3KUYC

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyC00
4YM6C 4H9RA 3B0CW 5B31D 5B32A 3W97A 5B1LD 3WTPA 3W99A 3LELA 4X23C 3KXBC 3REJC 2F8NK 3WA9D 1BH8B 3REIC 4ZUXD 3RELD 5AV6A 5F99A 3AZEC 1KX4C 5AVBD 3MGQA 1F66C 4YM6B 1KX3C 4YS3D 3A6NA 5AV9C 1U35A 3R45B 2F8NA 3KWQA 3AYWC 5CP6C 1M19C 5BO0B 1ZLAC 4WV4B 4J8UC 2AROC 4X23B 3KXBB 1EQZA 3REJB 3REIB 3AZEB 1KX4B 3AV2C 1Q9CA 1F66B 1KX3B 1S32A 5B2IC 3AZID 1P3KA 3C1BC 4CSRB 1B6WA 3AYWB 3B6FC 5CP6B 1M19B 5CPIC 3C1CC 1ZLAB 4KUDC 5B33D 4J8UB 2AROB 5B24A 3AFAA 3B0CT 3AZGC 3AV2B 3LZ1C 5BT1D 5B2IB 5B40C 3X1VC 3C1BB 3TU4A 5AY8C 3V9RA 1M1AC 3KUYD 3B6FB 3KUYB 5CPIB 3C1CB 1P3IC 4KUDB 1KX5D 3X1TD 3AZKD 2IO5C 5B0YC 3X1SA 4H9QB 3AZGB 3B6GA 3LZ1B 1BH9A 5B40B 3X1VB 1HQ3D 2BYMA 5AY8B 3VH6W 1M1AB 5B1LA 1P3IB 4WU9C 1P3GC 2IO5B 5B0YB 4Z5TD 5AVBA 1P3AD 4XUJC 4H9OB 3R45A 5BO0A 3UTBD 4WU8C 4WU9B 5BS7C 3KXBA 1P3GB 3REJA 3REIA 3X1UD 3REKC 1KX4A 4XZQD 1KX3A 2PYOC 4XUJB 5CPKB 3VH5W 3UT9C 3AYWA 5CP6A 5GT3C 1M19A 1ZLAA 4WU8B 5B32D 4J8UA 2AROA 3W97D 3WTPD 3W99D 3LELD 3REKB 3AV2A 4Z66C 1P3BC 5AV6D 3VH6T 5F99D 5B2IA 4AWLC 2PYOB 3MGQD 3C1BA 4DRBA 1U35D 4KGCC 3UT9B 3WKJC 3B6FA 3MNNC 5GT3B 3KUYA 4KHAB 3C1CA 5CPIA 4KUDA 3KWQD 1KX5A 3X1TA 2CWEA 4NE5A 3AZFC 3W98C 3AZGA 3LZ1A 4Z66B 4UUZA 1P3BB 4AWLB 5GSUD 5B40A 2CV5C 3AZHC 1S32D 5AY8A 4KGCB 3NQUB 1P3KD 4EO5C 1M1AA 3WKJB 3MNNB 1P3IA 5BNVB 4QLCC 4J8XD 3AZFB 3W98B 5B0YA 2HIOC 4Z5TA 3LJAD 3VH5T 4Z2MG 5B24D 3AFAD 1P34C 4H9OA 2CV5B 3AZHB 5GT0C 4EO5B 3TU4D 4WU9A 4QLCB 4H9NB 5E5AC 3O62C 1AOIB 3X1UA 3AZJC 2HIOB 5B2JC 4XZQA 1P3LD 3X1SD 3B6GD 5CPKA 4NE6A 1P34B 3AZLC 5GT0B 3REHC 3AN2C 4WU8A 4DRAA 5B0ZC 3MVDC 5BS7A 5E5AB 2RVQC 3O62B 3AZJB 3REKA 2PYOA 1M18C 5DNNC 4YM6D 3AZLB 4M6BA 2L5AA 5GT3A 4KHAA 5JA4B 3REHB 3AN2B 5B0ZB 3MVDB 3WTPE 5DNMC 4X23D 3KXBD 3REJD 5AV5C 3LZ0C 3REID 3AZED 1P3BA 1N1JB 1KX4D 5GSUA 1M18B 1F66D 5DNNB 1KX3D 4KGCA 5AV9B 3WKJA 2LY8A 5BNVA 3AYWD 5CP6D 4J8XA 1M19D 1ZLAD 3W98A 5DNMB 4J8UD 2AROD 3LJAA 5AV5B 3LZ0B 4R8PC 3AV2D 2CV5A 3AZHA 5B2ID 3MGPC 5JRGC 3B0DC 3C1BD 3WAAC 1H3OB 4QLCA 3B6FD 5CPID 3C1CD 1AOIA 4KUDD 3VH6A 2HIOA 1JFIB 1P3LA 3AZGD 4R8PB 1P34A 5FUGB 3LZ1D 4JJNC 3MGPB 5JRGB 5B40D 3X1VD 5CPJC 3B0DB 3MGRC 3WAAB 5G49B 5AY8D 2NQBC 1M1AD 5E5AA 1P3ID 4E44A 3O62A 3AZJA 4G91C 1BH8A 2FJ7C 5B0YD 1ID3C 2YFVB 3AZLA 3B0BA 4YM6A 4JJNB 5CPJB 3REHA 3AN2A 3MGRB 4J8WC 2NQBB 5B0ZA 2BYKB 3MVDA 5AV8C 3VH5A 4WU9D 4X23A 1P3GD 3MGSC 4LD9C 4G91B 3W96C 2FJ7B 3AZEA 1N1JA 4J8VC 1ID3B 1P3MC 1M18A 5DNNA 1F66A 4XUJD 5AV9A 5CPKD 4J8WB 4CSRA 5B1MC 2F8NG 5AVCC 5AV8B 4WU8D 1WWIA 3MGSB 4LD9B 5AV5A 3LZ0A 3W96B 3REKD 4J8VB 1P3MB 2PYOD 4G92C 1H3OA 5B1MB 3UT9D 5GT3D 5AVCB 1JFIA 1P3OC 4H9SC 4H9QA 4R8PA 5FUGA 3AZMC 4Z66D 3A6NC 1P3BD 4G92B 3MGPA 5JRGA 1WWSA 3UTAC 3X1VA 3WAAA 4KGCD 3WKJD 2HUEC 3MNND 3AZNC 1EQZC 3AZFD 1P3OB 3W98D 2YFVA 3AZMB 3A6NB 2NZDC 3UTAB 2F8NB 4WNNB 5B31G 3AZHD 2CV5D 2NQBA 2BYKA 2HUEB 3AZNB 4QLCD 1EQZB 1P3GA 1AOID 2FJ7A 1TZYC 1ID3A 2HIOD 4XUJA 1TAFB 1P34D 3AV1C 1P3FC 2NZDB 4J8WA 5GT0D 1P3PC 5AV8A 5E5AD 3MGSA 4LD9A 3O62D 3W96A 1TZYB 3AZJD 5GXQC 1R4VA 4J8VA 5B2JD 4WZSB 5B2JB 1P3MA 5B31C 1P3FB 3AV1B 3AZLD 5B1MA 3UT9A 4ZBJC 5B1LC 5AVCA 3REHD 3AN2D 1P3PB 5B0ZD 3MVDD 2RVQD 3WA9C 4ZUXC 3RELC 5GXQB 5AVBC 4YS3C 4Z66A 1BH9B 5B31B 1M18D 5DNND 2BYMB 5AV9D 3NQUA 4ZBJB 5B1LB 3MNNA 3WA9B 1P3OA 5DNMD 4ZUXB 3RELB 3AZFA 4H9SA 5AVBB 5AV5D 3AZMA 3LZ0D 5C3IC 4YS3B 3AZIC 4Z2MH 3UTAA 4WNNA 4CAYB 2YFWB 3AZNA 5B33C 4H9NA 5BT1C 5C3IB 1TAFA 3AZIB 4R8PD 4NFTA 2NZDA 5GT0A 5JRGD 3MGPD 3KUYC 3WAAD 5B33B 1KX5C 3X1TC 3AZKC 5BNXB 4HGAC 1TZYA 5B2JA 1P3FA 3AV1A 5KDMB 4JJND 1HQ3C 1KU5A 5CPJD 1P3PA 5JA4A 3MGRD 2NQBD 1KX5B 3X1TB 3AZKB 5B32G 3NQJB 4HGAB 4Z5TC 5GXQA 1P3AC 2FJ7D 4UUZB 5B31A 1ID3D 3KSYA 1HQ3B 4E45A 3UTBC 4J8WD 1HTAA 3WA9A 5AV8D 4ZUXA 3RELA 5DNMA 3X1UC 4Z5TB 3MGSD 4LD9D 1P3AB 4XZQC 3W96D 4YS3A 5CPKC 4J8VD 1P3MD 4CAYA 2YFWA 3UTBB 5B32C 5B1MD 3W97C 3WTPC 3W99C 1F1EA 5AVCD 2JSSA 3LELC 3X1UB 4H9PB 4NE3A 4XZQB 5AV6C 5F99C 3AZIA 3MGQC 1U35C 4H9RB 1A7WA 3KWQC 5CHLB 1B67A 5G49A 5B32B 1ULYA 5B33A 3W97B 3WTPB 3W99B 3LELB 5BNXA 1P3OD 5AV6B 5F99B 5GSUC 3MGQB 3AZMD 1BFMA 5KDMA 3A6ND 1S32C 4JJNA 1U35B 1P3KC 3UTAD 5CPJA 2F8ND 3MGRA 3KWQB 4J8XC 3AZKA 3NQJA 3AZND 1EQZD 3LJAC 3B6GB 5B24C 3AFAC 5GSUB 1HQ3A 1S32B 1P3KB 2NZDD 3TU4C 4J8XB 1AOIC 2F8NH 3LJAB 1P3AA 5B24B 3AFAB 1TZYD 1P3LC 3X1SC 3B6GC 1P3FD 3AV1D 3UTBA 3TU4B 3V9RB 1P3PD 4H9PA 1P3LB 3X1SB 5GXQD
