3UTBD

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbD00
3X1TB 3V9RA 4H9NA 1EQZD 3LJAC 3MGRD 4H9OB 5AVBD 4R8PB 2PYOA 5CPIC 5B2ID 4XZQA 3B6GB 1N1JB 5DNND 4Z66A 5AY8B 3X1TD 3MVDC 3X1VA 1JFIB 5AV5C 1P3LC 3X1SA 3KUYC 1TZYC 3AN2B 1ULYA 5CP6B 4R8PD 5FUGA 4KGCA 4HGAB 5BS7A 4E45A 3B6GD 2HUEC 5BO0B 2YFWB 4UUZA 5AY8D 5AVCC 4Z5TC 3AYWA 3WTPA 3WA9A 3AN2D 3AZNA 1M1AC 1KX4B 5CP6D 2NQBC 5CPKC 5F99B 1ZLAA 3A6NA 5DNMA 3UTBA 1BH8B 1P34B 1P3OB 3AV2D 3REKB 4H9PB 1F66B 3KWQC 4EO5B 1KX4D 3B6FB 5C3IC 5F99D 4NE5A 5B2JA 3AZMC 3RELB 4WU9C 1S32C 1P34D 1P3OD 5BNVA 3W97B 3UTAC 1F66D 3AZHC 1HTAA 4KUDC 1HQ3C 2FJ7B 5B31B 3RELD 1H3OA 3LZ1A 2L5AA 4LD9A 4G92C 2NZDA 1P3KA 5AV6A 2CV5A 1M18B 3W97D 1EQZC 3MGRC 3LZ0A 5B40A 3VH5W 5AVBC 1P3IA 3B0CW 4CSRA 1AOIA 5B2IC 2FJ7D 2F8NA 5B31D 5DNNC 1P3LB 3X1TC 3KUYB 1M18D 3AZIC 3C1BA 1P3FA 3WAAA 5AV8B 1B6WA 3AV1B 2RVQD 5B1MA 2HIOB 3B6GC 3NQJA 3TU4A 4J8VA 4JJNB 3AZKA 5E5AA 5JRGA 3KUYD 5AV8D 3W98A 1P3AA 3AN2C 3VH5A 5CPKB 3AV1D 3MGQA 5BNXA 5CP6C 5CPJB 4HGAC 2HIOD 3LJAA 5BT1D 4JJND 3AV2C 4QLCC 5CPIA 3VH6T 5CPKD 1KX4C 4J8XA 3MVDA 1S32B 5CPJD 3LELB 5AV5A 1A7WA 1TZYA 1KX5A 5JA4B 4X23C 1P34C 1P3OC 3UTAB 4CAYA 4KUDB 1HQ3B 2JSSA 1M19B 1P3BC 5AVCA 4EO5C 4Z2MH 5G49B 4Z5TA 4XUJC 1S32D 3LELD 3RELC 3MNNB 1M1AA 5B1LC 2NQBA 5GT3C 5AVBB 4NFTA 3AFAB 3KXBB 1M19D 1P3GB 2IO5B 2FJ7C 5B31C 3AZIB 3MNND 3AZLC 4YS3B 3KWQA 4WU8B 1KX3B 1M18C 3AZMA 2BYMA 5B0YB 4WU9A 2F8NK 3AFAD 1U35B 3KXBD 1P3GD 2RVQC 4UUZB 3C1CB 3AZID 3AYWB 4YS3D 3AZHA 3WA9B 3R45A 4WU8D 1KX3D 5B32B 5B31G 5AV8C 4H9QA 5B0YD 3AV1C 1U35D 5KDMA 3WKJB 5B24C 2HIOC 1TAFB 1EQZA 3MGRA 3C1CD 3AV2B 5B33B 2YFVA 4QLCB 3AYWD 5BT1C 4JJNC 3WA9D 4G91C 5B32D 3W99A 5B2IA 3REHB 5DNNA 3W96C 3X1TA 3WKJD 1P3PB 4X23B 5CPJC 3UT9B 4H9OA 5B33D 4QLCD 2AROB 4R8PA 5B0ZC 1P3BB 1N1JA 3REHD 4XUJB 5AY8A 5GXQB 1P3PD 4LD9B 5B1LB 4X23D 5GT3B 3O62A 3LELC 1JFIA 3UT9D 3AN2A 2AROD 5CP6A 3AZGC 1P3BD 5BO0A 1ID3B 4XUJD 2YFWA 1M19C 4J8WB 4NE6A 3NQUB 5GXQD 3AZLB 4LD9D 1WWSA 5B1LD 5GT3D 5AV6D 3B0BA 3MNNC 4WNNB 1KX4A 4M6BA 3REIB 3AZJA 5F99A 4ZUXB 1ID3D 3AFAC 2PYOC 1BH8A 2BYKB 3KXBC 1P34A 1P3OA 4J8WD 1P3GC 1R4VA 2IO5C 5AV9B 3AZLD 4Z66C 3AZFB 3REKA 4H9PA 4YS3C 1F66A 1WWIA 3MGPB 4WU8C 1KX3C 3B6FA 3REID 4ZUXD 3KSYA 5B0YC 3RELA 5B24B 1U35C 4DRBA 5BS7C 4H9RB 5AV9D 3W97A 3AZKD 4G91B 3AZFD 4YM6B 3C1CC 3REJB 3AYWC 4KHAB 3MGPD 3WA9C 3W96B 5B32C 3B0DB 5GT0B 2FJ7A 5B31A 5B24D 3A6NC 1KU5A 3WKJC 1M18A 3AZEB 5B0ZB 4YM6D 3REJD 5B33C 1P3MB 5GSUB 3W96D 5GT0D 4J8XD 3REHC 4J8UB 5B32G 1P3LA 3KUYA 1P3PC 3AZED 3AZGB 5AV8A 1BH9B 5B0ZD 3UT9C 1P3MD 3AV1A 3MGSB 2AROC 5GSUD 3X1UB 2HIOA 2CWEA 4J8UD 3V9RB 4H9SC 4JJNA 4H9NB 5GXQC 4LD9C 3AZGD 1P3KC 5AV6C 5CPKA 3MGSD 1Q9CA 2BYMB 2PYOB 5CPJA 4XZQB 3X1UD 4Z66B 1ID3C 4J8WC 3X1VB 4AWLC 3X1SB 5FUGB 3REIC 2PYOD 4KGCB 1S32A 4XZQD 3LELA 4ZUXC 4Z66D 3UTAA 5AV9C 3X1VD 4NE3A 3WTPB 3VH6W 3TU4C 4J8VC 3AZKC 3X1SD 4KUDA 1HQ3A 5JRGC 3AZFC 3AZNB 1M19A 3WTPE 3MGPC 1P3AC 5G49A 4KGCD 1ZLAB 3A6NB 5DNMB 3UTBB 3MNNA 4WV4B 5AVBA 3WTPD 3W99D 4YM6C 3AFAA 3REJC 3AZND 3KXBA 1P3GA 5B2JB 3B0DC 3A6ND 1ZLAD 5GT0C 5DNMD 4J8XC 3AZIA 3UTBD 4YS3A 3O62B 5BNVB 4WU8A 1KX3A 1KX5C 3VH6A 3AZEC 5B0YA 1P3MC 1U35A 3VH5T 3B6GA 5GSUC 3B0CT 5B2JD 4ZBJB 3C1CA 1H3OB 1BFMA 3LZ1B 3O62D 4J8UC 2NZDB 1P3KB 5AV6B 2CV5B 5B32A 3LZ0B 5B40B 3AZJB 1P3IB 3MGSC 4CSRB 3WKJA 1AOIB 2F8NB 3X1UC 1TAFA 3AV2A 5B33A 3LZ1D 4QLCA 4AWLB 2NZDD 1P3KD 2CV5D 3C1BB 1P3FB 3WAAB 3LZ0D 5B40D 3REHA 3AZJD 1P3ID 1P3PA 1AOID 5B1MB 4X23A 4XZQC 2F8ND 3NQJB 3UT9A 3TU4B 4J8VB 2AROA 3AZKB 5E5AB 5JRGB 3REKD 3C1BD 3X1VC 1P3FD 1P3BA 3WAAD 3W98B 1B67A 1P3AB 3X1SC 3B6FD 4XUJA 5BNXB 3MGQB 4H9SA 5GXQA 4KGCC 5B1MD 5B1LA 3LJAB 5GT3A 3TU4D 4J8VD 5E5AD 5JRGD 5CPIB 3WTPC 1P3AD 3W98D 3W99C 3AZNC 1ID3A 3MGQD 4J8XB 4J8WA 3MVDB 3NQUA 3AZLA 5AV5B 3LJAD 1ZLAC 1TZYB 5DNMC 1KX5B 3UTBC 4WNNA 3REIA 4CAYB 5CPID 2HUEB 4R8PC 4ZUXA 5AVCB 2BYKA 5CHLB 4Z5TB 3MVDD 5AV9A 5AY8C 5B2JC 5AV5D 1P3LD 1TZYD 3AZFA 1KX5D 1M1AB 2NQBB 3O62C 3MGPA 4DRAA 5B24A 5AVCD 1F1EA 4Z5TD 4H9RA 4ZBJC 4YM6A 3KWQB 3LZ1C 3REJA 4KHAA 1M1AD 2NQBD 2NZDC 2CV5C 5C3IB 3W96A 3AZMB 5GT0A 3LZ0C 4WU9B 5B40C 3AZJC 1P3IC 5F99C 4E44A 1AOIC 3AZEA 5B0ZA 3KWQD 1P3MA 3AZHB 3R45B 3REKC 5GSUA 4WZSB 3C1BC 3WAAC 1P3FC 1F66C 2F8NH 3AZMD 4H9QB 4WU9D 3B6FC 4G92B 4J8UA 5KDMB 5B1MC 5JA4A 1EQZB 3MGRB 3AZGA 1BH9A 3UTAD 2YFVB 3AZHD 3MGSA 3W97C 4KUDD 2LY8A 1HQ3D 5E5AC 2F8NG 3W99B 5B2IB 3X1UA 3W98C 4Z2MG 5DNNB 3MGQC
