5AV8C

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8C00
5CPIB 1B6WA 1ZLAC 3X1VB 1F66C 5FUGA 4J8UA 1M18D 4H9QB 4Z5TD 1HQ3C 2CV5C 3KSYA 4UUZB 5AVBB 3VH5W 4H9RB 1ID3C 5AV8C 3B6FA 1P3PC 1P3OD 3W97C 3W98D 4H9SA 3KXBC 2NZDB 4J8XA 3AV2A 3O62D 5AV6A 3TU4A 5AV9A 4YS3A 4AWLB 5GT3C 1S32C 1TZYB 5B0ZB 4R8PD 3AZFC 1EQZA 2PYOA 4KGCA 3KWQD 1M1AC 3W99D 4XUJC 3AZKB 4LD9D 4ZBJB 1P3LB 3AN2C 3NQUB 1P34B 3W96C 3B6GC 5B24B 3REKC 3UT9D 3AZJC 5DNND 1F1EA 3C1BA 5CPKA 2AROB 5B2JD 1KX4A 3AZLB 4J8VA 5B33B 5CPIA 3VH5T 3X1VA 3AZIA 5JRGA 4J8WC 1P3FC 3MGQC 4UUZA 5AVBA 4KHAB 5CPJA 5AVCA 4ZUXB 3REIC 3LJAA 3AZMB 5CP6D 5F99C 3KUYC 2NZDA 1WWIA 1P3MB 3AFAD 5E5AD 3UTAC 1N1JA 3AYWD 3LZ1B 3VH5A 1U35D 1TZYA 2YFWB 5B31D 5B0ZA 3MGRD 3AZNC 3WA9D 4Z66B 3C1CB 3X1SB 5AV5B 3UTBB 3NQUA 1P34A 3LELB 4EO5B 5B32B 5B0YC 4WZSB 5B33A 3REHB 3MGSD 3MGPA 3X1TB 3KWQC 5C3IC 4YM6D 2L5AA 5B1MB 2NQBA 1A7WA 4QLCC 4X23B 3VH6A 1ZLAD 4ZUXA 5CHLB 5B31G 5BO0B 1P3IC 3AZMA 1M19B 2HIOB 1KX5B 1HQ3D 2CV5D 3B0CW 5B1LC 4Z2MH 5GSUB 1P3LC 1ID3D 5AV8D 3AV1B 5B24C 3REJD 1P3PD 3KXBD 3C1CA 3X1SA 4KUDA 5AV5A 2AROC 3AZEB 3V9RA 3LELA 4J8UB 5GT3D 1S32D 3LZ0C 1H3OB 3AFAC 5E5AC 3RELA 5B32A 3X1UA 4XUJD 3WAAC 1AOIB 3MGRC 3REHA 3X1TA 3W96D 5G49B 3B0DB 2IO5B 3B6GD 4XZQA 3AZJD 4WU8C 4J8XB 3AV2B 5AV6B 3TU4B 5B40C 1P3MC 4X23A 1KX3B 3WKJA 4JJNB 2PYOB 5BO0A 3LZ1C 4J8WD 3MVDB 1P3FD 1KX5A 4NE3A 3WTPB 5GSUA 3MNNA 5AV9D 3REID 1F66A 5GT0A 3C1BB 3AV1A 5F99D 3KUYD 3AZHA 5B2IC 4J8VB 3UTAD 2FJ7A 4H9PB 3AZEA 5DNMB 3AZIB 5JRGB 4WU9A 2HUEB 2YFVA 1P3KB 1H3OA 3AZND 1P3BC 5B1MC 4Z2MG 5CPJB 1AOIA 5AVCB 1P3AA 1Q9CA 5AY8A 5BS7C 3LJAB 4E44A 5G49A 3REJC 5BT1C 4Z5TB 1N1JB 5B0YD 2HIOC 5JA4A 5GXQC 1KX3A 1P3OB 4JJNA 3REKA 3O62B 3AZGA 3MVDA 3A6NC 4R8PB 4QLCD 2NZDD 3WTPA 1P3ID 2BYMA 3MGQA 1TZYD 5B0ZD 3MGPB 4H9PA 3UT9B 5DNMA 3AZKD 5B1LD 1P3GB 5DNNB 1P3LD 2NQBB 3B6FC 1P3KA 3B0DC 5B24D 4H9SC 4G92B 5AV6C 4YS3C 5AV9C 3TU4C 2F8NH 2AROD 1M18A 3WTPE 3AZLD 2JSSA 4Z5TA 1EQZC 3LZ0D 4KGCC 3WAAD 4NE6A 1P3OA 5CP6B 4CSRA 3W98A 3O62A 4WU8D 4KUDB 5CPKC 3C1BC 5B40D 4CAYB 3V9RB 1KX4C 5CPIC 4R8PA 4J8VC 1P3MD 1BH9A 3KWQA 3X1VC 3RELB 5JRGC 3LZ1D 3AZIC 3W99A 3X1UB 2HUEC 1KU5A 4LD9A 2F8ND 4HGAB 5AVBC 2LY8A 3UT9A 4Z66D 3C1CD 5AVCC 1P3GA 4XZQB 3UTBD 5DNNA 3LJAC 5B2JA 3LELD 5B2ID 2NZDC 4H9OA 3WKJB 4WV4B 4AWLC 2RVQC 1TZYC 5B0ZC 1P3BD 3R45B 5B1MD 3AZKC 3B0BA 1ZLAB 3MNNB 4ZBJC 1P34C 5GT0B 1F66B 5CP6A 3AZHB 1HTAA 3AFAA 5BT1D 5E5AA 1HQ3B 2F8NG 3AYWA 2FJ7B 1M19D 4CAYA 1U35A 2HIOD 4WU9B 3AZLC 4NFTA 5B33C 1ID3B 5B31A 2YFVB 5GXQD 5AV8B 3MGPC 3MGRA 5KDMB 1P3PB 3WA9A 3W97B 1B67A 2NQBC 1P3AB 5AY8B 3A6ND 4G92C 4ZUXC 3AZFB 3AZED 3AZMC 1M1AB 4J8UD 1JFIB 5JA4B 3AN2B 3MGSA 3W96B 4YM6A 3REKB 3B6GB 3AZGB 1WWSA 3B6FD 3R45A 2BYKA 4H9NA 4Z66C 3C1CC 3X1SC 4J8XD 3AV2D 5AV5C 3UTBC 5AV6D 4YS3D 3TU4D 1ZLAA 4KUDC 4J8WB 3NQJB 3LELC 2BYMB 1BH8B 3MGQB 5BNVA 1HQ3A 4EO5C 4G91B 2CV5A 1EQZD 5B32C 2PYOD 4KGCD 3X1UC 3REIB 4HGAC 1ID3A 5BS7A 3REHC 5AV8A 3X1TC 5KDMA 5F99B 3REJA 1P3PA 3W97A 4XZQC 3KXBA 3UTAB 5CPKD 3C1BD 1M18B 5GT3A 1KX4D 4X23C 4J8VD 5CPID 1S32A 3WKJC 3AZFA 3AZNB 3X1VD 3AZID 5JRGD 1M19C 4XUJA 1M1AA 1JFIA 1KX5C 3AN2A 3W96A 5AVBD 3B6GA 4CSRB 5CPJD 3AZJA 3W98B 5GSUC 5AVCD 3MNNC 5GT0C 3LJAD 5B0YB 3AV1C 4WNNA 3AZHC 1BH9B 2FJ7C 3AZEC 3KWQB 2F8NK 5C3IB 4J8WA 3NQJA 4WU9C 3W99B 4J8UC 1P3FA 4LD9B 1BH8A 2RVQD 5BNXA 4QLCB 1AOIC 1TAFA 3REIA 1P3AC 5AY8C 1P3IB 1P34D 5B2JB 5F99A 3KUYA 2IO5C 4J8XC 3AV2C 3UTAA 4H9OB 5B1LB 5B33D 1KX3C 3AZNA 3MGPD 4JJNC 2PYOC 1P3GD 3AZGC 3MVDC 2NQBD 3VH6W 3WTPC 4ZUXD 3LZ0B 3AFAB 5E5AB 5B0YA 3AYWB 3AZMD 1U35B 3WAAB 4H9QA 4G91C 5B31B 3MGRB 3WA9B 5DNMC 4H9RA 4WU8B 5B40B 1P3KC 1BFMA 4QLCA 4DRBA 5CPJC 3X1SD 4KUDD 5AV5D 1P3IA 2CWEA 1M18C 2F8NB 4E45A 4Z5TC 3MGSB 3RELD 5B32D 3AZKA 5B1LA 4YM6B 3X1UD 1P3LA 1P3OC 3REHD 3VH6T 3X1TD 5B24A 3W98C 5B2IB 2BYKB 4XZQD 3O62C 4H9NB 2AROA 3AZLA 4R8PC 4X23D 3WKJD 3LZ0A 5BNVB 1P3BB 2CV5B 3W99C 3WAAA 4LD9C 1KX5D 3UT9C 4KHAA 3REJB 1P3GC 3KXBB 1R4VA 5GSUD 5DNNC 4WU8A 3MNND 1F66D 5GT0D 5B40A 5B2JC 3AV1D 5B32G 3AZHD 1P3MA 5GT3B 5GXQB 1S32B 4M6BA 2FJ7D 3LZ1A 4WU9D 4XUJB 2YFWA 2F8NA 3A6NB 3W97D 4Z66A 1ULYA 3UTBA 3AZJB 1AOID 1P3AD 5AY8D 5CP6C 5FUGB 4WNNB 5B2IA 3AZFD 3AYWC 1M1AD 1U35C 3WA9C 5B31C 3AN2D 1P3FB 1KX3D 3B6FB 5BNXB 1P3BA 4JJND 3REKD 3RELC 5B1MA 3AZGD 1TAFB 5AV9B 3MVDD 4YS3B 3KUYB 3WTPD 3B0CT 1EQZB 4KGCB 1M19A 2HIOA 3MGQD 5GXQA 4DRAA 3MGSC 4YM6C 4NE5A 5DNMD 5CPKB 3A6NA 1P3KD 1KX4B