chains in the Genus database with same CATH superfamily
4YM6C 3A1KA 4H9RA 3B0CW 5B31D 5B32A 3W97A 5B1LD 3EPJA 3WTPA 3W99A 3LELA 4X23C 3KXBC 3REJC 2F8NK 3WA9D 1BH8B 3REIC 4ZUXD 3RELD 5AV6A 5F99A 3AZEC 1KX4C 5AVBD 3MGQA 1F66C 2DF4C 4YM6B 1KX3C 4YS3D 3A6NA 5AV9C 1U35A 3R45B 2F8NA 3KWQA 3AYWC 5CP6C 1M19C 5BO0B 1ZLAC 4WV4B 2F2AC 4J8UC 2AROC 4X23B 3KXBB 1EQZA 3REJB 2Y2QA 3REIB 3AZEB 1KX4B 3AV2C 1Q9CA 1F66B 1KX3B 1S32A 5B2IC 3AZID 1P3KA 3C1BC 4CSRB 1B6WA 3AYWB 3B6FC 5CP6B 1M19B 5CPIC 3C1CC 1ZLAB 4KUDC 5B33D 4J8UB 2AROB 3H0MC 5B24A 3AFAA 3B0CT 3AZGC 3AV2B 3LZ1C 5BT1D 5B2IB 5B40C 3X1VC 3C1BB 3TU4A 5AY8C 3V9RA 1M1AC 3KUYD 3B6FB 3KUYB 5CPIB 3C1CB 1P3IC 4KUDB 1KX5D 3X1TD 3AZKD 2Y2NA 2IO5C 5B0YC 3X1SA 4H9QB 3AZGB 3B6GA 3LZ1B 1BH9A 5B40B 3X1VB 2ZY2A 1HQ3D 2BYMA 5AY8B 3VH6W 1M1AB 5B1LA 1P3IB 4WU9C 3P5JB 1P3GC 2IO5B 5B0YB 4Z5TD 5AVBA 1P3AD 4XUJC 4H9OB 3R45A 5BO0A 3UTBD 4WU8C 4WU9B 5BS7C 3KXBA 1P3GB 3REJA 3REIA 3X1UD 3REKC 1KX4A 4XZQD 1KX3A 2PYOC 4XUJB 2Y2MA 5CPKB 3VH5W 3UT9C 3AYWA 5CP6A 5GT3C 1M19A 1ZLAA 4WU8B 5B32D 4J8UA 2AROA 3W97D 3WTPD 3W99D 3LELD 3REKB 3AV2A 4Z66C 1P3BC 5AV6D 3VH6T 5F99D 5B2IA 4AWLC 2PYOB 4WJ3C 3MGQD 3C1BA 4DRBA 1U35D 4KGCC 3UT9B 3WKJC 3B6FA 3MNNC 5GT3B 3KUYA 4KHAB 3C1CA 5CPIA 4KUDA 3KWQD 2J8PA 1KX5A 3X1TA 2CWEA 4NE5A 3AZFC 3W98C 3AZGA 3LZ1A 4Z66B 4UUZA 1P3BB 4AWLB 5GSUD 5B40A 2CV5C 3AZHC 1S32D 5AY8A 4DQYB 3NQUB 1P3KD 4EO5C 1M1AA 3WKJB 4KGCB 3MNNB 1P3IA 5BNVB 4QLCC 4J8XD 2FFFB 3AZFB 3W98B 5B0YA 2HIOC 4Z5TA 3LJAD 3VH5T 4Z2MG 5B24D 3AFAD 3H0RC 1P34C 4H9OA 2CV5B 3AZHB 5GT0C 4EO5B 3TU4D 4WU9A 4QLCB 4H9NB 5E5AC 3O62C 1AOIB 3X1UA 3AZJC 2HIOB 5B2JC 4XZQA 1P3LD 3X1SD 3B6GD 5CPKA 4NE6A 1P34B 3AZLC 5GT0B 3REHC 2Y2KA 3AN2C 4WU8A 4DRAA 5B0ZC 3MVDC 5BS7A 5E5AB 2RVQC 3O62B 3AZJB 2UWXA 3REKA 2PYOA 1M18C 5DNNC 4YM6D 3AZLB 4M6BA 2L5AA 2W8SA 3KFUG 5GT3A 4KHAA 5JA4B 3REHB 3AN2B 5B0ZB 3MVDB 3WTPE 5DNMC 4X23D 3KXBD 2Y2OA 3REJD 5AV5C 3LZ0C 3REID 3AZED 1P3BA 1N1JB 1KX4D 5GSUA 1M18B 1F66D 5DNNB 1KX3D 2JCHA 4KGCA 5AV9B 3WKJA 2LY8A 5BNVA 3AYWD 5CP6D 4J8XA 1M19D 1ZLAD 3W98A 5DNMB 4J8UD 2AROD 3LJAA 5AV5B 3LZ0B 2ZY4A 4R8PC 3AV2D 2CV5A 3AZHA 2Y2IA 5B2ID 3MGPC 5JRGC 4UPKA 2ZY3A 3B0DC 3C1BD 3WAAC 1H3OB 4QLCA 3B6FD 5CPID 3C1CD 1AOIA 4KUDD 2JE5A 3VH6A 2HIOA 1JFIB 2ZY5A 3AZGD 1P3LA 4R8PB 1P34A 5FUGB 3LZ1D 4JJNC 3MGPB 5JRGB 2DQNC 5B40D 3X1VD 5CPJC 2Y2PA 3B0DB 3MGRC 3WAAB 5G49B 5AY8D 2NQBC 1M1AD 5E5AA 1P3ID 4E44A 3O62A 3AZJA 4G91C 1BH8A 2FJ7C 5B0YD 1ID3C 2YFVB 3EPKA 3AZLA 3B0BA 4YM6A 4JJNB 5CPJB 3REHA 3AN2A 3MGRB 4J8WC 2NQBB 5B0ZA 2BYKB 3MVDA 5AV8C 3VH5A 4WU9D 4X23A 1P3GD 3MGSC 4LD9C 4G91B 3W96C 2FJ7B 3AZEA 3EG5B 1N1JA 4J8VC 1ID3B 1P3MC 1M18A 5DNNA 1F66A 4XUJD 5AV9A 5CPKD 4J8WB 4CSRA 5B1MC 2F8NG 5AVCC 5AV8B 4WU8D 1WWIA 3MGSB 4LD9B 5AV5A 3LZ0A 3W96B 3REKD 4J8VB 1P3MB 2PYOD 4G92C 1H3OA 2Y2HA 5B1MB 3UT9D 5GT3D 5AVCB 1JFIA 1P3OC 4H9SC 4H9QA 4R8PA 5FUGA 3AZMC 4Z66D 3A6NC 1P3BD 4G92B 3MGPA 5JRGA 1WWSA 3UTAC 3X1VA 3WAAA 4KGCD 3WKJD 2HUEC 2XD5A 3MNND 3AZNC 1EQZC 3AZFD 1P3OB 3W98D 2YFVA 3AZMB 3A6NB 2NZDC 3UTAB 2F8NB 4WNNB 5B31G 3AZHD 2CV5D 2NQBA 3FDDA 2BYKA 2HUEB 3AZNB 4QLCD 1EQZB 1P3GA 2Y2GA 1AOID 2FJ7A 1TZYC 1ID3A 2HIOD 4XUJA 1TAFB 1P34D 3AV1C 1P3FC 2NZDB 4J8WA 5GT0D 1P3PC 3IP4C 3A1IA 5AV8A 5E5AD 3MGSA 4LD9A 3O62D 3W96A 1TZYB 3AZJD 5GXQC 1R4VA 4J8VA 5B2JD 4WZSB 5B2JB 2Y2LA 1P3MA 5B31C 1P3FB 3AV1B 3AZLD 5B1MA 3UT9A 4ZBJC 1T3UA 5B1LC 5AVCA 3REHD 3AN2D 1P3PB 5B0ZD 3MVDD 2RVQD 3WA9C 4ZUXC 3RELC 5GXQB 5AVBC 4YS3C 4Z66A 1BH9B 5B31B 1M18D 5DNND 2BYMB 5AV9D 3NQUA 4ZBJB 5B1LB 3MNNA 3EPHA 3WA9B 1P3OA 5DNMD 4ZUXB 3RELB 3AZFA 4H9SA 5AVBB 5AV5D 3AZMA 3LZ0D 5C3IC 4YS3B 3AZIC 4Z2MH 3UTAA 4WNNA 4CAYB 2RIQA 2YFWB 3AZNA 5B33C 4H9NA 5BT1C 5C3IB 1TAFA 3AZIB 2G5HC 4R8PD 4NFTA 2NZDA 5GT0A 5JRGD 3MGPD 3KUYC 3WAAD 5B33B 1KX5C 1PZRA 3X1TC 3AZKC 5BNXB 4HGAC 1TZYA 5B2JA 1P3FA 3AV1A 5KDMB 4JJND 1HQ3C 1KU5A 5CPJD 1P3PA 5JA4A 3MGRD 2NQBD 1KX5B 3X1TB 3AZKB 5B32G 3NQJB 4HGAB 4Z5TC 5GXQA 1P3AC 2FJ7D 4UUZB 5B31A 1ID3D 3KSYA 1HQ3B 4E45A 3UTBC 4J8WD 1HTAA 3WA9A 5AV8D 4ZUXA 3RELA 5DNMA 3X1UC 4Z5TB 3MGSD 4LD9D 3EPLA 1P3AB 4XZQC 3W96D 1Z2CB 4YS3A 5CPKC 4J8VD 1P3MD 4CAYA 2YFWA 3F6TA 3UTBB 5B32C 5B1MD 3W97C 3WTPC 3W99C 1F1EA 5AVCD 2JSSA 3LELC 3X1UB 4H9PB 4NE3A 4XZQB 5AV6C 5F99C 3AZIA 3MGQC 1U35C 4H9RB 2BG1A 3AL0C 1A7WA 3KWQC 5CHLB 1B67A 5G49A 5B32B 1ULYA 5B33A 3W97B 3WTPB 3W99B 3LELB 5BNXA 1P3OD 5AV6B 5F99B 5GSUC 3MGQB 3AZMD 1BFMA 5KDMA 3A6ND 2ZM5A 4JJNA 1S32C 3H0LC 1U35B 1P3KC 3UTAD 5CPJA 2F8ND 3MGRA 3KWQB 4J8XC 2XD1A 3AZKA 3NQJA 3AZND 1EQZD 3LJAC 3B6GB 5B24C 3AFAC 5GSUB 1HQ3A 2VQRA 1S32B 1P3KB 2NZDD 3TU4C 4J8XB 1AOIC 2F8NH 3LJAB 1P3AA 5B24B 3AFAB 1TZYD 1P3LC 3X1SC 3B6GC 2Y2JA 1P3FD 2G5IC 3AV1D 3UTBA 3TU4B 3V9RB 1P3PD 4H9PA 1W2EA 1P3LB 3X1SB 5GXQD
