3KUYC

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyC00
3REHD 3KXBA 3KXBC 3MGRA 3VH6T 1U35B 3LELB 5E5AD 2FJ7B 4J8UD 4LD9A 4LD9C 1ULYA 4WU8D 5JRGA 5JRGC 4H9SA 4H9SC 3B6FC 4H9NA 3C1BD 2F8NG 4CAYA 4R8PC 5B2JD 4J8XB 5B1LA 5B1LC 3W99D 3AZIA 3AZIC 5AVCA 5AVCC 5E5AB 4J8UB 2PYOA 3UTBA 4WU8B 3UTBC 1KX3A 3AZJA 3AZJC 1KX3C 5GXQA 5GXQC 3AZLD 2CV5A 2CV5C 2PYOC 3X1UA 3X1UC 2YFVA 3C1BB 5B2JB 1S32A 1S32C 5AVBB 2LY8A 3MGSD 1P3PC 5B24A 5B24C 1P3PA 5AV8D 1F66A 1F66C 3X1TA 3B0CT 3WA9A 3WA9C 1M18A 5GT0A 5GT0C 1M18C 4NE5A 1P3ID 5B1MD 3LZ0A 4CSRB 3LZ0C 3RELD 2YFWA 3AV1D 3MNND 4E45A 3W97A 3W97C 2RVQC 5CPKD 3UT9C 1BH9B 1P3IB 5B1MB 3TU4C 3AV1B 4Z66A 3MNNB 1B6WA 4ZBJC 3B6GD 3B6FD 5CPKB 4Z5TA 4Z5TC 3X1VD 4R8PD 3MGPA 4H9PB 5BNVA 5JA4B 5GSUA 5GSUC 5B31A 5B31C 5CP6D 3KUYA 3KUYC 1H3OB 3B6GB 1KX3D 2HUEB 5GXQD 3X1VB 2AROB 1U35C 4G92B 1U35A 5BO0B 3LELC 2FJ7A 2FJ7C 1B67A 2F8NB 5CP6B 1P3PD 4XUJD 1F66D 3R45B 4EO5C 4J8XC 4J8XA 3WA9D 1P3OD 5E5AA 5E5AC 5KDMB 4J8UA 4J8UC 4WU8A 4WU8C 4XUJB 3C1BA 3C1BC 1M19D 5B2JA 5B2JC 1P3AD 4WNNB 1P3OB 5AVBA 5AVBC 3W99A 3UT9D 5B0YB 5B32D 3WKJB 3TU4D 3AZLA 1M19B 1P3AB 4CSRA 4Z5TD 5B32B 2F8NH 1HQ3D 1BH9A 1P3IA 5B1MA 5B1MC 1P3IC 5F99D 3LELD 3AV1A 3MNNA 3MNNC 4KUDD 4J8WD 4E44A 3REKD 5CPKA 5CPKC 1HQ3B 2NQBB 4JJND 4H9PA 4ZUXD 4J8XD 5JA4A 5F99B 3VH5W 5GT3D 1A7WA 4KUDB 1KU5A 4J8WB 2NZDB 1H3OA 3B6GA 3B6GC 5G49B 3W96D 3REKB 3B6FA 3B0DB 2HUEC 3WAAD 5BNXB 3X1VA 3X1VC 2AROA 2AROC 4G92C 5BO0A 4R8PA 4JJNB 4ZUXB 5DNND 4EO5B 1KX5D 3AFAD 5AVBD 3VH6W 2F8NA 5CP6A 5CP6C 5GT3B 1P3GD 5AY8B 5B40D 3R45A 3W96B 3WAAB 2BYKA 3UTAD 5DNNB 5KDMA 1KX5B 3AZND 3AFAB 4Z2MG 1P3MD 4KGCB 4YM6B 4XUJA 4XUJC 2F8NK 1P3GB 3MGQD 5B40B 3NQUA 3O62D 4WNNA 5DNMD 1P3OA 1P3OC 4WZSB 5B0YA 5B0YC 3UTAB 3AZNB 3WKJA 1P3MB 3WKJC 1WWIA 3X1SB 1M19A 1M19C 3MGQB 1P3AA 1P3AC 1M1AD 3O62B 4H9OB 5DNMB 3AZMB 3UT9A 5B32A 5B32C 3TU4A 3AZFB 3WTPD 1M1AB 2AROD 3B0BA 4J8VD 2HIOB 3AN2D 2F8ND 2IO5B 5B33D 1HQ3A 1HQ3C 5B2ID 3C1CD 1P3KD 2NQBC 3MVDB 3WTPB 5F99A 5F99C 1AOIC 4UUZB 3LELA 4NE3A 4J8VB 4KUDA 1KX4D 4KUDC 4J8WA 4J8WC 2NZDA 2NZDC 3AN2B 5B33B 3REKA 3REKC 3B0DC 5BNXA 5B2IB 5AV5B 3A6ND 3C1CB 4DRAA 1P3KB 4JJNA 4JJNC 5B31G 4ZUXA 4G91B 4ZUXC 4XZQC 3MGRB 5AV6D 5B0YD 5GT3A 5GT3C 5CPID 1KX4B 3WKJD 1Q9CA 5AY8C 3W96A 3W96C 3WAAA 3WAAC 3A6NB 4H9NB 5DNNA 5DNNC 1KX5A 1KX5C 3AFAA 3AFAC 3NQJB 4KGCC 4KGCA 1BFMA 5AV6B 4M6BA 4YM6C 1P3LD 5CPIB 1P3GA 1P3GC 5B40A 5B40C 1BH8B 3AZED 2YFVB 3UTAC 3UTAA 1P34D 1R4VA 3AZNA 3AZNC 4NFTA 1P3MC 3KWQD 1P3MA 3KSYA 2L5AA 1P3LB 3X1SA 3X1SC 3LJAD 3MGQA 3MGQC 3O62A 3O62C 4H9OA 5DNMA 5DNMC 3AZMA 3AZMC 3AV2D 2NQBD 1F1EA 3AZEB 1P34B 1AOID 3KWQB 3AZFA 3AZFC 4YS3D 2NZDD 3LJAB 1TZYD 1M1AA 1M1AC 1EQZD 3AV2B 1P3BD 3W98B 3VH5A 3WTPE 1ZLAB 4XZQD 3AZKB 2HIOC 1AOIB 2IO5C 4WV4B 4H9QB 4Z66B 4YS3B 5AY8D 3MVDA 3MVDC 1TZYB 3WTPA 3WTPC 1EQZB 4X23D 1P3BB 4UUZA 3VH6A 4J8VA 4J8VC 1TAFB 3MGPB 4XZQB 4KGCD 3AN2A 3AN2C 5B33A 5B33C 4YM6D 3AYWD 5B2IA 5AV5A 5B2IC 5AV5C 3C1CA 3C1CC 1P3KA 1P3KC 4G91C 2BYMB 4QLCD 4X23B 3MGRC 5AV9D 1KX4A 1KX4C 4AWLB 3AYWB 3X1SD 3A6NA 3A6NC 1N1JB 4QLCB 4KHAB 3NQJA 3REHB 3AZMD 5AV6A 5AV6C 5CPIA 5CPIC 5AV9B 4H9RB 3AZFD 3LZ1D 5BS7A 5BS7C 1BH8A 4WU9D 5FUGB 4HGAB 5C3IB 1ID3D 3B0CW 5CPJD 3V9RB 1P3FD 1JFIB 3W99B 1P3LA 4NE6A 1P3LC 2HIOD 3AZGD 5CHLB 5B0ZD 3LZ1B 3X1TC 3AZLB 3MVDD 3AZEA 3AZEC 4WU9B 1ID3B 1P34A 1P34C 5CPJB 3KWQA 3KWQC 1P3FB 3REJD 3MGSB 3LJAA 5AV8B 3LJAC 3REID 3AZGB 5B0ZB 3AV2A 5AV5D 3AZHD 3AV2C 3W98A 3W98C 2NQBA 5B32G 1ZLAA 3AZKA 3AZKC 1ZLAC 3KXBD 3MGRD 1AOIA 4H9QA 3REJB 3RELB 4YS3A 4YS3C 4Z66C 4LD9D 5G49A 1TZYA 1TZYC 3REIB 5JRGD 2JSSA 1EQZA 1EQZC 3AZHB 1P3BA 1P3BC 1TAFA 3MGPC 4XZQA 3KXBB 5B1LD 3AZID 5AVCD 5AY8A 4LD9B 2BYMA 5BT1C 3UTBD 2PYOD 5JRGB 3AZJD 4X23A 4X23C 3B6FB 2CV5D 3X1UD 4CAYB 4R8PB 4AWLC 1S32D 5B1LB 4YM6A 3AYWA 3AYWC 3AZIB 5B24D 5AVCB 1N1JA 4QLCA 4QLCC 4KHAA 3X1TD 3UTBB 3REHA 3REHC 3AZJB 1KX3B 2PYOB 5GXQB 2CV5B 1M18D 5GT0D 3X1UB 2BYKB 5AV9A 5AV9C 4H9RA 1S32B 1HTAA 3LZ0D 1P3PB 5B24B 5FUGA 1F66B 4HGAC 5C3IC 3W97D 2RVQD 3X1TB 3NQUB 3V9RA 3WA9B 3W98D 1JFIA 1M18B 5GT0B 3W99C 1WWSA 1ZLAD 3AZKD 3LZ0B 3LZ1A 3LZ1C 2YFWB 4Z66D 3AZLC 4WU9A 4WU9C 1ID3A 1ID3C 3W97B 5CPJA 5CPJC 1P3FA 1P3FC 4Z2MH 3MGPD 3UT9B 3MGSA 3MGSC 2HIOA 5GSUD 5AV8A 5AV8C 5B31D 3AZGA 3AZGC 5B0ZA 5B0ZC 3TU4B 3KUYD 4ZBJB 2CWEA 5BT1D 3VH5T 4Z5TB 1U35D 3REJA 3REJC 3RELA 3RELC 3AV1C 2FJ7D 4DRBA 5BNVB 5GSUB 3REIA 5B31B 3REIC 3AZHA 3AZHC 3KUYB