chains in the Genus database with same CATH superfamily
5CPIB 1B6WA 1ZLAC 2Y2KA 3X1VB 1F66C 5FUGA 4J8UA 1M18D 4H9QB 4Z5TD 1HQ3C 2CV5C 3KSYA 4UUZB 5AVBB 3VH5W 4H9RB 1ID3C 5AV8C 3B6FA 1P3PC 1P3OD 3W97C 3W98D 4H9SA 3KXBC 2NZDB 4J8XA 3AV2A 3O62D 5AV6A 3TU4A 5AV9A 4YS3A 2Y2IA 4AWLB 5GT3C 1S32C 1TZYB 5B0ZB 4R8PD 3AZFC 1EQZA 2PYOA 4KGCA 3KWQD 1M1AC 3W99D 4XUJC 3AZKB 4LD9D 4WJ3C 4ZBJB 1P3LB 3AN2C 3NQUB 1P34B 3W96C 3B6GC 5B24B 3REKC 3UT9D 3AZJC 5DNND 1F1EA 3C1BA 5CPKA 2AROB 5B2JD 1KX4A 3AZLB 4J8VA 5B33B 5CPIA 3VH5T 3X1VA 3AZIA 5JRGA 4J8WC 1P3FC 3MGQC 2G5IC 4UUZA 5AVBA 4KHAB 5CPJA 5AVCA 4ZUXB 3REIC 3LJAA 3AZMB 5CP6D 2ZY5A 5F99C 3KUYC 2NZDA 1WWIA 1P3MB 3AFAD 5E5AD 3UTAC 1N1JA 3AYWD 3P5JB 3VH5A 3LZ1B 1U35D 2Y2JA 1TZYA 2YFWB 5B31D 5B0ZA 3MGRD 3AZNC 3WA9D 2J8PA 4Z66B 3C1CB 3X1SB 5AV5B 3UTBB 1KX4B 3NQUA 1P34A 3LELB 4EO5B 5B32B 5B0YC 4WZSB 5B33A 3REHB 2Y2HA 3MGSD 3MGPA 3X1TB 3KWQC 5C3IC 4YM6D 2L5AA 5B1MB 2NQBA 1A7WA 4QLCC 4X23B 3VH6A 1ZLAD 4ZUXA 5CHLB 5B31G 5BO0B 1P3IC 3AZMA 1M19B 3H0RC 2HIOB 1KX5B 1HQ3D 2CV5D 3B0CW 5B1LC 4Z2MH 5GSUB 1P3LC 1ID3D 5AV8D 3AV1B 5B24C 3REJD 1P3PD 3KXBD 3FDDA 3X1SA 3C1CA 4KUDA 5AV5A 3KFUG 2AROC 3AZEB 3V9RA 3LELA 4J8UB 5GT3D 1S32D 3LZ0C 1H3OB 3AFAC 5E5AC 3RELA 5B32A 3X1UA 4XUJD 3WAAC 1AOIB 4UPKA 3MGRC 3REHA 3X1TA 3W96D 5G49B 3B0DB 2IO5B 3B6GD 4XZQA 3AZJD 4WU8C 4J8XB 3AV2B 5AV6B 3TU4B 5B40C 2JE5A 1P3MC 4X23A 1KX3B 3WKJA 4JJNB 2PYOB 5BO0A 3LZ1C 4J8WD 3MVDB 1P3FD 1KX5A 4NE3A 3WTPB 5GSUA 3MNNA 5AV9D 3REID 1F66A 5GT0A 3C1BB 3AV1A 5F99D 3KUYD 3AZHA 5B2IC 4J8VB 3UTAD 2FJ7A 4H9PB 3AZEA 5DNMB 3AZIB 5JRGB 4WU9A 2HUEB 2YFVA 1P3KB 1H3OA 3AZND 1P3BC 5B1MC 4Z2MG 5CPJB 1AOIA 5AVCB 1P3AA 2Y2OA 1Q9CA 5AY8A 5BS7C 3LJAB 4E44A 5G49A 3REJC 5BT1C 4Z5TB 2VQRA 1N1JB 5B0YD 2HIOC 3EPLA 5JA4A 5GXQC 1KX3A 1P3OB 2ZM5A 4JJNA 3REKA 1Z2CB 3O62B 3AZGA 3MVDA 2DF4C 3EPHA 3A6NC 4QLCD 4R8PB 2NZDD 3WTPA 1P3ID 2BYMA 3MGQA 1TZYD 5B0ZD 3MGPB 4H9PA 3UT9B 5DNMA 3AZKD 5B1LD 1P3GB 5DNNB 1P3LD 2NQBB 3B6FC 1P3KA 3B0DC 5B24D 4H9SC 4G92B 5AV6C 4YS3C 5AV9C 3TU4C 2F8NH 2AROD 1M18A 3WTPE 3AZLD 3EPJA 2JSSA 4Z5TA 1EQZC 3LZ0D 4KGCC 3WAAD 4NE6A 1P3OA 5CP6B 4CSRA 3W98A 3O62A 4WU8D 4KUDB 5CPKC 3C1BC 5B40D 4CAYB 3V9RB 1KX4C 5CPIC 4R8PA 4J8VC 1P3MD 1BH9A 3KWQA 3X1VC 3RELB 5JRGC 3LZ1D 3AZIC 3W99A 3H0LC 3X1UB 2HUEC 1KU5A 4LD9A 2F8ND 4HGAB 5AVBC 2LY8A 3UT9A 4Z66D 3C1CD 5AVCC 1P3GA 4XZQB 3UTBD 5DNNA 3LJAC 5B2JA 3LELD 2ZY3A 2XD1A 3H0MC 5B2ID 2NZDC 4H9OA 3WKJB 4WV4B 4AWLC 2RVQC 1TZYC 5B0ZC 1P3BD 2Y2QA 3R45B 5B1MD 3AZKC 3B0BA 1ZLAB 3MNNB 4ZBJC 1P34C 5GT0B 1F66B 5CP6A 3AZHB 1HTAA 3AFAA 1T3UA 5E5AA 1HQ3B 5BT1D 2F8NG 3AYWA 2FJ7B 1M19D 4CAYA 1U35A 2HIOD 4WU9B 3AZLC 4NFTA 5B33C 1ID3B 5B31A 2YFVB 5GXQD 5AV8B 3MGPC 3MGRA 5KDMB 1P3PB 3WA9A 3W97B 1B67A 2NQBC 1P3AB 2G5HC 5AY8B 3A6ND 4G92C 4ZUXC 2BG1A 3AZFB 3AZED 3A1KA 2UWXA 3AZMC 1M1AB 4J8UD 1JFIB 5JA4B 3AN2B 3MGSA 3W96B 4YM6A 3REKB 3B6GB 4DQYB 3AZGB 1WWSA 3B6FD 3R45A 2BYKA 4H9NA 4Z66C 3C1CC 3X1SC 4J8XD 3AV2D 5AV5C 3UTBC 5AV6D 4YS3D 3TU4D 1ZLAA 4KUDC 4J8WB 3NQJB 3LELC 2BYMB 1BH8B 3MGQB 5BNVA 1HQ3A 4EO5C 4G91B 2CV5A 1EQZD 5B32C 2PYOD 4KGCD 3X1UC 3REIB 4HGAC 1ID3A 5BS7A 3REHC 5AV8A 3X1TC 5KDMA 5F99B 3REJA 1P3PA 3W97A 2F2AC 4XZQC 3KXBA 3UTAB 5CPKD 3C1BD 1M18B 5GT3A 1KX4D 4X23C 4J8VD 5CPID 1S32A 3WKJC 3AZFA 3AZNB 3X1VD 3AZID 5JRGD 1M19C 4XUJA 1M1AA 1JFIA 1KX5C 2W8SA 3AN2A 3W96A 5AVBD 3B6GA 4CSRB 5CPJD 3AZJA 3W98B 5GSUC 5AVCD 3MNNC 2Y2PA 5GT0C 3LJAD 2Y2GA 5B0YB 3AV1C 4WNNA 3AZHC 1BH9B 2FJ7C 3AZEC 3KWQB 2F8NK 5C3IB 4J8WA 2ZY4A 3NQJA 4WU9C 3W99B 4J8UC 1P3FA 4LD9B 1BH8A 2RVQD 5BNXA 4QLCB 1AOIC 1TAFA 3REIA 1P3AC 5AY8C 1P3IB 1P34D 5B2JB 5F99A 3KUYA 2IO5C 4J8XC 3AV2C 3UTAA 4H9OB 5B1LB 5B33D 1KX3C 2Y2MA 3AZNA 3MGPD 4JJNC 2PYOC 1P3GD 3AZGC 3MVDC 2NQBD 3F6TA 3VH6W 3WTPC 4ZUXD 3LZ0B 3AFAB 5E5AB 5B0YA 3AYWB 3AZMD 1U35B 3WAAB 4H9QA 4G91C 5B31B 3MGRB 3WA9B 5DNMC 4H9RA 4WU8B 2XD5A 5B40B 1P3KC 1BFMA 2DQNC 4QLCA 4DRBA 5CPJC 3X1SD 4KUDD 5AV5D 1P3IA 2CWEA 1M18C 2F8NB 4E45A 4Z5TC 3MGSB 3RELD 5B32D 3AZKA 2FFFB 5B1LA 4YM6B 3X1UD 1P3LA 1P3OC 3REHD 3VH6T 3X1TD 5B24A 3W98C 5B2IB 2BYKB 4XZQD 3O62C 4H9NB 2AROA 3AL0C 3AZLA 4R8PC 4X23D 3WKJD 3LZ0A 5BNVB 1P3BB 2CV5B 3W99C 3WAAA 4LD9C 1KX5D 3UT9C 4KHAA 3REJB 1P3GC 3KXBB 1R4VA 5GSUD 5DNNC 4WU8A 3MNND 1F66D 5GT0D 5B40A 5B2JC 3AV1D 5B32G 3AZHD 1P3MA 5GT3B 5GXQB 1S32B 4M6BA 1PZRA 2FJ7D 3LZ1A 4WU9D 4XUJB 2YFWA 2F8NA 3A6NB 3W97D 4Z66A 1W2EA 1ULYA 3UTBA 3AZJB 1AOID 1P3AD 5AY8D 5CP6C 5FUGB 4WNNB 5B2IA 3AZFD 3AYWC 1M1AD 1U35C 3WA9C 5B31C 3AN2D 1P3FB 1KX3D 3B6FB 2RIQA 5BNXB 3EPKA 1P3BA 3A1IA 4JJND 3REKD 3RELC 2Y2LA 5B1MA 2ZY2A 3EG5B 3AZGD 1TAFB 5AV9B 3MVDD 4YS3B 3KUYB 3WTPD 3B0CT 1EQZB 4KGCB 2JCHA 1M19A 2HIOA 3MGQD 5GXQA 4DRAA 3MGSC 4YM6C 4NE5A 5DNMD 5CPKB 3IP4C 3A6NA 1P3KD 2Y2NA