chains in the Genus database with same CATH topology
4YM6C 3A1KA 4H9RA 3B0CW 5B31D 5B32A 3W97A 5B1LD 3EPJA 3WTPA 3W99A 3LELA 4X23C 3KXBC 3REJC 2F8NK 3WA9D 1BH8B 3REIC 4ZUXD 3RELD 5AV6A 5F99A 3AZEC 1KX4C 5AVBD 3MGQA 1F66C 2DF4C 4YM6B 1KX3C 4YS3D 3A6NA 5AV9C 1U35A 3R45B 2F8NA 3KWQA 3AYWC 5CP6C 1M19C 5BO0B 1ZLAC 4WV4B 2F2AC 4J8UC 2AROC 4X23B 3KXBB 1EQZA 3REJB 2Y2QA 3REIB 3AZEB 1KX4B 3AV2C 1Q9CA 1F66B 1KX3B 1S32A 5B2IC 3AZID 1P3KA 3C1BC 4CSRB 1B6WA 3AYWB 3B6FC 5CP6B 1M19B 5CPIC 3C1CC 1ZLAB 4KUDC 5B33D 4J8UB 2AROB 3H0MC 5B24A 3AFAA 3B0CT 3AZGC 3AV2B 3LZ1C 5BT1D 5B2IB 5B40C 3X1VC 3C1BB 3TU4A 5AY8C 3V9RA 1M1AC 3KUYD 3B6FB 3KUYB 5CPIB 3C1CB 1P3IC 4KUDB 1KX5D 3X1TD 3AZKD 2Y2NA 2IO5C 5B0YC 3X1SA 4H9QB 3AZGB 3B6GA 3LZ1B 1BH9A 5B40B 3X1VB 2ZY2A 1HQ3D 2BYMA 5AY8B 3VH6W 1M1AB 5B1LA 1P3IB 4WU9C 3P5JB 1P3GC 2IO5B 5B0YB 4Z5TD 5AVBA 1P3AD 4XUJC 4H9OB 3R45A 5BO0A 3UTBD 4WU8C 4WU9B 5BS7C 3KXBA 1P3GB 3REJA 3REIA 3X1UD 3REKC 1KX4A 4XZQD 1KX3A 2PYOC 4XUJB 2Y2MA 5CPKB 3VH5W 3UT9C 3AYWA 5CP6A 5GT3C 1M19A 1ZLAA 4WU8B 5B32D 4J8UA 2AROA 3W97D 3WTPD 3W99D 3LELD 3REKB 3AV2A 4Z66C 1P3BC 5AV6D 3VH6T 5F99D 5B2IA 4AWLC 2PYOB 4WJ3C 3MGQD 3C1BA 4DRBA 1U35D 4KGCC 3UT9B 3WKJC 3B6FA 3MNNC 5GT3B 3KUYA 4KHAB 3C1CA 5CPIA 4KUDA 3KWQD 2J8PA 1KX5A 3X1TA 2CWEA 4NE5A 3AZFC 3W98C 3AZGA 3LZ1A 4Z66B 4UUZA 1P3BB 4AWLB 5GSUD 5B40A 2CV5C 3AZHC 1S32D 5AY8A 4DQYB 3NQUB 1P3KD 4EO5C 1M1AA 3WKJB 4KGCB 3MNNB 1P3IA 5BNVB 4QLCC 4J8XD 2FFFB 3AZFB 3W98B 5B0YA 2HIOC 4Z5TA 3LJAD 3VH5T 4Z2MG 5B24D 3AFAD 3H0RC 1P34C 4H9OA 2CV5B 3AZHB 5GT0C 4EO5B 3TU4D 4WU9A 4QLCB 4H9NB 5E5AC 3O62C 1AOIB 3X1UA 3AZJC 2HIOB 5B2JC 4XZQA 1P3LD 3X1SD 3B6GD 5CPKA 4NE6A 1P34B 3AZLC 5GT0B 3REHC 2Y2KA 3AN2C 4WU8A 4DRAA 5B0ZC 3MVDC 5BS7A 5E5AB 2RVQC 3O62B 3AZJB 2UWXA 3REKA 2PYOA 1M18C 5DNNC 4YM6D 3AZLB 4M6BA 2L5AA 2W8SA 3KFUG 5GT3A 4KHAA 5JA4B 3REHB 3AN2B 5B0ZB 3MVDB 3WTPE 5DNMC 4X23D 3KXBD 2Y2OA 3REJD 5AV5C 3LZ0C 3REID 3AZED 1P3BA 1N1JB 1KX4D 5GSUA 1M18B 1F66D 5DNNB 1KX3D 2JCHA 4KGCA 5AV9B 3WKJA 2LY8A 5BNVA 3AYWD 5CP6D 4J8XA 1M19D 1ZLAD 3W98A 5DNMB 4J8UD 2AROD 3LJAA 5AV5B 3LZ0B 2ZY4A 4R8PC 3AV2D 2CV5A 3AZHA 2Y2IA 5B2ID 3MGPC 5JRGC 4UPKA 2ZY3A 3B0DC 3C1BD 3WAAC 1H3OB 4QLCA 3B6FD 5CPID 3C1CD 1AOIA 4KUDD 2JE5A 3VH6A 2HIOA 1JFIB 2ZY5A 3AZGD 1P3LA 4R8PB 1P34A 5FUGB 3LZ1D 4JJNC 3MGPB 5JRGB 2DQNC 5B40D 3X1VD 5CPJC 2Y2PA 3B0DB 3MGRC 3WAAB 5G49B 5AY8D 2NQBC 1M1AD 5E5AA 1P3ID 4E44A 3O62A 3AZJA 4G91C 1BH8A 2FJ7C 5B0YD 1ID3C 2YFVB 3EPKA 3AZLA 3B0BA 4YM6A 4JJNB 5CPJB 3REHA 3AN2A 3MGRB 4J8WC 2NQBB 5B0ZA 2BYKB 3MVDA 5AV8C 3VH5A 4WU9D 4X23A 1P3GD 3MGSC 4LD9C 4G91B 3W96C 2FJ7B 3AZEA 3EG5B 1N1JA 4J8VC 1ID3B 1P3MC 1M18A 5DNNA 1F66A 4XUJD 5AV9A 5CPKD 4J8WB 4CSRA 5B1MC 2F8NG 5AVCC 5AV8B 4WU8D 1WWIA 3MGSB 4LD9B 5AV5A 3LZ0A 3W96B 3REKD 4J8VB 1P3MB 2PYOD 4G92C 1H3OA 2Y2HA 5B1MB 3UT9D 5GT3D 5AVCB 1JFIA 1P3OC 4H9SC 4H9QA 4R8PA 5FUGA 3AZMC 4Z66D 3A6NC 1P3BD 4G92B 3MGPA 5JRGA 1WWSA 3UTAC 3X1VA 3WAAA 4KGCD 3WKJD 2HUEC 2XD5A 3MNND 3AZNC 1EQZC 3AZFD 1P3OB 3W98D 2YFVA 3AZMB 3A6NB 2NZDC 3UTAB 2F8NB 4WNNB 5B31G 3AZHD 2CV5D 2NQBA 3FDDA 2BYKA 2HUEB 3AZNB 4QLCD 1EQZB 1P3GA 2Y2GA 1AOID 2FJ7A 1TZYC 1ID3A 2HIOD 4XUJA 1TAFB 1P34D 3AV1C 1P3FC 2NZDB 4J8WA 5GT0D 1P3PC 3IP4C 3A1IA 5AV8A 5E5AD 3MGSA 4LD9A 3O62D 3W96A 1TZYB 3AZJD 5GXQC 1R4VA 4J8VA 5B2JD 4WZSB 5B2JB 2Y2LA 1P3MA 5B31C 1P3FB 3AV1B 3AZLD 5B1MA 3UT9A 4ZBJC 1T3UA 5B1LC 5AVCA 3REHD 3AN2D 1P3PB 5B0ZD 3MVDD 2RVQD 3WA9C 4ZUXC 3RELC 5GXQB 5AVBC 4YS3C 4Z66A 1BH9B 5B31B 1M18D 5DNND 2BYMB 5AV9D 3NQUA 4ZBJB 5B1LB 3MNNA 3EPHA 3WA9B 1P3OA 5DNMD 4ZUXB 3RELB 3AZFA 4H9SA 5AVBB 5AV5D 3AZMA 3LZ0D 5C3IC 4YS3B 3AZIC 4Z2MH 3UTAA 4WNNA 4CAYB 2RIQA 2YFWB 3AZNA 5B33C 4H9NA 5BT1C 5C3IB 1TAFA 3AZIB 2G5HC 4R8PD 4NFTA 2NZDA 5GT0A 5JRGD 3MGPD 3KUYC 3WAAD 5B33B 1KX5C 1PZRA 3X1TC 3AZKC 5BNXB 4HGAC 1TZYA 5B2JA 1P3FA 3AV1A 5KDMB 4JJND 