chains in the Genus database with same CATH superfamily
3REHD 3KXBA 3KXBC 3MGRA 3VH6T 1U35B 3LELB 5E5AD 2FJ7B 4J8UD 4LD9A 4LD9C 1ULYA 2XD1A 4WU8D 5JRGA 5JRGC 4H9SA 4H9SC 3B6FC 4H9NA 3C1BD 2F8NG 4CAYA 4R8PC 5B2JD 4J8XB 5B1LA 5B1LC 3W99D 3AZIA 3AZIC 5AVCA 5AVCC 5E5AB 4J8UB 2Y2LA 2PYOA 3UTBA 4WU8B 3UTBC 1KX3A 3AZJA 3AZJC 1KX3C 5GXQA 5GXQC 3AZLD 2CV5A 2CV5C 2PYOC 3X1UA 3X1UC 2YFVA 3C1BB 5B2JB 1S32A 1S32C 5AVBB 2LY8A 3MGSD 1P3PC 5B24A 5B24C 1P3PA 5AV8D 1F66A 1F66C 2BG1A 3X1TA 3B0CT 3WA9A 3WA9C 1M18A 5GT0A 5GT0C 1M18C 2ZM5A 4NE5A 1P3ID 5B1MD 3LZ0A 4CSRB 3LZ0C 3RELD 2YFWA 3AV1D 3MNND 4E45A 3W97A 3W97C 2RVQC 3P5JB 5CPKD 2J8PA 3UT9C 1BH9B 1P3IB 5B1MB 2RIQA 3TU4C 3AV1B 4Z66A 3A1KA 3MNNB 1B6WA 4ZBJC 3B6GD 3B6FD 5CPKB 4Z5TA 4Z5TC 3X1VD 4R8PD 3MGPA 4H9PB 5BNVA 5JA4B 5GSUA 5GSUC 5B31A 5B31C 3IP4C 5CP6D 3KUYA 3KUYC 1H3OB 3B6GB 1KX3D 2HUEB 5GXQD 3X1VB 2AROB 1U35C 4G92B 1U35A 5BO0B 3LELC 2FJ7A 2FJ7C 1B67A 2F8NB 5CP6B 1P3PD 4XUJD 1F66D 3R45B 4EO5C 4J8XC 4J8XA 3WA9D 1P3OD 5E5AA 5E5AC 5KDMB 4J8UA 4J8UC 4WU8A 4WU8C 4XUJB 2FFFB 3C1BA 3C1BC 1M19D 5B2JA 5B2JC 1P3AD 2DQNC 4WNNB 1P3OB 5AVBA 5AVBC 3W99A 3UT9D 5B0YB 5B32D 3WKJB 3TU4D 3AZLA 1M19B 1P3AB 4CSRA 4Z5TD 5B32B 2F8NH 1HQ3D 2F2AC 1W2EA 1BH9A 1P3IA 5B1MA 5B1MC 1P3IC 5F99D 3LELD 3AV1A 3MNNA 3MNNC 4KUDD 4J8WD 4E44A 3REKD 5CPKA 5CPKC 1HQ3B 2NQBB 4JJND 4H9PA 4ZUXD 4J8XD 5JA4A 5F99B 3VH5W 5GT3D 1A7WA 4KUDB 1KU5A 4J8WB 2NZDB 1H3OA 4UPKA 3B6GA 5G49B 3B6GC 3W96D 3REKB 3B6FA 3B0DB 2HUEC 2VQRA 3WAAD 5BNXB 3X1VA 3X1VC 2AROA 2AROC 4G92C 5BO0A 4R8PA 4JJNB 2Y2MA 5DNND 4EO5B 4ZUXB 1KX5D 3AFAD 5AVBD 3VH6W 2F8NA 5CP6A 5CP6C 5GT3B 1P3GD 5AY8B 5B40D 3R45A 3W96B 3WAAB 2BYKA 3UTAD 5DNNB 5KDMA 1KX5B 3AZND 3AFAB 4Z2MG 1P3MD 4KGCB 4YM6B 4XUJA 4XUJC 2F8NK 1P3GB 3MGQD 5B40B 3NQUA 3O62D 4WNNA 5DNMD 1P3OA 1P3OC 4WZSB 5B0YA 5B0YC 3UTAB 3AZNB 3WKJA 1P3MB 3WKJC 1WWIA 3X1SB 1M19A 1M19C 3MGQB 1P3AA 1P3AC 1M1AD 3O62B 4H9OB 5DNMB 3AZMB 3UT9A 5B32A 5B32C 3TU4A 3AZFB 1T3UA 3WTPD 1M1AB 2AROD 3B0BA 4J8VD 2HIOB 3AN2D 2F8ND 2IO5B 5B33D 1HQ3A 1HQ3C 5B2ID 3C1CD 1P3KD 2NQBC 3MVDB 2ZY4A 3WTPB 3EPLA 5F99A 5F99C 1AOIC 4UUZB 3LELA 4NE3A 4J8VB 3EG5B 1KX4D 4KUDA 4J8WA 4J8WC 4KUDC 2NZDA 2NZDC 3AN2B 5B33B 3REKA 3REKC 3B0DC 5BNXA 5B2IB 5AV5B 3A6ND 3C1CB 4DRAA 1P3KB 4JJNA 3EPKA 5B31G 4ZUXA 4G91B 4ZUXC 4JJNC 4XZQC 3MGRB 5AV6D 5B0YD 5GT3A 5GT3C 5CPID 1KX4B 3WKJD 1Q9CA 5AY8C 3W96A 3W96C 3WAAA 3WAAC 2DF4C 3A6NB 4H9NB 1Z2CB 5DNNA 5DNNC 2Y2QA 1KX5A 1KX5C 3AFAA 3AFAC 3NQJB 4KGCC 4KGCA 1BFMA 5AV6B 4M6BA 4YM6C 1P3LD 5CPIB 1P3GA 1P3GC 5B40A 5B40C 2G5HC 1BH8B 3AZED 2YFVB 3UTAC 2UWXA 3UTAA 1R4VA 1P34D 3AZNA 3AZNC 4NFTA 1P3MC 3KWQD 1P3MA 3KSYA 2L5AA 1P3LB 3X1SA 3X1SC 3LJAD 3F6TA 3MGQA 3MGQC 3O62A 3O62C 4H9OA 5DNMA 5DNMC 3AZMA 3AZMC 3AV2D 3FDDA 2NQBD 1F1EA 3AZEB 1P34B 1AOID 3KWQB 3AZFA 3AZFC 4YS3D 2NZDD 3LJAB 1TZYD 3A1IA 1M1AA 1M1AC 1EQZD 3AV2B 1P3BD 3W98B 3VH5A 2Y2GA 3WTPE 1ZLAB 4XZQD 3AZKB 2HIOC 1AOIB 2IO5C 4WV4B 4H9QB 3EPHA 3H0RC 4Z66B 4YS3B 5AY8D 3MVDA 3MVDC 1TZYB 3WTPA 3WTPC 1EQZB 4X23D 1P3BB 4UUZA 3VH6A 4J8VA 4J8VC 1TAFB 3MGPB 4XZQB 4KGCD 2JCHA 3AN2C 3AN2A 2Y2OA 5B33A 5B33C 4YM6D 3AYWD 5B2IA 5AV5A 5B2IC 5AV5C 3C1CA 3C1CC 1P3KA 1P3KC 4G91C 2BYMB 4QLCD 4X23B 3MGRC 5AV9D 1KX4A 1KX4C 4AWLB 3AYWB 3X1SD 3A6NA 3A6NC 1PZRA 1N1JB 4QLCB 4KHAB 3NQJA 3REHB 3AZMD 5AV6A 5AV6C 5CPIA 5CPIC 5AV9B 4H9RB 3AZFD 3LZ1D 5BS7A 5BS7C 1BH8A 4DQYB 3KFUG 4WU9D 5FUGB 4HGAB 5C3IB 1ID3D 3H0LC 3B0CW 5CPJD 3V9RB 1P3FD 2W8SA 1JFIB 3W99B 1P3LA 4NE6A 1P3LC 2HIOD 2ZY5A 3AZGD 5CHLB 5B0ZD 3LZ1B 3X1TC 3AZLB 3MVDD 3AZEA 3AZEC 4WU9B 1ID3B 3H0MC 1P34C 1P34A 5CPJB 3KWQA 3KWQC 1P3FB 2ZY3A 3REJD 3MGSB 3LJAA 5AV8B 3LJAC 3REID 3AZGB 5B0ZB 3AV2A 5AV5D 3AZHD 3AV2C 3W98A 3W98C 2NQBA 5B32G 1ZLAA 3AZKA 3AZKC 1ZLAC 3KXBD 3MGRD 1AOIA 4H9QA 3REJB 3RELB 4YS3A 4YS3C 4Z66C 4LD9D 5G49A 2Y2JA 1TZYA 1TZYC 3REIB 5JRGD 2JSSA 1EQZA 1EQZC 3AZHB 1P3BA 2ZY2A 1P3BC 1TAFA 3MGPC 4XZQA 3KXBB 5B1LD 3AL0C 2Y2PA 2Y2KA 3AZID 5AVCD 5AY8A 4LD9B 2BYMA 5BT1C 3UTBD 2PYOD 5JRGB 3AZJD 4X23A 4X23C 3B6FB 2CV5D 3X1UD 4CAYB 4R8PB 4AWLC 1S32D 2Y2IA 5B1LB 4YM6A 3AYWA 3AYWC 3AZIB 5B24D 5AVCB 1N1JA 4QLCA 4QLCC 4KHAA 3X1TD 3UTBB 3REHA 3REHC 3AZJB 1KX3B 2PYOB 5GXQB 2CV5B 1M18D 5GT0D 3X1UB 2Y2HA 2BYKB 5AV9A 5AV9C 4H9RA 1S32B 1HTAA 3LZ0D 2G5IC 1P3PB 5B24B 2XD5A 5FUGA 4HGAC 1F66B 4WJ3C 5C3IC 3W97D 2RVQD 3X1TB 3NQUB 3V9RA 3WA9B 3W98D 1JFIA 1M18B 5GT0B 3W99C 2Y2NA 1WWSA 1ZLAD 3AZKD 3LZ0B 3LZ1A 3LZ1C 2YFWB 4Z66D 3AZLC 4WU9A 4WU9C 1ID3A 1ID3C 3W97B 5CPJA 5CPJC 1P3FA 1P3FC 4Z2MH 3MGPD 3UT9B 3MGSA 3MGSC 2HIOA 5GSUD 5AV8A 2JE5A 5AV8C 5B31D 3AZGA 3AZGC 5B0ZA 5B0ZC 3TU4B 3KUYD 4ZBJB 2CWEA 5BT1D 3VH5T 4Z5TB 1U35D 3REJA 3REJC 3RELA 3RELC 3AV1C 2FJ7D 4DRBA 5BNVB 5GSUB 3REIA 5B31B 3REIC 3AZHA 3AZHC 3EPJA 3KUYB
