3KUYC

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyC00
1P3OD 4NE3A 3WAAD 2BYKB 4X23A 3AZJB 5B2JA 4WU9D 1N1JB 1R4VA 1P3KC 4J8WA 1P3BA 4HGAC 3B6FD 3W98C 5B0YA 4J8UA 4XZQD 4JJNB 5B31B 1KX4D 5BT1C 5GSUC 5AV9A 1BH8A 2NQBB 3UTBA 3AV1D 4KUDC 3RELC 1KX5C 2AROC 3AZLB 3AYWD 5AY8C 3AZMA 3AZJD 3REIB 4Z2MG 3AZIA 1ID3B 5B1LC 4Z66A 5AVCC 1ULYA 4H9SC 1P3IA 5CPKC 4ZBJB 4ZUXA 4JJND 5CPJB 5B31D 1JFIB 1U35C 5CPIC 3AZKC 4X23B 3REKA 2NQBD 5B2JB 3W96C 2RVQC 5AV8C 2F8NA 3VH5A 4J8WB 1P3BB 1P34C 5B0YB 4J8UB 3REID 2NZDC 5B1MA 1ZLAA 4Z5TC 1BH8B 3VH6W 5AV9B 5AV6A 2F8NG 1B67A 4YS3C 5CPJD 3UTBB 3AFAC 5B32C 1M1AC 1HQ3C 4X23D 3AZMB 3KWQA 3AZIB 5B2JD 4LD9A 5GT0C 4WZSB 4Z66B 1P3AB 1P3GC 2YFVA 4J8WD 1F66C 1P3BD 4YM6C 1P3IB 2FJ7C 5B0YD 4ZUXB 1M19A 5B2IA 1P3FC 5AV9D 3REKB 1P3PC 4EO5C 2PYOA 3UTBD 2F8NB 3AZFA 3AZMD 3AZID 4H9OA 5C3IC 1WWIA 4Z66D 1P3AD 4J8XD 5B1MB 3W98A 1P3ID 1ZLAB 1B6WA 5AV6B 4DRAA 5G49A 4ZUXD 3X1UC 3UT9A 5BNXA 5GSUA 4QLCC 3KSYA 3REKD 3KWQB 4KUDA 3RELA 4LD9B 1KX5A 3R45A 2F8ND 2AROA 2YFVB 5AY8A 5JA4A 5B1LA 4H9PA 5AVCA 4H9SA 5B1MD 1M19B 5B2IB 5CPKA 1ZLAD 5AV6D 1U35A 5CPIA 1KX3C 2PYOB 3AZKA 3AZFB 1P3LC 4XUJC 3W96A 4H9OB 3KWQD 4Z2MH 5AV8A 3LZ1C 1P3KB 4LD9D 3AYWA 4HGAB 1P34A 3W98B 5G49B 2BYMA 1M19D 5BS7C 2HUEC 5BNXB 4WV4B 5GSUB 4Z5TA 4KUDB 2PYOD 3RELB 3AFAA 5B32A 1KX5B 3X1SC 3R45B 2AROB 1HQ3A 1M1AA 5AY8B 3VH5W 2YFWA 5JA4B 5B1LB 5GT0A 4H9PB 1P3KD 1P3GA 5AVCB 1F66A 5B32G 4WNNA 4YM6A 3W98D 5CPKB 3KUYC 1TZYC 2FJ7A 3B6GC 2F8NH 1U35B 5CPIB 5BT1D 1P3FA 1H3OA 5GSUD 3VH6T 3AZKB 5BO0A 3X1VC 1P3PA 1JFIA 4KUDD 3W96B 3RELD 3TU4C 5AV8B 1KX5D 3AYWB 2AROD 5AY8D 1P34B 5B1LD 4CAYA 2NZDB 5AVCD 2BYMB 3A6NC 5CPKD 4Z5TB 2PYOC 5B33C 5B0ZC 3X1UA 3AZEC 1U35D 5CPID 3AFAB 4R8PC 5B32B 1BFMA 4QLCA 5F99C 1HQ3B 3UTAC 1KU5A 3AZKD 1M1AB 4H9RA 5AVBC 2YFWB 2IO5C 4H9QA 3W96D 2RVQD 5GT0B 1P3GB 5DNMC 5AV8D 4G92C 1F66B 4KHAA 4WNNB 4YM6B 1P34D 2FJ7B 3C1CC 3W99C 1P3AA 4J8XA 2NZDD 1P3FB 1H3OB 3B0CW 4Z5TD 5BO0B 4YS3D 1P3PB 4EO5B 1KX3A 3AFAD 5B32D 3NQJA 3MVDC 3C1BC 1HQ3D 1M1AD 1P3LA 4XUJA 5C3IB 5GT0D 1P3GD 4CAYB 1F66D 5AV5C 5GT3C 3O62D 4YM6D 2FJ7D 5DNNC 3AZNC 3X1UB 5CHLB 5BS7A 4CSRA 1P3FD 4QLCB 3WA9C 1P3PD 4H9RB 4H9QB 3X1SA 4KHAB 1A7WA 4G91C 3X1TC 5B24C 4J8XB 3O62C 3MGQC 3KUYA 1TZYA 1S32C 3X1UD 1KX3B 2HIOC 3NQJB 4QLCD 5CP6C 4AWLC 1P3LB 4XUJB 3TU4A 3LJAC 3LZ1B 3VH5T 5JRGC 1P3MC 1P3KA 1F1EA 2HUEB 4CSRB 5B40C 3KXBC 5B33A 1AOIC 5B0ZA 2CWEA 3AZHC 3AZLC 3AZEA 1KX3D 4R8PA 3X1SB 3MGSC 3NQUA 5F99A 3UTAA 3MGRC 3REHC 1P3LD 4XUJD 5AVBA 4WU8C 3LZ1D 1TAFA 3KUYB 1TZYB 3W99A 3B6GB 3WKJC 3X1VB 3LZ0C 3TU4B 3MVDA 3X1SD 3WTPC 3C1BA 5KDMA 5GT3A 3A6NB 3KUYD 1TZYD 5DNNA 3AZNA 5B33B 5B0ZB 3B6GD 3AZEB 2NZDA 4R8PB 3B0CT 3B0BA 1BH9A 3NQUB 5F99B 4E45A 3UTAB 3REJC 4YS3A 3X1VD 3WA9A 5AVBB 2IO5B 3TU4D 3AN2C 4G92B 2CV5C 4J8VC 1TAFB 5GXQC 3B0DC 3C1CB 3W99B 3O62A 3MGQA 3A6ND 1S32A 5B33D 5B0ZD 3MGPC 3AZED 1EQZC 4R8PD 2HIOA 3MVDB 3AZGC 1HTAA 5F99D 5CP6A 3C1BB 5KDMB 3UTAD 5AVBD 3LJAA 5DNMD 5AV5B 5GT3B 2JSSA 3LELC 5JRGA 5DNNB 3AZNB 3MNNC 3C1CD 3W99D 5B40A 1BH9B 3KXBA 1AOIA 4YS3B 3AZHA 3WA9B 4KGCC 3MGSA 3MVDD 3C1BD 3MGRA 3REHA 5B2IC 4G91B 3X1TB 4WU8A 5B24B 3O62B 5AV5D 5GT3D 3MGQB 3W97C 1S32B 5DNND 3AZND 3AZFC 3WKJA 2HIOB 5CP6B 4AWLB 3WA9D 3LZ0A 5E5AC 3LJAB 3WTPA 3AV2C 5JRGB 3UT9C 3X1TD 1M18C 1P3MB 3LZ1A 5B24D 3MGQD 1P3OC 5B40B 1S32D 3KXBB 1AOIB 3WAAC 3AZHB 4WU9C 3MGSB 2HIOD 4H9NA 5CP6D 3MGRB 3REJA 3REHB 3B6FC 3LJAD 3AN2A 4WU8B 4XZQC 2CV5A 4J8VA 5GXQA 1KX4C 5JRGD 1P3MD 3WKJB 3AV1C 5B40D 3KXBD 1AOID 3MGPA 3B6GA 3AYWC 3AZHD 3AZLD 3AZJC 1EQZA 3LZ0B 1ID3D 3MGSD 3AZGA 3WTPB 4DRBA 3MGRD 3X1VA 4E44A 3WTPE 3REHD 5FUGA 4WU8D 4JJNC 5B31C 3LELA 3MNNA 3WKJD 2NQBC 3A6NA 2F8NK 4H9NB 3REJB 3LZ0D 3REIC 1ID3C 5BNVA 4J8UD 3AN2B 4KGCA 2CV5B 3WTPD 4J8VB 5GXQB 3B0DB 4ZBJC 5DNMA 3W97A 5CPJC 3C1CA 3MGPB 4X23C 1EQZB 5B2JC 3AZGB 4J8WC 3REJD 1P3BC 5E5AA 5FUGB 5B0YC 4J8UC 3AN2D 2CV5D 4J8VD 3LELB 3AV2A 5GXQD 1M18A 3MNNB 5AV9C 5AV5A 4UUZA 3UTBC 1P3OA 3WAAA 4NFTA 3MGPD 4NE6A 3AZMC 4WU9A 1EQZD 3AZIC 5BNVB 4KGCB 1Q9CA 3AZGD 4Z66C 1P3AC 4J8XC 3B6FA 1P3IC 5DNMB 4XZQA 4ZUXC 3W97B 3VH6A 3LELD 1KX4A 3V9RA 3X1TA 3MNND 5B24A 3REKC 4NE5A 3AV1A 2BYKA 3AZJA 5E5AB 4KGCD 1N1JA 5B1MC 3UT9B 3AV2B 5B2ID 1M18B 1ZLAC 5AV6C 4JJNA 5B31A 4UUZB 3W97D 1P3OB 3WAAB 1P3MA 3AZFD 2NQBA 4WU9B 3KWQC 1WWSA 4LD9C 5B31G 3AZLA 3B6FB 3REIA 5E5AD 1ID3A 4XZQB 1KX4B 1M19C 3AV2D 4M6BA 3UT9D 3V9RB 1M18D 2L5AA 5CPJA 3AV1B 2LY8A