1HQ3C 1KU5A 5CPJD 1P3PA 5JA4A 3MGRD 2NQBD 1KX5B 3X1TB 3AZKB 5B32G 3NQJB 4HGAB 4Z5TC 5GXQA 1P3AC 2FJ7D 4UUZB 5B31A 1ID3D 3KSYA 1HQ3B 4E45A 3UTBC 4J8WD 1HTAA 3WA9A 5AV8D 4ZUXA 3RELA 5DNMA 3X1UC 4Z5TB 3MGSD 4LD9D 3EPLA 1P3AB 4XZQC 3W96D 1Z2CB 4YS3A 5CPKC 4J8VD 1P3MD 4CAYA 2YFWA 3F6TA 3UTBB 5B32C 5B1MD 3W97C 3WTPC 3W99C 1F1EA 5AVCD 2JSSA 3LELC 3X1UB 4H9PB 4NE3A 4XZQB 5AV6C 5F99C 3AZIA 3MGQC 1U35C 4H9RB 2BG1A 3AL0C 1A7WA 3KWQC 5CHLB 1B67A 5G49A 5B32B 1ULYA 5B33A 3W97B 3WTPB 3W99B 3LELB 5BNXA 1P3OD 5AV6B 5F99B 5GSUC 3MGQB 3AZMD 1BFMA 5KDMA 3A6ND 2ZM5A 4JJNA 1S32C 3H0LC 1U35B 1P3KC 3UTAD 5CPJA 2F8ND 3MGRA 3KWQB 4J8XC 2XD1A 3AZKA 3NQJA 3AZND 1EQZD 3LJAC 3B6GB 5B24C 3AFAC 5GSUB 1HQ3A 2VQRA 1S32B 1P3KB 2NZDD 3TU4C 4J8XB 1AOIC 2F8NH 3LJAB 1P3AA 5B24B 3AFAB 1TZYD 1P3LC 3X1SC 3B6GC 2Y2JA 1P3FD 2G5IC 3AV1D 3UTBA 3TU4B 3V9RB 1P3PD 4H9PA 1W2EA 1P3LB 3X1SB 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 C;  4H9R A;  3B0C W;  5B31 D;  5B32 A;  3W97 A;  5B1L D;  3WTP A;  3W99 A;  3LEL A;  4X23 C;  3KXB C;  3REJ C;  2F8N K;  3WA9 D;  1BH8 B;  3REI C;  4ZUX D;  3REL D;  5AV6 A;  5F99 A;  3AZE C;  1KX4 C;  5AVB D;  3MGQ A;  1F66 C;  4YM6 B;  1KX3 C;  4YS3 D;  3A6N A;  5AV9 C;  1U35 A;  3R45 B;  2F8N A;  3KWQ A;  3AYW C;  5CP6 C;  1M19 C;  5BO0 B;  1ZLA C;  4WV4 B;  4J8U C;  2ARO C;  4X23 B;  3KXB B;  1EQZ A;  3REJ B;  3REI B;  3AZE B;  1KX4 B;  3AV2 C;  1Q9C A;  1F66 B;  1KX3 B;  1S32 A;  5B2I C;  3AZI D;  1P3K A;  3C1B C;  4CSR B;  1B6W A;  3AYW B;  3B6F C;  5CP6 B;  1M19 B;  5CPI C;  3C1C C;  1ZLA B;  4KUD C;  5B33 D;  4J8U B;  2ARO B;  5B24 A;  3AFA A;  3B0C T;  3AZG C;  3AV2 B;  3LZ1 C;  5BT1 D;  5B2I B;  5B40 C;  3X1V C;  3C1B B;  3TU4 A;  5AY8 C;  3V9R A;  1M1A C;  3KUY D;  3B6F B;  3KUY B;  5CPI B;  3C1C B;  1P3I C;  4KUD B;  1KX5 D;  3X1T D;  3AZK D;  2IO5 C;  5B0Y C;  3X1S A;  4H9Q B;  3AZG B;  3B6G A;  3LZ1 B;  1BH9 A;  5B40 B;  3X1V B;  1HQ3 D;  2BYM A;  5AY8 B;  3VH6 W;  1M1A B;  5B1L A;  1P3I B;  4WU9 C;  1P3G C;  2IO5 B;  5B0Y B;  4Z5T D;  5AVB A;  1P3A D;  4XUJ C;  4H9O B;  3R45 A;  5BO0 A;  3UTB D;  4WU8 C;  4WU9 B;  5BS7 C;  3KXB A;  1P3G B;  3REJ A;  3REI A;  3X1U D;  3REK C;  1KX4 A;  4XZQ D;  1KX3 A;  2PYO C;  4XUJ B;  5CPK B;  3VH5 W;  3UT9 C;  3AYW A;  5CP6 A;  5GT3 C;  1M19 A;  1ZLA A;  4WU8 B;  5B32 D;  4J8U A;  2ARO A;  3W97 D;  3WTP D;  3W99 D;  3LEL D;  3REK B;  3AV2 A;  4Z66 C;  1P3B C;  5AV6 D;  3VH6 T;  5F99 D;  5B2I A;  4AWL C;  2PYO B;  3MGQ D;  3C1B A;  4DRB A;  1U35 D;  4KGC C;  3UT9 B;  3WKJ C;  3B6F A;  3MNN C;  5GT3 B;  3KUY A;  4KHA B;  3C1C A;  5CPI A;  4KUD A;  3KWQ D;  1KX5 A;  3X1T A;  2CWE A;  4NE5 A;  3AZF C;  3W98 C;  3AZG A;  3LZ1 A;  4Z66 B;  4UUZ A;  1P3B B;  4AWL B;  5GSU D;  5B40 A;  2CV5 C;  3AZH C;  1S32 D;  5AY8 A;  4KGC B;  3NQU B;  1P3K D;  4EO5 C;  1M1A A;  3WKJ B;  3MNN B;  1P3I A;  5BNV B;  4QLC C;  4J8X D;  3AZF B;  3W98 B;  5B0Y A;  2HIO C;  4Z5T A;  3LJA D;  3VH5 T;  4Z2M G;  5B24 D;  3AFA D;  1P34 C;  4H9O A;  2CV5 B;  3AZH B;  5GT0 C;  4EO5 B;  3TU4 D;  4WU9 A;  4QLC B;  4H9N B;  5E5A C;  3O62 C;  1AOI B;  3X1U A;  3AZJ C;  2HIO B;  5B2J C;  4XZQ A;  1P3L D;  3X1S D;  3B6G D;  5CPK A;  4NE6 A;  1P34 B;  3AZL C;  5GT0 B;  3REH C;  3AN2 C;  4WU8 A;  4DRA A;  5B0Z C;  3MVD C;  5BS7 A;  5E5A B;  2RVQ C;  3O62 B;  3AZJ B;  3REK A;  2PYO A;  1M18 C;  5DNN C;  4YM6 D;  3AZL B;  4M6B A;  2L5A A;  5GT3 A;  4KHA A;  5JA4 B;  3REH B;  3AN2 B;  5B0Z B;  3MVD B;  3WTP E;  5DNM C;  4X23 D;  3KXB D;  3REJ D;  5AV5 C;  3LZ0 C;  3REI D;  3AZE D;  1P3B A;  1N1J B;  1KX4 D;  5GSU A;  1M18 B;  1F66 D;  5DNN B;  1KX3 D;  4KGC A;  5AV9 B;  3WKJ A;  2LY8 A;  5BNV A;  3AYW D;  5CP6 D;  4J8X A;  1M19 D;  1ZLA D;  3W98 A;  5DNM B;  4J8U D;  2ARO D;  3LJA A;  5AV5 B;  3LZ0 B;  4R8P C;  3AV2 D;  2CV5 A;  3AZH A;  5B2I D;  3MGP C;  5JRG C;  3B0D C;  3C1B D;  3WAA C;  1H3O B;  4QLC A;  3B6F D;  5CPI D;  3C1C D;  1AOI A;  4KUD D;  3VH6 A;  2HIO A;  1JFI B;  1P3L A;  3AZG D;  4R8P B;  1P34 A;  5FUG B;  3LZ1 D;  4JJN C;  3MGP B;  5JRG B;  5B40 D;  3X1V D;  5CPJ C;  3B0D B;  3MGR C;  3WAA B;  5G49 B;  5AY8 D;  2NQB C;  1M1A D;  5E5A A;  1P3I D;  4E44 A;  3O62 A;  3AZJ A;  4G91 C;  1BH8 A;  2FJ7 C;  5B0Y D;  1ID3 C;  2YFV B;  3AZL A;  3B0B A;  4YM6 A;  4JJN B;  5CPJ B;  3REH