3W96 A;  4J8X D;  5AV9 A;  3KWQ C;  2RVQ D;  1EQZ A;  2XD5 A;  4Z66 B;  5AV6 A;  4YS3 D;  5AV8 B;  5B24 B;  3LJA C;  3KUY D;  4Z5T B;  1T3U A;  3WA9 B;  3AZE C;  3C1C A;  2FJ7 C;  2NQB B;  1M1A B;  5B2I D;  1JFI B;  3X1T D;  2HIO C;  1H3O B;  4J8U B;  5B33 A;  3AZF D;  5CHL B;  1P3P D;  4J8X B;  3UT9 D;  5JRG B;  1ID3 D;  4Z66 C;  2ARO D;  1TZY A;  5C3I B;  2BYK A;  3KUY B;  1P3I A;  4Z5T C;  5B40 D;  3B0D B;  3B6G D;  2NQB C;  1A7W A;  3REK D;  4WU9 B;  5KDM A;  3REL A;  3REJ C;  3X1T B;  4J8U C;  3WKJ A;  5F99 D;  1HQ3 C;  5GT3 B;  4J8X C;  3O62 A;  3UTB B;  3AZF B;  1ZLA A;  2RVQ C;  3B0C W;  3UT9 B;  1KU5 A;  2ZY3 A;  5DNN A;  4YS3 C;  4R8P D;  1R4V A;  3KUY C;  3AZI D;  1ID3 B;  2PYO A;  3MGS A;  3B0D C;  3NQJ A;  5B1M A;  3H0R C;  3B6G B;  3KWQ A;  4H9S C;  5B2I C;  3H0L C;  5FUG B;  3LJA A;  4J8V B;  3REK B;  3X1T C;  1B6W A;  1P3F B;  3AZE A;  3AZF C;  2L5A A;  5F99 B;  2Y2M A;  1P3P C;  2FJ7 A;  3UT9 C;  1ID3 C;  1P3L D;  2ARO C;  2F8N H;  4R8P B;  2HIO A;  5B40 C;  4KHA B;  3REK C;  4Z66 A;  4Z5T A;  3AZG B;  5F99 C;  2NQB A;  5DNM D;  4R8P C;  1JFI A;  3AZI C;  1P3L B;  1P3M D;  1B67 A;  1H3O A;  3REJ A;  4J8U A;  2CWE A;  3FDD A;  4J8X A;  3VH6 T;  3R45 A;  5AV9 D;  3MNN D;  4E44 A;  3KUY A;  4DRA A;  2W8S A;  5BS7 A;  4KUD D;  4X23 D;  1P3A D;  4H9S A;  1AOI D;  4WU9 A;  2F8N D;  5B2I A;  1P3L C;  1TAF B;  3X1T A;  3A1I A;  5BT1 D;  3AZF A;  3UTB A;  4WZS B;  1P3P A;  3LEL D;  3UT9 A;  3AN2 D;  1ID3 A;  2ARO A;  3MNN B;  1WWI A;  4YM6 D;  1M18 D;  4ZBJ B;  3B6G A;  1W2E A;  4KUD B;  4X23 B;  5DNM C;  5FUG A;  3REK A;  1KX3 D;  3X1S D;  2F8N B;  1P3M C;  5AV5 D;  1P34 D;  3REH D;  5F99 A;  4UPK A;  3LEL B;  3AV1 B;  4R8P A;  3AN2 B;  5AV9 C;  3MNN C;  3AZI A;  4KGC D;  5GXQ B;  4DQY B;  2Y2L A;  5BNV B;  4KUD C;  2ZM5 A;  4YM6 B;  4X23 C;  1P3A C;  5B1M D;  3UTA B;  1AOI C;  1Z2C B;  3AZG A;  5B32 D;  1P3B D;  5BT1 C;  1KX5 B;  1S32 D;  3LEL C;  3AN2 C;  3W97 B;  1P3L A;  3LZ0 D;  1P3G B;  1ULY A;  5CPJ D;  4YM6 C;  1M18 C;  2JSS A;  4J8W D;  4H9Q B;  1KX3 C;  3X1S C;  1P3O B;  5AV5 C;  5AV8 D;  5B24 D;  1P34 C;  5B32 B;  3REH C;  1P3B B;  3C1B B;  3WA9 D;  3AFA D;  5DNM A;  4H9O B;  1M1A D;  4KGC C;  1P3M A;  3IP4 C;  3LZ0 B;  5B0Y D;  3AL0 C;  5CPJ B;  3VH6 W;  5B1M C;  4J8W B;  5JRG D;  3MNN A;  2HUE B;  2DF4 C;  3B6F B;  2Y2G A;  5B32 C;  3EPH A;  1P3B C;  4KUD A;  4X23 A;  1S32 C;  3WTP D;  1P3A A;  3AFA B;  3TU4 D;  1AOI A;  2F8N A;  4WU9 D;  3LZ0 C;  5BNX B;  4H9P B;  3F6T A;  5B0Y B;  5GT3 D;  3LEL A;  2BYM B;  4J8W C;  3UTB D;  3AN2 A;  2HUE C;  5AV8 C;  5BNV A;  5B24 C;  4YM6 A;  1M18 A;  2JCH A;  2YFV B;  3WA9 C;  3AFA C;  3WTP B;  3TU4 B;  1KX3 A;  3EPJ A;  4CSR B;  3X1S A;  1M1A C;  5AV5 A;  4J8V D;  1P34 A;  1KX5 A;  5B0Y C;  1P3F D;  3REH A;  5E5A D;  3AZJ D;  5JRG C;  4KGC A;  4Z2M H;  4EO5 B;  5C3I C;  5B31 B;  2F8N G;  4WNN B;  5BS7 C;  3WTP C;  4H9Q A;  5AVB D;  3TU4 C;  4H9N B;  4WU9 C;  2ZY2 A;  5B32 A;  1P3K D;  3AZG D;  1P3B A;  1S32 A;  5GT3 C;  3X1U D;  5E5A B;  4H9O A;  3AYW D;  3UTB C;  3AZJ B;  4HGA B;  3LZ0 A;  5CPJ A;  4NFT A;  3W99 D;  3MVD B;  4J8W A;  3B6G C;  5AVB B;  4J8V C;  5AV8 A;  5B24 A;  4G92 B;  1P3K B;  1P3F C;  3AZK B;  1F66 B;  3WA9 A;  3AFA A;  5E5A C;  3AZJ C;  3X1U B;  4NE6 A;  3AYW B;  4HGA C;  3VH5 A;  4XUJ D;  1M1A A;  2Y2O A;  2FFF B;  4H9P A;  5B0Y A;  2BYM A;  3W99 B;  5AVB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...