chains in the Genus database with same CATH superfamily
1P3OD 4NE3A 3EPLA 2BYKB 3WAAD 4X23A 3AZJB 1Z2CB 5B2JA 4WU9D 2Y2GA 1N1JB 1R4VA 1P3KC 4J8WA 1P3BA 4HGAC 3B6FD 3W98C 5B0YA 4J8UA 4XZQD 4JJNB 5B31B 1KX4D 5BT1C 5GSUC 3EG5B 1BH8A 5AV9A 2UWXA 2NQBB 3UTBA 3AV1D 4KUDC 3RELC 2ZY3A 3KFUG 1KX5C 2AROC 3AZLB 3AYWD 5AY8C 3AZMA 3AZJD 3REIB 4Z2MG 3AZIA 1ID3B 5B1LC 4Z66A 5AVCC 1ULYA 4H9SC 1P3IA 5CPKC 4ZBJB 4ZUXA 4JJND 5CPJB 5B31D 1JFIB 1U35C 5CPIC 3AZKC 4X23B 3REKA 2NQBD 5B2JB 3W96C 2RVQC 5AV8C 2BG1A 2F8NA 3VH5A 4J8WB 1P3BB 1P34C 5B0YB 4J8UB 3REID 2NZDC 5B1MA 1ZLAA 4Z5TC 1BH8B 3VH6W 5AV9B 3IP4C 5AV6A 1B67A 2F8NG 4YS3C 5CPJD 3UTBB 3AFAC 5B32C 2XD5A 1M1AC 1HQ3C 4X23D 3AZMB 3KWQA 3AZIB 5B2JD 4LD9A 5GT0C 4WZSB 4Z66B 1P3AB 1P3GC 2YFVA 4J8WD 1F66C 1P3BD 4YM6C 1P3IB 2FJ7C 2F2AC 5B0YD 4ZUXB 1M19A 5B2IA 1P3FC 5AV9D 2G5IC 2DQNC 2Y2HA 3REKB 1P3PC 4EO5C 2PYOA 3UTBD 3AL0C 2F8NB 3AZFA 2ZM5A 3AZMD 3AZID 4H9OA 2VQRA 5C3IC 4WJ3C 1WWIA 4Z66D 1P3AD 4J8XD 5B1MB 4DQYB 3W98A 1P3ID 1ZLAB 1B6WA 5AV6B 4DRAA 5G49A 4ZUXD 3X1UC 3UT9A 5BNXA 5GSUA 4QLCC 3KSYA 3REKD 3KWQB 4KUDA 3RELA 4LD9B 1KX5A 3R45A 2F8ND 2AROA 2YFVB 5AY8A 5JA4A 2W8SA 5B1LA 4H9PA 5AVCA 4H9SA 5B1MD 1M19B 5B2IB 5CPKA 1ZLAD 2FFFB 5AV6D 1U35A 5CPIA 1KX3C 2PYOB 2Y2QA 3AZKA 3AZFB 1P3LC 4XUJC 3W96A 4H9OB 3KWQD 4Z2MH 5AV8A 3LZ1C 1P3KB 4LD9D 3AYWA 4HGAB 1P34A 3W98B 5G49B 2BYMA 1M19D 5BS7C 2HUEC 5BNXB 4WV4B 5GSUB 4Z5TA 4KUDB 2PYOD 3RELB 3AFAA 5B32A 1KX5B 3X1SC 3R45B 2AROB 1HQ3A 1M1AA 5AY8B 3VH5W 2YFWA 5JA4B 5B1LB 5GT0A 4H9PB 1P3KD 1P3GA 5AVCB 1F66A 3P5JB 5B32G 4WNNA 4YM6A 3W98D 5CPKB 3KUYC 1TZYC 2FJ7A 3B6GC 2F8NH 1U35B 5CPIB 5BT1D 1P3FA 1H3OA 5GSUD 3VH6T 3AZKB 5BO0A 3X1VC 1P3PA 2JCHA 1JFIA 4KUDD 3W96B 3RELD 3TU4C 5AV8B 1KX5D 3AYWB 2AROD 5AY8D 1P34B 5B1LD 4CAYA 2NZDB 5AVCD 2BYMB 3A6NC 5CPKD 4Z5TB 2PYOC 5B33C 5B0ZC 2Y2IA 3H0LC 3X1UA 3AZEC 5CPID 3AFAB 4R8PC 5B32B 1U35D 1BFMA 4QLCA 5F99C 1HQ3B 3UTAC 1KU5A 3AZKD 1M1AB 4H9RA 3F6TA 3H0MC 2YFWB 2IO5C 4H9QA 5AVBC 2RVQD 3W96D 5GT0B 1P3GB 5AV8D 5DNMC 4G92C 1F66B 4KHAA 4WNNB 4YM6B 1P34D 2FJ7B 3C1CC 3W99C 1P3AA 4J8XA 2NZDD 1P3FB 1H3OB 3B0CW 4Z5TD 5BO0B 4YS3D 1P3PB 4EO5B 1KX3A 3AFAD 5B32D 3NQJA 3MVDC 3C1BC 1HQ3D 1M1AD 1P3LA 4XUJA 5C3IB 5GT0D 1P3GD 4CAYB 1F66D 5AV5C 5GT3C 3O62D 4YM6D 2FJ7D 5DNNC 3AZNC 3X1UB 5CHLB 5BS7A 4CSRA 1P3FD 4QLCB 3WA9C 1P3PD 4H9RB 4H9QB 3X1SA 4KHAB 1A7WA 4G91C 4UPKA 3X1TC 2RIQA 5B24C 4J8XB 3FDDA 2Y2PA 3O62C 3MGQC 3KUYA 1TZYA 1S32C 3EPJA 3X1UD 1KX3B 2HIOC 3NQJB 4QLCD 5CP6C 4AWLC 1P3LB 4XUJB 3TU4A 3LJAC 3LZ1B 3VH5T 5JRGC 1P3MC 1P3KA 1F1EA 2HUEB 4CSRB 5B40C 3KXBC 5B33A 1AOIC 5B0ZA 2CWEA 3AZHC 1PZRA 3AZLC 3AZEA 1KX3D 4R8PA 3X1SB 2ZY5A 3NQUA 5F99A 3MGSC 3UTAA 3MGRC 3REHC 1P3LD 4XUJD 5AVBA 4WU8C 3LZ1D 1TAFA 3KUYB 1TZYB 2ZY4A 3W99A 3B6GB 3WKJC 3X1VB 3LZ0C 3TU4B 3MVDA 3X1SD 3WTPC 3C1BA 5KDMA 3EPHA 5GT3A 3A6NB 3KUYD 1TZYD 5DNNA 3AZNA 3A1IA 5B33B 5B0ZB 1T3UA 3B6GD 3AZEB 2NZDA 4R8PB 3B0CT 3B0BA 1BH9A 3NQUB 5F99B 4E45A 3UTAB 3REJC 4YS3A 3X1VD 3WA9A 5AVBB 2IO5B 3TU4D 3AN2C 4G92B 2CV5C 4J8VC 1TAFB 5GXQC 3B0DC 3C1CB 3W99B 2Y2MA 3O62A 3MGQA 3A6ND 1S32A 5B33D 5B0ZD 3MGPC 3AZED 1EQZC 4R8PD 2HIOA 3MVDB 3AZGC 1HTAA 5F99D 5CP6A 3C1BB 5KDMB 3UTAD 5AVBD 3LJAA 1W2EA 5DNMD 5AV5B 5GT3B 2JSSA 3LELC 5JRGA 5DNNB 3AZNB 3MNNC 3C1CD 3W99D 5B40A 1BH9B 3KXBA 1AOIA 4YS3B 3AZHA 3WA9B 2DF4C 4KGCC 3MGSA 3MVDD 3A1KA 3C1BD 3MGRA 3REHA 2ZY2A 5B2IC 4G91B 3X1TB 4WU8A 2Y2OA 5B24B 3O62B 5AV5D 5GT3D 3MGQB 3W97C 1S32B 5DNND 3AZND 3AZFC 3WKJA 2HIOB 5CP6B 4AWLB 3WA9D 3LZ0A 5E5AC 3LJAB 3WTPA 3AV2C 5JRGB 3UT9C 2Y2KA 3X1TD 1M18C 1P3MB 3LZ1A 5B24D 3MGQD 1P3OC 5B40B 1S32D 3KXBB 1AOIB 3WAAC 3AZHB 2XD1A 4WU9C 3H0RC 3MGSB 2HIOD 4H9NA 5CP6D 3MGRB 3REJA 3REHB 3B6FC 3LJAD 3AN2A 4WU8B 2Y2JA 4XZQC 2CV5A 4J8VA 5GXQA 1KX4C 5JRGD 1P3MD 3WKJB 3AV1C 5B40D 3KXBD 1AOID 3MGPA 3B6GA 3AYWC 3AZHD 3AZLD 3AZJC 1EQZA 3LZ0B 1ID3D 3MGSD 3AZGA 3WTPB 4DRBA 3MGRD 3X1VA 4E44A 3WTPE 3REHD 5FUGA 4WU8D 4JJNC 5B31C 3LELA 3MNNA 2Y2LA 3WKJD 2NQBC 3A6NA 2F8NK 4H9NB 3REJB 3LZ0D 3REIC 1ID3C 5BNVA 4J8UD 3AN2B 4KGCA 2CV5B 3WTPD 4J8VB 5GXQB 3B0DB 4ZBJC 5DNMA 2Y2NA 3W97A 5CPJC 3C1CA 3MGPB 4X23C 1EQZB 5B2JC 3EPKA 3AZGB 4J8WC 3REJD 1P3BC 5E5AA 5FUGB 5B0YC 4J8UC 3AN2D 2JE5A 2CV5D 4J8VD 3LELB 3AV2A 5GXQD 1M18A 3MNNB 5AV9C 5AV5A 4UUZA 3UTBC 1P3OA 3WAAA 2J8PA 4NFTA 3MGPD 4NE6A 3AZMC 4WU9A 1EQZD 3AZIC 5BNVB 4KGCB 1Q9CA 3AZGD 4Z66C 1P3AC 4J8XC 3B6FA 1P3IC 5DNMB 4XZQA 4ZUXC 3W97B 3VH6A 3LELD 1KX4A 3V9RA 3X1TA 3MNND 5B24A 3REKC 4NE5A 3AV1A 2BYKA 3AZJA 5E5AB 4KGCD 1N1JA 5B1MC 3UT9B 3AV2B 2G5HC 5B2ID 1M18B 1ZLAC 5AV6C 4JJNA 5B31A 4UUZB 3W97D 1P3OB 3WAAB 1P3MA 3AZFD 2NQBA 4WU9B 3KWQC 1WWSA 4LD9C 5B31G 3AZLA 3B6FB 3REIA 5E5AD 1ID3A 4XZQB 1KX4B 1M19C 3AV2D 4M6BA 3UT9D 3V9RB 1M18D 2L5AA 5CPJA 3AV1B 2LY8A