A;  3AN2 A;  3MGR B;  4J8W C;  2NQB B;  5B0Z A;  2BYK B;  3MVD A;  5AV8 C;  3VH5 A;  4WU9 D;  4X23 A;  1P3G D;  3MGS C;  4LD9 C;  4G91 B;  3W96 C;  2FJ7 B;  3AZE A;  1N1J A;  4J8V C;  1ID3 B;  1P3M C;  1M18 A;  5DNN A;  1F66 A;  4XUJ D;  5AV9 A;  5CPK D;  4J8W B;  4CSR A;  5B1M C;  2F8N G;  5AVC C;  5AV8 B;  4WU8 D;  1WWI A;  3MGS B;  4LD9 B;  5AV5 A;  3LZ0 A;  3W96 B;  3REK D;  4J8V B;  1P3M B;  2PYO D;  4G92 C;  1H3O A;  5B1M B;  3UT9 D;  5GT3 D;  5AVC B;  1JFI A;  1P3O C;  4H9S C;  4H9Q A;  4R8P A;  5FUG A;  3AZM C;  4Z66 D;  3A6N C;  1P3B D;  4G92 B;  3MGP A;  5JRG A;  1WWS A;  3UTA C;  3X1V A;  3WAA A;  4KGC D;  3WKJ D;  2HUE C;  3MNN D;  3AZN C;  1EQZ C;  3AZF D;  1P3O B;  3W98 D;  2YFV A;  3AZM B;  3A6N B;  2NZD C;  3UTA B;  2F8N B;  4WNN B;  5B31 G;  3AZH D;  2CV5 D;  2NQB A;  2BYK A;  2HUE B;  3AZN B;  4QLC D;  1EQZ B;  1P3G A;  1AOI D;  2FJ7 A;  1TZY C;  1ID3 A;  2HIO D;  4XUJ A;  1TAF B;  1P34 D;  3AV1 C;  1P3F C;  2NZD B;  4J8W A;  5GT0 D;  1P3P C;  5AV8 A;  5E5A D;  3MGS A;  4LD9 A;  3O62 D;  3W96 A;  1TZY B;  3AZJ D;  5GXQ C;  1R4V A;  4J8V A;  5B2J D;  4WZS B;  5B2J B;  1P3M A;  5B31 C;  1P3F B;  3AV1 B;  3AZL D;  5B1M A;  3UT9 A;  4ZBJ C;  5B1L C;  5AVC A;  3REH D;  3AN2 D;  1P3P B;  5B0Z D;  3MVD D;  2RVQ D;  3WA9 C;  4ZUX C;  3REL C;  5GXQ B;  5AVB C;  4YS3 C;  4Z66 A;  1BH9 B;  5B31 B;  1M18 D;  5DNN D;  2BYM B;  5AV9 D;  3NQU A;  4ZBJ B;  5B1L B;  3MNN A;  3WA9 B;  1P3O A;  5DNM D;  4ZUX B;  3REL B;  3AZF A;  4H9S A;  5AVB B;  5AV5 D;  3AZM A;  3LZ0 D;  5C3I C;  4YS3 B;  3AZI C;  4Z2M H;  3UTA A;  4WNN A;  4CAY B;  2YFW B;  3AZN A;  5B33 C;  4H9N A;  5BT1 C;  5C3I B;  1TAF A;  3AZI B;  4R8P D;  4NFT A;  2NZD A;  5GT0 A;  5JRG D;  3MGP D;  3KUY C;  3WAA D;  5B33 B;  1KX5 C;  3X1T C;  3AZK C;  5BNX B;  4HGA C;  1TZY A;  5B2J A;  1P3F A;  3AV1 A;  5KDM B;  4JJN D;  1HQ3 C;  1KU5 A;  5CPJ D;  1P3P A;  5JA4 A;  3MGR D;  2NQB D;  1KX5 B;  3X1T B;  3AZK B;  5B32 G;  3NQJ B;  4HGA B;  4Z5T C;  5GXQ A;  1P3A C;  2FJ7 D;  4UUZ B;  5B31 A;  1ID3 D;  3KSY A;  1HQ3 B;  4E45 A;  3UTB C;  4J8W D;  1HTA A;  3WA9 A;  5AV8 D;  4ZUX A;  3REL A;  5DNM A;  3X1U C;  4Z5T B;  3MGS D;  4LD9 D;  1P3A B;  4XZQ C;  3W96 D;  4YS3 A;  5CPK C;  4J8V D;  1P3M D;  4CAY A;  2YFW A;  3UTB B;  5B32 C;  5B1M D;  3W97 C;  3WTP C;  3W99 C;  1F1E A;  5AVC D;  2JSS A;  3LEL C;  3X1U B;  4H9P B;  4NE3 A;  4XZQ B;  5AV6 C;  5F99 C;  3AZI A;  3MGQ C;  1U35 C;  4H9R B;  1A7W A;  3KWQ C;  5CHL B;  1B67 A;  5G49 A;  5B32 B;  1ULY A;  5B33 A;  3W97 B;  3WTP B;  3W99 B;  3LEL B;  5BNX A;  1P3O D;  5AV6 B;  5F99 B;  5GSU C;  3MGQ B;  3AZM D;  1BFM A;  5KDM A;  3A6N D;  1S32 C;  4JJN A;  1U35 B;  1P3K C;  3UTA D;  5CPJ A;  2F8N D;  3MGR A;  3KWQ B;  4J8X C;  3AZK A;  3NQJ A;  3AZN D;  1EQZ D;  3LJA C;  3B6G B;  5B24 C;  3AFA C;  5GSU B;  1HQ3 A;  1S32 B;  1P3K B;  2NZD D;  3TU4 C;  4J8X B;  1AOI C;  2F8N H;  3LJA B;  1P3A A;  5B24 B;  3AFA B;  1TZY D;  1P3L C;  3X1S C;  3B6G C;  1P3F D;  3AV1 D;  3UTB A;  3TU4 B;  3V9R B;  1P3P D;  4H9P A;  1P3L B;  3X1S B;  5GXQ D; 
#chains in the Genus database with same CATH topology
 4YM6 C;  3A1K A;  4H9R A;  3B0C W;  5B31 D;  5B32 A;  3W97 A;  5B1L D;  3EPJ A;  3WTP A;  3W99 A;  3LEL A;  4X23 C;  3KXB C;  3REJ C;  2F8N K;  3WA9 D;  1BH8 B;  3REI C;  4ZUX D;  3REL D;  5AV6 A;  5F99 A;  3AZE C;  1KX4 C;  5AVB D;  3MGQ A;  1F66 C;  2DF4 C;  4YM6 B;  1KX3 C;  4YS3 D;  3A6N A;  5AV9 C;  1U35 A;  3R45 B;  2F8N A;  3KWQ A;  3AYW C;  5CP6 C;  1M19 C;  5BO0 B;  1ZLA C;  4WV4 B;  2F2A C;  4J8U C;  2ARO C;  4X23 B;  3KXB B;  1EQZ A;  3REJ B;  2Y2Q A;  3REI B;  3AZE B;  1KX4 B;  3AV2 C;  1Q9C A;  1F66 B;  1KX3 B;  1S32 A;  5B2I C;  3AZI D;  1P3K A;  3C1B C;  4CSR B;  1B6W A;  3AYW B;  3B6F C;  5CP6 B;  1M19 B;  5CPI C;  3C1C C;  1ZLA B;  4KUD C;  5B33 D;  4J8U B;  2ARO B;  3H0M C;  5B24 A;  3AFA A;  3B0C T;  3AZG C;  3AV2 B;  3LZ1 C;  5BT1 D;  5B2I B;  5B40 C;  3X1V C;  3C1B B;  3TU4 A;  5AY8 C;  3V9R A;  1M1A C;  3KUY D;  3B6F B;  3KUY B;  5CPI B;  3C1C B;  1P3I C;  4KUD B;  1KX5 D;  3X1T D;  3AZK D;  2Y2N A;  2IO5 C;  5B0Y C;  3X1S A;  4H9Q B;  3AZG B;  3B6G A;  3LZ1 B;  1BH9 A;  5B40 B;  3X1V B;  2ZY2 A;  1HQ3 D;  2BYM A;  5AY8 B;  3VH6 W;  1M1A B;  5B1L A;  1P3I B;  4WU9 C;  3P5J