chains in the Genus database with same CATH superfamily
3X1TB 3V9RA 4H9NA 4DQYB 1EQZD 3LJAC 3MGRD 4H9OB 5AVBD 4R8PB 2PYOA 3EPHA 5B2ID 5CPIC 4XZQA 3B6GB 1N1JB 5DNND 4Z66A 5AY8B 3X1TD 3MVDC 3X1VA 1JFIB 5AV5C 1P3LC 3X1SA 3KUYC 1TZYC 3AN2B 1ULYA 5CP6B 4R8PD 5FUGA 4KGCA 4HGAB 5BS7A 4E45A 3B6GD 2HUEC 5BO0B 2YFWB 4UUZA 5AY8D 5AVCC 4Z5TC 3AYWA 3WTPA 2Y2KA 3WA9A 3AN2D 3AZNA 1M1AC 1KX4B 5CP6D 2NQBC 2BG1A 5CPKC 5F99B 1ZLAA 3A6NA 5DNMA 3UTBA 1BH8B 1P34B 1P3OB 3AV2D 3REKB 4H9PB 3F6TA 1F66B 3KWQC 4EO5B 1KX4D 3B6FB 5C3IC 1W2EA 5F99D 4NE5A 5B2JA 3AZMC 2JCHA 3RELB 4WU9C 1S32C 1P34D 1P3OD 2UWXA 5BNVA 3W97B 3UTAC 1F66D 2ZY3A 3AZHC 1HTAA 4KUDC 1HQ3C 3EPKA 2FJ7B 5B31B 3RELD 1H3OA 3LZ1A 2L5AA 4LD9A 4G92C 2NZDA 1P3KA 5AV6A 2CV5A 1M18B 3W97D 3H0LC 1EQZC 3MGRC 3LZ0A 5B40A 3VH5W 5AVBC 1P3IA 3B0CW 4CSRA 1AOIA 5B2IC 2FJ7D 2F8NA 5B31D 5DNNC 2DF4C 1P3LB 3X1TC 3KUYB 1M18D 3AZIC 3C1BA 1P3FA 3WAAA 5AV8B 1B6WA 3AV1B 2ZY4A 2RVQD 5B1MA 2HIOB 3B6GC 3NQJA 3TU4A 4J8VA 2JE5A 4JJNB 5E5AA 5JRGA 3KUYD 3AZKA 5AV8D 3W98A 1P3AA 3H0MC 3AN2C 3VH5A 5CPKB 3AV1D 3MGQA 5BNXA 5CP6C 5CPJB 4HGAC 2HIOD 3LJAA 5BT1D 4JJND 3AV2C 4QLCC 5CPIA 3VH6T 5CPKD 1KX4C 4J8XA 3MVDA 1S32B 5CPJD 3LELB 5AV5A 1A7WA 1T3UA 1TZYA 1KX5A 5JA4B 2Y2JA 4X23C 1P34C 2Y2QA 3UTAB 1P3OC 4CAYA 4KUDB 1HQ3B 2JSSA 1M19B 1P3BC 5AVCA 4EO5C 4Z2MH 5G49B 4Z5TA 4XUJC 1S32D 3LELD 3RELC 3FDDA 3MNNB 1M1AA 5B1LC 2NQBA 5GT3C 5AVBB 4NFTA 4WJ3C 3AFAB 3KXBB 1M19D 1Z2CB 1P3GB 2IO5B 2FJ7C 5B31C 3AZIB 3MNND 3AZLC 4YS3B 3KWQA 4WU8B 1KX3B 1M18C 3AZMA 2BYMA 5B0YB 4WU9A 2XD1A 3AFAD 2F8NK 1U35B 3KXBD 1P3GD 2RVQC 4UUZB 3C1CB 3AZID 3AYWB 4YS3D 3AZHA 3WA9B 3R45A 4WU8D 1KX3D 5B32B 5B31G 5AV8C 4H9QA 5B0YD 3AV1C 1U35D 5KDMA 1PZRA 3WKJB 2ZY2A 5B24C 2HIOC 1TAFB 1EQZA 3MGRA 3C1CD 3AV2B 5B33B 2YFVA 4QLCB 3AYWD 5BT1C 4JJNC 3WA9D 4G91C 5B32D 3W99A 5B2IA 3REHB 5DNNA 3W96C 3X1TA 3WKJD 1P3PB 4X23B 5CPJC 3UT9B 4H9OA 5B33D 4QLCD 2AROB 2Y2OA 4R8PA 5B0ZC 1P3BB 1N1JA 3REHD 4XUJB 3A1IA 5AY8A 2ZM5A 5GXQB 1P3PD 4LD9B 5B1LB 4X23D 2ZY5A 5GT3B 3O62A 3LELC 1JFIA 3UT9D 3AN2A 2AROD 5CP6A 3AZGC 3EPJA 1P3BD 5BO0A 1ID3B 4XUJD 2YFWA 1M19C 4J8WB 4NE6A 2VQRA 3NQUB 5GXQD 3AZLB 4LD9D 1WWSA 5B1LD 5GT3D 5AV6D 3B0BA 3MNNC 4WNNB 1KX4A 2J8PA 2Y2MA 4M6BA 3REIB 3AZJA 5F99A 4ZUXB 1ID3D 3AFAC 2PYOC 1BH8A 2BYKB 3KXBC 1P34A 1P3OA 4J8WD 1P3GC 1R4VA 2IO5C 5AV9B 3AZLD 4Z66C 3AZFB 3REKA 4H9PA 4YS3C 1F66A 1WWIA 3MGPB 4WU8C 1KX3C 3B6FA 3REID 4ZUXD 3KSYA 5B0YC 3RELA 5B24B 1U35C 4DRBA 5BS7C 4H9RB 5AV9D 3W97A 3AZKD 4G91B 3AZFD 4YM6B 3C1CC 3REJB 3AYWC 4KHAB 3MGPD 3WA9C 3W96B 5B32C 3B0DB 3EG5B 5GT0B 5B31A 2FJ7A 5B24D 2Y2LA 3A6NC 1KU5A 3WKJC 1M18A 3AZEB 5B0ZB 4YM6D 3REJD 5B33C 1P3MB 5GSUB 3W96D 5GT0D 4J8XD 3REHC 4J8UB 5B32G 1P3LA 3KUYA 1P3PC 3AZED 3AZGB 5AV8A 1BH9B 5B0ZD 3UT9C 1P3MD 3AV1A 3MGSB 2AROC 5GSUD 3X1UB 2HIOA 2CWEA 4J8UD 3V9RB 4H9SC 4JJNA 4H9NB 2F2AC 5GXQC 4LD9C 3AZGD 1P3KC 5AV6C 5CPKA 3MGSD 1Q9CA 2BYMB 2PYOB 5CPJA 4XZQB 3X1UD 4Z66B 1ID3C 4J8WC 3X1VB 4AWLC 3X1SB 2RIQA 5FUGB 3REIC 2PYOD 2DQNC 4KGCB 1S32A 4XZQD 3LELA 2Y2HA 4ZUXC 2Y2NA 4Z66D 3UTAA 5AV9C 3X1VD 4NE3A 3WTPB 3VH6W 3TU4C 4J8VC 3AZKC 3X1SD 4KUDA 1HQ3A 5JRGC 3AZFC 3AZNB 1M19A 3WTPE 3MGPC 1P3AC 5G49A 4KGCD 1ZLAB 3A6NB 3EPLA 5DNMB 3UTBB 3MNNA 4WV4B 5AVBA 3WTPD 3AL0C 3W99D 4YM6C 3AFAA 3REJC 3AZND 3KXBA 1P3GA 5B2JB 3B0DC 3A6ND 1ZLAD 5GT0C 5DNMD 4J8XC 3AZIA 3UTBD 4YS3A 3O62B 5BNVB 4WU8A 1KX3A 1KX5C 3VH6A 3AZEC 2XD5A 3P5JB 5B0YA 1P3MC 1U35A 3VH5T 3B6GA 5GSUC 3B0CT 5B2JD 4ZBJB 3C1CA 1H3OB 1BFMA 3LZ1B 3O62D 4J8UC 2NZDB 1P3KB 5AV6B 2CV5B 5B32A 3LZ0B 5B40B 3AZJB 1P3IB 3MGSC 4CSRB 3WKJA 1AOIB 2G5IC 3X1UC 2F8NB 1TAFA 3AV2A 5B33A 3LZ1D 4QLCA 4AWLB 2NZDD 1P3KD 2CV5D 3C1BB 1P3FB 3WAAB 2G5HC 3LZ0D 5B40D 3REHA 3AZJD 1P3ID 1P3PA 1AOID 5B1MB 4X23A 4XZQC 2F8ND 2Y2IA 3NQJB 3UT9A 2Y2GA 3TU4B 4J8VB 2AROA 3AZKB 5E5AB 5JRGB 3REKD 3C1BD 3X1VC 1P3FD 1P3BA 3WAAD 3W98B 1B67A 1P3AB 2Y2PA 3X1SC 3B6FD 4XUJA 5BNXB 3MGQB 4H9SA 5GXQA 4KGCC 5B1MD 5B1LA 3LJAB 5GT3A 3A1KA 3TU4D 4J8VD 5E5AD 5JRGD 5CPIB 3H0RC 3WTPC 1P3AD 3W98D 3W99C 3AZNC 1ID3A 3MGQD 4J8XB 4J8WA 3MVDB 3NQUA 3AZLA 5AV5B 3LJAD 1ZLAC 1TZYB 5DNMC 1KX5B 3UTBC 4WNNA 3REIA 4CAYB 5CPID 4UPKA 2HUEB 4R8PC 4ZUXA 5AVCB 2BYKA 5CHLB 4Z5TB 3MVDD 5AV9A 2FFFB 5AY8C 5B2JC 5AV5D 1P3LD 1TZYD 3AZFA 1KX5D 1M1AB 2NQBB 3O62C 3MGPA 4DRAA 5B24A 5AVCD 1F1EA 4Z5TD 4H9RA 3KFUG 4ZBJC 4YM6A 3KWQB 3LZ1C 3REJA 4KHAA 1M1AD 2NQBD 2W8SA 2NZDC 2CV5C 5C3IB 3W96A 3AZMB 5GT0A 3LZ0C 4WU9B 5B40C 3AZJC 1P3IC 5F99C 4E44A 1AOIC 3AZEA 5B0ZA 3KWQD 1P3MA 3AZHB 3R45B 3REKC 5GSUA 4WZSB 3C1BC 3WAAC 1P3FC 3IP4C 1F66C 2F8NH 3AZMD 4H9QB 4WU9D 3B6FC 4G92B 4J8UA 5KDMB 5B1MC 5JA4A 1EQZB 3MGRB 3AZGA 1BH9A 3UTAD 2YFVB 3AZHD 3MGSA 3W97C 4KUDD 2LY8A 1HQ3D 5E5AC 2F8NG 3W99B 5B2IB 3X1UA 3W98C 4Z2MG 5DNNB 3MGQC