chains in the Genus database with same CATH topology
1P3OD 4NE3A 3EPLA 2BYKB 3WAAD 4X23A 3AZJB 1Z2CB 5B2JA 4WU9D 2Y2GA 1N1JB 1R4VA 1P3KC 4J8WA 1P3BA 4HGAC 3B6FD 3W98C 5B0YA 4J8UA 4XZQD 4JJNB 5B31B 1KX4D 5BT1C 5GSUC 3EG5B 1BH8A 5AV9A 2UWXA 2NQBB 3UTBA 3AV1D 4KUDC 3RELC 2ZY3A 3KFUG 1KX5C 2AROC 3AZLB 3AYWD 5AY8C 3AZMA 3AZJD 3REIB 4Z2MG 3AZIA 1ID3B 5B1LC 4Z66A 5AVCC 1ULYA 4H9SC 1P3IA 5CPKC 4ZBJB 4ZUXA 4JJND 5CPJB 5B31D 1JFIB 1U35C 5CPIC 3AZKC 4X23B 3REKA 2NQBD 5B2JB 3W96C 2RVQC 5AV8C 2BG1A 2F8NA 3VH5A 4J8WB 1P3BB 1P34C 5B0YB 4J8UB 3REID 2NZDC 5B1MA 1ZLAA 4Z5TC 1BH8B 3VH6W 5AV9B 3IP4C 5AV6A 1B67A 2F8NG 4YS3C 5CPJD 3UTBB 3AFAC 5B32C 2XD5A 1M1AC 1HQ3C 4X23D 3AZMB 3KWQA 3AZIB 5B2JD 4LD9A 5GT0C 4WZSB 4Z66B 1P3AB 1P3GC 2YFVA 4J8WD 1F66C 1P3BD 4YM6C 1P3IB 2FJ7C 2F2AC 5B0YD 4ZUXB 1M19A 5B2IA 1P3FC 5AV9D 2G5IC 2DQNC 2Y2HA 3REKB 1P3PC 4EO5C 2PYOA 3UTBD 3AL0C 2F8NB 3AZFA 2ZM5A 3AZMD 3AZID 4H9OA 2VQRA 5C3IC 4WJ3C 1WWIA 4Z66D 1P3AD 4J8XD 5B1MB 4DQYB 3W98A 1P3ID 1ZLAB 1B6WA 5AV6B 4DRAA 5G49A 4ZUXD 3X1UC 3UT9A 5BNXA 5GSUA 4QLCC 3KSYA 3REKD 3KWQB 4KUDA 3RELA 4LD9B 1KX5A 3R45A 2F8ND 2AROA 2YFVB 5AY8A 5JA4A 2W8SA 5B1LA 4H9PA 5AVCA 4H9SA 5B1MD 1M19B 5B2IB 5CPKA 1ZLAD 2FFFB 5AV6D 1U35A 5CPIA 1KX3C 2PYOB 2Y2QA 3AZKA 3AZFB 1P3LC 4XUJC 3W96A 4H9OB 3KWQD 4Z2MH 5AV8A 3LZ1C 1P3KB 4LD9D 3AYWA 4HGAB 1P34A 3W98B 5G49B 2BYMA 1M19D 5BS7C 2HUEC 5BNXB 4WV4B 5GSUB 4Z5TA 4KUDB 2PYOD 3RELB 3AFAA 5B32A 1KX5B 3X1SC 3R45B 2AROB 1HQ3A 1M1AA 5AY8B 3VH5W 2YFWA 5JA4B 5B1LB 5GT0A 4H9PB 1P3KD 1P3GA 5AVCB 1F66A 3P5JB 5B32G 4WNNA 4YM6A 3W98D 5CPKB 3KUYC 1TZYC 2FJ7A 3B6GC 2F8NH 1U35B 5CPIB 5BT1D 1P3FA 1H3OA 5GSUD 3VH6T 3AZKB 5BO0A 3X1VC 1P3PA 2JCHA 1JFIA 4KUDD 3W96B 3RELD 3TU4C 5AV8B 1KX5D 3AYWB 2AROD 5AY8D 1P34B 5B1LD 4CAYA 2NZDB 5AVCD 2BYMB 3A6NC 5CPKD 4Z5TB 2PYOC 5B33C 5B0ZC 2Y2IA 3H0LC 3X1UA 3AZEC 5CPID 3AFAB 4R8PC 5B32B 1U35D 1BFMA 4QLCA 5F99C 1HQ3B 3UTAC 1KU5A 3AZKD 1M1AB 4H9RA 3F6TA 3H0MC 2YFWB 2IO5C 4H9QA 5AVBC 2RVQD 3W96D 5GT0B 1P3GB 5AV8D 5DNMC 4G92C 1F66B 4KHAA 4WNNB 4YM6B 1P34D 2FJ7B 3C1CC 3W99C 1P3AA 4J8XA 2NZDD 1P3FB 1H3OB 3B0CW 4Z5TD 5BO0B 4YS3D 1P3PB 4EO5B 1KX3A 3AFAD 5B32D 3NQJA 3MVDC 3C1BC 1HQ3D 1M1AD 1P3LA 4XUJA 5C3IB 5GT0D 1P3GD 4CAYB 1F66D 5AV5C 5GT3C 3O62D 4YM6D 2FJ7D 5DNNC 3AZNC 3X1UB 5CHLB 5BS7A 4CSRA 1P3FD 4QLCB 3WA9C 1P3PD 4H9RB 4H9QB 3X1SA 4KHAB 1A7WA 4G91C 4UPKA 3X1TC 2RIQA 5B24C 4J8XB 3FDDA 2Y2PA 3O62C 3MGQC 3KUYA 1TZYA 1S32C 3EPJA 3X1UD 1KX3B 2HIOC 3NQJB 4QLCD 5CP6C 4AWLC 1P3LB 4XUJB 3TU4A 3LJAC 3LZ1B 3VH5T 5JRGC 1P3MC 1P3KA 1F1EA 2HUEB 4CSRB 5B40C 3KXBC 5B33A 1AOIC 5B0ZA 2CWEA 3AZHC 1PZRA 3AZLC 3AZEA 1KX3D 4R8PA 3X1SB 2ZY5A 3NQUA 5F99A 3MGSC 3UTAA 3MGRC 3REHC 1P3LD 4XUJD 5AVBA 4WU8C 3LZ1D 1TAFA 3KUYB 1TZYB 2ZY4A 3W99A 3B6GB 3WKJC 3X1VB 3LZ0C 3TU4B 3MVDA 3X1SD 3WTPC 3C1BA 5KDMA 3EPHA 5GT3A 3A6NB 3KUYD 1TZYD 5DNNA 3AZNA 3A1IA 5B33B 5B0ZB 1T3UA 3B6GD 3AZEB 2NZDA 4R8PB 3B0CT 3B0BA 1BH9A 3NQUB 5F99B 4E45A 3UTAB 3REJC 4YS3A 3X1VD 3WA9A 5AVBB 2IO5B 3TU4D 3AN2C 4G92B 2CV5C 4J8VC 1TAFB 5GXQC 3B0DC 3C1CB 3W99B 2Y2MA 3O62A 3MGQA 3A6ND 1S32A 5B33D 5B0ZD 3MGPC 3AZED 1EQZC 4R8PD 2HIOA 3MVDB 3AZGC 1HTAA 5F99D 5CP6A 3C1BB 5KDMB 3UTAD 5AVBD 3LJAA 1W2EA 5DNMD 5AV5B 5GT3B 2JSSA 3LELC 5JRGA 5DNNB 3AZNB 3MNNC 3C1CD 3W99D 5B40A 1BH9B 3KXBA 1AOIA 4YS3B 3AZHA 3WA9B 2DF4C 4KGCC 3MGSA 3MVDD 3A1KA 3C1BD 3MGRA 3REHA 2ZY2A 5B2IC 4G91B 3X1TB 4WU8A 2Y2OA 5B24B 3O62B 5AV5D 5GT3D 3MGQB 3W97C 1S32B 5DNND 3AZND 3AZFC 3WKJA 2HIOB 5CP6B 4AWLB 3WA9D 3LZ0A 5E5AC 3LJAB 3WTPA 3AV2C 5JRGB 3UT9C 2Y2KA 3X1TD 1M18C 1P3MB 3LZ1A 5B24D 3MGQD 1P3OC 5B40B 1S32D 3KXBB 1AOIB 3WAAC 3AZHB 2XD1A 4WU9C 3H0RC 3MGSB 2HIOD 4H9NA 5CP6D 3MGRB 3REJA 3REHB 3B6FC 3LJAD 3AN2A 4WU8B 2Y2JA 4XZQC 2CV5A 4J8VA 5GXQA 1KX4C 5JRGD 1P3MD 3WKJB 3AV1C 5B40D 3KXBD 1AOID 3MGPA 3B6GA 3AYWC 3AZHD 3AZLD 3AZJC 1EQZA 3LZ0B 1ID3D 3MGSD 