chains in the Genus database with same CATH topology
5CPIB 1B6WA 1ZLAC 2Y2KA 3X1VB 1F66C 5FUGA 4J8UA 1M18D 4H9QB 4Z5TD 1HQ3C 2CV5C 3KSYA 4UUZB 5AVBB 3VH5W 4H9RB 1ID3C 5AV8C 3B6FA 1P3PC 1P3OD 3W97C 3W98D 4H9SA 3KXBC 2NZDB 4J8XA 3AV2A 3O62D 5AV6A 3TU4A 5AV9A 4YS3A 2Y2IA 4AWLB 5GT3C 1S32C 1TZYB 5B0ZB 4R8PD 3AZFC 1EQZA 2PYOA 4KGCA 3KWQD 1M1AC 3W99D 4XUJC 3AZKB 4LD9D 4WJ3C 4ZBJB 1P3LB 3AN2C 3NQUB 1P34B 3W96C 3B6GC 5B24B 3REKC 3UT9D 3AZJC 5DNND 1F1EA 3C1BA 5CPKA 2AROB 5B2JD 1KX4A 3AZLB 4J8VA 5B33B 5CPIA 3VH5T 3X1VA 3AZIA 5JRGA 4J8WC 1P3FC 3MGQC 2G5IC 4UUZA 5AVBA 4KHAB 5CPJA 5AVCA 4ZUXB 3REIC 3LJAA 3AZMB 5CP6D 2ZY5A 5F99C 3KUYC 2NZDA 1WWIA 1P3MB 3AFAD 5E5AD 3UTAC 1N1JA 3AYWD 3P5JB 3VH5A 3LZ1B 1U35D 2Y2JA 1TZYA 2YFWB 5B31D 5B0ZA 3MGRD 3AZNC 3WA9D 2J8PA 4Z66B 3C1CB 3X1SB 5AV5B 3UTBB 1KX4B 3NQUA 1P34A 3LELB 4EO5B 5B32B 5B0YC 4WZSB 5B33A 3REHB 2Y2HA 3MGSD 3MGPA 3X1TB 3KWQC 5C3IC 4YM6D 2L5AA 5B1MB 2NQBA 1A7WA 4QLCC 4X23B 3VH6A 1ZLAD 4ZUXA 5CHLB 5B31G 5BO0B 1P3IC 3AZMA 1M19B 3H0RC 2HIOB 1KX5B 1HQ3D 2CV5D 3B0CW 5B1LC 4Z2MH 5GSUB 1P3LC 1ID3D 5AV8D 3AV1B 5B24C 3REJD 1P3PD 3KXBD 3FDDA 3X1SA 3C1CA 4KUDA 5AV5A 3KFUG 2AROC 3AZEB 3V9RA 3LELA 4J8UB 5GT3D 1S32D 3LZ0C 1H3OB 3AFAC 5E5AC 3RELA 5B32A 3X1UA 4XUJD 3WAAC 1AOIB 4UPKA 3MGRC 3REHA 3X1TA 3W96D 5G49B 3B0DB 2IO5B 3B6GD 4XZQA 3AZJD 4WU8C 4J8XB 3AV2B 5AV6B 3TU4B 5B40C 2JE5A 1P3MC 4X23A 1KX3B 3WKJA 4JJNB 2PYOB 5BO0A 3LZ1C 4J8WD 3MVDB 1P3FD 1KX5A 4NE3A 3WTPB 5GSUA 3MNNA 5AV9D 3REID 1F66A 5GT0A 3C1BB 3AV1A 5F99D 3KUYD 3AZHA 5B2IC 4J8VB 3UTAD 2FJ7A 4H9PB 3AZEA 5DNMB 3AZIB 5JRGB 4WU9A 2HUEB 2YFVA 1P3KB 1H3OA 3AZND 1P3BC 5B1MC 4Z2MG 5CPJB 1AOIA 5AVCB 1P3AA 2Y2OA 1Q9CA 5AY8A 5BS7C 3LJAB 4E44A 5G49A 3REJC 5BT1C 4Z5TB 2VQRA 1N1JB 5B0YD 2HIOC 3EPLA 5JA4A 5GXQC 1KX3A 1P3OB 2ZM5A 4JJNA 3REKA 1Z2CB 3O62B 3AZGA 3MVDA 2DF4C 3EPHA 3A6NC 4QLCD 4R8PB 2NZDD 3WTPA 1P3ID 2BYMA 3MGQA 1TZYD 5B0ZD 3MGPB 4H9PA 3UT9B 5DNMA 3AZKD 5B1LD 1P3GB 5DNNB 1P3LD 2NQBB 3B6FC 1P3KA 3B0DC 5B24D 4H9SC 4G92B 5AV6C 4YS3C 5AV9C 3TU4C 2F8NH 2AROD 1M18A 3WTPE 3AZLD 3EPJA 2JSSA 4Z5TA 1EQZC 3LZ0D 4KGCC 3WAAD 4NE6A 1P3OA 5CP6B 4CSRA 3W98A 3O62A 4WU8D 4KUDB 5CPKC 3C1BC 5B40D 4CAYB 3V9RB 1KX4C 5CPIC 4R8PA 4J8VC 1P3MD 1BH9A 3KWQA 3X1VC 3RELB 5JRGC 3LZ1D 3AZIC 3W99A 3H0LC 3X1UB 2HUEC 1KU5A 4LD9A 2F8ND 4HGAB 5AVBC 2LY8A 3UT9A 4Z66D 3C1CD 5AVCC 1P3GA 4XZQB 3UTBD 5DNNA 3LJAC 5B2JA 3LELD 2ZY3A 2XD1A 3H0MC 5B2ID 2NZDC 4H9OA 3WKJB 4WV4B 4AWLC 2RVQC 1TZYC 5B0ZC 1P3BD 2Y2QA 3R45B 5B1MD 3AZKC 3B0BA 1ZLAB 3MNNB 4ZBJC 1P34C 5GT0B 1F66B 5CP6A 3AZHB 1HTAA 3AFAA 1T3UA 5E5AA 1HQ3B 5BT1D 2F8NG 3AYWA 2FJ7B 1M19D 4CAYA 1U35A 2HIOD 4WU9B 3AZLC 4NFTA 5B33C 1ID3B 5B31A 2YFVB 5GXQD 5AV8B 3MGPC 3MGRA 5KDMB 1P3PB 3WA9A 3W97B 1B67A 2NQBC 1P3AB 2G5HC 5AY8B 3A6ND 4G92C 4ZUXC 2BG1A 3AZFB 3AZED 3A1KA 2UWXA 3AZMC 1M1AB 4J8UD 1JFIB 5JA4B 3AN2B 3MGSA 3W96B 4YM6A 3REKB 3B6GB 4DQYB 3AZGB 1WWSA 3B6FD 3R45A 2BYKA 4H9NA 4Z66C 3C1CC 3X1SC 4J8XD 3AV2D 5AV5C 3UTBC 5AV6D 4YS3D 3TU4D 1ZLAA 4KUDC 4J8WB 3NQJB 3LELC 2BYMB 1BH8B 3MGQB 5BNVA 1HQ3A 4EO5C 4G91B 2CV5A 1EQZD 5B32C 2PYOD 4KGCD 3X1UC 3REIB 4HGAC 1ID3A 5BS7A 3REHC 5AV8A 3X1TC 5KDMA 5F99B 3REJA 1P3PA 3W97A 2F2AC 4XZQC 3KXBA 3UTAB 5CPKD 3C1BD 1M18B 5GT3A 1KX4D 4X23C 4J8VD 5CPID 1S32A 3WKJC 3AZFA 3AZNB 3X1VD 3AZID 5JRGD 1M19C 4XUJA 1M1AA 1JFIA 1KX5C 2W8SA 3AN2A 3W96A 5AVBD 3B6GA 4CSRB 5CPJD 3AZJA 3W98B 5GSUC 5AVCD 3MNNC 2Y2PA 5GT0C 3LJAD 2Y2GA 5B0YB 3AV1C 4WNNA 3AZHC 1BH9B 2FJ7C 3AZEC 3KWQB 2F8NK 5C3IB 4J8WA 2ZY4A 3NQJA 4WU9C 3W99B 4J8UC 1P3FA 4LD9B 1BH8A 2RVQD 5BNXA 4QLCB 1AOIC 1TAFA 3REIA 1P3AC 5AY8C 1P3IB 1P34D 5B2JB 5F99A 3KUYA 2IO5C 4J8XC 3AV2C 3UTAA 4H9OB 5B1LB 5B33D 1KX3C 2Y2MA 3AZNA 3MGPD 4JJNC 2PYOC 1P3GD 3AZGC 3MVDC 2NQBD 3F6TA 3VH6W 3WTPC 4ZUXD 3LZ0B 3AFAB 5E5AB 5B0YA 3AYWB 3AZMD 1U35B 3WAAB 4H9QA 4G91C 5B31B 3MGRB 3WA9B 5DNMC 4H9RA 