chains in the Genus database with same CATH topology
3X1TB 3V9RA 4H9NA 4DQYB 1EQZD 3LJAC 3MGRD 4H9OB 5AVBD 4R8PB 2PYOA 3EPHA 5B2ID 5CPIC 4XZQA 3B6GB 1N1JB 5DNND 4Z66A 5AY8B 3X1TD 3MVDC 3X1VA 1JFIB 5AV5C 1P3LC 3X1SA 3KUYC 1TZYC 3AN2B 1ULYA 5CP6B 4R8PD 5FUGA 4KGCA 4HGAB 5BS7A 4E45A 3B6GD 2HUEC 5BO0B 2YFWB 4UUZA 5AY8D 5AVCC 4Z5TC 3AYWA 3WTPA 2Y2KA 3WA9A 3AN2D 3AZNA 1M1AC 1KX4B 5CP6D 2NQBC 2BG1A 5CPKC 5F99B 1ZLAA 3A6NA 5DNMA 3UTBA 1BH8B 1P34B 1P3OB 3AV2D 3REKB 4H9PB 3F6TA 1F66B 3KWQC 4EO5B 1KX4D 3B6FB 5C3IC 1W2EA 5F99D 4NE5A 5B2JA 3AZMC 2JCHA 3RELB 4WU9C 1S32C 1P34D 1P3OD 2UWXA 5BNVA 3W97B 3UTAC 1F66D 2ZY3A 3AZHC 1HTAA 4KUDC 1HQ3C 3EPKA 2FJ7B 5B31B 3RELD 1H3OA 3LZ1A 2L5AA 4LD9A 4G92C 2NZDA 1P3KA 5AV6A 2CV5A 1M18B 3W97D 3H0LC 1EQZC 3MGRC 3LZ0A 5B40A 3VH5W 5AVBC 1P3IA 3B0CW 4CSRA 1AOIA 5B2IC 2FJ7D 2F8NA 5B31D 5DNNC 2DF4C 1P3LB 3X1TC 3KUYB 1M18D 3AZIC 3C1BA 1P3FA 3WAAA 5AV8B 1B6WA 3AV1B 2ZY4A 2RVQD 5B1MA 2HIOB 3B6GC 3NQJA 3TU4A 4J8VA 2JE5A 4JJNB 5E5AA 5JRGA 3KUYD 3AZKA 5AV8D 3W98A 1P3AA 3H0MC 3AN2C 3VH5A 5CPKB 3AV1D 3MGQA 5BNXA 5CP6C 5CPJB 4HGAC 2HIOD 3LJAA 5BT1D 4JJND 3AV2C 4QLCC 5CPIA 3VH6T 5CPKD 1KX4C 4J8XA 3MVDA 1S32B 5CPJD 3LELB 5AV5A 1A7WA 1T3UA 1TZYA 1KX5A 5JA4B 2Y2JA 4X23C 1P34C 2Y2QA 3UTAB 1P3OC 4CAYA 4KUDB 1HQ3B 2JSSA 1M19B 1P3BC 5AVCA 4EO5C 4Z2MH 5G49B 4Z5TA 4XUJC 1S32D 3LELD 3RELC 3FDDA 3MNNB 1M1AA 5B1LC 2NQBA 5GT3C 5AVBB 4NFTA 4WJ3C 3AFAB 3KXBB 1M19D 1Z2CB 1P3GB 2IO5B 2FJ7C 5B31C 3AZIB 3MNND 3AZLC 4YS3B 3KWQA 4WU8B 1KX3B 1M18C 3AZMA 2BYMA 5B0YB 4WU9A 2XD1A 3AFAD 2F8NK 1U35B 3KXBD 1P3GD 2RVQC 4UUZB 3C1CB 3AZID 3AYWB 4YS3D 3AZHA 3WA9B 3R45A 4WU8D 1KX3D 5B32B 5B31G 5AV8C 4H9QA 5B0YD 3AV1C 1U35D 5KDMA 1PZRA 3WKJB 2ZY2A 5B24C 2HIOC 1TAFB 1EQZA 3MGRA 3C1CD 3AV2B 5B33B 2YFVA 4QLCB 3AYWD 5BT1C 4JJNC 3WA9D 4G91C 5B32D 3W99A 5B2IA 3REHB 5DNNA 3W96C 3X1TA 3WKJD 1P3PB 4X23B 5CPJC 3UT9B 4H9OA 5B33D 4QLCD 2AROB 2Y2OA 4R8PA 5B0ZC 1P3BB 1N1JA 3REHD 4XUJB 3A1IA 5AY8A 2ZM5A 5GXQB 1P3PD 4LD9B 5B1LB 4X23D 2ZY5A 5GT3B 3O62A 3LELC 1JFIA 3UT9D 3AN2A 2AROD 5CP6A 3AZGC 3EPJA 1P3BD 5BO0A 1ID3B 4XUJD 2YFWA 1M19C 4J8WB 4NE6A 2VQRA 3NQUB 5GXQD 3AZLB 4LD9D 1WWSA 5B1LD 5GT3D 5AV6D 3B0BA 3MNNC 4WNNB 1KX4A 2J8PA 2Y2MA 4M6BA 3REIB 3AZJA 5F99A 4ZUXB 1ID3D 3AFAC 2PYOC 1BH8A 2BYKB 3KXBC 1P34A 1P3OA 4J8WD 1P3GC 1R4VA 2IO5C 5AV9B 3AZLD 4Z66C 3AZFB 3REKA 4H9PA 4YS3C 1F66A 1WWIA 3MGPB 4WU8C 1KX3C 3B6FA 3REID 4ZUXD 3KSYA 5B0YC 3RELA 5B24B 1U35C 4DRBA 5BS7C 4H9RB 5AV9D 3W97A 3AZKD 4G91B 3AZFD 4YM6B 3C1CC 3REJB 3AYWC 4KHAB 3MGPD 3WA9C 3W96B 5B32C 3B0DB 3EG5B 5GT0B 5B31A 2FJ7A 5B24D 2Y2LA 3A6NC 1KU5A 3WKJC 1M18A 3AZEB 5B0ZB 4YM6D 3REJD 5B33C 1P3MB 5GSUB 3W96D 5GT0D 4J8XD 3REHC 4J8UB 5B32G 1P3LA 3KUYA 1P3PC 3AZED 3AZGB 5AV8A 1BH9B 5B0ZD 3UT9C 1P3MD 3AV1A 3MGSB 2AROC 5GSUD 3X1UB 2HIOA 2CWEA 4J8UD 3V9RB 4H9SC 4JJNA 4H9NB 2F2AC 5GXQC 4LD9C 3AZGD 1P3KC 5AV6C 5CPKA 3MGSD 1Q9CA 2BYMB 2PYOB 5CPJA 4XZQB 3X1UD 4Z66B 1ID3C 4J8WC 3X1VB 4AWLC 3X1SB 2RIQA 5FUGB 3REIC 2PYOD 2DQNC 4KGCB 1S32A 4XZQD 3LELA 2Y2HA 4ZUXC 2Y2NA 4Z66D 3UTAA 5AV9C 3X1VD 4NE3A 3WTPB 3VH6W 3TU4C 4J8VC 3AZKC 3X1SD 4KUDA 1HQ3A 5JRGC 3AZFC 3AZNB 1M19A 3WTPE 3MGPC 1P3AC 5G49A 4KGCD 1ZLAB 3A6NB 3EPLA 5DNMB 3UTBB 3MNNA 4WV4B 5AVBA 3WTPD 3AL0C 3W99D 4YM6C 3AFAA 3REJC 3AZND 3KXBA 1P3GA 5B2JB 3B0DC 3A6ND 1ZLAD 5GT0C 5DNMD 4J8XC 3AZIA 3UTBD 4YS3A 3O62B 5BNVB 4WU8A 1KX3A 1KX5C 3VH6A 3AZEC 2XD5A 3P5JB 5B0YA 1P3MC 1U35A 3VH5T 3B6GA 5GSUC 3B0CT 5B2JD 4ZBJB 3C1CA 1H3OB 1BFMA 3LZ1B 3O62D 4J8UC 2NZDB 1P3KB 5AV6B 2CV5B 5B32A 3LZ0B 5B40B 3AZJB 1P3IB 3MGSC 4CSRB 3WKJA 1AOIB 2G5IC 3X1UC 2F8NB 1TAFA 3AV2A 5B33A 3LZ1D 4QLCA 4AWLB 2NZDD 1P3KD 2CV5D 3C1BB 1P3FB 3WAAB 2G5HC 3LZ0D 5B40D 3REHA 3AZJD 1P3ID 1P3PA 1AOID 5B1MB 4X23A 4XZQC 2F8ND 2Y2IA 3NQJB 3UT9A 2Y2GA 3TU4B 4J8VB 2AROA 3AZKB 5E5AB 5JRGB 3REKD 3C1BD 3X1VC 1P3FD 1P3BA 3WAAD 3W98B 