3AZGA 3WTPB 4DRBA 3MGRD 3X1VA 4E44A 3WTPE 3REHD 5FUGA 4WU8D 4JJNC 5B31C 3LELA 3MNNA 2Y2LA 3WKJD 2NQBC 3A6NA 2F8NK 4H9NB 3REJB 3LZ0D 3REIC 1ID3C 5BNVA 4J8UD 3AN2B 4KGCA 2CV5B 3WTPD 4J8VB 5GXQB 3B0DB 4ZBJC 5DNMA 2Y2NA 3W97A 5CPJC 3C1CA 3MGPB 4X23C 1EQZB 5B2JC 3EPKA 3AZGB 4J8WC 3REJD 1P3BC 5E5AA 5FUGB 5B0YC 4J8UC 3AN2D 2JE5A 2CV5D 4J8VD 3LELB 3AV2A 5GXQD 1M18A 3MNNB 5AV9C 5AV5A 4UUZA 3UTBC 1P3OA 3WAAA 2J8PA 4NFTA 3MGPD 4NE6A 3AZMC 4WU9A 1EQZD 3AZIC 5BNVB 4KGCB 1Q9CA 3AZGD 4Z66C 1P3AC 4J8XC 3B6FA 1P3IC 5DNMB 4XZQA 4ZUXC 3W97B 3VH6A 3LELD 1KX4A 3V9RA 3X1TA 3MNND 5B24A 3REKC 4NE5A 3AV1A 2BYKA 3AZJA 5E5AB 4KGCD 1N1JA 5B1MC 3UT9B 3AV2B 2G5HC 5B2ID 1M18B 1ZLAC 5AV6C 4JJNA 5B31A 4UUZB 3W97D 1P3OB 3WAAB 1P3MA 3AZFD 2NQBA 4WU9B 3KWQC 1WWSA 4LD9C 5B31G 3AZLA 3B6FB 3REIA 5E5AD 1ID3A 4XZQB 1KX4B 1M19C 3AV2D 4M6BA 3UT9D 3V9RB 1M18D 2L5AA 5CPJA 3AV1B 2LY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O D;  4NE3 A;  3WAA D;  2BYK B;  4X23 A;  3AZJ B;  5B2J A;  4WU9 D;  1N1J B;  1R4V A;  1P3K C;  4J8W A;  1P3B A;  4HGA C;  3B6F D;  3W98 C;  5B0Y A;  4J8U A;  4XZQ D;  4JJN B;  5B31 B;  1KX4 D;  5BT1 C;  5GSU C;  5AV9 A;  1BH8 A;  2NQB B;  3UTB A;  3AV1 D;  4KUD C;  3REL C;  1KX5 C;  2ARO C;  3AZL B;  3AYW D;  5AY8 C;  3AZM A;  3AZJ D;  3REI B;  4Z2M G;  3AZI A;  1ID3 B;  5B1L C;  4Z66 A;  5AVC C;  1ULY A;  4H9S C;  1P3I A;  5CPK C;  4ZBJ B;  4ZUX A;  4JJN D;  5CPJ B;  5B31 D;  1JFI B;  1U35 C;  5CPI C;  3AZK C;  4X23 B;  3REK A;  2NQB D;  5B2J B;  3W96 C;  2RVQ C;  5AV8 C;  2F8N A;  3VH5 A;  4J8W B;  1P3B B;  1P34 C;  5B0Y B;  4J8U B;  3REI D;  2NZD C;  5B1M A;  1ZLA A;  4Z5T C;  1BH8 B;  3VH6 W;  5AV9 B;  5AV6 A;  2F8N G;  1B67 A;  4YS3 C;  5CPJ D;  3UTB B;  3AFA C;  5B32 C;  1M1A C;  1HQ3 C;  4X23 D;  3AZM B;  3KWQ A;  3AZI B;  5B2J D;  4LD9 A;  5GT0 C;  4WZS B;  4Z66 B;  1P3A B;  1P3G C;  2YFV A;  4J8W D;  1F66 C;  1P3B D;  4YM6 C;  1P3I B;  2FJ7 C;  5B0Y D;  4ZUX B;  1M19 A;  5B2I A;  1P3F C;  5AV9 D;  3REK B;  1P3P C;  4EO5 C;  2PYO A;  3UTB D;  2F8N B;  3AZF A;  3AZM D;  3AZI D;  4H9O A;  5C3I C;  1WWI A;  4Z66 D;  1P3A D;  4J8X D;  5B1M B;  3W98 A;  1P3I D;  1ZLA B;  1B6W A;  5AV6 B;  4DRA A;  5G49 A;  4ZUX D;  3X1U C;  3UT9 A;  5BNX A;  5GSU A;  4QLC C;  3KSY A;  3REK D;  3KWQ B;  4KUD A;  3REL A;  4LD9 B;  1KX5 A;  3R45 A;  2F8N D;  2ARO A;  2YFV B;  5AY8 A;  5JA4 A;  5B1L A;  4H9P A;  5AVC A;  4H9S A;  5B1M D;  1M19 B;  5B2I B;  5CPK A;  1ZLA D;  5AV6 D;  1U35 A;  5CPI A;  1KX3 C;  2PYO B;  3AZK A;  3AZF B;  1P3L C;  4XUJ C;  3W96 A;  4H9O B;  3KWQ D;  4Z2M H;  5AV8 A;  3LZ1 C;  1P3K B;  4LD9 D;  3AYW A;  4HGA B;  1P34 A;  3W98 B;  5G49 B;  2BYM A;  1M19 D;  5BS7 C;  2HUE C;  5BNX B;  4WV4 B;  5GSU B;  4Z5T A;  4KUD B;  2PYO D;  3REL B;  3AFA A;  5B32 A;  1KX5 B;  3X1S C;  3R45 B;  2ARO B;  1HQ3 A;  1M1A A;  5AY8 B;  3VH5 W;  2YFW A;  5JA4 B;  5B1L B;  5GT0 A;  4H9P B;  1P3K D;  1P3G A;  5AVC B;  1F66 A;  5B32 G;  4WNN A;  4YM6 A;  3W98 D;  5CPK B;  3KUY C;  1TZY C;  2FJ7 A;  3B6G C;  2F8N H;  1U35 B;  5CPI B;  5BT1 D;  1P3F A;  1H3O A;  5GSU D;  3VH6 T;  3AZK B;  5BO0 A;  3X1V C;  1P3P A;  1JFI A;  4KUD D;  3W96 B;  3REL D;  3TU4 C;  5AV8 B;  1KX5 D;  3AYW B;  2ARO D;  5AY8 D;  1P34 B;  5B1L D;  4CAY A;  2NZD B;  5AVC D;  2BYM B;  3A6N C;  5CPK D;  4Z5T B;  2PYO C;  5B33 C;  5B0Z C;  3X1U A;  3AZE C;  1U35 D;  5CPI D;  3AFA B;  4R8P C;  5B32 B;  1BFM A;  4QLC A;  5F99 C;  1HQ3 B;  3UTA C;  1KU5 A;  3AZK D;  1M1A B;  4H9R A;  5AVB C;  2YFW B;  2IO5 C;  4H9Q A;  3W96 D;  2RVQ D;  5GT0 B;  1P3G B;  5DNM C;  5AV8 D;  4G92 C;  1F66 B;  4KHA A;  4WNN B;  4YM6 B;  1P34 D;  2FJ7 B;  3C1C C;  3W99 C;  1P3A A;  4J8X A;  2NZD D;  1P3F B;  1H3O B;  3B0C W;  4Z5T D;  5BO0 B;  4YS3 D;  1P3P B;  4EO5 B;  1KX3 A;  3AFA D;  5B32 D;  3NQJ A;  3MVD C;  3C1B C;  1HQ3 D;  1M1A D;  1P3L A;  4XUJ A;  5C3I B;  5GT0 D;  1P3G D;  4CAY B;  1F66 D;  5AV5 C;  5GT3 C;  3O62 D;  4YM6 D;  2FJ7 D;  5DNN C;  3AZN C;  3X1U B;  5CHL B;  5BS7 A;  4CSR A;  1P3F D;  4QLC B;  3WA9 C;  1P3P D;  4H9R B;  4H9Q B;  3X1S A;  4KHA B;  1A7W A;  4G91 C;  3X1T C;  5B24 C;  4J8X B;  3O62 C;  3MGQ C;  3KUY A;  1TZY A;  1S32 C;  3X1U D;  1KX3 B;  2HIO C;  3NQJ B;  4QLC D;  5CP6 C;  4AWL C;  1P3L B;  4XUJ B;  3TU4 A;  3LJA C;  3LZ1 B;  3VH5 