B;  1P3G C;  2IO5 B;  5B0Y B;  4Z5T D;  5AVB A;  1P3A D;  4XUJ C;  4H9O B;  3R45 A;  5BO0 A;  3UTB D;  4WU8 C;  4WU9 B;  5BS7 C;  3KXB A;  1P3G B;  3REJ A;  3REI A;  3X1U D;  3REK C;  1KX4 A;  4XZQ D;  1KX3 A;  2PYO C;  4XUJ B;  2Y2M A;  5CPK B;  3VH5 W;  3UT9 C;  3AYW A;  5CP6 A;  5GT3 C;  1M19 A;  1ZLA A;  4WU8 B;  5B32 D;  4J8U A;  2ARO A;  3W97 D;  3WTP D;  3W99 D;  3LEL D;  3REK B;  3AV2 A;  4Z66 C;  1P3B C;  5AV6 D;  3VH6 T;  5F99 D;  5B2I A;  4AWL C;  2PYO B;  4WJ3 C;  3MGQ D;  3C1B A;  4DRB A;  1U35 D;  4KGC C;  3UT9 B;  3WKJ C;  3B6F A;  3MNN C;  5GT3 B;  3KUY A;  4KHA B;  3C1C A;  5CPI A;  4KUD A;  3KWQ D;  2J8P A;  1KX5 A;  3X1T A;  2CWE A;  4NE5 A;  3AZF C;  3W98 C;  3AZG A;  3LZ1 A;  4Z66 B;  4UUZ A;  1P3B B;  4AWL B;  5GSU D;  5B40 A;  2CV5 C;  3AZH C;  1S32 D;  5AY8 A;  4DQY B;  3NQU B;  1P3K D;  4EO5 C;  1M1A A;  3WKJ B;  4KGC B;  3MNN B;  1P3I A;  5BNV B;  4QLC C;  4J8X D;  2FFF B;  3AZF B;  3W98 B;  5B0Y A;  2HIO C;  4Z5T A;  3LJA D;  3VH5 T;  4Z2M G;  5B24 D;  3AFA D;  3H0R C;  1P34 C;  4H9O A;  2CV5 B;  3AZH B;  5GT0 C;  4EO5 B;  3TU4 D;  4WU9 A;  4QLC B;  4H9N B;  5E5A C;  3O62 C;  1AOI B;  3X1U A;  3AZJ C;  2HIO B;  5B2J C;  4XZQ A;  1P3L D;  3X1S D;  3B6G D;  5CPK A;  4NE6 A;  1P34 B;  3AZL C;  5GT0 B;  3REH C;  2Y2K A;  3AN2 C;  4WU8 A;  4DRA A;  5B0Z C;  3MVD C;  5BS7 A;  5E5A B;  2RVQ C;  3O62 B;  3AZJ B;  2UWX A;  3REK A;  2PYO A;  1M18 C;  5DNN C;  4YM6 D;  3AZL B;  4M6B A;  2L5A A;  2W8S A;  3KFU G;  5GT3 A;  4KHA A;  5JA4 B;  3REH B;  3AN2 B;  5B0Z B;  3MVD B;  3WTP E;  5DNM C;  4X23 D;  3KXB D;  2Y2O A;  3REJ D;  5AV5 C;  3LZ0 C;  3REI D;  3AZE D;  1P3B A;  1N1J B;  1KX4 D;  5GSU A;  1M18 B;  1F66 D;  5DNN B;  1KX3 D;  2JCH A;  4KGC A;  5AV9 B;  3WKJ A;  2LY8 A;  5BNV A;  3AYW D;  5CP6 D;  4J8X A;  1M19 D;  1ZLA D;  3W98 A;  5DNM B;  4J8U D;  2ARO D;  3LJA A;  5AV5 B;  3LZ0 B;  2ZY4 A;  4R8P C;  3AV2 D;  2CV5 A;  3AZH A;  2Y2I A;  5B2I D;  3MGP C;  5JRG C;  4UPK A;  2ZY3 A;  3B0D C;  3C1B D;  3WAA C;  1H3O B;  4QLC A;  3B6F D;  5CPI D;  3C1C D;  1AOI A;  4KUD D;  2JE5 A;  3VH6 A;  2HIO A;  1JFI B;  2ZY5 A;  3AZG D;  1P3L A;  4R8P B;  1P34 A;  5FUG B;  3LZ1 D;  4JJN C;  3MGP B;  5JRG B;  2DQN C;  5B40 D;  3X1V D;  5CPJ C;  2Y2P A;  3B0D B;  3MGR C;  3WAA B;  5G49 B;  5AY8 D;  2NQB C;  1M1A D;  5E5A A;  1P3I D;  4E44 A;  3O62 A;  3AZJ A;  4G91 C;  1BH8 A;  2FJ7 C;  5B0Y D;  1ID3 C;  2YFV B;  3EPK A;  3AZL A;  3B0B A;  4YM6 A;  4JJN B;  5CPJ B;  3REH A;  3AN2 A;  3MGR B;  4J8W C;  2NQB B;  5B0Z A;  2BYK B;  3MVD A;  5AV8 C;  3VH5 A;  4WU9 D;  4X23 A;  1P3G D;  3MGS C;  4LD9 C;  4G91 B;  3W96 C;  2FJ7 B;  3AZE A;  3EG5 B;  1N1J A;  4J8V C;  1ID3 B;  1P3M C;  1M18 A;  5DNN A;  1F66 A;  4XUJ D;  5AV9 A;  5CPK D;  4J8W B;  4CSR A;  5B1M C;  2F8N G;  5AVC C;  5AV8 B;  4WU8 D;  1WWI A;  3MGS B;  4LD9 B;  5AV5 A;  3LZ0 A;  3W96 B;  3REK D;  4J8V B;  1P3M B;  2PYO D;  4G92 C;  1H3O A;  2Y2H A;  5B1M B;  3UT9 D;  5GT3 D;  5AVC B;  1JFI A;  1P3O C;  4H9S C;  4H9Q A;  4R8P A;  5FUG A;  3AZM C;  4Z66 D;  3A6N C;  1P3B D;  4G92 B;  3MGP A;  5JRG A;  1WWS A;  3UTA C;  3X1V A;  3WAA A;  4KGC D;  3WKJ D;  2HUE C;  2XD5 A;  3MNN D;  3AZN C;  1EQZ C;  3AZF D;  1P3O B;  3W98 D;  2YFV A;  3AZM B;  3A6N B;  2NZD C;  3UTA B;  2F8N B;  4WNN B;  5B31 G;  3AZH D;  2CV5 D;  2NQB A;  3FDD A;  2BYK A;  2HUE B;  3AZN B;  4QLC D;  1EQZ B;  1P3G A;  2Y2G A;  1AOI D;  2FJ7 A;  1TZY C;  1ID3 A;  2HIO D;  4XUJ A;  1TAF B;  1P34 D;  3AV1 C;  1P3F C;  2NZD B;  4J8W A;  5GT0 D;  1P3P C;  3IP4 C;  3A1I A;  5AV8 A;  5E5A D;  3MGS A;  4LD9 A;  3O62 D;  3W96 A;  1TZY B;  3AZJ D;  5GXQ C;  1R4V A;  4J8V A;  5B2J D;  4WZS B;  5B2J B;  2Y2L A;  1P3M A;  5B31 C;  1P3F B;  3AV1 B;  3AZL D;  5B1M A;  3UT9 A;  4ZBJ C;  1T3U A;  5B1L C;  5AVC A;  3REH D;  3AN2 D;  1P3P B;  5B0Z D;  3MVD D;  2RVQ D;  3WA9 C;  4ZUX C;  3REL C;  5GXQ B;  5AVB C;  4YS3 C;  4Z66 A;  1BH9 B;  5B31 B;  1M18 D;  5DNN D;  2BYM B;  5AV9 D;  3NQU A;  4ZBJ B;  5B1L B;  3MNN A;  3EPH A;  3WA9 B;  1P3O A;  5DNM D;  4ZUX B;  3REL B;  3AZF A;  4H9S A;  5AVB B;  5AV5 D;  3AZM A;  3LZ0 D;  5C3I C;  4YS3 B;  3AZI C;  4Z2M H;  3UTA A;  4WNN A;  4CAY B;  2RIQ A;  2YFW B;  3AZN A;  5B33 C;  4H9N A;  5BT1 C;  5C3I B;  1TAF A;  3AZI B;  2G5H C;  