1B67A 1P3AB 2Y2PA 3X1SC 3B6FD 4XUJA 5BNXB 3MGQB 4H9SA 5GXQA 4KGCC 5B1MD 5B1LA 3LJAB 5GT3A 3A1KA 3TU4D 4J8VD 5E5AD 5JRGD 5CPIB 3H0RC 3WTPC 1P3AD 3W98D 3W99C 3AZNC 1ID3A 3MGQD 4J8XB 4J8WA 3MVDB 3NQUA 3AZLA 5AV5B 3LJAD 1ZLAC 1TZYB 5DNMC 1KX5B 3UTBC 4WNNA 3REIA 4CAYB 5CPID 4UPKA 2HUEB 4R8PC 4ZUXA 5AVCB 2BYKA 5CHLB 4Z5TB 3MVDD 5AV9A 2FFFB 5AY8C 5B2JC 5AV5D 1P3LD 1TZYD 3AZFA 1KX5D 1M1AB 2NQBB 3O62C 3MGPA 4DRAA 5B24A 5AVCD 1F1EA 4Z5TD 4H9RA 3KFUG 4ZBJC 4YM6A 3KWQB 3LZ1C 3REJA 4KHAA 1M1AD 2NQBD 2W8SA 2NZDC 2CV5C 5C3IB 3W96A 3AZMB 5GT0A 3LZ0C 4WU9B 5B40C 3AZJC 1P3IC 5F99C 4E44A 1AOIC 3AZEA 5B0ZA 3KWQD 1P3MA 3AZHB 3R45B 3REKC 5GSUA 4WZSB 3C1BC 3WAAC 1P3FC 3IP4C 1F66C 2F8NH 3AZMD 4H9QB 4WU9D 3B6FC 4G92B 4J8UA 5KDMB 5B1MC 5JA4A 1EQZB 3MGRB 3AZGA 1BH9A 3UTAD 2YFVB 3AZHD 3MGSA 3W97C 4KUDD 2LY8A 1HQ3D 5E5AC 2F8NG 3W99B 5B2IB 3X1UA 3W98C 4Z2MG 5DNNB 3MGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T B;  3V9R A;  4H9N A;  1EQZ D;  3LJA C;  3MGR D;  4H9O B;  5AVB D;  4R8P B;  2PYO A;  5CPI C;  5B2I D;  4XZQ A;  3B6G B;  1N1J B;  5DNN D;  4Z66 A;  5AY8 B;  3X1T D;  3MVD C;  3X1V A;  1JFI B;  5AV5 C;  1P3L C;  3X1S A;  3KUY C;  1TZY C;  3AN2 B;  1ULY A;  5CP6 B;  4R8P D;  5FUG A;  4KGC A;  4HGA B;  5BS7 A;  4E45 A;  3B6G D;  2HUE C;  5BO0 B;  2YFW B;  4UUZ A;  5AY8 D;  5AVC C;  4Z5T C;  3AYW A;  3WTP A;  3WA9 A;  3AN2 D;  3AZN A;  1M1A C;  1KX4 B;  5CP6 D;  2NQB C;  5CPK C;  5F99 B;  1ZLA A;  3A6N A;  5DNM A;  3UTB A;  1BH8 B;  1P34 B;  1P3O B;  3AV2 D;  3REK B;  4H9P B;  1F66 B;  3KWQ C;  4EO5 B;  1KX4 D;  3B6F B;  5C3I C;  5F99 D;  4NE5 A;  5B2J A;  3AZM C;  3REL B;  4WU9 C;  1S32 C;  1P34 D;  1P3O D;  5BNV A;  3W97 B;  3UTA C;  1F66 D;  3AZH C;  1HTA A;  4KUD C;  1HQ3 C;  2FJ7 B;  5B31 B;  3REL D;  1H3O A;  3LZ1 A;  2L5A A;  4LD9 A;  4G92 C;  2NZD A;  1P3K A;  5AV6 A;  2CV5 A;  1M18 B;  3W97 D;  1EQZ C;  3MGR C;  3LZ0 A;  5B40 A;  3VH5 W;  5AVB C;  1P3I A;  3B0C W;  4CSR A;  1AOI A;  5B2I C;  2FJ7 D;  2F8N A;  5B31 D;  5DNN C;  1P3L B;  3X1T C;  3KUY B;  1M18 D;  3AZI C;  3C1B A;  1P3F A;  3WAA A;  5AV8 B;  1B6W A;  3AV1 B;  2RVQ D;  5B1M A;  2HIO B;  3B6G C;  3NQJ A;  3TU4 A;  4J8V A;  4JJN B;  3AZK A;  5E5A A;  5JRG A;  3KUY D;  5AV8 D;  3W98 A;  1P3A A;  3AN2 C;  3VH5 A;  5CPK B;  3AV1 D;  3MGQ A;  5BNX A;  5CP6 C;  5CPJ B;  4HGA C;  2HIO D;  3LJA A;  5BT1 D;  4JJN D;  3AV2 C;  4QLC C;  5CPI A;  3VH6 T;  5CPK D;  1KX4 C;  4J8X A;  3MVD A;  1S32 B;  5CPJ D;  3LEL B;  5AV5 A;  1A7W A;  1TZY A;  1KX5 A;  5JA4 B;  4X23 C;  1P34 C;  1P3O C;  3UTA B;  4CAY A;  4KUD B;  1HQ3 B;  2JSS A;  1M19 B;  1P3B C;  5AVC A;  4EO5 C;  4Z2M H;  5G49 B;  4Z5T A;  4XUJ C;  1S32 D;  3LEL D;  3REL C;  3MNN B;  1M1A A;  5B1L C;  2NQB A;  5GT3 C;  5AVB B;  4NFT A;  3AFA B;  3KXB B;  1M19 D;  1P3G B;  2IO5 B;  2FJ7 C;  5B31 C;  3AZI B;  3MNN D;  3AZL C;  4YS3 B;  3KWQ A;  4WU8 B;  1KX3 B;  1M18 C;  3AZM A;  2BYM A;  5B0Y B;  4WU9 A;  2F8N K;  3AFA D;  1U35 B;  3KXB D;  1P3G D;  2RVQ C;  4UUZ B;  3C1C B;  3AZI D;  3AYW B;  4YS3 D;  3AZH A;  3WA9 B;  3R45 A;  4WU8 D;  1KX3 D;  5B32 B;  5B31 G;  5AV8 C;  4H9Q A;  5B0Y D;  3AV1 C;  1U35 D;  5KDM A;  3WKJ B;  5B24 C;  2HIO C;  1TAF B;  1EQZ A;  3MGR A;  3C1C D;  3AV2 B;  5B33 B;  2YFV A;  4QLC B;  3AYW D;  5BT1 C;  4JJN C;  3WA9 D;  4G91 C;  5B32 D;  3W99 A;  5B2I A;  3REH B;  5DNN A;  3W96 C;  3X1T A;  3WKJ D;  1P3P B;  4X23 B;  5CPJ C;  3UT9 B;  4H9O A;  5B33 D;  4QLC D;  2ARO B;  4R8P A;  5B0Z C;  1P3B B;  1N1J A;  3REH D;  4XUJ B;  5AY8 A;  5GXQ B;  1P3P D;  4LD9 B;  5B1L B;  4X23 D;  5GT3 B;  3O62 A;  3LEL C;  1JFI A;  3UT9 D;  3AN2 A;  2ARO D;  5CP6 A;  3AZG C;  1P3B D;  5BO0 A;  1ID3 B;  4XUJ D;  2YFW A;  1M19 C;  4J8W B;  4NE6 A;  3NQU B;  5GXQ D;  3AZL B;  4LD9 D;  1WWS A;  5B1L D;  5GT3 D;  5AV6 D;  3B0B A;  3MNN C;  4WNN B;  1KX4 A;  4M6B A;  3REI B;  3AZJ A;  5F99 A;  4ZUX B;  1ID3 D;  3AFA C;  2PYO C;  1BH8 A;  2BYK B;  3KXB C;  1P34 A;  1P3O A;  4J8W D;  1P3G C;  1R4V A;  2IO5 C;  5AV9 B;  3AZL D;  4Z66 C;  3AZF B;  3REK A;  4H9P A;  4YS3 C;  1F66 A;  1WWI A;  3MGP B;  4WU8 C;  1KX3 C;  3B6F A;  3REI D;  4ZUX D;  3KSY A;  5B0Y C;  3REL A;  5B24 B;  1U35 C;  4DRB A;  5BS7 C;  4H9R B;  5AV9 D;  3W97 A;  3AZK D;  4G91 B;  3AZF D;  4YM6 B;  3C1C C;  3REJ B;  3AYW