chains in the Genus database with same CATH topology
3REHD 3KXBA 3KXBC 3MGRA 3VH6T 1U35B 3LELB 5E5AD 2FJ7B 4J8UD 4LD9A 4LD9C 1ULYA 2XD1A 4WU8D 5JRGA 5JRGC 4H9SA 4H9SC 3B6FC 4H9NA 3C1BD 2F8NG 4CAYA 4R8PC 5B2JD 4J8XB 5B1LA 5B1LC 3W99D 3AZIA 3AZIC 5AVCA 5AVCC 5E5AB 4J8UB 2Y2LA 2PYOA 3UTBA 4WU8B 3UTBC 1KX3A 3AZJA 3AZJC 1KX3C 5GXQA 5GXQC 3AZLD 2CV5A 2CV5C 2PYOC 3X1UA 3X1UC 2YFVA 3C1BB 5B2JB 1S32A 1S32C 5AVBB 2LY8A 3MGSD 1P3PC 5B24A 5B24C 1P3PA 5AV8D 1F66A 1F66C 2BG1A 3X1TA 3B0CT 3WA9A 3WA9C 1M18A 5GT0A 5GT0C 1M18C 2ZM5A 4NE5A 1P3ID 5B1MD 3LZ0A 4CSRB 3LZ0C 3RELD 2YFWA 3AV1D 3MNND 4E45A 3W97A 3W97C 2RVQC 3P5JB 5CPKD 2J8PA 3UT9C 1BH9B 1P3IB 5B1MB 2RIQA 3TU4C 3AV1B 4Z66A 3A1KA 3MNNB 1B6WA 4ZBJC 3B6GD 3B6FD 5CPKB 4Z5TA 4Z5TC 3X1VD 4R8PD 3MGPA 4H9PB 5BNVA 5JA4B 5GSUA 5GSUC 5B31A 5B31C 3IP4C 5CP6D 3KUYA 3KUYC 1H3OB 3B6GB 1KX3D 2HUEB 5GXQD 3X1VB 2AROB 1U35C 4G92B 1U35A 5BO0B 3LELC 2FJ7A 2FJ7C 1B67A 2F8NB 5CP6B 1P3PD 4XUJD 1F66D 3R45B 4EO5C 4J8XC 4J8XA 3WA9D 1P3OD 5E5AA 5E5AC 5KDMB 4J8UA 4J8UC 4WU8A 4WU8C 4XUJB 2FFFB 3C1BA 3C1BC 1M19D 5B2JA 5B2JC 1P3AD 2DQNC 4WNNB 1P3OB 5AVBA 5AVBC 3W99A 3UT9D 5B0YB 5B32D 3WKJB 3TU4D 3AZLA 1M19B 1P3AB 4CSRA 4Z5TD 5B32B 2F8NH 1HQ3D 2F2AC 1W2EA 1BH9A 1P3IA 5B1MA 5B1MC 1P3IC 5F99D 3LELD 3AV1A 3MNNA 3MNNC 4KUDD 4J8WD 4E44A 3REKD 5CPKA 5CPKC 1HQ3B 2NQBB 4JJND 4H9PA 4ZUXD 4J8XD 5JA4A 5F99B 3VH5W 5GT3D 1A7WA 4KUDB 1KU5A 4J8WB 2NZDB 1H3OA 4UPKA 3B6GA 5G49B 3B6GC 3W96D 3REKB 3B6FA 3B0DB 2HUEC 2VQRA 3WAAD 5BNXB 3X1VA 3X1VC 2AROA 2AROC 4G92C 5BO0A 4R8PA 4JJNB 2Y2MA 5DNND 4EO5B 4ZUXB 1KX5D 3AFAD 5AVBD 3VH6W 2F8NA 5CP6A 5CP6C 5GT3B 1P3GD 5AY8B 5B40D 3R45A 3W96B 3WAAB 2BYKA 3UTAD 5DNNB 5KDMA 1KX5B 3AZND 3AFAB 4Z2MG 1P3MD 4KGCB 4YM6B 4XUJA 4XUJC 2F8NK 1P3GB 3MGQD 5B40B 3NQUA 3O62D 4WNNA 5DNMD 1P3OA 1P3OC 4WZSB 5B0YA 5B0YC 3UTAB 3AZNB 3WKJA 1P3MB 3WKJC 1WWIA 3X1SB 1M19A 1M19C 3MGQB 1P3AA 1P3AC 1M1AD 3O62B 4H9OB 5DNMB 3AZMB 3UT9A 5B32A 5B32C 3TU4A 3AZFB 1T3UA 3WTPD 1M1AB 2AROD 3B0BA 4J8VD 2HIOB 3AN2D 2F8ND 2IO5B 5B33D 1HQ3A 1HQ3C 5B2ID 3C1CD 1P3KD 2NQBC 3MVDB 2ZY4A 3WTPB 3EPLA 5F99A 5F99C 1AOIC 4UUZB 3LELA 4NE3A 4J8VB 3EG5B 1KX4D 4KUDA 4J8WA 4J8WC 4KUDC 2NZDA 2NZDC 3AN2B 5B33B 3REKA 3REKC 3B0DC 5BNXA 5B2IB 5AV5B 3A6ND 3C1CB 4DRAA 1P3KB 4JJNA 3EPKA 5B31G 4ZUXA 4G91B 4ZUXC 4JJNC 4XZQC 3MGRB 5AV6D 5B0YD 5GT3A 5GT3C 5CPID 1KX4B 3WKJD 1Q9CA 5AY8C 3W96A 3W96C 3WAAA 3WAAC 2DF4C 3A6NB 4H9NB 1Z2CB 5DNNA 5DNNC 2Y2QA 1KX5A 1KX5C 3AFAA 3AFAC 3NQJB 4KGCC 4KGCA 1BFMA 5AV6B 4M6BA 4YM6C 1P3LD 5CPIB 1P3GA 1P3GC 5B40A 5B40C 2G5HC 1BH8B 3AZED 2YFVB 3UTAC 2UWXA 3UTAA 1R4VA 1P34D 3AZNA 3AZNC 4NFTA 1P3MC 3KWQD 1P3MA 3KSYA 2L5AA 1P3LB 3X1SA 3X1SC 3LJAD 3F6TA 3MGQA 3MGQC 3O62A 3O62C 4H9OA 5DNMA 5DNMC 3AZMA 3AZMC 3AV2D 3FDDA 2NQBD 1F1EA 3AZEB 1P34B 1AOID 3KWQB 3AZFA 3AZFC 4YS3D 2NZDD 3LJAB 1TZYD 3A1IA 1M1AA 1M1AC 1EQZD 3AV2B 1P3BD 3W98B 3VH5A 2Y2GA 3WTPE 1ZLAB 4XZQD 3AZKB 2HIOC 1AOIB 2IO5C 4WV4B 4H9QB 3EPHA 3H0RC 4Z66B 4YS3B 5AY8D 3MVDA 3MVDC 1TZYB 3WTPA 3WTPC 1EQZB 4X23D 1P3BB 4UUZA 3VH6A 4J8VA 4J8VC 1TAFB 3MGPB 4XZQB 4KGCD 2JCHA 3AN2C 3AN2A 2Y2OA 5B33A 5B33C 4YM6D 3AYWD 5B2IA 5AV5A 5B2IC 5AV5C 3C1CA 3C1CC 1P3KA 1P3KC 4G91C 2BYMB 4QLCD 4X23B 3MGRC 5AV9D 1KX4A 1KX4C 4AWLB 3AYWB 3X1SD 3A6NA 3A6NC 1PZRA 1N1JB 4QLCB 4KHAB 3NQJA 3REHB 3AZMD 5AV6A 5AV6C 5CPIA 5CPIC 5AV9B 4H9RB 3AZFD 3LZ1D 5BS7A 5BS7C 1BH8A 4DQYB 3KFUG 4WU9D 5FUGB 4HGAB 5C3IB 1ID3D 3H0LC 3B0CW 5CPJD 3V9RB 1P3FD 2W8SA 1JFIB 3W99B 1P3LA 4NE6A 1P3LC 2HIOD 2ZY5A 3AZGD 5CHLB 5B0ZD 3LZ1B 3X1TC 3AZLB 3MVDD 3AZEA 3AZEC 4WU9B 1ID3B 3H0MC 1P34C 1P34A 5CPJB 3KWQA 3KWQC 1P3FB 2ZY3A 3REJD 3MGSB 3LJAA 5AV8B 3LJAC 3REID 3AZGB 5B0ZB 3AV2A 5AV5D 3AZHD 3AV2C 3W98A 3W98C 2NQBA 5B32G 1ZLAA 3AZKA 3AZKC 1ZLAC 3KXBD 3MGRD 1AOIA 4H9QA 3REJB 3RELB 4YS3A 4YS3C 4Z66C 4LD9D 5G49A 2Y2JA 1TZYA 1TZYC 3REIB 5JRGD 2JSSA 1EQZA 