T;  5JRG C;  1P3M C;  1P3K A;  1F1E A;  2HUE B;  4CSR B;  5B40 C;  3KXB C;  5B33 A;  1AOI C;  5B0Z A;  2CWE A;  3AZH C;  3AZL C;  3AZE A;  1KX3 D;  4R8P A;  3X1S B;  3MGS C;  3NQU A;  5F99 A;  3UTA A;  3MGR C;  3REH C;  1P3L D;  4XUJ D;  5AVB A;  4WU8 C;  3LZ1 D;  1TAF A;  3KUY B;  1TZY B;  3W99 A;  3B6G B;  3WKJ C;  3X1V B;  3LZ0 C;  3TU4 B;  3MVD A;  3X1S D;  3WTP C;  3C1B A;  5KDM A;  5GT3 A;  3A6N B;  3KUY D;  1TZY D;  5DNN A;  3AZN A;  5B33 B;  5B0Z B;  3B6G D;  3AZE B;  2NZD A;  4R8P B;  3B0C T;  3B0B A;  1BH9 A;  3NQU B;  5F99 B;  4E45 A;  3UTA B;  3REJ C;  4YS3 A;  3X1V D;  3WA9 A;  5AVB B;  2IO5 B;  3TU4 D;  3AN2 C;  4G92 B;  2CV5 C;  4J8V C;  1TAF B;  5GXQ C;  3B0D C;  3C1C B;  3W99 B;  3O62 A;  3MGQ A;  3A6N D;  1S32 A;  5B33 D;  5B0Z D;  3MGP C;  3AZE D;  1EQZ C;  4R8P D;  2HIO A;  3MVD B;  3AZG C;  1HTA A;  5F99 D;  5CP6 A;  3C1B B;  5KDM B;  3UTA D;  5AVB D;  3LJA A;  5DNM D;  5AV5 B;  5GT3 B;  2JSS A;  3LEL C;  5JRG A;  5DNN B;  3AZN B;  3MNN C;  3C1C D;  3W99 D;  5B40 A;  1BH9 B;  3KXB A;  1AOI A;  4YS3 B;  3AZH A;  3WA9 B;  4KGC C;  3MGS A;  3MVD D;  3C1B D;  3MGR A;  3REH A;  5B2I C;  4G91 B;  3X1T B;  4WU8 A;  5B24 B;  3O62 B;  5AV5 D;  5GT3 D;  3MGQ B;  3W97 C;  1S32 B;  5DNN D;  3AZN D;  3AZF C;  3WKJ A;  2HIO B;  5CP6 B;  4AWL B;  3WA9 D;  3LZ0 A;  5E5A C;  3LJA B;  3WTP A;  3AV2 C;  5JRG B;  3UT9 C;  3X1T D;  1M18 C;  1P3M B;  3LZ1 A;  5B24 D;  3MGQ D;  1P3O C;  5B40 B;  1S32 D;  3KXB B;  1AOI B;  3WAA C;  3AZH B;  4WU9 C;  3MGS B;  2HIO D;  4H9N A;  5CP6 D;  3MGR B;  3REJ A;  3REH B;  3B6F C;  3LJA D;  3AN2 A;  4WU8 B;  4XZQ C;  2CV5 A;  4J8V A;  5GXQ A;  1KX4 C;  5JRG D;  1P3M D;  3WKJ B;  3AV1 C;  5B40 D;  3KXB D;  1AOI D;  3MGP A;  3B6G A;  3AYW C;  3AZH D;  3AZL D;  3AZJ C;  1EQZ A;  3LZ0 B;  1ID3 D;  3MGS D;  3AZG A;  3WTP B;  4DRB A;  3MGR D;  3X1V A;  4E44 A;  3WTP E;  3REH D;  5FUG A;  4WU8 D;  4JJN C;  5B31 C;  3LEL A;  3MNN A;  3WKJ D;  2NQB C;  3A6N A;  2F8N K;  4H9N B;  3REJ B;  3LZ0 D;  3REI C;  1ID3 C;  5BNV A;  4J8U D;  3AN2 B;  4KGC A;  2CV5 B;  3WTP D;  4J8V B;  5GXQ B;  3B0D B;  4ZBJ C;  5DNM A;  3W97 A;  5CPJ C;  3C1C A;  3MGP B;  4X23 C;  1EQZ B;  5B2J C;  3AZG B;  4J8W C;  3REJ D;  1P3B C;  5E5A A;  5FUG B;  5B0Y C;  4J8U C;  3AN2 D;  2CV5 D;  4J8V D;  3LEL B;  3AV2 A;  5GXQ D;  1M18 A;  3MNN B;  5AV9 C;  5AV5 A;  4UUZ A;  3UTB C;  1P3O A;  3WAA A;  4NFT A;  3MGP D;  4NE6 A;  3AZM C;  4WU9 A;  1EQZ D;  3AZI C;  5BNV B;  4KGC B;  1Q9C A;  3AZG D;  4Z66 C;  1P3A C;  4J8X C;  3B6F A;  1P3I C;  5DNM B;  4XZQ A;  4ZUX C;  3W97 B;  3VH6 A;  3LEL D;  1KX4 A;  3V9R A;  3X1T A;  3MNN D;  5B24 A;  3REK C;  4NE5 A;  3AV1 A;  2BYK A;  3AZJ A;  5E5A B;  4KGC D;  1N1J A;  5B1M C;  3UT9 B;  3AV2 B;  5B2I D;  1M18 B;  1ZLA C;  5AV6 C;  4JJN A;  5B31 A;  4UUZ B;  3W97 D;  1P3O B;  3WAA B;  1P3M A;  3AZF D;  2NQB A;  4WU9 B;  3KWQ C;  1WWS A;  4LD9 C;  5B31 G;  3AZL A;  3B6F B;  3REI A;  5E5A D;  1ID3 A;  4XZQ B;  1KX4 B;  1M19 C;  3AV2 D;  4M6B A;  3UT9 D;  3V9R B;  1M18 D;  2L5A A;  5CPJ A;  3AV1 B;  2LY8 A; 
#chains in the Genus database with same CATH topology
 1P3O D;  4NE3 A;  3EPL A;  2BYK B;  3WAA D;  4X23 A;  3AZJ B;  1Z2C B;  5B2J A;  4WU9 D;  2Y2G A;  1N1J B;  1R4V A;  1P3K C;  4J8W A;  1P3B A;  4HGA C;  3B6F D;  3W98 C;  5B0Y A;  4J8U A;  4XZQ D;  4JJN B;  5B31 B;  1KX4 D;  5BT1 C;  5GSU C;  3EG5 B;  1BH8 A;  5AV9 A;  2UWX A;  2NQB B;  3UTB A;  3AV1 D;  4KUD C;  3REL C;  2ZY3 A;  3KFU G;  1KX5 C;  2ARO C;  3AZL B;  3AYW D;  5AY8 C;  3AZM A;  3AZJ D;  3REI B;  4Z2M G;  3AZI A;  1ID3 B;  5B1L C;  4Z66 A;  5AVC C;  1ULY A;  4H9S C;  1P3I A;  5CPK C;  4ZBJ B;  4ZUX A;  4JJN D;  5CPJ B;  5B31 D;  1JFI B;  1U35 C;  5CPI C;  3AZK C;  4X23 B;  3REK A;  2NQB D;  5B2J B;  3W96 C;  2RVQ C;  5AV8 C;  2BG1 A;  2F8N A;  3VH5 A;  4J8W B;  1P3B B;  1P34 C;  5B0Y B;  4J8U B;  3REI D;  2NZD C;  5B1M A;  1ZLA A;  4Z5T C;  1BH8 B;  3VH6 W;  5AV9 B;  3IP4 C;  5AV6 A;  1B67 A;  2F8N G;  4YS3 C;  5CPJ D;  3UTB B;  3AFA C;  5B32 C;  2XD5 A;  1M1A C;  1HQ3 C;  4X23 D;  3AZM B;  3KWQ A;  3AZI B;  5B2J D;  4LD9 A;  5GT0 C;  4WZS B;  4Z66 B;  1P3A B;  1P3G C;  2YFV A;  4J8W D;  1F66 C;  1P3B D;  4YM6 C;  1P3I B;  2FJ7 C;  2F2A C;  5B0Y D;  4ZUX B;  1M19 A;  5B2I A;  1P3F C;  