C;  4KHA B;  3MGP D;  3WA9 C;  3W96 B;  5B32 C;  3B0D B;  5GT0 B;  2FJ7 A;  5B31 A;  5B24 D;  3A6N C;  1KU5 A;  3WKJ C;  1M18 A;  3AZE B;  5B0Z B;  4YM6 D;  3REJ D;  5B33 C;  1P3M B;  5GSU B;  3W96 D;  5GT0 D;  4J8X D;  3REH C;  4J8U B;  5B32 G;  1P3L A;  3KUY A;  1P3P C;  3AZE D;  3AZG B;  5AV8 A;  1BH9 B;  5B0Z D;  3UT9 C;  1P3M D;  3AV1 A;  3MGS B;  2ARO C;  5GSU D;  3X1U B;  2HIO A;  2CWE A;  4J8U D;  3V9R B;  4H9S C;  4JJN A;  4H9N B;  5GXQ C;  4LD9 C;  3AZG D;  1P3K C;  5AV6 C;  5CPK A;  3MGS D;  1Q9C A;  2BYM B;  2PYO B;  5CPJ A;  4XZQ B;  3X1U D;  4Z66 B;  1ID3 C;  4J8W C;  3X1V B;  4AWL C;  3X1S B;  5FUG B;  3REI C;  2PYO D;  4KGC B;  1S32 A;  4XZQ D;  3LEL A;  4ZUX C;  4Z66 D;  3UTA A;  5AV9 C;  3X1V D;  4NE3 A;  3WTP B;  3VH6 W;  3TU4 C;  4J8V C;  3AZK C;  3X1S D;  4KUD A;  1HQ3 A;  5JRG C;  3AZF C;  3AZN B;  1M19 A;  3WTP E;  3MGP C;  1P3A C;  5G49 A;  4KGC D;  1ZLA B;  3A6N B;  5DNM B;  3UTB B;  3MNN A;  4WV4 B;  5AVB A;  3WTP D;  3W99 D;  4YM6 C;  3AFA A;  3REJ C;  3AZN D;  3KXB A;  1P3G A;  5B2J B;  3B0D C;  3A6N D;  1ZLA D;  5GT0 C;  5DNM D;  4J8X C;  3AZI A;  3UTB D;  4YS3 A;  3O62 B;  5BNV B;  4WU8 A;  1KX3 A;  1KX5 C;  3VH6 A;  3AZE C;  5B0Y A;  1P3M C;  1U35 A;  3VH5 T;  3B6G A;  5GSU C;  3B0C T;  5B2J D;  4ZBJ B;  3C1C A;  1H3O B;  1BFM A;  3LZ1 B;  3O62 D;  4J8U C;  2NZD B;  1P3K B;  5AV6 B;  2CV5 B;  5B32 A;  3LZ0 B;  5B40 B;  3AZJ B;  1P3I B;  3MGS C;  4CSR B;  3WKJ A;  1AOI B;  2F8N B;  3X1U C;  1TAF A;  3AV2 A;  5B33 A;  3LZ1 D;  4QLC A;  4AWL B;  2NZD D;  1P3K D;  2CV5 D;  3C1B B;  1P3F B;  3WAA B;  3LZ0 D;  5B40 D;  3REH A;  3AZJ D;  1P3I D;  1P3P A;  1AOI D;  5B1M B;  4X23 A;  4XZQ C;  2F8N D;  3NQJ B;  3UT9 A;  3TU4 B;  4J8V B;  2ARO A;  3AZK B;  5E5A B;  5JRG B;  3REK D;  3C1B D;  3X1V C;  1P3F D;  1P3B A;  3WAA D;  3W98 B;  1B67 A;  1P3A B;  3X1S C;  3B6F D;  4XUJ A;  5BNX B;  3MGQ B;  4H9S A;  5GXQ A;  4KGC C;  5B1M D;  5B1L A;  3LJA B;  5GT3 A;  3TU4 D;  4J8V D;  5E5A D;  5JRG D;  5CPI B;  3WTP C;  1P3A D;  3W98 D;  3W99 C;  3AZN C;  1ID3 A;  3MGQ D;  4J8X B;  4J8W A;  3MVD B;  3NQU A;  3AZL A;  5AV5 B;  3LJA D;  1ZLA C;  1TZY B;  5DNM C;  1KX5 B;  3UTB C;  4WNN A;  3REI A;  4CAY B;  5CPI D;  2HUE B;  4R8P C;  4ZUX A;  5AVC B;  2BYK A;  5CHL B;  4Z5T B;  3MVD D;  5AV9 A;  5AY8 C;  5B2J C;  5AV5 D;  1P3L D;  1TZY D;  3AZF A;  1KX5 D;  1M1A B;  2NQB B;  3O62 C;  3MGP A;  4DRA A;  5B24 A;  5AVC D;  1F1E A;  4Z5T D;  4H9R A;  4ZBJ C;  4YM6 A;  3KWQ B;  3LZ1 C;  3REJ A;  4KHA A;  1M1A D;  2NQB D;  2NZD C;  2CV5 C;  5C3I B;  3W96 A;  3AZM B;  5GT0 A;  3LZ0 C;  4WU9 B;  5B40 C;  3AZJ C;  1P3I C;  5F99 C;  4E44 A;  1AOI C;  3AZE A;  5B0Z A;  3KWQ D;  1P3M A;  3AZH B;  3R45 B;  3REK C;  5GSU A;  4WZS B;  3C1B C;  3WAA C;  1P3F C;  1F66 C;  2F8N H;  3AZM D;  4H9Q B;  4WU9 D;  3B6F C;  4G92 B;  4J8U A;  5KDM B;  5B1M C;  5JA4 A;  1EQZ B;  3MGR B;  3AZG A;  1BH9 A;  3UTA D;  2YFV B;  3AZH D;  3MGS A;  3W97 C;  4KUD D;  2LY8 A;  1HQ3 D;  5E5A C;  2F8N G;  3W99 B;  5B2I B;  3X1U A;  3W98 C;  4Z2M G;  5DNN B;  3MGQ C; 
#chains in the Genus database with same CATH topology
 3X1T B;  3V9R A;  4H9N A;  4DQY B;  1EQZ D;  3LJA C;  3MGR D;  4H9O B;  5AVB D;  4R8P B;  2PYO A;  3EPH A;  5B2I D;  5CPI C;  4XZQ A;  3B6G B;  1N1J B;  5DNN D;  4Z66 A;  5AY8 B;  3X1T D;  3MVD C;  3X1V A;  1JFI B;  5AV5 C;  1P3L C;  3X1S A;  3KUY C;  1TZY C;  3AN2 B;  1ULY A;  5CP6 B;  4R8P D;  5FUG A;  4KGC A;  4HGA B;  5BS7 A;  4E45 A;  3B6G D;  2HUE C;  5BO0 B;  2YFW B;  4UUZ A;  5AY8 D;  5AVC C;  4Z5T C;  3AYW A;  3WTP A;  2Y2K A;  3WA9 A;  3AN2 D;  3AZN A;  1M1A C;  1KX4 B;  5CP6 D;  2NQB C;  2BG1 A;  5CPK C;  5F99 B;  1ZLA A;  3A6N A;  5DNM A;  3UTB A;  1BH8 B;  1P34 B;  1P3O B;  3AV2 D;  3REK B;  4H9P B;  3F6T A;  1F66 B;  3KWQ C;  4EO5 B;  1KX4 D;  3B6F B;  5C3I C;  1W2E A;  5F99 D;  4NE5 A;  5B2J A;  3AZM C;  2JCH A;  3REL B;  4WU9 C;  1S32 C;  1P34 D;  1P3O D;  2UWX A;  5BNV A;  3W97 B;  3UTA C;  1F66 D;  2ZY3 A;  3AZH C;  1HTA A;  4KUD C;  1HQ3 C;  3EPK A;  2FJ7 B;  5B31 B;  3REL D;  1H3O A;  3LZ1 A;  2L5A A;  4LD9 A;  4G92 C;  2NZD A;  1P3K A;  5AV6 A;  2CV5 A;  1M18 B;  3W97 D;  3H0L C;  1EQZ C;  3MGR C;  3LZ0 A;  5B40 A;  3VH5 W;  5AVB C;  1P3I A;  3B0C W;  4CSR A;  1AOI A;  5B2I C;  