1EQZC 3AZHB 1P3BA 2ZY2A 1P3BC 1TAFA 3MGPC 4XZQA 3KXBB 5B1LD 3AL0C 2Y2PA 2Y2KA 3AZID 5AVCD 5AY8A 4LD9B 2BYMA 5BT1C 3UTBD 2PYOD 5JRGB 3AZJD 4X23A 4X23C 3B6FB 2CV5D 3X1UD 4CAYB 4R8PB 4AWLC 1S32D 2Y2IA 5B1LB 4YM6A 3AYWA 3AYWC 3AZIB 5B24D 5AVCB 1N1JA 4QLCA 4QLCC 4KHAA 3X1TD 3UTBB 3REHA 3REHC 3AZJB 1KX3B 2PYOB 5GXQB 2CV5B 1M18D 5GT0D 3X1UB 2Y2HA 2BYKB 5AV9A 5AV9C 4H9RA 1S32B 1HTAA 3LZ0D 2G5IC 1P3PB 5B24B 2XD5A 5FUGA 4HGAC 1F66B 4WJ3C 5C3IC 3W97D 2RVQD 3X1TB 3NQUB 3V9RA 3WA9B 3W98D 1JFIA 1M18B 5GT0B 3W99C 2Y2NA 1WWSA 1ZLAD 3AZKD 3LZ0B 3LZ1A 3LZ1C 2YFWB 4Z66D 3AZLC 4WU9A 4WU9C 1ID3A 1ID3C 3W97B 5CPJA 5CPJC 1P3FA 1P3FC 4Z2MH 3MGPD 3UT9B 3MGSA 3MGSC 2HIOA 5GSUD 5AV8A 2JE5A 5AV8C 5B31D 3AZGA 3AZGC 5B0ZA 5B0ZC 3TU4B 3KUYD 4ZBJB 2CWEA 5BT1D 3VH5T 4Z5TB 1U35D 3REJA 3REJC 3RELA 3RELC 3AV1C 2FJ7D 4DRBA 5BNVB 5GSUB 3REIA 5B31B 3REIC 3AZHA 3AZHC 3EPJA 3KUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH D;  3KXB A;  3KXB C;  3MGR A;  3VH6 T;  1U35 B;  3LEL B;  5E5A D;  2FJ7 B;  4J8U D;  4LD9 A;  4LD9 C;  1ULY A;  4WU8 D;  5JRG A;  5JRG C;  4H9S A;  4H9S C;  3B6F C;  4H9N A;  3C1B D;  2F8N G;  4CAY A;  4R8P C;  5B2J D;  4J8X B;  5B1L A;  5B1L C;  3W99 D;  3AZI A;  3AZI C;  5AVC A;  5AVC C;  5E5A B;  4J8U B;  2PYO A;  3UTB A;  4WU8 B;  3UTB C;  1KX3 A;  3AZJ A;  3AZJ C;  1KX3 C;  5GXQ A;  5GXQ C;  3AZL D;  2CV5 A;  2CV5 C;  2PYO C;  3X1U A;  3X1U C;  2YFV A;  3C1B B;  5B2J B;  1S32 A;  1S32 C;  5AVB B;  2LY8 A;  3MGS D;  1P3P C;  5B24 A;  5B24 C;  1P3P A;  5AV8 D;  1F66 A;  1F66 C;  3X1T A;  3B0C T;  3WA9 A;  3WA9 C;  1M18 A;  5GT0 A;  5GT0 C;  1M18 C;  4NE5 A;  1P3I D;  5B1M D;  3LZ0 A;  4CSR B;  3LZ0 C;  3REL D;  2YFW A;  3AV1 D;  3MNN D;  4E45 A;  3W97 A;  3W97 C;  2RVQ C;  5CPK D;  3UT9 C;  1BH9 B;  1P3I B;  5B1M B;  3TU4 C;  3AV1 B;  4Z66 A;  3MNN B;  1B6W A;  4ZBJ C;  3B6G D;  3B6F D;  5CPK B;  4Z5T A;  4Z5T C;  3X1V D;  4R8P D;  3MGP A;  4H9P B;  5BNV A;  5JA4 B;  5GSU A;  5GSU C;  5B31 A;  5B31 C;  5CP6 D;  3KUY A;  3KUY C;  1H3O B;  3B6G B;  1KX3 D;  2HUE B;  5GXQ D;  3X1V B;  2ARO B;  1U35 C;  4G92 B;  1U35 A;  5BO0 B;  3LEL C;  2FJ7 A;  2FJ7 C;  1B67 A;  2F8N B;  5CP6 B;  1P3P D;  4XUJ D;  1F66 D;  3R45 B;  4EO5 C;  4J8X C;  4J8X A;  3WA9 D;  1P3O D;  5E5A A;  5E5A C;  5KDM B;  4J8U A;  4J8U C;  4WU8 A;  4WU8 C;  4XUJ B;  3C1B A;  3C1B C;  1M19 D;  5B2J A;  5B2J C;  1P3A D;  4WNN B;  1P3O B;  5AVB A;  5AVB C;  3W99 A;  3UT9 D;  5B0Y B;  5B32 D;  3WKJ B;  3TU4 D;  3AZL A;  1M19 B;  1P3A B;  4CSR A;  4Z5T D;  5B32 B;  2F8N H;  1HQ3 D;  1BH9 A;  1P3I A;  5B1M A;  5B1M C;  1P3I C;  5F99 D;  3LEL D;  3AV1 A;  3MNN A;  3MNN C;  4KUD D;  4J8W D;  4E44 A;  3REK D;  5CPK A;  5CPK C;  1HQ3 B;  2NQB B;  4JJN D;  4H9P A;  4ZUX D;  4J8X D;  5JA4 A;  5F99 B;  3VH5 W;  5GT3 D;  1A7W A;  4KUD B;  1KU5 A;  4J8W B;  2NZD B;  1H3O A;  3B6G A;  3B6G C;  5G49 B;  3W96 D;  3REK B;  3B6F A;  3B0D B;  2HUE C;  3WAA D;  5BNX B;  3X1V A;  3X1V C;  2ARO A;  2ARO C;  4G92 C;  5BO0 A;  4R8P A;  4JJN B;  4ZUX B;  5DNN D;  4EO5 B;  1KX5 D;  3AFA D;  5AVB D;  3VH6 W;  2F8N A;  5CP6 A;  5CP6 C;  5GT3 B;  1P3G D;  5AY8 B;  5B40 D;  3R45 A;  3W96 B;  3WAA B;  2BYK A;  3UTA D;  5DNN B;  5KDM A;  1KX5 B;  3AZN D;  3AFA B;  4Z2M G;  1P3M D;  4KGC B;  4YM6 B;  4XUJ A;  4XUJ C;  2F8N K;  1P3G B;  3MGQ D;  5B40 B;  3NQU A;  3O62 D;  4WNN A;  5DNM D;  1P3O A;  1P3O C;  4WZS B;  5B0Y A;  5B0Y C;  3UTA B;  3AZN B;  3WKJ A;  1P3M B;  3WKJ C;  1WWI A;  3X1S B;  1M19 A;  1M19 C;  3MGQ B;  1P3A A;  1P3A C;  1M1A D;  3O62 B;  4H9O B;  5DNM B;  3AZM B;  3UT9 A;  5B32 A;  5B32 C;  3TU4 A;  3AZF B;  3WTP D;  1M1A B;  2ARO D;  3B0B A;  4J8V D;  2HIO B;  3AN2 D;  2F8N D;  2IO5 B;  5B33 D;  1HQ3 A;  1HQ3 C;  5B2I D;  3C1C D;  1P3K D;  2NQB C;  3MVD B;  3WTP B;  5F99 A;  5F99 C;  1AOI C;  4UUZ B;  3LEL A;  4NE3 A;  4J8V B;  4KUD A;  1KX4 D;  4KUD C;  4J8W A;  4J8W C;  2NZD A;  2NZD C;  3AN2 B;  5B33 B;  3REK A;  3REK C;  3B0D C;  5BNX A;  5B2I B;  5AV5 B;  3A6N D;  3C1C B;  4DRA A;  1P3K B;  4JJN A;  4JJN C;  5B31 G;  4ZUX A;  4G91 B;  4ZUX C;  4XZQ C;  3MGR B;  5AV6 D;  5B0Y D;  5GT3 A;  5GT3 C;  5CPI D;  1KX4 B;  3WKJ D;  1Q9C A;  5AY8 C;  3W96 A;  3W96 C;  3WAA A;  3WAA C;  3A6N B;  4H9N B;  5DNN A;  5DNN C;  1KX5 A;  1KX5 C;  3AFA A;  3AFA