5AV8C

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8C00
3UTBA 3A6ND 5CP6C 5B0ZD 5CPKC 4XUJD 4YM6D 1P3OA 3X1SB 4ZBJB 1BH9B 2BYMA 3AZKD 5AV5A 1P34A 2FJ7C 3WA9B 3KWQA 3MGPC 1F66D 1S32D 4KUDD 4J8WC 1KX3D 3UT9D 5DNND 1TZYC 3O62C 4J8VC 2CV5D 3AV1B 5GT3D 3LELA 3REIA 4LD9C 2HIOD 3AN2B 2YFWA 4H9NA 1Q9CA 3AZJD 3B6GC 3X1UC 1KX4B 3WKJC 1B67A 3REJC 2PYOB 1B6WA 2NQBD 4H9RA 3AFAC 3AZHD 5CP6D 5AY8A 5FUGA 4ZUXB 1P3LA 4AWLB 3W98A 5B32A 5CPIA 2FJ7D 4R8PB 5B2IA 3MGPD 1P34C 3W96A 4J8WD 1AOIC 3C1CA 1BH8A 4J8VD 1WWIA 3A6NB 5B0ZB 3LZ1A 5AVBA 3REIC 1P3MD 3B6GD 2HUEC 3KXBD 4NE6A 5C3IC 3WKJD 3WAAA 3AZKB 3AFAD 3X1TB 1EQZD 4H9QB 1F66B 1S32B 4KUDB 3AZLB 1KX3B 3UT9B 5DNNB 2RVQC 3AZMA 2CV5B 5GT3B 3KUYD 4YS3A 1TAFA 2HIOB 5AV9A 4DRBA 5BS7A 5AV6B 1P3LC 4NE5A 3AZJB 4DRAA 4CSRA 3MNNC 3B0DB 5CPIC 5B32C 3MGQD 1P34D 3AZIA 5AV8B 3VH6A 2NQBB 4EO5C 5B2IC 1AOID 4KGCA 1ULYA 5CP6B 5BO0A 4H9PA 5B31G 5CPKB 3LZ0C 3REHC 3V9RB 1P3IC 3B6FD 5AVBC 3AZGA 2FJ7B 1P3PA 3WAAC 5B33D 3MGPB 5GXQA 3VH5W 4WU8D 4J8WB 1P3GC 1TZYB 3O62B 4J8VB 2F8NK 3NQUA 2LY8A 5B40A 4WV4B 3AZEC 3AZMC 4YS3C 3B6GB 3MNND 4WNNB 5E5AA 5BNVA 5BS7C 5AV9C 4WU9C 3WKJB 5B32D 4KHAB 3AFAB 5KDMB 4Z66C 5CPJC 2AROA 4KGCC 3REKC 3LZ0D 3REHD 4Z5TA 1ZLAC 3KUYB 3B0BA 1P3ID 3WTPE 3VH6T 1KX4D 1P3BC 2BYMB 1HQ3A 4E45A 1P34B 1P3PC 5B1LC 5B0YD 1AOIB 1P3GD 5GXQC 1M19A 5G49A 3NQJA 5AVCC 1WWSA 3AZED 4YS3D 4NE3A 2HUEB 2F8ND 4WU9D 3B6FB 3WTPC 2YFWB 4H9NB 5C3IB 3C1BA 4JJNA 3W99A 3MVDA 5JRGC 4J8XA 2NZDA 4Z66D 5CPJD 4KGCD 3REKD 1P3FA 4XZQA 3AV2A 5F99A 2AROC 5B1MA 1ZLAD 4UUZA 5FUGB 5BNXA 1P3LB 4Z5TC 1P3KA 1HTAA 1H3OA 3MNNB 1P3BD 4G92B 5B32B 5CPIB 3X1TD 5B1LD 3MGSA 4EO5B 2BYKB 5AVCD 3AZNC 3AZLD 5BT1C 1P3AC 3X1VA 4X23A 3TU4A 3LZ0B 4H9SA 3REHB 3VH5A 5AV6D 1M18A 5B2JA 1KX5A 1P3IB 3MGRC 3WTPD 1M1AC 5CHLB 4J8UC 5DNMA 5AV8D 3LJAA 3WAAB 5JRGD 3W99C 5B0YB 1P3GB 4J8XC 3AYWC 2NZDC 2AROD 4H9OA 1N1JB 5CPKD 3KSYA 3UTBC 3R45B 4XZQC 3AV2C 3AZEB 3AZMB 4YS3B 5GT0A 1P3OC 4WU9B 4Z2MH 2F8NB 1ID3A 3UTAA 5AV5C 1U35A 3AZND 3KWQC 4Z66B 5BT1D 5B24A 1TZYD 3O62D 5CPJB 1P3AD 3REKB 4KGCB 5B31A 4G91C 3W97A 4LD9D 1ZLAB 1R4VA 3B0CW 4X23C 4H9PB 3TU4C 3MGRD 3LELC 3X1UD 1M18C 1M1AD 3REJD 1P3BB 4J8UD 3X1SA 5B1LB 3AZFA 