4WU8B 2XD5A 5B40B 1P3KC 1BFMA 2DQNC 4QLCA 4DRBA 5CPJC 3X1SD 4KUDD 5AV5D 1P3IA 2CWEA 1M18C 2F8NB 4E45A 4Z5TC 3MGSB 3RELD 5B32D 3AZKA 2FFFB 5B1LA 4YM6B 3X1UD 1P3LA 1P3OC 3REHD 3VH6T 3X1TD 5B24A 3W98C 5B2IB 2BYKB 4XZQD 3O62C 4H9NB 2AROA 3AL0C 3AZLA 4R8PC 4X23D 3WKJD 3LZ0A 5BNVB 1P3BB 2CV5B 3W99C 3WAAA 4LD9C 1KX5D 3UT9C 4KHAA 3REJB 1P3GC 3KXBB 1R4VA 5GSUD 5DNNC 4WU8A 3MNND 1F66D 5GT0D 5B40A 5B2JC 3AV1D 5B32G 3AZHD 1P3MA 5GT3B 5GXQB 1S32B 4M6BA 1PZRA 2FJ7D 3LZ1A 4WU9D 4XUJB 2YFWA 2F8NA 3A6NB 3W97D 4Z66A 1W2EA 1ULYA 3UTBA 3AZJB 1AOID 1P3AD 5AY8D 5CP6C 5FUGB 4WNNB 5B2IA 3AZFD 3AYWC 1M1AD 1U35C 3WA9C 5B31C 3AN2D 1P3FB 1KX3D 3B6FB 2RIQA 5BNXB 3EPKA 1P3BA 3A1IA 4JJND 3REKD 3RELC 2Y2LA 5B1MA 2ZY2A 3EG5B 3AZGD 1TAFB 5AV9B 3MVDD 4YS3B 3KUYB 3WTPD 3B0CT 1EQZB 4KGCB 2JCHA 1M19A 2HIOA 3MGQD 5GXQA 4DRAA 3MGSC 4YM6C 4NE5A 5DNMD 5CPKB 3IP4C 3A6NA 1P3KD 2Y2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI B;  1B6W A;  1ZLA C;  3X1V B;  1F66 C;  5FUG A;  4J8U A;  1M18 D;  4H9Q B;  4Z5T D;  1HQ3 C;  2CV5 C;  3KSY A;  4UUZ B;  5AVB B;  3VH5 W;  4H9R B;  1ID3 C;  5AV8 C;  3B6F A;  1P3P C;  1P3O D;  3W97 C;  3W98 D;  4H9S A;  3KXB C;  2NZD B;  4J8X A;  3AV2 A;  3O62 D;  5AV6 A;  3TU4 A;  5AV9 A;  4YS3 A;  4AWL B;  5GT3 C;  1S32 C;  1TZY B;  5B0Z B;  4R8P D;  3AZF C;  1EQZ A;  2PYO A;  4KGC A;  3KWQ D;  1M1A C;  3W99 D;  4XUJ C;  3AZK B;  4LD9 D;  4ZBJ B;  1P3L B;  3AN2 C;  3NQU B;  1P34 B;  3W96 C;  3B6G C;  5B24 B;  3REK C;  3UT9 D;  3AZJ C;  5DNN D;  1F1E A;  3C1B A;  5CPK A;  2ARO B;  5B2J D;  1KX4 A;  3AZL B;  4J8V A;  5B33 B;  5CPI A;  3VH5 T;  3X1V A;  3AZI A;  5JRG A;  4J8W C;  1P3F C;  3MGQ C;  4UUZ A;  5AVB A;  4KHA B;  5CPJ A;  5AVC A;  4ZUX B;  3REI C;  3LJA A;  3AZM B;  5CP6 D;  5F99 C;  3KUY C;  2NZD A;  1WWI A;  1P3M B;  3AFA D;  5E5A D;  3UTA C;  1N1J A;  3AYW D;  3LZ1 B;  3VH5 A;  1U35 D;  1TZY A;  2YFW B;  5B31 D;  5B0Z A;  3MGR D;  3AZN C;  3WA9 D;  4Z66 B;  3C1C B;  3X1S B;  5AV5 B;  3UTB B;  3NQU A;  1P34 A;  3LEL B;  4EO5 B;  5B32 B;  5B0Y C;  4WZS B;  5B33 A;  3REH B;  3MGS D;  3MGP A;  3X1T B;  3KWQ C;  5C3I C;  4YM6 D;  2L5A A;  5B1M B;  2NQB A;  1A7W A;  4QLC C;  4X23 B;  3VH6 A;  1ZLA D;  4ZUX A;  5CHL B;  5B31 G;  5BO0 B;  1P3I C;  3AZM A;  1M19 B;  2HIO B;  1KX5 B;  1HQ3 D;  2CV5 D;  3B0C W;  5B1L C;  4Z2M H;  5GSU B;  1P3L C;  1ID3 D;  5AV8 D;  3AV1 B;  5B24 C;  3REJ D;  1P3P D;  3KXB D;  3C1C A;  3X1S A;  4KUD A;  5AV5 A;  2ARO C;  3AZE B;  3V9R A;  3LEL A;  4J8U B;  5GT3 D;  1S32 D;  3LZ0 C;  1H3O B;  3AFA C;  5E5A C;  3REL A;  5B32 A;  3X1U A;  4XUJ D;  3WAA C;  1AOI B;  3MGR C;  3REH A;  3X1T A;  3W96 D;  5G49 B;  3B0D B;  2IO5 B;  3B6G D;  4XZQ A;  3AZJ D;  4WU8 C;  4J8X B;  3AV2 B;  5AV6 B;  3TU4 B;  5B40 C;  1P3M C;  4X23 A;  1KX3 B;  3WKJ A;  4JJN B;  2PYO B;  5BO0 A;  3LZ1 C;  4J8W D;  3MVD B;  1P3F D;  1KX5 A;  4NE3 A;  3WTP B;  5GSU A;  3MNN A;  5AV9 D;  3REI D;  1F66 A;  5GT0 A;  3C1B B;  3AV1 A;  5F99 D;  3KUY D;  3AZH A;  5B2I C;  4J8V B;  3UTA D;  2FJ7 A;  4H9P B;  3AZE A;  5DNM B;  3AZI B;  5JRG B;  4WU9 A;  2HUE B;  2YFV A;  1P3K B;  1H3O A;  3AZN D;  1P3B C;  5B1M C;  4Z2M G;  5CPJ B;  1AOI A;  5AVC B;  1P3A A;  1Q9C A;  5AY8 A;  5BS7 C;  3LJA B;  4E44 A;  5G49 A;  3REJ C;  5BT1 C;  4Z5T B;  1N1J B;  5B0Y D;  2HIO C;  5JA4 A;  5GXQ C;  1KX3 A;  1P3O B;  4JJN A;  3REK A;  3O62 B;  3AZG A;  3MVD A;  3A6N C;  4R8P B;  4QLC D;  2NZD D;  3WTP A;  1P3I D;  2BYM A;  3MGQ A;  1TZY D;  5B0Z D;  3MGP B;  4H9P A;  3UT9 B;  5DNM A;  3AZK D;  5B1L D;  1P3G B;  5DNN B;  1P3L D;  2NQB B;  3B6F C;  1P3K A;  3B0D C;  5B24 D;  4H9S C;  4G92 B;  5AV6 C;  4YS3 C;  5AV9 C;  3TU4 C;  2F8N H;  2ARO D;  1M18 A;  3WTP E;  3AZL D;  2JSS A;  4Z5T A;  1EQZ C;  3LZ0 D;  4KGC C;  3WAA D;  4NE6 A;  1P3O A;  5CP6 B;  4CSR A;  3W98 A;  3O62 A;  4WU8 D;  4KUD B;  5CPK C;  3C1B C;  5B40 D;  4CAY B;  3V9R B;  1KX4 C;  5CPI C;  4R8P A;  4J8V C;  1P3M D;  1BH9 A;  3KWQ A;  3X1V C;  3REL B;  5JRG C;  3LZ1 D;  3AZI C;  3W99 A;  3X1U B;  2HUE C;  1KU5 A;  4LD9 A;  2F8N D;  4HGA B;  5AVB C;  2LY8 A;  3UT9 A;  4Z66 D;  3C1C D;  5AVC C;  1P3G A;  4XZQ B;  3UTB D;  5DNN A;  3LJA C;  5B2J A;  3LEL D;  5B2I D;  2NZD C;  4H9O A;  3WKJ B;  4WV4 B;  4AWL C;  2RVQ C;  1TZY C;  5B0Z C;  1P3B D;  3R45 B;  5B1M