C;  3NQJ B;  4KGC C;  4KGC A;  1BFM A;  5AV6 B;  4M6B A;  4YM6 C;  1P3L D;  5CPI B;  1P3G A;  1P3G C;  5B40 A;  5B40 C;  1BH8 B;  3AZE D;  2YFV B;  3UTA C;  3UTA A;  1P34 D;  1R4V A;  3AZN A;  3AZN C;  4NFT A;  1P3M C;  3KWQ D;  1P3M A;  3KSY A;  2L5A A;  1P3L B;  3X1S A;  3X1S C;  3LJA D;  3MGQ A;  3MGQ C;  3O62 A;  3O62 C;  4H9O A;  5DNM A;  5DNM C;  3AZM A;  3AZM C;  3AV2 D;  2NQB D;  1F1E A;  3AZE B;  1P34 B;  1AOI D;  3KWQ B;  3AZF A;  3AZF C;  4YS3 D;  2NZD D;  3LJA B;  1TZY D;  1M1A A;  1M1A C;  1EQZ D;  3AV2 B;  1P3B D;  3W98 B;  3VH5 A;  3WTP E;  1ZLA B;  4XZQ D;  3AZK B;  2HIO C;  1AOI B;  2IO5 C;  4WV4 B;  4H9Q B;  4Z66 B;  4YS3 B;  5AY8 D;  3MVD A;  3MVD C;  1TZY B;  3WTP A;  3WTP C;  1EQZ B;  4X23 D;  1P3B B;  4UUZ A;  3VH6 A;  4J8V A;  4J8V C;  1TAF B;  3MGP B;  4XZQ B;  4KGC D;  3AN2 A;  3AN2 C;  5B33 A;  5B33 C;  4YM6 D;  3AYW D;  5B2I A;  5AV5 A;  5B2I C;  5AV5 C;  3C1C A;  3C1C C;  1P3K A;  1P3K C;  4G91 C;  2BYM B;  4QLC D;  4X23 B;  3MGR C;  5AV9 D;  1KX4 A;  1KX4 C;  4AWL B;  3AYW B;  3X1S D;  3A6N A;  3A6N C;  1N1J B;  4QLC B;  4KHA B;  3NQJ A;  3REH B;  3AZM D;  5AV6 A;  5AV6 C;  5CPI A;  5CPI C;  5AV9 B;  4H9R B;  3AZF D;  3LZ1 D;  5BS7 A;  5BS7 C;  1BH8 A;  4WU9 D;  5FUG B;  4HGA B;  5C3I B;  1ID3 D;  3B0C W;  5CPJ D;  3V9R B;  1P3F D;  1JFI B;  3W99 B;  1P3L A;  4NE6 A;  1P3L C;  2HIO D;  3AZG D;  5CHL B;  5B0Z D;  3LZ1 B;  3X1T C;  3AZL B;  3MVD D;  3AZE A;  3AZE C;  4WU9 B;  1ID3 B;  1P34 A;  1P34 C;  5CPJ B;  3KWQ A;  3KWQ C;  1P3F B;  3REJ D;  3MGS B;  3LJA A;  5AV8 B;  3LJA C;  3REI D;  3AZG B;  5B0Z B;  3AV2 A;  5AV5 D;  3AZH D;  3AV2 C;  3W98 A;  3W98 C;  2NQB A;  5B32 G;  1ZLA A;  3AZK A;  3AZK C;  1ZLA C;  3KXB D;  3MGR D;  1AOI A;  4H9Q A;  3REJ B;  3REL B;  4YS3 A;  4YS3 C;  4Z66 C;  4LD9 D;  5G49 A;  1TZY A;  1TZY C;  3REI B;  5JRG D;  2JSS A;  1EQZ A;  1EQZ C;  3AZH B;  1P3B A;  1P3B C;  1TAF A;  3MGP C;  4XZQ A;  3KXB B;  5B1L D;  3AZI D;  5AVC D;  5AY8 A;  4LD9 B;  2BYM A;  5BT1 C;  3UTB D;  2PYO D;  5JRG B;  3AZJ D;  4X23 A;  4X23 C;  3B6F B;  2CV5 D;  3X1U D;  4CAY B;  4R8P B;  4AWL C;  1S32 D;  5B1L B;  4YM6 A;  3AYW A;  3AYW C;  3AZI B;  5B24 D;  5AVC B;  1N1J A;  4QLC A;  4QLC C;  4KHA A;  3X1T D;  3UTB B;  3REH A;  3REH C;  3AZJ B;  1KX3 B;  2PYO B;  5GXQ B;  2CV5 B;  1M18 D;  5GT0 D;  3X1U B;  2BYK B;  5AV9 A;  5AV9 C;  4H9R A;  1S32 B;  1HTA A;  3LZ0 D;  1P3P B;  5B24 B;  5FUG A;  1F66 B;  4HGA C;  5C3I C;  3W97 D;  2RVQ D;  3X1T B;  3NQU B;  3V9R A;  3WA9 B;  3W98 D;  1JFI A;  1M18 B;  5GT0 B;  3W99 C;  1WWS A;  1ZLA D;  3AZK D;  3LZ0 B;  3LZ1 A;  3LZ1 C;  2YFW B;  4Z66 D;  3AZL C;  4WU9 A;  4WU9 C;  1ID3 A;  1ID3 C;  3W97 B;  5CPJ A;  5CPJ C;  1P3F A;  1P3F C;  4Z2M H;  3MGP D;  3UT9 B;  3MGS A;  3MGS C;  2HIO A;  5GSU D;  5AV8 A;  5AV8 C;  5B31 D;  3AZG A;  3AZG C;  5B0Z A;  5B0Z C;  3TU4 B;  3KUY D;  4ZBJ B;  2CWE A;  5BT1 D;  3VH5 T;  4Z5T B;  1U35 D;  3REJ A;  3REJ C;  3REL A;  3REL C;  3AV1 C;  2FJ7 D;  4DRB A;  5BNV B;  5GSU B;  3REI A;  5B31 B;  3REI C;  3AZH A;  3AZH C;  3KUY B; 
#chains in the Genus database with same CATH topology
 3REH D;  3KXB A;  3KXB C;  3MGR A;  3VH6 T;  1U35 B;  3LEL B;  5E5A D;  2FJ7 B;  4J8U D;  4LD9 A;  4LD9 C;  1ULY A;  2XD1 A;  4WU8 D;  5JRG A;  5JRG C;  4H9S A;  4H9S C;  3B6F C;  4H9N A;  3C1B D;  2F8N G;  4CAY A;  4R8P C;  5B2J D;  4J8X B;  5B1L A;  5B1L C;  3W99 D;  3AZI A;  3AZI C;  5AVC A;  5AVC C;  5E5A B;  4J8U B;  2Y2L A;  2PYO A;  3UTB A;  4WU8 B;  3UTB C;  1KX3 A;  3AZJ A;  3AZJ C;  1KX3 C;  5GXQ A;  5GXQ C;  3AZL D;  2CV5 A;  2CV5 C;  2PYO C;  3X1U A;  3X1U C;  2YFV A;  3C1B B;  5B2J B;  1S32 A;  1S32 C;  5AVB B;  2LY8 A;  3MGS D;  1P3P C;  5B24 A;  5B24 C;  1P3P A;  5AV8 D;  1F66 A;  1F66 C;  2BG1 A;  3X1T A;  3B0C T;  3WA9 A;  3WA9 C;  1M18 A;  5GT0 A;  5GT0 C;  1M18 C;  2ZM5 A;  4NE5 A;  1P3I D;  5B1M D;  3LZ0 A;  4CSR B;  3LZ0 C;  3REL D;  2YFW A;  3AV1 D;  3MNN D;  4E45 A;  3W97 A;  3W97 C;  2RVQ C;  3P5J B;  5CPK D;  2J8P A;  3UT9 C;  1BH9 B;  1P3I B;  5B1M B;  2RIQ A;  3TU4 C;  3AV1 B;  4Z66 A;  3A1K A;  3MNN B;  1B6W A;  4ZBJ C;  3B6G D;  3B6F D;  5CPK B;  4Z5T A;  4Z5T C;  3X1V D;  4R8P D;  3MGP A;  4H9P B;  5BNV A;  5JA4 B;  5GSU A;  5GSU C;  5B31 A;  5B31 C;  3IP4 C;  5CP6 D;  