2FJ7 D;  2F8N A;  5B31 D;  5DNN C;  2DF4 C;  1P3L B;  3X1T C;  3KUY B;  1M18 D;  3AZI C;  3C1B A;  1P3F A;  3WAA A;  5AV8 B;  1B6W A;  3AV1 B;  2ZY4 A;  2RVQ D;  5B1M A;  2HIO B;  3B6G C;  3NQJ A;  3TU4 A;  4J8V A;  2JE5 A;  4JJN B;  5E5A A;  5JRG A;  3KUY D;  3AZK A;  5AV8 D;  3W98 A;  1P3A A;  3H0M C;  3AN2 C;  3VH5 A;  5CPK B;  3AV1 D;  3MGQ A;  5BNX A;  5CP6 C;  5CPJ B;  4HGA C;  2HIO D;  3LJA A;  5BT1 D;  4JJN D;  3AV2 C;  4QLC C;  5CPI A;  3VH6 T;  5CPK D;  1KX4 C;  4J8X A;  3MVD A;  1S32 B;  5CPJ D;  3LEL B;  5AV5 A;  1A7W A;  1T3U A;  1TZY A;  1KX5 A;  5JA4 B;  2Y2J A;  4X23 C;  1P34 C;  2Y2Q A;  3UTA B;  1P3O C;  4CAY A;  4KUD B;  1HQ3 B;  2JSS A;  1M19 B;  1P3B C;  5AVC A;  4EO5 C;  4Z2M H;  5G49 B;  4Z5T A;  4XUJ C;  1S32 D;  3LEL D;  3REL C;  3FDD A;  3MNN B;  1M1A A;  5B1L C;  2NQB A;  5GT3 C;  5AVB B;  4NFT A;  4WJ3 C;  3AFA B;  3KXB B;  1M19 D;  1Z2C B;  1P3G B;  2IO5 B;  2FJ7 C;  5B31 C;  3AZI B;  3MNN D;  3AZL C;  4YS3 B;  3KWQ A;  4WU8 B;  1KX3 B;  1M18 C;  3AZM A;  2BYM A;  5B0Y B;  4WU9 A;  2XD1 A;  3AFA D;  2F8N K;  1U35 B;  3KXB D;  1P3G D;  2RVQ C;  4UUZ B;  3C1C B;  3AZI D;  3AYW B;  4YS3 D;  3AZH A;  3WA9 B;  3R45 A;  4WU8 D;  1KX3 D;  5B32 B;  5B31 G;  5AV8 C;  4H9Q A;  5B0Y D;  3AV1 C;  1U35 D;  5KDM A;  1PZR A;  3WKJ B;  2ZY2 A;  5B24 C;  2HIO C;  1TAF B;  1EQZ A;  3MGR A;  3C1C D;  3AV2 B;  5B33 B;  2YFV A;  4QLC B;  3AYW D;  5BT1 C;  4JJN C;  3WA9 D;  4G91 C;  5B32 D;  3W99 A;  5B2I A;  3REH B;  5DNN A;  3W96 C;  3X1T A;  3WKJ D;  1P3P B;  4X23 B;  5CPJ C;  3UT9 B;  4H9O A;  5B33 D;  4QLC D;  2ARO B;  2Y2O A;  4R8P A;  5B0Z C;  1P3B B;  1N1J A;  3REH D;  4XUJ B;  3A1I A;  5AY8 A;  2ZM5 A;  5GXQ B;  1P3P D;  4LD9 B;  5B1L B;  4X23 D;  2ZY5 A;  5GT3 B;  3O62 A;  3LEL C;  1JFI A;  3UT9 D;  3AN2 A;  2ARO D;  5CP6 A;  3AZG C;  3EPJ A;  1P3B D;  5BO0 A;  1ID3 B;  4XUJ D;  2YFW A;  1M19 C;  4J8W B;  4NE6 A;  2VQR A;  3NQU B;  5GXQ D;  3AZL B;  4LD9 D;  1WWS A;  5B1L D;  5GT3 D;  5AV6 D;  3B0B A;  3MNN C;  4WNN B;  1KX4 A;  2J8P A;  2Y2M A;  4M6B A;  3REI B;  3AZJ A;  5F99 A;  4ZUX B;  1ID3 D;  3AFA C;  2PYO C;  1BH8 A;  2BYK B;  3KXB C;  1P34 A;  1P3O A;  4J8W D;  1P3G C;  1R4V A;  2IO5 C;  5AV9 B;  3AZL D;  4Z66 C;  3AZF B;  3REK A;  4H9P A;  4YS3 C;  1F66 A;  1WWI A;  3MGP B;  4WU8 C;  1KX3 C;  3B6F A;  3REI D;  4ZUX D;  3KSY A;  5B0Y C;  3REL A;  5B24 B;  1U35 C;  4DRB A;  5BS7 C;  4H9R B;  5AV9 D;  3W97 A;  3AZK D;  4G91 B;  3AZF D;  4YM6 B;  3C1C C;  3REJ B;  3AYW C;  4KHA B;  3MGP D;  3WA9 C;  3W96 B;  5B32 C;  3B0D B;  3EG5 B;  5GT0 B;  5B31 A;  2FJ7 A;  5B24 D;  2Y2L A;  3A6N C;  1KU5 A;  3WKJ C;  1M18 A;  3AZE B;  5B0Z B;  4YM6 D;  3REJ D;  5B33 C;  1P3M B;  5GSU B;  3W96 D;  5GT0 D;  4J8X D;  3REH C;  4J8U B;  5B32 G;  1P3L A;  3KUY A;  1P3P C;  3AZE D;  3AZG B;  5AV8 A;  1BH9 B;  5B0Z D;  3UT9 C;  1P3M D;  3AV1 A;  3MGS B;  2ARO C;  5GSU D;  3X1U B;  2HIO A;  2CWE A;  4J8U D;  3V9R B;  4H9S C;  4JJN A;  4H9N B;  2F2A C;  5GXQ C;  4LD9 C;  3AZG D;  1P3K C;  5AV6 C;  5CPK A;  3MGS D;  1Q9C A;  2BYM B;  2PYO B;  5CPJ A;  4XZQ B;  3X1U D;  4Z66 B;  1ID3 C;  4J8W C;  3X1V B;  4AWL C;  3X1S B;  2RIQ A;  5FUG B;  3REI C;  2PYO D;  2DQN C;  4KGC B;  1S32 A;  4XZQ D;  3LEL A;  2Y2H A;  4ZUX C;  2Y2N A;  4Z66 D;  3UTA A;  5AV9 C;  3X1V D;  4NE3 A;  3WTP B;  3VH6 W;  3TU4 C;  4J8V C;  3AZK C;  3X1S D;  4KUD A;  1HQ3 A;  5JRG C;  3AZF C;  3AZN B;  1M19 A;  3WTP E;  3MGP C;  1P3A C;  5G49 A;  4KGC D;  1ZLA B;  3A6N B;  3EPL A;  5DNM B;  3UTB B;  3MNN A;  4WV4 B;  5AVB A;  3WTP D;  3AL0 C;  3W99 D;  4YM6 C;  3AFA A;  3REJ C;  3AZN D;  3KXB A;  1P3G A;  5B2J B;  3B0D C;  3A6N D;  1ZLA D;  5GT0 C;  5DNM D;  4J8X C;  3AZI A;  3UTB D;  4YS3 A;  3O62 B;  5BNV B;  4WU8 A;  1KX3 A;  1KX5 C;  3VH6 A;  3AZE C;  2XD5 A;  3P5J B;  5B0Y A;  1P3M C;  1U35 A;  3VH5 T;  3B6G A;  5GSU C;  3B0C T;  5B2J D;  4ZBJ B;  3C1C A;  1H3O B;  1BFM A;  3LZ1 B;  3O62 D;  4J8U C;  2NZD B;  1P3K B;  5AV6 B;  2CV5 B;  5B32 A;  3LZ0 B;  5B40 B;  3AZJ B;  1P3I B;  3MGS C;  4CSR B;  3WKJ A;  1AOI B;  2G5I C;  3X1U C;  2F8N B;  1TAF A;  3AV2 A;  5B33 A;  3LZ1 D;  4QLC A;  4AWL B;  2NZD D;  1P3K D;  2CV5 D;  3C1B B;  1P3F B;  3WAA B;  2G5H C;  3LZ0 D;  5B40 D;  3REH A;  3AZJ D;  1P3I D;  1P3P A;  1AOI