D;  3AZK C;  3B0B A;  1ZLA B;  3MNN B;  4ZBJ C;  1P34 C;  5GT0 B;  1F66 B;  5CP6 A;  3AZH B;  1HTA A;  3AFA A;  5BT1 D;  5E5A A;  1HQ3 B;  2F8N G;  3AYW A;  2FJ7 B;  1M19 D;  4CAY A;  1U35 A;  2HIO D;  4WU9 B;  3AZL C;  4NFT A;  5B33 C;  1ID3 B;  5B31 A;  2YFV B;  5GXQ D;  5AV8 B;  3MGP C;  3MGR A;  5KDM B;  1P3P B;  3WA9 A;  3W97 B;  1B67 A;  2NQB C;  1P3A B;  5AY8 B;  3A6N D;  4G92 C;  4ZUX C;  3AZF B;  3AZE D;  3AZM C;  1M1A B;  4J8U D;  1JFI B;  5JA4 B;  3AN2 B;  3MGS A;  3W96 B;  4YM6 A;  3REK B;  3B6G B;  3AZG B;  1WWS A;  3B6F D;  3R45 A;  2BYK A;  4H9N A;  4Z66 C;  3C1C C;  3X1S C;  4J8X D;  3AV2 D;  5AV5 C;  3UTB C;  5AV6 D;  4YS3 D;  3TU4 D;  1ZLA A;  4KUD C;  4J8W B;  3NQJ B;  3LEL C;  2BYM B;  1BH8 B;  3MGQ B;  5BNV A;  1HQ3 A;  4EO5 C;  4G91 B;  2CV5 A;  1EQZ D;  5B32 C;  2PYO D;  4KGC D;  3X1U C;  3REI B;  4HGA C;  1ID3 A;  5BS7 A;  3REH C;  5AV8 A;  3X1T C;  5KDM A;  5F99 B;  3REJ A;  1P3P A;  3W97 A;  4XZQ C;  3KXB A;  3UTA B;  5CPK D;  3C1B D;  1M18 B;  5GT3 A;  1KX4 D;  4X23 C;  4J8V D;  5CPI D;  1S32 A;  3WKJ C;  3AZF A;  3AZN B;  3X1V D;  3AZI D;  5JRG D;  1M19 C;  4XUJ A;  1M1A A;  1JFI A;  1KX5 C;  3AN2 A;  3W96 A;  5AVB D;  3B6G A;  4CSR B;  5CPJ D;  3AZJ A;  3W98 B;  5GSU C;  5AVC D;  3MNN C;  5GT0 C;  3LJA D;  5B0Y B;  3AV1 C;  4WNN A;  3AZH C;  1BH9 B;  2FJ7 C;  3AZE C;  3KWQ B;  2F8N K;  5C3I B;  4J8W A;  3NQJ A;  4WU9 C;  3W99 B;  4J8U C;  1P3F A;  4LD9 B;  1BH8 A;  2RVQ D;  5BNX A;  4QLC B;  1AOI C;  1TAF A;  3REI A;  1P3A C;  5AY8 C;  1P3I B;  1P34 D;  5B2J B;  5F99 A;  3KUY A;  2IO5 C;  4J8X C;  3AV2 C;  3UTA A;  4H9O B;  5B1L B;  5B33 D;  1KX3 C;  3AZN A;  3MGP D;  4JJN C;  2PYO C;  1P3G D;  3AZG C;  3MVD C;  2NQB D;  3VH6 W;  3WTP C;  4ZUX D;  3LZ0 B;  3AFA B;  5E5A B;  5B0Y A;  3AYW B;  3AZM D;  1U35 B;  3WAA B;  4H9Q A;  4G91 C;  5B31 B;  3MGR B;  3WA9 B;  5DNM C;  4H9R A;  4WU8 B;  5B40 B;  1P3K C;  1BFM A;  4QLC A;  4DRB A;  5CPJ C;  3X1S D;  4KUD D;  5AV5 D;  1P3I A;  2CWE A;  1M18 C;  2F8N B;  4E45 A;  4Z5T C;  3MGS B;  3REL D;  5B32 D;  3AZK A;  5B1L A;  4YM6 B;  3X1U D;  1P3L A;  1P3O C;  3REH D;  3VH6 T;  3X1T D;  5B24 A;  3W98 C;  5B2I B;  2BYK B;  4XZQ D;  3O62 C;  4H9N B;  2ARO A;  3AZL A;  4R8P C;  4X23 D;  3WKJ D;  3LZ0 A;  5BNV B;  1P3B B;  2CV5 B;  3W99 C;  3WAA A;  4LD9 C;  1KX5 D;  3UT9 C;  4KHA A;  3REJ B;  1P3G C;  3KXB B;  1R4V A;  5GSU D;  5DNN C;  4WU8 A;  3MNN D;  1F66 D;  5GT0 D;  5B40 A;  5B2J C;  3AV1 D;  5B32 G;  3AZH D;  1P3M A;  5GT3 B;  5GXQ B;  1S32 B;  4M6B A;  2FJ7 D;  3LZ1 A;  4WU9 D;  4XUJ B;  2YFW A;  2F8N A;  3A6N B;  3W97 D;  4Z66 A;  1ULY A;  3UTB A;  3AZJ B;  1AOI D;  1P3A D;  5AY8 D;  5CP6 C;  5FUG B;  4WNN B;  5B2I A;  3AZF D;  3AYW C;  1M1A D;  1U35 C;  3WA9 C;  5B31 C;  3AN2 D;  1P3F B;  1KX3 D;  3B6F B;  5BNX B;  1P3B A;  4JJN D;  3REK D;  3REL C;  5B1M A;  3AZG D;  1TAF B;  5AV9 B;  3MVD D;  4YS3 B;  3KUY B;  3WTP D;  3B0C T;  1EQZ B;  4KGC B;  1M19 A;  2HIO A;  3MGQ D;  5GXQ A;  4DRA A;  3MGS C;  4YM6 C;  4NE5 A;  5DNM D;  5CPK B;  3A6N A;  1P3K D;  1KX4 B; 
#chains in the Genus database with same CATH topology
 5CPI B;  1B6W A;  1ZLA C;  2Y2K A;  3X1V B;  1F66 C;  5FUG A;  4J8U A;  1M18 D;  4H9Q B;  4Z5T D;  1HQ3 C;  2CV5 C;  3KSY A;  4UUZ B;  5AVB B;  3VH5 W;  4H9R B;  1ID3 C;  5AV8 C;  3B6F A;  1P3P C;  1P3O D;  3W97 C;  3W98 D;  4H9S A;  3KXB C;  2NZD B;  4J8X A;  3AV2 A;  3O62 D;  5AV6 A;  3TU4 A;  5AV9 A;  4YS3 A;  2Y2I A;  4AWL B;  5GT3 C;  1S32 C;  1TZY B;  5B0Z B;  4R8P D;  3AZF C;  1EQZ A;  2PYO A;  4KGC A;  3KWQ D;  1M1A C;  3W99 D;  4XUJ C;  3AZK B;  4LD9 D;  4WJ3 C;  4ZBJ B;  1P3L B;  3AN2 C;  3NQU B;  1P34 B;  3W96 C;  3B6G C;  5B24 B;  3REK C;  3UT9 D;  3AZJ C;  5DNN D;  1F1E A;  3C1B A;  5CPK A;  2ARO B;  5B2J D;  1KX4 A;  3AZL B;  4J8V A;  5B33 B;  5CPI A;  3VH5 T;  3X1V A;  3AZI A;  5JRG A;  4J8W C;  1P3F C;  3MGQ C;  2G5I C;  4UUZ A;  5AVB A;  4KHA B;  5CPJ A;  5AVC A;  4ZUX B;  3REI C;  3LJA A;  3AZM B;  5CP6 D;  2ZY5 A;  5F99 C;  3KUY C;  2NZD A;  1WWI A;  1P3M B;  3AFA D;  5E5A D;  3UTA C;  1N1J A;  3AYW D;  3P5J B;  3VH5 A;  3LZ1 B;  1U35 D;  2Y2J A;  1TZY A;  2YFW B;  5B31 D;  5B0Z A;  3MGR D;  3AZN C;  3WA9 D;  2J8P A;  4Z66 B;  3C1C B;  3X1S B;  5AV5 B;  3UTB B;  1KX4 B;  3NQU A;  