3KUY A;  3KUY C;  1H3O B;  3B6G B;  1KX3 D;  2HUE B;  5GXQ D;  3X1V B;  2ARO B;  1U35 C;  4G92 B;  1U35 A;  5BO0 B;  3LEL C;  2FJ7 A;  2FJ7 C;  1B67 A;  2F8N B;  5CP6 B;  1P3P D;  4XUJ D;  1F66 D;  3R45 B;  4EO5 C;  4J8X C;  4J8X A;  3WA9 D;  1P3O D;  5E5A A;  5E5A C;  5KDM B;  4J8U A;  4J8U C;  4WU8 A;  4WU8 C;  4XUJ B;  2FFF B;  3C1B A;  3C1B C;  1M19 D;  5B2J A;  5B2J C;  1P3A D;  2DQN C;  4WNN B;  1P3O B;  5AVB A;  5AVB C;  3W99 A;  3UT9 D;  5B0Y B;  5B32 D;  3WKJ B;  3TU4 D;  3AZL A;  1M19 B;  1P3A B;  4CSR A;  4Z5T D;  5B32 B;  2F8N H;  1HQ3 D;  2F2A C;  1W2E A;  1BH9 A;  1P3I A;  5B1M A;  5B1M C;  1P3I C;  5F99 D;  3LEL D;  3AV1 A;  3MNN A;  3MNN C;  4KUD D;  4J8W D;  4E44 A;  3REK D;  5CPK A;  5CPK C;  1HQ3 B;  2NQB B;  4JJN D;  4H9P A;  4ZUX D;  4J8X D;  5JA4 A;  5F99 B;  3VH5 W;  5GT3 D;  1A7W A;  4KUD B;  1KU5 A;  4J8W B;  2NZD B;  1H3O A;  4UPK A;  3B6G A;  5G49 B;  3B6G C;  3W96 D;  3REK B;  3B6F A;  3B0D B;  2HUE C;  2VQR A;  3WAA D;  5BNX B;  3X1V A;  3X1V C;  2ARO A;  2ARO C;  4G92 C;  5BO0 A;  4R8P A;  4JJN B;  2Y2M A;  5DNN D;  4EO5 B;  4ZUX B;  1KX5 D;  3AFA D;  5AVB D;  3VH6 W;  2F8N A;  5CP6 A;  5CP6 C;  5GT3 B;  1P3G D;  5AY8 B;  5B40 D;  3R45 A;  3W96 B;  3WAA B;  2BYK A;  3UTA D;  5DNN B;  5KDM A;  1KX5 B;  3AZN D;  3AFA B;  4Z2M G;  1P3M D;  4KGC B;  4YM6 B;  4XUJ A;  4XUJ C;  2F8N K;  1P3G B;  3MGQ D;  5B40 B;  3NQU A;  3O62 D;  4WNN A;  5DNM D;  1P3O A;  1P3O C;  4WZS B;  5B0Y A;  5B0Y C;  3UTA B;  3AZN B;  3WKJ A;  1P3M B;  3WKJ C;  1WWI A;  3X1S B;  1M19 A;  1M19 C;  3MGQ B;  1P3A A;  1P3A C;  1M1A D;  3O62 B;  4H9O B;  5DNM B;  3AZM B;  3UT9 A;  5B32 A;  5B32 C;  3TU4 A;  3AZF B;  1T3U A;  3WTP D;  1M1A B;  2ARO D;  3B0B A;  4J8V D;  2HIO B;  3AN2 D;  2F8N D;  2IO5 B;  5B33 D;  1HQ3 A;  1HQ3 C;  5B2I D;  3C1C D;  1P3K D;  2NQB C;  3MVD B;  2ZY4 A;  3WTP B;  3EPL A;  5F99 A;  5F99 C;  1AOI C;  4UUZ B;  3LEL A;  4NE3 A;  4J8V B;  3EG5 B;  1KX4 D;  4KUD A;  4J8W A;  4J8W C;  4KUD C;  2NZD A;  2NZD C;  3AN2 B;  5B33 B;  3REK A;  3REK C;  3B0D C;  5BNX A;  5B2I B;  5AV5 B;  3A6N D;  3C1C B;  4DRA A;  1P3K B;  4JJN A;  3EPK A;  5B31 G;  4ZUX A;  4G91 B;  4ZUX C;  4JJN C;  4XZQ C;  3MGR B;  5AV6 D;  5B0Y D;  5GT3 A;  5GT3 C;  5CPI D;  1KX4 B;  3WKJ D;  1Q9C A;  5AY8 C;  3W96 A;  3W96 C;  3WAA A;  3WAA C;  2DF4 C;  3A6N B;  4H9N B;  1Z2C B;  5DNN A;  5DNN C;  2Y2Q A;  1KX5 A;  1KX5 C;  3AFA A;  3AFA C;  3NQJ B;  4KGC C;  4KGC A;  1BFM A;  5AV6 B;  4M6B A;  4YM6 C;  1P3L D;  5CPI B;  1P3G A;  1P3G C;  5B40 A;  5B40 C;  2G5H C;  1BH8 B;  3AZE D;  2YFV B;  3UTA C;  2UWX A;  3UTA A;  1R4V A;  1P34 D;  3AZN A;  3AZN C;  4NFT A;  1P3M C;  3KWQ D;  1P3M A;  3KSY A;  2L5A A;  1P3L B;  3X1S A;  3X1S C;  3LJA D;  3F6T A;  3MGQ A;  3MGQ C;  3O62 A;  3O62 C;  4H9O A;  5DNM A;  5DNM C;  3AZM A;  3AZM C;  3AV2 D;  3FDD A;  2NQB D;  1F1E A;  3AZE B;  1P34 B;  1AOI D;  3KWQ B;  3AZF A;  3AZF C;  4YS3 D;  2NZD D;  3LJA B;  1TZY D;  3A1I A;  1M1A A;  1M1A C;  1EQZ D;  3AV2 B;  1P3B D;  3W98 B;  3VH5 A;  2Y2G A;  3WTP E;  1ZLA B;  4XZQ D;  3AZK B;  2HIO C;  1AOI B;  2IO5 C;  4WV4 B;  4H9Q B;  3EPH A;  3H0R C;  4Z66 B;  4YS3 B;  5AY8 D;  3MVD A;  3MVD C;  1TZY B;  3WTP A;  3WTP C;  1EQZ B;  4X23 D;  1P3B B;  4UUZ A;  3VH6 A;  4J8V A;  4J8V C;  1TAF B;  3MGP B;  4XZQ B;  4KGC D;  2JCH A;  3AN2 C;  3AN2 A;  2Y2O A;  5B33 A;  5B33 C;  4YM6 D;  3AYW D;  5B2I A;  5AV5 A;  5B2I C;  5AV5 C;  3C1C A;  3C1C C;  1P3K A;  1P3K C;  4G91 C;  2BYM B;  4QLC D;  4X23 B;  3MGR C;  5AV9 D;  1KX4 A;  1KX4 C;  4AWL B;  3AYW B;  3X1S D;  3A6N A;  3A6N C;  1PZR A;  1N1J B;  4QLC B;  4KHA B;  3NQJ A;  3REH B;  3AZM D;  5AV6 A;  5AV6 C;  5CPI A;  5CPI C;  5AV9 B;  4H9R B;  3AZF D;  3LZ1 D;  5BS7 A;  5BS7 C;  1BH8 A;  4DQY B;  3KFU G;  4WU9 D;  5FUG B;  4HGA B;  5C3I B;  1ID3 D;  3H0L C;  3B0C W;  5CPJ D;  3V9R B;  1P3F D;  2W8S A;  1JFI B;  3W99 B;  1P3L A;  4NE6 A;  1P3L C;  2HIO D;  2ZY5 A;  3AZG D;  5CHL B;  5B0Z D;  3LZ1 B;  3X1T C;  3AZL B;  3MVD D;  3AZE A;  3AZE C;  4WU9 B;  1ID3 B;  3H0M C;  1P34 C;  1P34 A;  5CPJ B;  3KWQ A;  3KWQ C;  1P3F B;  2ZY3 A;  3REJ D;  3MGS B;  3LJA A;  5AV8 B;  3LJA C;  3REI D;  3AZG B;  5B0Z B;  3AV2 A;  5AV5 D;  3AZH D;  3AV2 C;  3W98 A;  3W98 C;  2NQB A;  5B32 G;  1ZLA