D;  5B1M B;  4X23 A;  4XZQ C;  2F8N D;  2Y2I A;  3NQJ B;  3UT9 A;  2Y2G A;  3TU4 B;  4J8V B;  2ARO A;  3AZK B;  5E5A B;  5JRG B;  3REK D;  3C1B D;  3X1V C;  1P3F D;  1P3B A;  3WAA D;  3W98 B;  1B67 A;  1P3A B;  2Y2P A;  3X1S C;  3B6F D;  4XUJ A;  5BNX B;  3MGQ B;  4H9S A;  5GXQ A;  4KGC C;  5B1M D;  5B1L A;  3LJA B;  5GT3 A;  3A1K A;  3TU4 D;  4J8V D;  5E5A D;  5JRG D;  5CPI B;  3H0R C;  3WTP C;  1P3A D;  3W98 D;  3W99 C;  3AZN C;  1ID3 A;  3MGQ D;  4J8X B;  4J8W A;  3MVD B;  3NQU A;  3AZL A;  5AV5 B;  3LJA D;  1ZLA C;  1TZY B;  5DNM C;  1KX5 B;  3UTB C;  4WNN A;  3REI A;  4CAY B;  5CPI D;  4UPK A;  2HUE B;  4R8P C;  4ZUX A;  5AVC B;  2BYK A;  5CHL B;  4Z5T B;  3MVD D;  5AV9 A;  2FFF B;  5AY8 C;  5B2J C;  5AV5 D;  1P3L D;  1TZY D;  3AZF A;  1KX5 D;  1M1A B;  2NQB B;  3O62 C;  3MGP A;  4DRA A;  5B24 A;  5AVC D;  1F1E A;  4Z5T D;  4H9R A;  3KFU G;  4ZBJ C;  4YM6 A;  3KWQ B;  3LZ1 C;  3REJ A;  4KHA A;  1M1A D;  2NQB D;  2W8S A;  2NZD C;  2CV5 C;  5C3I B;  3W96 A;  3AZM B;  5GT0 A;  3LZ0 C;  4WU9 B;  5B40 C;  3AZJ C;  1P3I C;  5F99 C;  4E44 A;  1AOI C;  3AZE A;  5B0Z A;  3KWQ D;  1P3M A;  3AZH B;  3R45 B;  3REK C;  5GSU A;  4WZS B;  3C1B C;  3WAA C;  1P3F C;  3IP4 C;  1F66 C;  2F8N H;  3AZM D;  4H9Q B;  4WU9 D;  3B6F C;  4G92 B;  4J8U A;  5KDM B;  5B1M C;  5JA4 A;  1EQZ B;  3MGR B;  3AZG A;  1BH9 A;  3UTA D;  2YFV B;  3AZH D;  3MGS A;  3W97 C;  4KUD D;  2LY8 A;  1HQ3 D;  5E5A C;  2F8N G;  3W99 B;  5B2I B;  3X1U A;  3W98 C;  4Z2M G;  5DNN B;  3MGQ C; 
#chains in the Genus database with same CATH homology
 3X1T B;  3V9R A;  4H9N A;  4DQY B;  1EQZ D;  3LJA C;  3MGR D;  4H9O B;  5AVB D;  4R8P B;  2PYO A;  3EPH A;  5B2I D;  5CPI C;  4XZQ A;  3B6G B;  1N1J B;  5DNN D;  4Z66 A;  5AY8 B;  3X1T D;  3MVD C;  3X1V A;  1JFI B;  5AV5 C;  1P3L C;  3X1S A;  3KUY C;  1TZY C;  3AN2 B;  1ULY A;  5CP6 B;  4R8P D;  5FUG A;  4KGC A;  4HGA B;  5BS7 A;  4E45 A;  3B6G D;  2HUE C;  5BO0 B;  2YFW B;  4UUZ A;  5AY8 D;  5AVC C;  4Z5T C;  3AYW A;  3WTP A;  2Y2K A;  3WA9 A;  3AN2 D;  3AZN A;  1M1A C;  1KX4 B;  5CP6 D;  2NQB C;  2BG1 A;  5CPK C;  5F99 B;  1ZLA A;  3A6N A;  5DNM A;  3UTB A;  1BH8 B;  1P34 B;  1P3O B;  3AV2 D;  3REK B;  4H9P B;  3F6T A;  1F66 B;  3KWQ C;  4EO5 B;  1KX4 D;  3B6F B;  5C3I C;  1W2E A;  5F99 D;  4NE5 A;  5B2J A;  3AZM C;  2JCH A;  3REL B;  4WU9 C;  1S32 C;  1P34 D;  1P3O D;  2UWX A;  5BNV A;  3W97 B;  3UTA C;  1F66 D;  2ZY3 A;  3AZH C;  1HTA A;  4KUD C;  1HQ3 C;  3EPK A;  2FJ7 B;  5B31 B;  3REL D;  1H3O A;  3LZ1 A;  2L5A A;  4LD9 A;  4G92 C;  2NZD A;  1P3K A;  5AV6 A;  2CV5 A;  1M18 B;  3W97 D;  3H0L C;  1EQZ C;  3MGR C;  3LZ0 A;  5B40 A;  3VH5 W;  5AVB C;  1P3I A;  3B0C W;  4CSR A;  1AOI A;  5B2I C;  2FJ7 D;  2F8N A;  5B31 D;  5DNN C;  2DF4 C;  1P3L B;  3X1T C;  3KUY B;  1M18 D;  3AZI C;  3C1B A;  1P3F A;  3WAA A;  5AV8 B;  1B6W A;  3AV1 B;  2ZY4 A;  2RVQ D;  5B1M A;  2HIO B;  3B6G C;  3NQJ A;  3TU4 A;  4J8V A;  2JE5 A;  4JJN B;  5E5A A;  5JRG A;  3KUY D;  3AZK A;  5AV8 D;  3W98 A;  1P3A A;  3H0M C;  3AN2 C;  3VH5 A;  5CPK B;  3AV1 D;  3MGQ A;  5BNX A;  5CP6 C;  5CPJ B;  4HGA C;  2HIO D;  3LJA A;  5BT1 D;  4JJN D;  3AV2 C;  4QLC C;  5CPI A;  3VH6 T;  5CPK D;  1KX4 C;  4J8X A;  3MVD A;  1S32 B;  5CPJ D;  3LEL B;  5AV5 A;  1A7W A;  1T3U A;  1TZY A;  1KX5 A;  5JA4 B;  2Y2J A;  4X23 C;  1P34 C;  2Y2Q A;  3UTA B;  1P3O C;  4CAY A;  4KUD B;  1HQ3 B;  2JSS A;  1M19 B;  1P3B C;  5AVC A;  4EO5 C;  4Z2M H;  5G49 B;  4Z5T A;  4XUJ C;  1S32 D;  3LEL D;  3REL C;  3FDD A;  3MNN B;  1M1A A;  5B1L C;  2NQB A;  5GT3 C;  5AVB B;  4NFT A;  4WJ3 C;  3AFA B;  3KXB B;  1M19 D;  1Z2C B;  1P3G B;  2IO5 B;  2FJ7 C;  5B31 C;  3AZI B;  3MNN D;  3AZL C;  4YS3 B;  3KWQ A;  4WU8 B;  1KX3 B;  1M18 C;  3AZM A;  2BYM A;  5B0Y B;  4WU9 A;  2XD1 A;  3AFA D;  2F8N K;  1U35 B;  3KXB D;  1P3G D;  2RVQ C;  4UUZ B;  3C1C B;  3AZI D;  3AYW B;  4YS3 D;  3AZH A;  3WA9 B;  3R45 A;  4WU8 D;  1KX3 D;  5B32 B;  5B31 G;  5AV8 C;  4H9Q A;  5B0Y D;  3AV1 C;  1U35 D;  5KDM A;  1PZR A;  3WKJ B;  2ZY2 A;  5B24 C;  2HIO C;  1TAF B;  1EQZ A;  3MGR A;  3C1C D;  3AV2 B;  5B33 B;  2YFV A;  4QLC B;  3AYW D;  5BT1 C;  4JJN C;  3WA9 D;  4G91 C;  5B32 D;  3W99 A;  5B2I A;  3REH B;  5DNN A;  3W96 C;  3X1T A;  3WKJ D;  1P3P B;  4X23 B;  5CPJ C;  3UT9 B;  