1P34 A;  3LEL B;  4EO5 B;  5B32 B;  5B0Y C;  4WZS B;  5B33 A;  3REH B;  2Y2H A;  3MGS D;  3MGP A;  3X1T B;  3KWQ C;  5C3I C;  4YM6 D;  2L5A A;  5B1M B;  2NQB A;  1A7W A;  4QLC C;  4X23 B;  3VH6 A;  1ZLA D;  4ZUX A;  5CHL B;  5B31 G;  5BO0 B;  1P3I C;  3AZM A;  1M19 B;  3H0R C;  2HIO B;  1KX5 B;  1HQ3 D;  2CV5 D;  3B0C W;  5B1L C;  4Z2M H;  5GSU B;  1P3L C;  1ID3 D;  5AV8 D;  3AV1 B;  5B24 C;  3REJ D;  1P3P D;  3KXB D;  3FDD A;  3X1S A;  3C1C A;  4KUD A;  5AV5 A;  3KFU G;  2ARO C;  3AZE B;  3V9R A;  3LEL A;  4J8U B;  5GT3 D;  1S32 D;  3LZ0 C;  1H3O B;  3AFA C;  5E5A C;  3REL A;  5B32 A;  3X1U A;  4XUJ D;  3WAA C;  1AOI B;  4UPK A;  3MGR C;  3REH A;  3X1T A;  3W96 D;  5G49 B;  3B0D B;  2IO5 B;  3B6G D;  4XZQ A;  3AZJ D;  4WU8 C;  4J8X B;  3AV2 B;  5AV6 B;  3TU4 B;  5B40 C;  2JE5 A;  1P3M C;  4X23 A;  1KX3 B;  3WKJ A;  4JJN B;  2PYO B;  5BO0 A;  3LZ1 C;  4J8W D;  3MVD B;  1P3F D;  1KX5 A;  4NE3 A;  3WTP B;  5GSU A;  3MNN A;  5AV9 D;  3REI D;  1F66 A;  5GT0 A;  3C1B B;  3AV1 A;  5F99 D;  3KUY D;  3AZH A;  5B2I C;  4J8V B;  3UTA D;  2FJ7 A;  4H9P B;  3AZE A;  5DNM B;  3AZI B;  5JRG B;  4WU9 A;  2HUE B;  2YFV A;  1P3K B;  1H3O A;  3AZN D;  1P3B C;  5B1M C;  4Z2M G;  5CPJ B;  1AOI A;  5AVC B;  1P3A A;  2Y2O A;  1Q9C A;  5AY8 A;  5BS7 C;  3LJA B;  4E44 A;  5G49 A;  3REJ C;  5BT1 C;  4Z5T B;  2VQR A;  1N1J B;  5B0Y D;  2HIO C;  3EPL A;  5JA4 A;  5GXQ C;  1KX3 A;  1P3O B;  2ZM5 A;  4JJN A;  3REK A;  1Z2C B;  3O62 B;  3AZG A;  3MVD A;  2DF4 C;  3EPH A;  3A6N C;  4QLC D;  4R8P B;  2NZD D;  3WTP A;  1P3I D;  2BYM A;  3MGQ A;  1TZY D;  5B0Z D;  3MGP B;  4H9P A;  3UT9 B;  5DNM A;  3AZK D;  5B1L D;  1P3G B;  5DNN B;  1P3L D;  2NQB B;  3B6F C;  1P3K A;  3B0D C;  5B24 D;  4H9S C;  4G92 B;  5AV6 C;  4YS3 C;  5AV9 C;  3TU4 C;  2F8N H;  2ARO D;  1M18 A;  3WTP E;  3AZL D;  3EPJ A;  2JSS A;  4Z5T A;  1EQZ C;  3LZ0 D;  4KGC C;  3WAA D;  4NE6 A;  1P3O A;  5CP6 B;  4CSR A;  3W98 A;  3O62 A;  4WU8 D;  4KUD B;  5CPK C;  3C1B C;  5B40 D;  4CAY B;  3V9R B;  1KX4 C;  5CPI C;  4R8P A;  4J8V C;  1P3M D;  1BH9 A;  3KWQ A;  3X1V C;  3REL B;  5JRG C;  3LZ1 D;  3AZI C;  3W99 A;  3H0L C;  3X1U B;  2HUE C;  1KU5 A;  4LD9 A;  2F8N D;  4HGA B;  5AVB C;  2LY8 A;  3UT9 A;  4Z66 D;  3C1C D;  5AVC C;  1P3G A;  4XZQ B;  3UTB D;  5DNN A;  3LJA C;  5B2J A;  3LEL D;  2ZY3 A;  2XD1 A;  3H0M C;  5B2I D;  2NZD C;  4H9O A;  3WKJ B;  4WV4 B;  4AWL C;  2RVQ C;  1TZY C;  5B0Z C;  1P3B D;  2Y2Q A;  3R45 B;  5B1M D;  3AZK C;  3B0B A;  1ZLA B;  3MNN B;  4ZBJ C;  1P34 C;  5GT0 B;  1F66 B;  5CP6 A;  3AZH B;  1HTA A;  3AFA A;  1T3U A;  5E5A A;  1HQ3 B;  5BT1 D;  2F8N G;  3AYW A;  2FJ7 B;  1M19 D;  4CAY A;  1U35 A;  2HIO D;  4WU9 B;  3AZL C;  4NFT A;  5B33 C;  1ID3 B;  5B31 A;  2YFV B;  5GXQ D;  5AV8 B;  3MGP C;  3MGR A;  5KDM B;  1P3P B;  3WA9 A;  3W97 B;  1B67 A;  2NQB C;  1P3A B;  2G5H C;  5AY8 B;  3A6N D;  4G92 C;  4ZUX C;  2BG1 A;  3AZF B;  3AZE D;  3A1K A;  2UWX A;  3AZM C;  1M1A B;  4J8U D;  1JFI B;  5JA4 B;  3AN2 B;  3MGS A;  3W96 B;  4YM6 A;  3REK B;  3B6G B;  4DQY B;  3AZG B;  1WWS A;  3B6F D;  3R45 A;  2BYK A;  4H9N A;  4Z66 C;  3C1C C;  3X1S C;  4J8X D;  3AV2 D;  5AV5 C;  3UTB C;  5AV6 D;  4YS3 D;  3TU4 D;  1ZLA A;  4KUD C;  4J8W B;  3NQJ B;  3LEL C;  2BYM B;  1BH8 B;  3MGQ B;  5BNV A;  1HQ3 A;  4EO5 C;  4G91 B;  2CV5 A;  1EQZ D;  5B32 C;  2PYO D;  4KGC D;  3X1U C;  3REI B;  4HGA C;  1ID3 A;  5BS7 A;  3REH C;  5AV8 A;  3X1T C;  5KDM A;  5F99 B;  3REJ A;  1P3P A;  3W97 A;  2F2A C;  4XZQ C;  3KXB A;  3UTA B;  5CPK D;  3C1B D;  1M18 B;  5GT3 A;  1KX4 D;  4X23 C;  4J8V D;  5CPI D;  1S32 A;  3WKJ C;  3AZF A;  3AZN B;  3X1V D;  3AZI D;  5JRG D;  1M19 C;  4XUJ A;  1M1A A;  1JFI A;  1KX5 C;  2W8S A;  3AN2 A;  3W96 A;  5AVB D;  3B6G A;  4CSR B;  5CPJ D;  3AZJ A;  3W98 B;  5GSU C;  5AVC D;  3MNN C;  2Y2P A;  5GT0 C;  3LJA D;  2Y2G A;  5B0Y B;  3AV1 C;  4WNN A;  3AZH C;  1BH9 B;  2FJ7 C;  3AZE C;  3KWQ B;  2F8N K;  5C3I B;  4J8W A;  2ZY4 A;  3NQJ A;  4WU9 C;  3W99 B;  4J8U C;  1P3F A;  4LD9 B;  1BH8 A;  2RVQ D;  5BNX A;  4QLC B;  1AOI C;  1TAF A;  3REI A;  1P3A C;  5AY8 C;  1P3I B;  1P34 D;  5B2J B;  5F99 A;  3KUY A;  2IO5 C;  4J8X C;  3AV2 C;  3UTA A;  4H9O B;  5B1L B;  5B33 D;  1KX3 C;  2Y2M A;  3AZN A;  3MGP D;  4JJN C;  2PYO C;  1P3G D;  3AZG C;  3MVD C;  2NQB D;  3F6T A;  3VH6 W;  3WTP C;  4ZUX D;  3LZ0 B;  3AFA B;  5E5A B;  5B0Y A;  3AYW B;  3AZM D;  1U35 B;  3WAA B;  4H9Q A;  4G91 C;  5B31 B;  3MGR B;  3WA9 B;  5DNM C;  4H9R A;  4WU8 B;  2XD5 A;  5B40 B;  1P3K C;  1BFM A;  2DQN C;  4QLC A;  4DRB A;  5CPJ C;  3X1S D;  4KUD D;  5AV5 D;  1P3I A;  2CWE A;  1M18 C;  2F8N B;  4E45 A;  4Z5T C;  3MGS B;  3REL D;  5B32 D;  3AZK A;  2FFF B;  5B1L A;  4YM6 B;  3X1U D;  1P3L A;  1P3O C;  3REH D;  3VH6 T;  3X1T D;  5B24 A;  3W98 C;  5B2I B;  2BYK B;  4XZQ D;  3O62 C;  4H9N B;  2ARO A;  3AL0 C;  3AZL A;  4R8P C;  4X23 D;  3WKJ D;  3LZ0 A;  5BNV B;  1P3B B;  2CV5 B;  3W99 C;  3WAA A;  4LD9 C;  1KX5 D;  3UT9 C;  4KHA A;  3REJ B;  1P3G C;  3KXB B;  1R4V A;  5GSU D;  5DNN C;  4WU8 A;  3MNN D;  1F66 D;  5GT0 D;  5B40 A;  5B2J C;  3AV1 D;  5B32 G;  3AZH D;  1P3M A;  5GT3 B;  5GXQ B;  1S32 B;  4M6B A;  1PZR A;  2FJ7 D;  3LZ1 A;  4WU9 D;  4XUJ B;  2YFW A;  2F8N A;  3A6N B;  3W97 D;  4Z66 A;  1W2E A;  1ULY A;  3UTB A;  3AZJ B;  1AOI D;  1P3A D;  5AY8 D;  5CP6 C;  5FUG B;  4WNN B;  5B2I A;  3AZF D;  3AYW C;  1M1A D;  1U35 C;  3WA9 C;  5B31 C;  3AN2 D;  1P3F B;  1KX3 D;  3B6F B;  2RIQ A;  5BNX B;  3EPK A;  1P3B A;  3A1I A;  4JJN D;  3REK D;  3REL C;  2Y2L A;  5B1M A;  2ZY2 A;  3EG5 B;  3AZG D;  1TAF B;  5AV9 B;  3MVD D;  4YS3 B;  3KUY B;  3WTP D;  3B0C T;  1EQZ B;  4KGC B;  2JCH A;  1M19 A;  2HIO A;  3MGQ D;  5GXQ A;  4DRA A;  3MGS C;  4YM6 C;  4NE5 A;  5DNM D;  5CPK B;  3IP4 C;  3A6N A;  1P3K D;  2Y2N A; 
#chains in the Genus database with same CATH homology
 5CPI B;  1B6W A;  1ZLA C;  2Y2K A;  3X1V B;  1F66 C;  5FUG A;  4J8U A;  1M18 D;  4H9Q B;  4Z5T D;  1HQ3 C;  2CV5 C;  3KSY A;  4UUZ B;  5AVB B;  3VH5 W;  4H9R B;  1ID3 C;  5AV8 C;  3B6F A;  1P3P C;  1P3O D;  3W97 C;  3W98 D;  4H9S A;  3KXB C;  2NZD B;  4J8X A;  3AV2 A;  3O62 D;  5AV6 A;  3TU4 A;  5AV9 A;  4YS3 A;  2Y2I A;  4AWL B;  5GT3 C;  1S32 C;  1TZY B;  5B0Z B;  4R8P D;  3AZF C;  1EQZ A;  2PYO A;  4KGC A;  3KWQ D;  1M1A C;  3W99 D;  4XUJ C;  3AZK B;  4LD9 D;  4WJ3 C;  4ZBJ B;  1P3L B;  3AN2 C;  3NQU B;  1P34 B;  3W96 C;  3B6G C;  5B24 B;  3REK C;  3UT9 D;  3AZJ C;  5DNN D;  1F1E A;  3C1B A;  5CPK A;  2ARO B;  5B2J D;  1KX4 A;  3AZL B;  4J8V A;  5B33 B;  5CPI A;  3VH5 T;  3X1V A;  3AZI A;  5JRG A;  4J8W C;  1P3F C;  3MGQ C;  2G5I C;  4UUZ A;  5AVB A;  4KHA B;  5CPJ A;  5AVC A;  4ZUX B;  3REI C;  3LJA A;  3AZM B;  5CP6 D;  2ZY5 A;  5F99 C;  3KUY C;  2NZD A;  1WWI A;  1P3M B;  3AFA D;  5E5A D;  3UTA C;  1N1J A;  3AYW D;  3P5J B;  3VH5 A;  3LZ1 B;  1U35 D;  2Y2J A;  1TZY A;  2YFW B;  5B31 D;  5B0Z A;  3MGR D;  3AZN C;  3WA9 D;  2J8P A;  4Z66 B;  3C1C B;  3X1S B;  5AV5 B;  3UTB B;  1KX4 B;  3NQU A;  1P34 A;  3LEL B;  4EO5 B;  5B32 B;  5B0Y C;  4WZS B;  5B33 A;  3REH B;  2Y2H A;  3MGS D;  3MGP A;  3X1T B;  3KWQ C;  5C3I C;  4YM6 D;  2L5A A;  5B1M B;  2NQB A;  1A7W A;  4QLC C;  4X23 B;  3VH6 A;  1ZLA D;  4ZUX A;  5CHL B;  5B31 G;  5BO0 B;  1P3I C;  3AZM A;  1M19 B;  3H0R C;  2HIO B;  1KX5 B;  1HQ3 D;  2CV5 D;  3B0C W;  5B1L C;  4Z2M H;  5GSU B;  1P3L C;  1ID3 D;  5AV8 D;  3AV1 B;  5B24 C;  3REJ D;  1P3P D;  3KXB D;  3FDD A;  3X1S A;  3C1C A;  4KUD A;  5AV5 A;  3KFU G;  2ARO C;  3AZE B;  3V9R A;  3LEL A;  4J8U B;  5GT3 D;  1S32 D;  3LZ0 C;  1H3O B;  3AFA C;  5E5A C;  3REL A;  5B32 A;  3X1U A;  4XUJ D;  3WAA C;  1AOI B;  4UPK A;  3MGR C;  3REH A;  3X1T A;  3W96 D;  5G49 B;  3B0D B;  2IO5 B;  3B6G D;  4XZQ A;  3AZJ D;  4WU8 C;  4J8X B;  3AV2 B;  5AV6 B;  3TU4 B;  5B40 C;  2JE5 A;  1P3M C;  4X23 A;  1KX3 B;  3WKJ A;  4JJN B;  2PYO B;  5BO0 A;  3LZ1 C;  4J8W D;  3MVD B;  1P3F D;  1KX5 A;  4NE3 A;  3WTP B;  5GSU A;  3MNN A;  5AV9 D;  3REI D;  1F66 A;  5GT0 A;  3C1B B;  3AV1 A;  5F99 D;  3KUY D;  3AZH A;  5B2I C;  4J8V B;  3UTA D;  2FJ7 A;  4H9P B;  3AZE A;  5DNM B;  3AZI B;  5JRG B;  4WU9 A;  2HUE B;  2YFV A;  1P3K B;  1H3O A;  3AZN D;  1P3B C;  5B1M C;  4Z2M G;  5CPJ B;  1AOI A;  5AVC B;  1P3A A;  2Y2O A;  1Q9C A;  5AY8 A;  5BS7 C;  3LJA B;  4E44 A;  5G49 A;  3REJ C;  5BT1 C;  4Z5T B;  2VQR A;  1N1J B;  5B0Y D;  2HIO C;  3EPL A;  5JA4 A;  5GXQ C;  1KX3 A;  1P3O B;  2ZM5 A;  4JJN A;  3REK A;  1Z2C B;  3O62 B;  3AZG A;  3MVD A;  2DF4 C;  3EPH A;  3A6N C;  4QLC D;  4R8P B;  2NZD D;  3WTP A;  1P3I D;  