4R8P D;  4NFT A;  2NZD A;  5GT0 A;  5JRG D;  3MGP D;  3KUY C;  3WAA D;  5B33 B;  1KX5 C;  1PZR A;  3X1T C;  3AZK C;  5BNX B;  4HGA C;  1TZY A;  5B2J A;  1P3F A;  3AV1 A;  5KDM B;  4JJN D;  1HQ3 C;  1KU5 A;  5CPJ D;  1P3P A;  5JA4 A;  3MGR D;  2NQB D;  1KX5 B;  3X1T B;  3AZK B;  5B32 G;  3NQJ B;  4HGA B;  4Z5T C;  5GXQ A;  1P3A C;  2FJ7 D;  4UUZ B;  5B31 A;  1ID3 D;  3KSY A;  1HQ3 B;  4E45 A;  3UTB C;  4J8W D;  1HTA A;  3WA9 A;  5AV8 D;  4ZUX A;  3REL A;  5DNM A;  3X1U C;  4Z5T B;  3MGS D;  4LD9 D;  3EPL A;  1P3A B;  4XZQ C;  3W96 D;  1Z2C B;  4YS3 A;  5CPK C;  4J8V D;  1P3M D;  4CAY A;  2YFW A;  3F6T A;  3UTB B;  5B32 C;  5B1M D;  3W97 C;  3WTP C;  3W99 C;  1F1E A;  5AVC D;  2JSS A;  3LEL C;  3X1U B;  4H9P B;  4NE3 A;  4XZQ B;  5AV6 C;  5F99 C;  3AZI A;  3MGQ C;  1U35 C;  4H9R B;  2BG1 A;  3AL0 C;  1A7W A;  3KWQ C;  5CHL B;  1B67 A;  5G49 A;  5B32 B;  1ULY A;  5B33 A;  3W97 B;  3WTP B;  3W99 B;  3LEL B;  5BNX A;  1P3O D;  5AV6 B;  5F99 B;  5GSU C;  3MGQ B;  3AZM D;  1BFM A;  5KDM A;  3A6N D;  2ZM5 A;  4JJN A;  1S32 C;  3H0L C;  1U35 B;  1P3K C;  3UTA D;  5CPJ A;  2F8N D;  3MGR A;  3KWQ B;  4J8X C;  2XD1 A;  3AZK A;  3NQJ A;  3AZN D;  1EQZ D;  3LJA C;  3B6G B;  5B24 C;  3AFA C;  5GSU B;  1HQ3 A;  2VQR A;  1S32 B;  1P3K B;  2NZD D;  3TU4 C;  4J8X B;  1AOI C;  2F8N H;  3LJA B;  1P3A A;  5B24 B;  3AFA B;  1TZY D;  1P3L C;  3X1S C;  3B6G C;  2Y2J A;  1P3F D;  2G5I C;  3AV1 D;  3UTB A;  3TU4 B;  3V9R B;  1P3P D;  4H9P A;  1W2E A;  1P3L B;  3X1S B;  5GXQ D; 
#chains in the Genus database with same CATH homology
 4YM6 C;  3A1K A;  4H9R A;  3B0C W;  5B31 D;  5B32 A;  3W97 A;  5B1L D;  3EPJ A;  3WTP A;  3W99 A;  3LEL A;  4X23 C;  3KXB C;  3REJ C;  2F8N K;  3WA9 D;  1BH8 B;  3REI C;  4ZUX D;  3REL D;  5AV6 A;  5F99 A;  3AZE C;  1KX4 C;  5AVB D;  3MGQ A;  1F66 C;  2DF4 C;  4YM6 B;  1KX3 C;  4YS3 D;  3A6N A;  5AV9 C;  1U35 A;  3R45 B;  2F8N A;  3KWQ A;  3AYW C;  5CP6 C;  1M19 C;  5BO0 B;  1ZLA C;  4WV4 B;  2F2A C;  4J8U C;  2ARO C;  4X23 B;  3KXB B;  1EQZ A;  3REJ B;  2Y2Q A;  3REI B;  3AZE B;  1KX4 B;  3AV2 C;  1Q9C A;  1F66 B;  1KX3 B;  1S32 A;  5B2I C;  3AZI D;  1P3K A;  3C1B C;  4CSR B;  1B6W A;  3AYW B;  3B6F C;  5CP6 B;  1M19 B;  5CPI C;  3C1C C;  1ZLA B;  4KUD C;  5B33 D;  4J8U B;  2ARO B;  3H0M C;  5B24 A;  3AFA A;  3B0C T;  3AZG C;  3AV2 B;  3LZ1 C;  5BT1 D;  5B2I B;  5B40 C;  3X1V C;  3C1B B;  3TU4 A;  5AY8 C;  3V9R A;  1M1A C;  3KUY D;  3B6F B;  3KUY B;  5CPI B;  3C1C B;  1P3I C;  4KUD B;  1KX5 D;  3X1T D;  3AZK D;  2Y2N A;  2IO5 C;  5B0Y C;  3X1S A;  4H9Q B;  3AZG B;  3B6G A;  3LZ1 B;  1BH9 A;  5B40 B;  3X1V B;  2ZY2 A;  1HQ3 D;  2BYM A;  5AY8 B;  3VH6 W;  1M1A B;  5B1L A;  1P3I B;  4WU9 C;  3P5J B;  1P3G C;  2IO5 B;  5B0Y B;  4Z5T D;  5AVB A;  1P3A D;  4XUJ C;  4H9O B;  3R45 A;  5BO0 A;  3UTB D;  4WU8 C;  4WU9 B;  5BS7 C;  3KXB A;  1P3G B;  3REJ A;  3REI A;  3X1U D;  3REK C;  1KX4 A;  4XZQ D;  1KX3 A;  2PYO C;  4XUJ B;  2Y2M A;  5CPK B;  3VH5 W;  3UT9 C;  3AYW A;  5CP6 A;  5GT3 C;  1M19 A;  1ZLA A;  4WU8 B;  5B32 D;  4J8U A;  2ARO A;  3W97 D;  3WTP D;  3W99 D;  3LEL D;  3REK B;  3AV2 A;  4Z66 C;  1P3B C;  5AV6 D;  3VH6 T;  5F99 D;  5B2I A;  4AWL C;  2PYO B;  4WJ3 C;  3MGQ D;  3C1B A;  4DRB A;  1U35 D;  4KGC C;  3UT9 B;  3WKJ C;  3B6F A;  3MNN C;  5GT3 B;  3KUY A;  4KHA B;  3C1C A;  5CPI A;  4KUD A;  3KWQ D;  2J8P A;  1KX5 A;  3X1T A;  2CWE A;  4NE5 A;  3AZF C;  3W98 C;  3AZG A;  3LZ1 A;  4Z66 B;  4UUZ A;  1P3B B;  4AWL B;  5GSU D;  5B40 A;  2CV5 C;  3AZH C;  1S32 D;  5AY8 A;  4DQY B;  3NQU B;  1P3K D;  4EO5 C;  1M1A A;  3WKJ B;  4KGC B;  3MNN B;  1P3I A;  5BNV B;  4QLC C;  4J8X D;  2FFF B;  3AZF B;  3W98 B;  5B0Y A;  2HIO C;  4Z5T A;  3LJA D;  3VH5 T;  4Z2M G;  5B24 D;  3AFA D;  3H0R C;  1P34 C;  4H9O A;  2CV5 B;  3AZH B;  5GT0 C;  4EO5 B;  3TU4 D;  4WU9 A;  4QLC B;  4H9N B;  5E5A C;  3O62 C;  1AOI B;  3X1U A;  3AZJ C;  2HIO B;  5B2J C;  4XZQ A;  1P3L D;  3X1S D;  3B6G D;  5CPK A;  4NE6 A;  1P34 B;  3AZL C;  5GT0 B;  3REH C;  2Y2K A;  3AN2 C;  4WU8 A;  4DRA A;  5B0Z C;  3MVD C;  5BS7 A;  5E5A B;  2RVQ C;  3O62 B;  3AZJ B;  2UWX A;  3REK A;  2PYO A;  1M18 C;  5DNN C;  4YM6 D;  3AZL B;  4M6B A;  2L5A A;  2W8S A;  3KFU G;  5GT3 A;  4KHA A;  5JA4 B;  3REH B;  3AN2 B;  5B0Z B;  3MVD B;  3WTP