5AV9 D;  2G5I C;  2DQN C;  2Y2H A;  3REK B;  1P3P C;  4EO5 C;  2PYO A;  3UTB D;  3AL0 C;  2F8N B;  3AZF A;  2ZM5 A;  3AZM D;  3AZI D;  4H9O A;  2VQR A;  5C3I C;  4WJ3 C;  1WWI A;  4Z66 D;  1P3A D;  4J8X D;  5B1M B;  4DQY B;  3W98 A;  1P3I D;  1ZLA B;  1B6W A;  5AV6 B;  4DRA A;  5G49 A;  4ZUX D;  3X1U C;  3UT9 A;  5BNX A;  5GSU A;  4QLC C;  3KSY A;  3REK D;  3KWQ B;  4KUD A;  3REL A;  4LD9 B;  1KX5 A;  3R45 A;  2F8N D;  2ARO A;  2YFV B;  5AY8 A;  5JA4 A;  2W8S A;  5B1L A;  4H9P A;  5AVC A;  4H9S A;  5B1M D;  1M19 B;  5B2I B;  5CPK A;  1ZLA D;  2FFF B;  5AV6 D;  1U35 A;  5CPI A;  1KX3 C;  2PYO B;  2Y2Q A;  3AZK A;  3AZF B;  1P3L C;  4XUJ C;  3W96 A;  4H9O B;  3KWQ D;  4Z2M H;  5AV8 A;  3LZ1 C;  1P3K B;  4LD9 D;  3AYW A;  4HGA B;  1P34 A;  3W98 B;  5G49 B;  2BYM A;  1M19 D;  5BS7 C;  2HUE C;  5BNX B;  4WV4 B;  5GSU B;  4Z5T A;  4KUD B;  2PYO D;  3REL B;  3AFA A;  5B32 A;  1KX5 B;  3X1S C;  3R45 B;  2ARO B;  1HQ3 A;  1M1A A;  5AY8 B;  3VH5 W;  2YFW A;  5JA4 B;  5B1L B;  5GT0 A;  4H9P B;  1P3K D;  1P3G A;  5AVC B;  1F66 A;  3P5J B;  5B32 G;  4WNN A;  4YM6 A;  3W98 D;  5CPK B;  3KUY C;  1TZY C;  2FJ7 A;  3B6G C;  2F8N H;  1U35 B;  5CPI B;  5BT1 D;  1P3F A;  1H3O A;  5GSU D;  3VH6 T;  3AZK B;  5BO0 A;  3X1V C;  1P3P A;  2JCH A;  1JFI A;  4KUD D;  3W96 B;  3REL D;  3TU4 C;  5AV8 B;  1KX5 D;  3AYW B;  2ARO D;  5AY8 D;  1P34 B;  5B1L D;  4CAY A;  2NZD B;  5AVC D;  2BYM B;  3A6N C;  5CPK D;  4Z5T B;  2PYO C;  5B33 C;  5B0Z C;  2Y2I A;  3H0L C;  3X1U A;  3AZE C;  5CPI D;  3AFA B;  4R8P C;  5B32 B;  1U35 D;  1BFM A;  4QLC A;  5F99 C;  1HQ3 B;  3UTA C;  1KU5 A;  3AZK D;  1M1A B;  4H9R A;  3F6T A;  3H0M C;  2YFW B;  2IO5 C;  4H9Q A;  5AVB C;  2RVQ D;  3W96 D;  5GT0 B;  1P3G B;  5AV8 D;  5DNM C;  4G92 C;  1F66 B;  4KHA A;  4WNN B;  4YM6 B;  1P34 D;  2FJ7 B;  3C1C C;  3W99 C;  1P3A A;  4J8X A;  2NZD D;  1P3F B;  1H3O B;  3B0C W;  4Z5T D;  5BO0 B;  4YS3 D;  1P3P B;  4EO5 B;  1KX3 A;  3AFA D;  5B32 D;  3NQJ A;  3MVD C;  3C1B C;  1HQ3 D;  1M1A D;  1P3L A;  4XUJ A;  5C3I B;  5GT0 D;  1P3G D;  4CAY B;  1F66 D;  5AV5 C;  5GT3 C;  3O62 D;  4YM6 D;  2FJ7 D;  5DNN C;  3AZN C;  3X1U B;  5CHL B;  5BS7 A;  4CSR A;  1P3F D;  4QLC B;  3WA9 C;  1P3P D;  4H9R B;  4H9Q B;  3X1S A;  4KHA B;  1A7W A;  4G91 C;  4UPK A;  3X1T C;  2RIQ A;  5B24 C;  4J8X B;  3FDD A;  2Y2P A;  3O62 C;  3MGQ C;  3KUY A;  1TZY A;  1S32 C;  3EPJ A;  3X1U D;  1KX3 B;  2HIO C;  3NQJ B;  4QLC D;  5CP6 C;  4AWL C;  1P3L B;  4XUJ B;  3TU4 A;  3LJA C;  3LZ1 B;  3VH5 T;  5JRG C;  1P3M C;  1P3K A;  1F1E A;  2HUE B;  4CSR B;  5B40 C;  3KXB C;  5B33 A;  1AOI C;  5B0Z A;  2CWE A;  3AZH C;  1PZR A;  3AZL C;  3AZE A;  1KX3 D;  4R8P A;  3X1S B;  2ZY5 A;  3NQU A;  5F99 A;  3MGS C;  3UTA A;  3MGR C;  3REH C;  1P3L D;  4XUJ D;  5AVB A;  4WU8 C;  3LZ1 D;  1TAF A;  3KUY B;  1TZY B;  2ZY4 A;  3W99 A;  3B6G B;  3WKJ C;  3X1V B;  3LZ0 C;  3TU4 B;  3MVD A;  3X1S D;  3WTP C;  3C1B A;  5KDM A;  3EPH A;  5GT3 A;  3A6N B;  3KUY D;  1TZY D;  5DNN A;  3AZN A;  3A1I A;  5B33 B;  5B0Z B;  1T3U A;  3B6G D;  3AZE B;  2NZD A;  4R8P B;  3B0C T;  3B0B A;  1BH9 A;  3NQU B;  5F99 B;  4E45 A;  3UTA B;  3REJ C;  4YS3 A;  3X1V D;  3WA9 A;  5AVB B;  2IO5 B;  3TU4 D;  3AN2 C;  4G92 B;  2CV5 C;  4J8V C;  1TAF B;  5GXQ C;  3B0D C;  3C1C B;  3W99 B;  2Y2M A;  3O62 A;  3MGQ A;  3A6N D;  1S32 A;  5B33 D;  5B0Z D;  3MGP C;  3AZE D;  1EQZ C;  4R8P D;  2HIO A;  3MVD B;  3AZG C;  1HTA A;  5F99 D;  5CP6 A;  3C1B B;  5KDM B;  3UTA D;  5AVB D;  3LJA A;  1W2E A;  5DNM D;  5AV5 B;  5GT3 B;  2JSS A;  3LEL C;  5JRG A;  5DNN B;  3AZN B;  3MNN C;  3C1C D;  3W99 D;  5B40 A;  1BH9 B;  3KXB A;  1AOI A;  4YS3 B;  3AZH A;  3WA9 B;  2DF4 C;  4KGC C;  3MGS A;  3MVD D;  3A1K A;  3C1B D;  3MGR A;  3REH A;  2ZY2 A;  5B2I C;  4G91 B;  3X1T B;  4WU8 A;  2Y2O A;  5B24 B;  3O62 B;  5AV5 D;  5GT3 D;  3MGQ B;  3W97 C;  1S32 B;  5DNN D;  3AZN D;  3AZF C;  3WKJ A;  2HIO B;  5CP6 B;  4AWL B;  3WA9 D;  3LZ0 A;  5E5A C;  3LJA B;  3WTP A;  3AV2 C;  5JRG B;  3UT9 C;  2Y2K A;  3X1T D;  1M18 C;  1P3M B;  3LZ1 A;  5B24 D;  3MGQ D;  1P3O C;  5B40 B;  1S32 D;  3KXB B;  1AOI B;  3WAA C;  3AZH B;  2XD1 A;  4WU9 C;  3H0R C;  3MGS B;  2HIO D;  4H9N A;  5CP6 D;  3MGR B;  3REJ A;  3REH B;  3B6F C;  3LJA D;  3AN2 A;  4WU8 B;  2Y2J A;  4XZQ C;  2CV5 A;  4J8V A;  5GXQ A;  1KX4 C;  5JRG D;  1P3M D;  3WKJ B;  3AV1 C;  5B40 D;  3KXB D;  1AOI D;  3MGP A;  3B6G A;  3AYW C;  3AZH D;  3AZL D;  3AZJ C;  1EQZ A;  3LZ0 B;  1ID3 D;  3MGS D;  3AZG A;  3WTP B;  4DRB A;  3MGR D;  3X1V A;  4E44 A;  3WTP E;  3REH D;  5FUG A;  4WU8 D;  4JJN C;  5B31 C;  3LEL A;  3MNN A;  2Y2L A;  3WKJ D;  2NQB C;  3A6N A;  2F8N K;  4H9N B;  3REJ B;  3LZ0 D;  3REI C;  1ID3 C;  5BNV A;  4J8U D;  3AN2 B;  4KGC A;  2CV5 B;  3WTP D;  4J8V B;  5GXQ B;  3B0D B;  4ZBJ C;  5DNM A;  2Y2N A;  3W97 A;  5CPJ C;  3C1C A;  3MGP B;  4X23 C;  1EQZ B;  5B2J C;  3EPK A;  3AZG B;  4J8W C;  3REJ D;  1P3B C;  5E5A A;  5FUG B;  5B0Y C;  4J8U C;  3AN2 D;  2JE5 A;  2CV5 D;  4J8V D;  3LEL B;  3AV2 A;  5GXQ D;  1M18 A;  3MNN B;  5AV9 C;  5AV5 A;  4UUZ A;  3UTB C;  1P3O A;  3WAA A;  2J8P A;  4NFT A;  3MGP D;  4NE6 A;  3AZM C;  4WU9 A;  1EQZ D;  3AZI C;  5BNV B;  4KGC B;  1Q9C A;  3AZG D;  4Z66 C;  1P3A C;  4J8X C;  3B6F A;  1P3I C;  5DNM B;  4XZQ A;  4ZUX C;  3W97 B;  3VH6 A;  3LEL D;  1KX4 A;  3V9R A;  3X1T A;  3MNN D;  5B24 A;  3REK C;  4NE5 A;  3AV1 A;  2BYK A;  3AZJ A;  5E5A B;  4KGC D;  1N1J A;  5B1M C;  3UT9 B;  3AV2 B;  2G5H C;  5B2I D;  1M18 B;  1ZLA C;  5AV6 C;  4JJN A;  5B31 A;  4UUZ B;  3W97 D;  1P3O B;  3WAA B;  1P3M A;  3AZF D;  2NQB A;  4WU9 B;  3KWQ C;  1WWS A;  4LD9 C;  5B31 G;  3AZL A;  3B6F B;  3REI A;  5E5A D;  1ID3 A;  4XZQ B;  1KX4 B;  1M19 C;  3AV2 D;  4M6B A;  3UT9 D;  3V9R B;  1M18 D;  2L5A A;  5CPJ A;  3AV1 B;  2LY8 A; 
#chains in the Genus database with same CATH homology
 1P3O D;  4NE3 A;  3EPL A;  2BYK B;  3WAA D;  4X23 A;  3AZJ B;  1Z2C B;  5B2J A;  4WU9 D;  2Y2G A;  1N1J B;  1R4V A;  1P3K C;  4J8W A;  1P3B A;  4HGA C;  3B6F D;  3W98 C;  5B0Y A;  4J8U A;  4XZQ D;  4JJN B;  5B31 B;  1KX4 D;  5BT1 C;  5GSU C;  3EG5 B;  1BH8 A;  5AV9 A;  2UWX A;  2NQB B;  3UTB A;  3AV1 D;  4KUD C;  3REL C;  2ZY3 A;  3KFU G;  1KX5 C;  2ARO C;  3AZL B;  3AYW D;  5AY8 C;  3AZM A;  3AZJ D;  3REI B;  4Z2M G;  3AZI A;  1ID3 B;  5B1L C;  4Z66 A;  5AVC C;  1ULY A;  4H9S C;  1P3I A;  5CPK C;  4ZBJ B;  4ZUX A;  4JJN D;  5CPJ B;  5B31 D;  1JFI B;  1U35 C;  5CPI C;  3AZK C;  4X23 B;  3REK A;  2NQB D;  5B2J B;  3W96 C;  2RVQ C;  5AV8 C;  2BG1 A;  2F8N A;  3VH5 A;  4J8W B;  1P3B B;  1P34 C;  5B0Y B;  4J8U B;  3REI D;  2NZD C;  5B1M A;  1ZLA A;  4Z5T C;  1BH8 B;  3VH6 W;  5AV9 B;  3IP4 C;  5AV6 A;  1B67 A;  2F8N G;  4YS3 C;  5CPJ D;  3UTB B;  3AFA C;  5B32 C;  2XD5 A;  1M1A C;  1HQ3 C;  4X23 D;  3AZM B;  3KWQ A;  3AZI B;  5B2J D;  4LD9 A;  5GT0 C;  4WZS B;  4Z66 B;  1P3A B;  1P3G C;  2YFV A;  4J8W D;  1F66 C;  1P3B D;  4YM6 C;  1P3I B;  2FJ7 C;  2F2A C;  5B0Y D;  4ZUX B;  1M19 A;  5B2I A;  1P3F C;  5AV9 D;  2G5I C;  2DQN C;  2Y2H A;  3REK B;  1P3P C;  4EO5 C;  2PYO A;  3UTB D;  3AL0 C;  2F8N B;  3AZF A;  2ZM5 A;  3AZM D;  3AZI D;  4H9O A;  2VQR A;  5C3I C;  4WJ3 C;  1WWI A;  4Z66 D;  1P3A D;  4J8X D;  5B1M B;  4DQY B;  3W98 A;  1P3I D;  1ZLA B;  1B6W A;  5AV6 B;  4DRA A;  5G49 A;  4ZUX D;  3X1U C;  3UT9 A;  5BNX A;  5GSU A;  4QLC C;  3KSY A;  3REK D;  3KWQ B;  4KUD A;  3REL A;  4LD9 B;  1KX5 A;  3R45 A;  2F8N D;  2ARO A;  2YFV B;  5AY8 A;  5JA4 A;  2W8S A;  5B1L A;  4H9P A;  5AVC A;  4H9S A;  5B1M D;  1M19 B;  5B2I B;  5CPK A;  1ZLA D;  2FFF B;  5AV6 D;  1U35 A;  5CPI A;  1KX3 C;  2PYO B;  2Y2Q A;  3AZK A;  3AZF B;  1P3L C;  4XUJ C;  3W96 A;  4H9O B;  3KWQ D;  4Z2M H;  5AV8 A;  3LZ1 C;  1P3K B;  4LD9 D;  3AYW A;  4HGA B;  1P34 A;  3W98 B;  5G49 B;  2BYM A;  1M19 D;  5BS7 C;  2HUE C;  5BNX B;  4WV4 B;  5GSU B;  4Z5T A;  4KUD B;  2PYO D;  3REL B;  3AFA A;  5B32 A;  1KX5 B;  3X1S C;  3R45 B;  2ARO B;  1HQ3 A;  1M1A A;  5AY8 B;  3VH5 W;  2YFW A;  5JA4 B;  5B1L B;  5GT0 A;  4H9P B;  1P3K D;  1P3G A;  5AVC B;  1F66 A;  3P5J B;  5B32 G;  4WNN A;  4YM6 A;  3W98 D;  5CPK B;  3KUY C;  1TZY C;  2FJ7 A;  3B6G C;  2F8N H;  1U35 B;  5CPI B;  5BT1 D;  1P3F A;  1H3O A;  5GSU D;  3VH6 T;  3AZK B;  5BO0 A;  3X1V C;  1P3P A;  2JCH A;  1JFI A;  4KUD D;  3W96 B;  3REL D;  3TU4 C;  5AV8 B;  1KX5 D;  3AYW B;  2ARO D;  5AY8 D;  1P34 B;  5B1L D;  4CAY A;  2NZD B;  5AVC D;  2BYM B;  3A6N C;  5CPK D;  4Z5T B;  2PYO C;  5B33 C;  5B0Z C;  2Y2I A;  3H0L C;  3X1U A;  3AZE C;  5CPI D;  3AFA B;  4R8P C;  5B32 B;  1U35 D;  