2BYM A;  3MGQ A;  1TZY D;  5B0Z D;  3MGP B;  4H9P A;  3UT9 B;  5DNM A;  3AZK D;  5B1L D;  1P3G B;  5DNN B;  1P3L D;  2NQB B;  3B6F C;  1P3K A;  3B0D C;  5B24 D;  4H9S C;  4G92 B;  5AV6 C;  4YS3 C;  5AV9 C;  3TU4 C;  2F8N H;  2ARO D;  1M18 A;  3WTP E;  3AZL D;  3EPJ A;  2JSS A;  4Z5T A;  1EQZ C;  3LZ0 D;  4KGC C;  3WAA D;  4NE6 A;  1P3O A;  5CP6 B;  4CSR A;  3W98 A;  3O62 A;  4WU8 D;  4KUD B;  5CPK C;  3C1B C;  5B40 D;  4CAY B;  3V9R B;  1KX4 C;  5CPI C;  4R8P A;  4J8V C;  1P3M D;  1BH9 A;  3KWQ A;  3X1V C;  3REL B;  5JRG C;  3LZ1 D;  3AZI C;  3W99 A;  3H0L C;  3X1U B;  2HUE C;  1KU5 A;  4LD9 A;  2F8N D;  4HGA B;  5AVB C;  2LY8 A;  3UT9 A;  4Z66 D;  3C1C D;  5AVC C;  1P3G A;  4XZQ B;  3UTB D;  5DNN A;  3LJA C;  5B2J A;  3LEL D;  2ZY3 A;  2XD1 A;  3H0M C;  5B2I D;  2NZD C;  4H9O A;  3WKJ B;  4WV4 B;  4AWL C;  2RVQ C;  1TZY C;  5B0Z C;  1P3B D;  2Y2Q A;  3R45 B;  5B1M D;  3AZK C;  3B0B A;  1ZLA B;  3MNN B;  4ZBJ C;  1P34 C;  5GT0 B;  1F66 B;  5CP6 A;  3AZH B;  1HTA A;  3AFA A;  1T3U A;  5E5A A;  1HQ3 B;  5BT1 D;  2F8N G;  3AYW A;  2FJ7 B;  1M19 D;  4CAY A;  1U35 A;  2HIO D;  4WU9 B;  3AZL C;  4NFT A;  5B33 C;  1ID3 B;  5B31 A;  2YFV B;  5GXQ D;  5AV8 B;  3MGP C;  3MGR A;  5KDM B;  1P3P B;  3WA9 A;  3W97 B;  1B67 A;  2NQB C;  1P3A B;  2G5H C;  5AY8 B;  3A6N D;  4G92 C;  4ZUX C;  2BG1 A;  3AZF B;  3AZE D;  3A1K A;  2UWX A;  3AZM C;  1M1A B;  4J8U D;  1JFI B;  5JA4 B;  3AN2 B;  3MGS A;  3W96 B;  4YM6 A;  3REK B;  3B6G B;  4DQY B;  3AZG B;  1WWS A;  3B6F D;  3R45 A;  2BYK A;  4H9N A;  4Z66 C;  3C1C C;  3X1S C;  4J8X D;  3AV2 D;  5AV5 C;  3UTB C;  5AV6 D;  4YS3 D;  3TU4 D;  1ZLA A;  4KUD C;  4J8W B;  3NQJ B;  3LEL C;  2BYM B;  1BH8 B;  3MGQ B;  5BNV A;  1HQ3 A;  4EO5 C;  4G91 B;  2CV5 A;  1EQZ D;  5B32 C;  2PYO D;  4KGC D;  3X1U C;  3REI B;  4HGA C;  1ID3 A;  5BS7 A;  3REH C;  5AV8 A;  3X1T C;  5KDM A;  5F99 B;  3REJ A;  1P3P A;  3W97 A;  2F2A C;  4XZQ C;  3KXB A;  3UTA B;  5CPK D;  3C1B D;  1M18 B;  5GT3 A;  1KX4 D;  4X23 C;  4J8V D;  5CPI D;  1S32 A;  3WKJ C;  3AZF A;  3AZN B;  3X1V D;  3AZI D;  5JRG D;  1M19 C;  4XUJ A;  1M1A A;  1JFI A;  1KX5 C;  2W8S A;  3AN2 A;  3W96 A;  5AVB D;  3B6G A;  4CSR B;  5CPJ D;  3AZJ A;  3W98 B;  5GSU C;  5AVC D;  3MNN C;  2Y2P A;  5GT0 C;  3LJA D;  2Y2G A;  5B0Y B;  3AV1 C;  4WNN A;  3AZH C;  1BH9 B;  2FJ7 C;  3AZE C;  3KWQ B;  2F8N K;  5C3I B;  4J8W A;  2ZY4 A;  3NQJ A;  4WU9 C;  3W99 B;  4J8U C;  1P3F A;  4LD9 B;  1BH8 A;  2RVQ D;  5BNX A;  4QLC B;  1AOI C;  1TAF A;  3REI A;  1P3A C;  5AY8 C;  1P3I B;  1P34 D;  5B2J B;  5F99 A;  3KUY A;  2IO5 C;  4J8X C;  3AV2 C;  3UTA A;  4H9O B;  5B1L B;  5B33 D;  1KX3 C;  2Y2M A;  3AZN A;  3MGP D;  4JJN C;  2PYO C;  1P3G D;  3AZG C;  3MVD C;  2NQB D;  3F6T A;  3VH6 W;  3WTP C;  4ZUX D;  3LZ0 B;  3AFA B;  5E5A B;  5B0Y A;  3AYW B;  3AZM D;  1U35 B;  3WAA B;  4H9Q A;  4G91 C;  5B31 B;  3MGR B;  3WA9 B;  5DNM C;  4H9R A;  4WU8 B;  2XD5 A;  5B40 B;  1P3K C;  1BFM A;  2DQN C;  4QLC A;  4DRB A;  5CPJ C;  3X1S D;  4KUD D;  5AV5 D;  1P3I A;  2CWE A;  1M18 C;  2F8N B;  4E45 A;  4Z5T C;  3MGS B;  3REL D;  5B32 D;  3AZK A;  2FFF B;  5B1L A;  4YM6 B;  3X1U D;  1P3L A;  1P3O C;  3REH D;  3VH6 T;  3X1T D;  5B24 A;  3W98 C;  5B2I B;  2BYK B;  4XZQ D;  3O62 C;  4H9N B;  2ARO A;  3AL0 C;  3AZL A;  4R8P C;  4X23 D;  3WKJ D;  3LZ0 A;  5BNV B;  1P3B B;  2CV5 B;  3W99 C;  3WAA A;  4LD9 C;  1KX5 D;  3UT9 C;  4KHA A;  3REJ B;  1P3G C;  3KXB B;  1R4V A;  5GSU D;  5DNN C;  4WU8 A;  3MNN D;  1F66 D;  5GT0 D;  5B40 A;  5B2J C;  3AV1 D;  5B32 G;  3AZH D;  1P3M A;  5GT3 B;  5GXQ B;  1S32 B;  4M6B A;  1PZR A;  2FJ7 D;  3LZ1 A;  4WU9 D;  4XUJ B;  2YFW A;  2F8N A;  3A6N B;  3W97 D;  4Z66 A;  1W2E A;  1ULY A;  3UTB A;  3AZJ B;  1AOI D;  1P3A D;  5AY8 D;  5CP6 C;  5FUG B;  4WNN B;  5B2I A;  3AZF D;  3AYW C;  1M1A D;  1U35 C;  3WA9 C;  5B31 C;  3AN2 D;  1P3F B;  1KX3 D;  3B6F B;  2RIQ A;  5BNX B;  3EPK A;  1P3B A;  3A1I A;  4JJN D;  3REK D;  3REL C;  2Y2L A;  5B1M A;  2ZY2 A;  3EG5 B;  3AZG D;  1TAF B;  5AV9 B;  3MVD D;  4YS3 B;  3KUY B;  3WTP D;  3B0C T;  1EQZ B;  4KGC B;  2JCH A;  1M19 A;  2HIO A;  3MGQ D;  5GXQ A;  4DRA A;  3MGS C;  4YM6 C;  4NE5 A;  5DNM D;  5CPK B;  3IP4 C;  3A6N A;  1P3K D;  2Y2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...