E;  5DNM C;  4X23 D;  3KXB D;  2Y2O A;  3REJ D;  5AV5 C;  3LZ0 C;  3REI D;  3AZE D;  1P3B A;  1N1J B;  1KX4 D;  5GSU A;  1M18 B;  1F66 D;  5DNN B;  1KX3 D;  2JCH A;  4KGC A;  5AV9 B;  3WKJ A;  2LY8 A;  5BNV A;  3AYW D;  5CP6 D;  4J8X A;  1M19 D;  1ZLA D;  3W98 A;  5DNM B;  4J8U D;  2ARO D;  3LJA A;  5AV5 B;  3LZ0 B;  2ZY4 A;  4R8P C;  3AV2 D;  2CV5 A;  3AZH A;  2Y2I A;  5B2I D;  3MGP C;  5JRG C;  4UPK A;  2ZY3 A;  3B0D C;  3C1B D;  3WAA C;  1H3O B;  4QLC A;  3B6F D;  5CPI D;  3C1C D;  1AOI A;  4KUD D;  2JE5 A;  3VH6 A;  2HIO A;  1JFI B;  2ZY5 A;  3AZG D;  1P3L A;  4R8P B;  1P34 A;  5FUG B;  3LZ1 D;  4JJN C;  3MGP B;  5JRG B;  2DQN C;  5B40 D;  3X1V D;  5CPJ C;  2Y2P A;  3B0D B;  3MGR C;  3WAA B;  5G49 B;  5AY8 D;  2NQB C;  1M1A D;  5E5A A;  1P3I D;  4E44 A;  3O62 A;  3AZJ A;  4G91 C;  1BH8 A;  2FJ7 C;  5B0Y D;  1ID3 C;  2YFV B;  3EPK A;  3AZL A;  3B0B A;  4YM6 A;  4JJN B;  5CPJ B;  3REH A;  3AN2 A;  3MGR B;  4J8W C;  2NQB B;  5B0Z A;  2BYK B;  3MVD A;  5AV8 C;  3VH5 A;  4WU9 D;  4X23 A;  1P3G D;  3MGS C;  4LD9 C;  4G91 B;  3W96 C;  2FJ7 B;  3AZE A;  3EG5 B;  1N1J A;  4J8V C;  1ID3 B;  1P3M C;  1M18 A;  5DNN A;  1F66 A;  4XUJ D;  5AV9 A;  5CPK D;  4J8W B;  4CSR A;  5B1M C;  2F8N G;  5AVC C;  5AV8 B;  4WU8 D;  1WWI A;  3MGS B;  4LD9 B;  5AV5 A;  3LZ0 A;  3W96 B;  3REK D;  4J8V B;  1P3M B;  2PYO D;  4G92 C;  1H3O A;  2Y2H A;  5B1M B;  3UT9 D;  5GT3 D;  5AVC B;  1JFI A;  1P3O C;  4H9S C;  4H9Q A;  4R8P A;  5FUG A;  3AZM C;  4Z66 D;  3A6N C;  1P3B D;  4G92 B;  3MGP A;  5JRG A;  1WWS A;  3UTA C;  3X1V A;  3WAA A;  4KGC D;  3WKJ D;  2HUE C;  2XD5 A;  3MNN D;  3AZN C;  1EQZ C;  3AZF D;  1P3O B;  3W98 D;  2YFV A;  3AZM B;  3A6N B;  2NZD C;  3UTA B;  2F8N B;  4WNN B;  5B31 G;  3AZH D;  2CV5 D;  2NQB A;  3FDD A;  2BYK A;  2HUE B;  3AZN B;  4QLC D;  1EQZ B;  1P3G A;  2Y2G A;  1AOI D;  2FJ7 A;  1TZY C;  1ID3 A;  2HIO D;  4XUJ A;  1TAF B;  1P34 D;  3AV1 C;  1P3F C;  2NZD B;  4J8W A;  5GT0 D;  1P3P C;  3IP4 C;  3A1I A;  5AV8 A;  5E5A D;  3MGS A;  4LD9 A;  3O62 D;  3W96 A;  1TZY B;  3AZJ D;  5GXQ C;  1R4V A;  4J8V A;  5B2J D;  4WZS B;  5B2J B;  2Y2L A;  1P3M A;  5B31 C;  1P3F B;  3AV1 B;  3AZL D;  5B1M A;  3UT9 A;  4ZBJ C;  1T3U A;  5B1L C;  5AVC A;  3REH D;  3AN2 D;  1P3P B;  5B0Z D;  3MVD D;  2RVQ D;  3WA9 C;  4ZUX C;  3REL C;  5GXQ B;  5AVB C;  4YS3 C;  4Z66 A;  1BH9 B;  5B31 B;  1M18 D;  5DNN D;  2BYM B;  5AV9 D;  3NQU A;  4ZBJ B;  5B1L B;  3MNN A;  3EPH A;  3WA9 B;  1P3O A;  5DNM D;  4ZUX B;  3REL B;  3AZF A;  4H9S A;  5AVB B;  5AV5 D;  3AZM A;  3LZ0 D;  5C3I C;  4YS3 B;  3AZI C;  4Z2M H;  3UTA A;  4WNN A;  4CAY B;  2RIQ A;  2YFW B;  3AZN A;  5B33 C;  4H9N A;  5BT1 C;  5C3I B;  1TAF A;  3AZI B;  2G5H C;  4R8P D;  4NFT A;  2NZD A;  5GT0 A;  5JRG D;  3MGP D;  3KUY C;  3WAA D;  5B33 B;  1KX5 C;  1PZR A;  3X1T C;  3AZK C;  5BNX B;  4HGA C;  1TZY A;  5B2J A;  1P3F A;  3AV1 A;  5KDM B;  4JJN D;  1HQ3 C;  1KU5 A;  5CPJ D;  1P3P A;  5JA4 A;  3MGR D;  2NQB D;  1KX5 B;  3X1T B;  3AZK B;  5B32 G;  3NQJ B;  4HGA B;  4Z5T C;  5GXQ A;  1P3A C;  2FJ7 D;  4UUZ B;  5B31 A;  1ID3 D;  3KSY A;  1HQ3 B;  4E45 A;  3UTB C;  4J8W D;  1HTA A;  3WA9 A;  5AV8 D;  4ZUX A;  3REL A;  5DNM A;  3X1U C;  4Z5T B;  3MGS D;  4LD9 D;  3EPL A;  1P3A B;  4XZQ C;  3W96 D;  1Z2C B;  4YS3 A;  5CPK C;  4J8V D;  1P3M D;  4CAY A;  2YFW A;  3F6T A;  3UTB B;  5B32 C;  5B1M D;  3W97 C;  3WTP C;  3W99 C;  1F1E A;  5AVC D;  2JSS A;  3LEL C;  3X1U B;  4H9P B;  4NE3 A;  4XZQ B;  5AV6 C;  5F99 C;  3AZI A;  3MGQ C;  1U35 C;  4H9R B;  2BG1 A;  3AL0 C;  1A7W A;  3KWQ C;  5CHL B;  1B67 A;  5G49 A;  5B32 B;  1ULY A;  5B33 A;  3W97 B;  3WTP B;  3W99 B;  3LEL B;  5BNX A;  1P3O D;  5AV6 B;  5F99 B;  5GSU C;  3MGQ B;  3AZM D;  1BFM A;  5KDM A;  3A6N D;  2ZM5 A;  4JJN A;  1S32 C;  3H0L C;  1U35 B;  1P3K C;  3UTA D;  5CPJ A;  2F8N D;  3MGR A;  3KWQ B;  4J8X C;  2XD1 A;  3AZK A;  3NQJ A;  3AZN D;  1EQZ D;  3LJA C;  3B6G B;  5B24 C;  3AFA C;  5GSU B;  1HQ3 A;  2VQR A;  1S32 B;  1P3K B;  2NZD D;  3TU4 C;  4J8X B;  1AOI C;  2F8N H;  3LJA B;  1P3A A;  5B24 B;  3AFA B;  1TZY D;  1P3L C;  3X1S C;  3B6G C;  2Y2J A;  1P3F D;  2G5I C;  3AV1 D;  3UTB A;  3TU4 B;  3V9R B;  1P3P D;  4H9P A;  1W2E A;  1P3L B;  3X1S B;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...