1BFM A;  4QLC A;  5F99 C;  1HQ3 B;  3UTA C;  1KU5 A;  3AZK D;  1M1A B;  4H9R A;  3F6T A;  3H0M C;  2YFW B;  2IO5 C;  4H9Q A;  5AVB C;  2RVQ D;  3W96 D;  5GT0 B;  1P3G B;  5AV8 D;  5DNM C;  4G92 C;  1F66 B;  4KHA A;  4WNN B;  4YM6 B;  1P34 D;  2FJ7 B;  3C1C C;  3W99 C;  1P3A A;  4J8X A;  2NZD D;  1P3F B;  1H3O B;  3B0C W;  4Z5T D;  5BO0 B;  4YS3 D;  1P3P B;  4EO5 B;  1KX3 A;  3AFA D;  5B32 D;  3NQJ A;  3MVD C;  3C1B C;  1HQ3 D;  1M1A D;  1P3L A;  4XUJ A;  5C3I B;  5GT0 D;  1P3G D;  4CAY B;  1F66 D;  5AV5 C;  5GT3 C;  3O62 D;  4YM6 D;  2FJ7 D;  5DNN C;  3AZN C;  3X1U B;  5CHL B;  5BS7 A;  4CSR A;  1P3F D;  4QLC B;  3WA9 C;  1P3P D;  4H9R B;  4H9Q B;  3X1S A;  4KHA B;  1A7W A;  4G91 C;  4UPK A;  3X1T C;  2RIQ A;  5B24 C;  4J8X B;  3FDD A;  2Y2P A;  3O62 C;  3MGQ C;  3KUY A;  1TZY A;  1S32 C;  3EPJ A;  3X1U D;  1KX3 B;  2HIO C;  3NQJ B;  4QLC D;  5CP6 C;  4AWL C;  1P3L B;  4XUJ B;  3TU4 A;  3LJA C;  3LZ1 B;  3VH5 T;  5JRG C;  1P3M C;  1P3K A;  1F1E A;  2HUE B;  4CSR B;  5B40 C;  3KXB C;  5B33 A;  1AOI C;  5B0Z A;  2CWE A;  3AZH C;  1PZR A;  3AZL C;  3AZE A;  1KX3 D;  4R8P A;  3X1S B;  2ZY5 A;  3NQU A;  5F99 A;  3MGS C;  3UTA A;  3MGR C;  3REH C;  1P3L D;  4XUJ D;  5AVB A;  4WU8 C;  3LZ1 D;  1TAF A;  3KUY B;  1TZY B;  2ZY4 A;  3W99 A;  3B6G B;  3WKJ C;  3X1V B;  3LZ0 C;  3TU4 B;  3MVD A;  3X1S D;  3WTP C;  3C1B A;  5KDM A;  3EPH A;  5GT3 A;  3A6N B;  3KUY D;  1TZY D;  5DNN A;  3AZN A;  3A1I A;  5B33 B;  5B0Z B;  1T3U A;  3B6G D;  3AZE B;  2NZD A;  4R8P B;  3B0C T;  3B0B A;  1BH9 A;  3NQU B;  5F99 B;  4E45 A;  3UTA B;  3REJ C;  4YS3 A;  3X1V D;  3WA9 A;  5AVB B;  2IO5 B;  3TU4 D;  3AN2 C;  4G92 B;  2CV5 C;  4J8V C;  1TAF B;  5GXQ C;  3B0D C;  3C1C B;  3W99 B;  2Y2M A;  3O62 A;  3MGQ A;  3A6N D;  1S32 A;  5B33 D;  5B0Z D;  3MGP C;  3AZE D;  1EQZ C;  4R8P D;  2HIO A;  3MVD B;  3AZG C;  1HTA A;  5F99 D;  5CP6 A;  3C1B B;  5KDM B;  3UTA D;  5AVB D;  3LJA A;  1W2E A;  5DNM D;  5AV5 B;  5GT3 B;  2JSS A;  3LEL C;  5JRG A;  5DNN B;  3AZN B;  3MNN C;  3C1C D;  3W99 D;  5B40 A;  1BH9 B;  3KXB A;  1AOI A;  4YS3 B;  3AZH A;  3WA9 B;  2DF4 C;  4KGC C;  3MGS A;  3MVD D;  3A1K A;  3C1B D;  3MGR A;  3REH A;  2ZY2 A;  5B2I C;  4G91 B;  3X1T B;  4WU8 A;  2Y2O A;  5B24 B;  3O62 B;  5AV5 D;  5GT3 D;  3MGQ B;  3W97 C;  1S32 B;  5DNN D;  3AZN D;  3AZF C;  3WKJ A;  2HIO B;  5CP6 B;  4AWL B;  3WA9 D;  3LZ0 A;  5E5A C;  3LJA B;  3WTP A;  3AV2 C;  5JRG B;  3UT9 C;  2Y2K A;  3X1T D;  1M18 C;  1P3M B;  3LZ1 A;  5B24 D;  3MGQ D;  1P3O C;  5B40 B;  1S32 D;  3KXB B;  1AOI B;  3WAA C;  3AZH B;  2XD1 A;  4WU9 C;  3H0R C;  3MGS B;  2HIO D;  4H9N A;  5CP6 D;  3MGR B;  3REJ A;  3REH B;  3B6F C;  3LJA D;  3AN2 A;  4WU8 B;  2Y2J A;  4XZQ C;  2CV5 A;  4J8V A;  5GXQ A;  1KX4 C;  5JRG D;  1P3M D;  3WKJ B;  3AV1 C;  5B40 D;  3KXB D;  1AOI D;  3MGP A;  3B6G A;  3AYW C;  3AZH D;  3AZL D;  3AZJ C;  1EQZ A;  3LZ0 B;  1ID3 D;  3MGS D;  3AZG A;  3WTP B;  4DRB A;  3MGR D;  3X1V A;  4E44 A;  3WTP E;  3REH D;  5FUG A;  4WU8 D;  4JJN C;  5B31 C;  3LEL A;  3MNN A;  2Y2L A;  3WKJ D;  2NQB C;  3A6N A;  2F8N K;  4H9N B;  3REJ B;  3LZ0 D;  3REI C;  1ID3 C;  5BNV A;  4J8U D;  3AN2 B;  4KGC A;  2CV5 B;  3WTP D;  4J8V B;  5GXQ B;  3B0D B;  4ZBJ C;  5DNM A;  2Y2N A;  3W97 A;  5CPJ C;  3C1C A;  3MGP B;  4X23 C;  1EQZ B;  5B2J C;  3EPK A;  3AZG B;  4J8W C;  3REJ D;  1P3B C;  5E5A A;  5FUG B;  5B0Y C;  4J8U C;  3AN2 D;  2JE5 A;  2CV5 D;  4J8V D;  3LEL B;  3AV2 A;  5GXQ D;  1M18 A;  3MNN B;  5AV9 C;  5AV5 A;  4UUZ A;  3UTB C;  1P3O A;  3WAA A;  2J8P A;  4NFT A;  3MGP D;  4NE6 A;  3AZM C;  4WU9 A;  1EQZ D;  3AZI C;  5BNV B;  4KGC B;  1Q9C A;  3AZG D;  4Z66 C;  1P3A C;  4J8X C;  3B6F A;  1P3I C;  5DNM B;  4XZQ A;  4ZUX C;  3W97 B;  3VH6 A;  3LEL D;  1KX4 A;  3V9R A;  3X1T A;  3MNN D;  5B24 A;  3REK C;  4NE5 A;  3AV1 A;  2BYK A;  3AZJ A;  5E5A B;  4KGC D;  1N1J A;  5B1M C;  3UT9 B;  3AV2 B;  2G5H C;  5B2I D;  1M18 B;  1ZLA C;  5AV6 C;  4JJN A;  5B31 A;  4UUZ B;  3W97 D;  1P3O B;  3WAA B;  1P3M A;  3AZF D;  2NQB A;  4WU9 B;  3KWQ C;  1WWS A;  4LD9 C;  5B31 G;  3AZL A;  3B6F B;  3REI A;  5E5A D;  1ID3 A;  4XZQ B;  1KX4 B;  1M19 C;  3AV2 D;  4M6B A;  3UT9 D;  3V9R B;  1M18 D;  2L5A A;  5CPJ A;  3AV1 B;  2LY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...