4H9O A;  5B33 D;  4QLC D;  2ARO B;  2Y2O A;  4R8P A;  5B0Z C;  1P3B B;  1N1J A;  3REH D;  4XUJ B;  3A1I A;  5AY8 A;  2ZM5 A;  5GXQ B;  1P3P D;  4LD9 B;  5B1L B;  4X23 D;  2ZY5 A;  5GT3 B;  3O62 A;  3LEL C;  1JFI A;  3UT9 D;  3AN2 A;  2ARO D;  5CP6 A;  3AZG C;  3EPJ A;  1P3B D;  5BO0 A;  1ID3 B;  4XUJ D;  2YFW A;  1M19 C;  4J8W B;  4NE6 A;  2VQR A;  3NQU B;  5GXQ D;  3AZL B;  4LD9 D;  1WWS A;  5B1L D;  5GT3 D;  5AV6 D;  3B0B A;  3MNN C;  4WNN B;  1KX4 A;  2J8P A;  2Y2M A;  4M6B A;  3REI B;  3AZJ A;  5F99 A;  4ZUX B;  1ID3 D;  3AFA C;  2PYO C;  1BH8 A;  2BYK B;  3KXB C;  1P34 A;  1P3O A;  4J8W D;  1P3G C;  1R4V A;  2IO5 C;  5AV9 B;  3AZL D;  4Z66 C;  3AZF B;  3REK A;  4H9P A;  4YS3 C;  1F66 A;  1WWI A;  3MGP B;  4WU8 C;  1KX3 C;  3B6F A;  3REI D;  4ZUX D;  3KSY A;  5B0Y C;  3REL A;  5B24 B;  1U35 C;  4DRB A;  5BS7 C;  4H9R B;  5AV9 D;  3W97 A;  3AZK D;  4G91 B;  3AZF D;  4YM6 B;  3C1C C;  3REJ B;  3AYW C;  4KHA B;  3MGP D;  3WA9 C;  3W96 B;  5B32 C;  3B0D B;  3EG5 B;  5GT0 B;  5B31 A;  2FJ7 A;  5B24 D;  2Y2L A;  3A6N C;  1KU5 A;  3WKJ C;  1M18 A;  3AZE B;  5B0Z B;  4YM6 D;  3REJ D;  5B33 C;  1P3M B;  5GSU B;  3W96 D;  5GT0 D;  4J8X D;  3REH C;  4J8U B;  5B32 G;  1P3L A;  3KUY A;  1P3P C;  3AZE D;  3AZG B;  5AV8 A;  1BH9 B;  5B0Z D;  3UT9 C;  1P3M D;  3AV1 A;  3MGS B;  2ARO C;  5GSU D;  3X1U B;  2HIO A;  2CWE A;  4J8U D;  3V9R B;  4H9S C;  4JJN A;  4H9N B;  2F2A C;  5GXQ C;  4LD9 C;  3AZG D;  1P3K C;  5AV6 C;  5CPK A;  3MGS D;  1Q9C A;  2BYM B;  2PYO B;  5CPJ A;  4XZQ B;  3X1U D;  4Z66 B;  1ID3 C;  4J8W C;  3X1V B;  4AWL C;  3X1S B;  2RIQ A;  5FUG B;  3REI C;  2PYO D;  2DQN C;  4KGC B;  1S32 A;  4XZQ D;  3LEL A;  2Y2H A;  4ZUX C;  2Y2N A;  4Z66 D;  3UTA A;  5AV9 C;  3X1V D;  4NE3 A;  3WTP B;  3VH6 W;  3TU4 C;  4J8V C;  3AZK C;  3X1S D;  4KUD A;  1HQ3 A;  5JRG C;  3AZF C;  3AZN B;  1M19 A;  3WTP E;  3MGP C;  1P3A C;  5G49 A;  4KGC D;  1ZLA B;  3A6N B;  3EPL A;  5DNM B;  3UTB B;  3MNN A;  4WV4 B;  5AVB A;  3WTP D;  3AL0 C;  3W99 D;  4YM6 C;  3AFA A;  3REJ C;  3AZN D;  3KXB A;  1P3G A;  5B2J B;  3B0D C;  3A6N D;  1ZLA D;  5GT0 C;  5DNM D;  4J8X C;  3AZI A;  3UTB D;  4YS3 A;  3O62 B;  5BNV B;  4WU8 A;  1KX3 A;  1KX5 C;  3VH6 A;  3AZE C;  2XD5 A;  3P5J B;  5B0Y A;  1P3M C;  1U35 A;  3VH5 T;  3B6G A;  5GSU C;  3B0C T;  5B2J D;  4ZBJ B;  3C1C A;  1H3O B;  1BFM A;  3LZ1 B;  3O62 D;  4J8U C;  2NZD B;  1P3K B;  5AV6 B;  2CV5 B;  5B32 A;  3LZ0 B;  5B40 B;  3AZJ B;  1P3I B;  3MGS C;  4CSR B;  3WKJ A;  1AOI B;  2G5I C;  3X1U C;  2F8N B;  1TAF A;  3AV2 A;  5B33 A;  3LZ1 D;  4QLC A;  4AWL B;  2NZD D;  1P3K D;  2CV5 D;  3C1B B;  1P3F B;  3WAA B;  2G5H C;  3LZ0 D;  5B40 D;  3REH A;  3AZJ D;  1P3I D;  1P3P A;  1AOI D;  5B1M B;  4X23 A;  4XZQ C;  2F8N D;  2Y2I A;  3NQJ B;  3UT9 A;  2Y2G A;  3TU4 B;  4J8V B;  2ARO A;  3AZK B;  5E5A B;  5JRG B;  3REK D;  3C1B D;  3X1V C;  1P3F D;  1P3B A;  3WAA D;  3W98 B;  1B67 A;  1P3A B;  2Y2P A;  3X1S C;  3B6F D;  4XUJ A;  5BNX B;  3MGQ B;  4H9S A;  5GXQ A;  4KGC C;  5B1M D;  5B1L A;  3LJA B;  5GT3 A;  3A1K A;  3TU4 D;  4J8V D;  5E5A D;  5JRG D;  5CPI B;  3H0R C;  3WTP C;  1P3A D;  3W98 D;  3W99 C;  3AZN C;  1ID3 A;  3MGQ D;  4J8X B;  4J8W A;  3MVD B;  3NQU A;  3AZL A;  5AV5 B;  3LJA D;  1ZLA C;  1TZY B;  5DNM C;  1KX5 B;  3UTB C;  4WNN A;  3REI A;  4CAY B;  5CPI D;  4UPK A;  2HUE B;  4R8P C;  4ZUX A;  5AVC B;  2BYK A;  5CHL B;  4Z5T B;  3MVD D;  5AV9 A;  2FFF B;  5AY8 C;  5B2J C;  5AV5 D;  1P3L D;  1TZY D;  3AZF A;  1KX5 D;  1M1A B;  2NQB B;  3O62 C;  3MGP A;  4DRA A;  5B24 A;  5AVC D;  1F1E A;  4Z5T D;  4H9R A;  3KFU G;  4ZBJ C;  4YM6 A;  3KWQ B;  3LZ1 C;  3REJ A;  4KHA A;  1M1A D;  2NQB D;  2W8S A;  2NZD C;  2CV5 C;  5C3I B;  3W96 A;  3AZM B;  5GT0 A;  3LZ0 C;  4WU9 B;  5B40 C;  3AZJ C;  1P3I C;  5F99 C;  4E44 A;  1AOI C;  3AZE A;  5B0Z A;  3KWQ D;  1P3M A;  3AZH B;  3R45 B;  3REK C;  5GSU A;  4WZS B;  3C1B C;  3WAA C;  1P3F C;  3IP4 C;  1F66 C;  2F8N H;  3AZM D;  4H9Q B;  4WU9 D;  3B6F C;  4G92 B;  4J8U A;  5KDM B;  5B1M C;  5JA4 A;  1EQZ B;  3MGR B;  3AZG A;  1BH9 A;  3UTA D;  2YFV B;  3AZH D;  3MGS A;  3W97 C;  4KUD D;  2LY8 A;  1HQ3 D;  5E5A C;  2F8N G;  3W99 B;  5B2I B;  3X1U A;  3W98 C;  4Z2M G;  5DNN B;  3MGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...