A;  3AZK A;  3AZK C;  1ZLA C;  3KXB D;  3MGR D;  1AOI A;  4H9Q A;  3REJ B;  3REL B;  4YS3 A;  4YS3 C;  4Z66 C;  4LD9 D;  5G49 A;  2Y2J A;  1TZY A;  1TZY C;  3REI B;  5JRG D;  2JSS A;  1EQZ A;  1EQZ C;  3AZH B;  1P3B A;  2ZY2 A;  1P3B C;  1TAF A;  3MGP C;  4XZQ A;  3KXB B;  5B1L D;  3AL0 C;  2Y2P A;  2Y2K A;  3AZI D;  5AVC D;  5AY8 A;  4LD9 B;  2BYM A;  5BT1 C;  3UTB D;  2PYO D;  5JRG B;  3AZJ D;  4X23 A;  4X23 C;  3B6F B;  2CV5 D;  3X1U D;  4CAY B;  4R8P B;  4AWL C;  1S32 D;  2Y2I A;  5B1L B;  4YM6 A;  3AYW A;  3AYW C;  3AZI B;  5B24 D;  5AVC B;  1N1J A;  4QLC A;  4QLC C;  4KHA A;  3X1T D;  3UTB B;  3REH A;  3REH C;  3AZJ B;  1KX3 B;  2PYO B;  5GXQ B;  2CV5 B;  1M18 D;  5GT0 D;  3X1U B;  2Y2H A;  2BYK B;  5AV9 A;  5AV9 C;  4H9R A;  1S32 B;  1HTA A;  3LZ0 D;  2G5I C;  1P3P B;  5B24 B;  2XD5 A;  5FUG A;  4HGA C;  1F66 B;  4WJ3 C;  5C3I C;  3W97 D;  2RVQ D;  3X1T B;  3NQU B;  3V9R A;  3WA9 B;  3W98 D;  1JFI A;  1M18 B;  5GT0 B;  3W99 C;  2Y2N A;  1WWS A;  1ZLA D;  3AZK D;  3LZ0 B;  3LZ1 A;  3LZ1 C;  2YFW B;  4Z66 D;  3AZL C;  4WU9 A;  4WU9 C;  1ID3 A;  1ID3 C;  3W97 B;  5CPJ A;  5CPJ C;  1P3F A;  1P3F C;  4Z2M H;  3MGP D;  3UT9 B;  3MGS A;  3MGS C;  2HIO A;  5GSU D;  5AV8 A;  2JE5 A;  5AV8 C;  5B31 D;  3AZG A;  3AZG C;  5B0Z A;  5B0Z C;  3TU4 B;  3KUY D;  4ZBJ B;  2CWE A;  5BT1 D;  3VH5 T;  4Z5T B;  1U35 D;  3REJ A;  3REJ C;  3REL A;  3REL C;  3AV1 C;  2FJ7 D;  4DRB A;  5BNV B;  5GSU B;  3REI A;  5B31 B;  3REI C;  3AZH A;  3AZH C;  3EPJ A;  3KUY B; 
#chains in the Genus database with same CATH homology
 3REH D;  3KXB A;  3KXB C;  3MGR A;  3VH6 T;  1U35 B;  3LEL B;  5E5A D;  2FJ7 B;  4J8U D;  4LD9 A;  4LD9 C;  1ULY A;  2XD1 A;  4WU8 D;  5JRG A;  5JRG C;  4H9S A;  4H9S C;  3B6F C;  4H9N A;  3C1B D;  2F8N G;  4CAY A;  4R8P C;  5B2J D;  4J8X B;  5B1L A;  5B1L C;  3W99 D;  3AZI A;  3AZI C;  5AVC A;  5AVC C;  5E5A B;  4J8U B;  2Y2L A;  2PYO A;  3UTB A;  4WU8 B;  3UTB C;  1KX3 A;  3AZJ A;  3AZJ C;  1KX3 C;  5GXQ A;  5GXQ C;  3AZL D;  2CV5 A;  2CV5 C;  2PYO C;  3X1U A;  3X1U C;  2YFV A;  3C1B B;  5B2J B;  1S32 A;  1S32 C;  5AVB B;  2LY8 A;  3MGS D;  1P3P C;  5B24 A;  5B24 C;  1P3P A;  5AV8 D;  1F66 A;  1F66 C;  2BG1 A;  3X1T A;  3B0C T;  3WA9 A;  3WA9 C;  1M18 A;  5GT0 A;  5GT0 C;  1M18 C;  2ZM5 A;  4NE5 A;  1P3I D;  5B1M D;  3LZ0 A;  4CSR B;  3LZ0 C;  3REL D;  2YFW A;  3AV1 D;  3MNN D;  4E45 A;  3W97 A;  3W97 C;  2RVQ C;  3P5J B;  5CPK D;  2J8P A;  3UT9 C;  1BH9 B;  1P3I B;  5B1M B;  2RIQ A;  3TU4 C;  3AV1 B;  4Z66 A;  3A1K A;  3MNN B;  1B6W A;  4ZBJ C;  3B6G D;  3B6F D;  5CPK B;  4Z5T A;  4Z5T C;  3X1V D;  4R8P D;  3MGP A;  4H9P B;  5BNV A;  5JA4 B;  5GSU A;  5GSU C;  5B31 A;  5B31 C;  3IP4 C;  5CP6 D;  3KUY A;  3KUY C;  1H3O B;  3B6G B;  1KX3 D;  2HUE B;  5GXQ D;  3X1V B;  2ARO B;  1U35 C;  4G92 B;  1U35 A;  5BO0 B;  3LEL C;  2FJ7 A;  2FJ7 C;  1B67 A;  2F8N B;  5CP6 B;  1P3P D;  4XUJ D;  1F66 D;  3R45 B;  4EO5 C;  4J8X C;  4J8X A;  3WA9 D;  1P3O D;  5E5A A;  5E5A C;  5KDM B;  4J8U A;  4J8U C;  4WU8 A;  4WU8 C;  4XUJ B;  2FFF B;  3C1B A;  3C1B C;  1M19 D;  5B2J A;  5B2J C;  1P3A D;  2DQN C;  4WNN B;  1P3O B;  5AVB A;  5AVB C;  3W99 A;  3UT9 D;  5B0Y B;  5B32 D;  3WKJ B;  3TU4 D;  3AZL A;  1M19 B;  1P3A B;  4CSR A;  4Z5T D;  5B32 B;  2F8N H;  1HQ3 D;  2F2A C;  1W2E A;  1BH9 A;  1P3I A;  5B1M A;  5B1M C;  1P3I C;  5F99 D;  3LEL D;  3AV1 A;  3MNN A;  3MNN C;  4KUD D;  4J8W D;  4E44 A;  3REK D;  5CPK A;  5CPK C;  1HQ3 B;  2NQB B;  4JJN D;  4H9P A;  4ZUX D;  4J8X D;  5JA4 A;  5F99 B;  3VH5 W;  5GT3 D;  1A7W A;  4KUD B;  1KU5 A;  4J8W B;  2NZD B;  1H3O A;  4UPK A;  3B6G A;  5G49 B;  3B6G C;  3W96 D;  3REK B;  3B6F A;  3B0D B;  2HUE C;  2VQR A;  3WAA D;  5BNX B;  3X1V A;  3X1V C;  2ARO A;  2ARO C;  4G92 C;  5BO0 A;  4R8P A;  4JJN B;  2Y2M A;  5DNN D;  4EO5 B;  4ZUX B;  1KX5 D;  3AFA D;  5AVB D;  3VH6 W;  2F8N A;  5CP6 A;  5CP6 C;  5GT3 B;  1P3G D;  5AY8 B;  5B40 D;  3R45 A;  3W96 B;  3WAA B;  2BYK A;  3UTA D;  5DNN B;  5KDM A;  1KX5 B;  3AZN D;  3AFA B;  4Z2M G;  1P3M D;  4KGC B;  4YM6 B;  4XUJ A;  4XUJ C;  2F8N K;  1P3G B;  3MGQ D;  5B40 B;  3NQU A;  3O62 D;  4WNN A;  5DNM D;  1P3O A;  1P3O C;  4WZS B;  5B0Y A;  5B0Y C;  3UTA B;  3AZN B;  3WKJ A;  1P3M B;  3WKJ C;  1WWI A;  3X1S B;  1M19 A;  1M19 C;  3MGQ B;  1P3A A;  1P3A C;  1M1A D;  3O62 B;  4H9O B;  5DNM B;  3AZM B;  3UT9 A;  5B32 A;  5B32 C;  3TU4 A;  3AZF B;  1T3U A;  3WTP D;  1M1A B;  2ARO D;  3B0B A;  4J8V D;  2HIO B;  3AN2 D;  2F8N D;  2IO5 B;  5B33 D;  1HQ3 A;  1HQ3 C;  5B2I D;  3C1C D;  1P3K D;  2NQB C;  3MVD B;  2ZY4 A;  3WTP B;  3EPL A;  5F99 A;  5F99 C;  1AOI C;  4UUZ B;  3LEL A;  4NE3 A;  4J8V B;  3EG5 B;  1KX4 D;  4KUD A;  4J8W A;  4J8W C;  4KUD C;  2NZD A;  2NZD C;  3AN2 B;  5B33 B;  3REK A;  3REK C;  3B0D C;  5BNX A;  5B2I B;  5AV5 B;  3A6N D;  3C1C B;  4DRA A;  1P3K B;  4JJN A;  3EPK A;  5B31 G;  4ZUX A;  4G91 B;  4ZUX C;  4JJN C;  4XZQ C;  3MGR B;  5AV6 D;  5B0Y D;  5GT3 A;  5GT3 C;  5CPI D;  1KX4 B;  3WKJ D;  1Q9C A;  5AY8 C;  3W96 A;  3W96 C;  3WAA A;  3WAA C;  2DF4 C;  3A6N B;  4H9N B;  1Z2C B;  5DNN A;  5DNN C;  2Y2Q A;  1KX5 A;  1KX5 C;  3AFA A;  3AFA C;  3NQJ B;  4KGC C;  4KGC A;  1BFM A;  5AV6 B;  4M6B A;  4YM6 C;  1P3L D;  5CPI B;  1P3G A;  1P3G C;  5B40 A;  5B40 C;  2G5H C;  1BH8 B;  3AZE D;  2YFV B;  3UTA C;  2UWX A;  3UTA A;  1R4V A;  1P34 D;  3AZN A;  3AZN C;  4NFT A;  1P3M C;  3KWQ D;  1P3M A;  3KSY A;  2L5A A;  1P3L B;  3X1S A;  3X1S C;  3LJA D;  3F6T A;  3MGQ A;  3MGQ C;  3O62 A;  3O62 C;  4H9O A;  5DNM A;  5DNM C;  3AZM A;  3AZM C;  3AV2 D;  3FDD A;  2NQB D;  1F1E A;  3AZE B;  1P34 B;  1AOI D;  3KWQ B;  3AZF A;  3AZF C;  4YS3 D;  2NZD D;  3LJA B;  1TZY D;  3A1I A;  1M1A A;  1M1A C;  1EQZ D;  3AV2 B;  1P3B D;  3W98 B;  3VH5 A;  2Y2G A;  3WTP E;  1ZLA B;  4XZQ D;  3AZK B;  2HIO C;  1AOI B;  2IO5 C;  4WV4 B;  4H9Q B;  3EPH A;  3H0R C;  4Z66 B;  4YS3 B;  5AY8 D;  3MVD A;  3MVD C;  1TZY B;  3WTP A;  3WTP C;  1EQZ B;  4X23 D;  1P3B B;  4UUZ A;  3VH6 A;  4J8V A;  4J8V C;  1TAF B;  3MGP B;  4XZQ B;  4KGC D;  2JCH A;  3AN2 C;  3AN2 A;  2Y2O A;  5B33 A;  5B33 C;  4YM6 D;  3AYW D;  5B2I A;  5AV5 A;  5B2I C;  5AV5 C;  3C1C A;  3C1C C;  1P3K A;  1P3K C;  4G91 C;  2BYM B;  4QLC D;  4X23 B;  3MGR C;  5AV9 D;  1KX4 A;  1KX4 C;  4AWL B;  3AYW B;  3X1S D;  3A6N A;  3A6N C;  1PZR A;  1N1J B;  4QLC B;  4KHA B;  3NQJ A;  3REH B;  3AZM D;  5AV6 A;  5AV6 C;  5CPI A;  5CPI C;  5AV9 B;  4H9R B;  3AZF D;  3LZ1 D;  5BS7 A;  5BS7 C;  1BH8 A;  4DQY B;  3KFU G;  4WU9 D;  5FUG B;  4HGA B;  5C3I B;  1ID3 D;  3H0L C;  3B0C W;  5CPJ D;  3V9R B;  1P3F D;  2W8S A;  1JFI B;  3W99 B;  1P3L A;  4NE6 A;  1P3L C;  2HIO D;  2ZY5 A;  3AZG D;  5CHL B;  5B0Z D;  3LZ1 B;  3X1T C;  3AZL B;  3MVD D;  3AZE A;  3AZE C;  4WU9 B;  1ID3 B;  3H0M C;  1P34 C;  1P34 A;  5CPJ B;  3KWQ A;  3KWQ C;  1P3F B;  2ZY3 A;  3REJ D;  3MGS B;  3LJA A;  5AV8 B;  3LJA C;  3REI D;  3AZG B;  5B0Z B;  3AV2 A;  5AV5 D;  3AZH D;  3AV2 C;  3W98 A;  3W98 C;  2NQB A;  5B32 G;  1ZLA A;  3AZK A;  3AZK C;  1ZLA C;  3KXB D;  3MGR D;  1AOI A;  4H9Q A;  3REJ B;  3REL B;  4YS3 A;  4YS3 C;  4Z66 C;  4LD9 D;  5G49 A;  2Y2J A;  1TZY A;  1TZY C;  3REI B;  5JRG D;  2JSS A;  1EQZ A;  1EQZ C;  3AZH B;  1P3B A;  2ZY2 A;  1P3B C;  1TAF A;  3MGP C;  4XZQ A;  3KXB B;  5B1L D;  3AL0 C;  2Y2P A;  2Y2K A;  3AZI D;  5AVC D;  5AY8 A;  4LD9 B;  2BYM A;  5BT1 C;  3UTB D;  2PYO D;  5JRG B;  3AZJ D;  4X23 A;  4X23 C;  3B6F B;  2CV5 D;  3X1U D;  4CAY B;  4R8P B;  4AWL C;  1S32 D;  2Y2I A;  5B1L B;  4YM6 A;  3AYW A;  3AYW C;  3AZI B;  5B24 D;  5AVC B;  1N1J A;  4QLC A;  4QLC C;  4KHA A;  3X1T D;  3UTB B;  3REH A;  3REH C;  3AZJ B;  1KX3 B;  2PYO B;  5GXQ B;  2CV5 B;  1M18 D;  5GT0 D;  3X1U B;  2Y2H A;  2BYK B;  5AV9 A;  5AV9 C;  4H9R A;  1S32 B;  1HTA A;  3LZ0 D;  2G5I C;  1P3P B;  5B24 B;  2XD5 A;  5FUG A;  4HGA C;  1F66 B;  4WJ3 C;  5C3I C;  3W97 D;  2RVQ D;  3X1T B;  3NQU B;  3V9R A;  3WA9 B;  3W98 D;  1JFI A;  1M18 B;  5GT0 B;  3W99 C;  2Y2N A;  1WWS A;  1ZLA D;  3AZK D;  3LZ0 B;  3LZ1 A;  3LZ1 C;  2YFW B;  4Z66 D;  3AZL C;  4WU9 A;  4WU9 C;  1ID3 A;  1ID3 C;  3W97 B;  5CPJ A;  5CPJ C;  1P3F A;  1P3F C;  4Z2M H;  3MGP D;  3UT9 B;  3MGS A;  3MGS C;  2HIO A;  5GSU D;  5AV8 A;  2JE5 A;  5AV8 C;  5B31 D;  3AZG A;  3AZG C;  5B0Z A;  5B0Z C;  3TU4 B;  3KUY D;  4ZBJ B;  2CWE A;  5BT1 D;  3VH5 T;  4Z5T B;  1U35 D;  3REJ A;  3REJ C;  3REL A;  3REL C;  3AV1 C;  2FJ7 D;  4DRB A;  5BNV B;  5GSU B;  3REI A;  5B31 B;  3REI C;  3AZH A;  3AZH C;  3EPJ A;  3KUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...