3LJAC 4J8XD 3AYWD 5AVCB 3VH5T 3WA9A 3UTBD 5AY8C 1P3OD 3WTPB 3AV1A 2L5AA 3W98C 3AN2A 5AV5D 2CWEA 5JRGB 3KWQD 2F8NH 3W96C 2PYOA 3C1CC 5B24C 2AROB 5B31C 3REID 3LELD 4Z5TB 3LZ1C 4E44A 4ZUXA 3RELA 3AZNB 4R8PA 3AZFC 1P3AB 2RVQD 5G49B 3NQJB 1JFIB 4LD9B 5AY8D 1P3LD 3MGRB 4CAYA 3X1UB 3A6NA 1M1AB 3W98D 5B0ZA 3REJB 5CPID 4XUJA 4J8UB 4QLCA 4YM6A 5B2ID 5JA4B 1KU5A 3AN2C 3AZIC 3W96D 4J8XB 3AYWB 3AZKA 3C1CD 3UTBB 4XZQB 3AV2B 1F66A 4KUDA 3LZ1D 1KX3A 3UT9A 5DNNA 5AVBD 1P3OB 2CV5A 5GT3A 3WAAD 2HIOA 3AZGC 5AV5B 3AZJA 3KWQB 3AZFD 4AWLC 3RELC 4G91B 1A7WA 2NQBA 3AZMD 2YFVA 3REIB 3LELB 3TU4B 4HGAC 3AZHA 5AV9D 5CP6A 5B40C 3A6NC 5E5AC 4XUJC 4QLCC 4YM6C 3LJAB 3AZID 4H9RB 2FJ7A 3MGPA 3AZKC 4J8WA 5AY8B 4J8VA 5DNNC 3W98B 3AZGD 2CV5C 1P3PD 1P3MA 3B6GA 5B2IB 3KXBA 4WNNA 5GXQD 1HQ3C 4WZSB 3W96B 4KHAA 3C1CB 1M19C 5B24B 1BH8B 3AFAA 5B31B 1EQZA 5KDMA 5B40D 3LZ1B 3AZHC 5AVBB 5E5AD 3KUYA 3C1BC 2IO5C 4JJNC 4QLCD 3VH6W 3AZFB 3MVDC 3MGQA 1P3FC 1AOIA 5F99C 4Z5TD 5B1MC 1TAFB 5AV9B 1P3KC 2JSSA 4CSRB 3B6FA 1HQ3D 3AZIB 3MGSC 1P3MC 3KXBC 1M19D 5GSUA 5B33A 3X1VC 4WU8A 5BO0B 1EQZC 4H9SC 1KX5C 5B2JC 3C1BD 4JJND 3AZGB 3KUYC 3W99D 1P3PB 5DNMC 3MNNA 1BH9A 5GXQB 3MVDD 2NZDD 3RELB 1P3FD 4XZQD 3AV2D 2BYKA 5F99D 3MGQC 5B1MD 4HGAB 3NQUB 5B40B 1P3KD 4CAYB 5GT0C 3LZ0A 3REHA 5E5AB 5BNVB 1P3IA 1BFMA 4XUJB 4QLCB 4YM6B 3MGSD 1ID3C 3UTAC 1KX4A 3B6FC 1U35C 3X1VD 4X23D 3W97C 3TU4D 5GSUC 5B0YA 5B33C 1P3GA 4WU8C 1M18D 5B2JD 1KX5D 1N1JA 4Z2MG 3R45A 3AZEA 5DNMD 3LJAD 2F8NA 4WU9A 1HQ3B 3X1SC 4ZBJC 4G92C 1M19B 5B32G 3WA9C 4Z66A 5CPJA 1F1EA 3REKA 2YFVB 3AZHB 5GT0D 1ZLAA 3C1BB 2IO5B 4JJNB 3AV1C 1ID3D 3UTAD 3W99B 1P3BA 1U35D 3MVDB 2NZDB 5B24D 1KX4C 3X1TA 5B31D 5B1LA 3W97D 5GSUD 1P3FB 2PYOC 4H9QA 5F99B 5B1MB 5AVCA 1S32A 4UUZB 3AZLA 5B0YC 4M6BA 5BNXB 1P3KB 1H3OB 5AV6A 4ZUXC 3WTPA 3X1SD 3MGSB 1P3MB 2F8NG 3KXBB 4R8PC 5AV8A 3WA9D 5JRGA 3X1VB 4X23B 4NFTA 1EQZB 1KX5B 1M18B 5B2JB 3AV1D 5CPKA 3V9RA 5B0ZC 3AN2D 5DNMB 2PYOD 4H9OB 3MGQB 3AZNA 3X1TC 1P3AA 1TZYA 3O62A 1F66C 1S32C 1JFIA 3AZLC 1KX3C 3UT9C 4KUDC 5GT0B 4LD9A 4ZUXD 5GT3C 3MGRA 3X1UA 1ID3B 2HIOC 3UTAB 5AV6C 1M1AA 3WKJA 3REJA 3RELD 3AZJC 1U35B 4J8UA 4R8PD 3B0DC 5JA4A 3W97B 5GSUB 5B33B 5AV8C 3AYWA 2NQBC 4WU8B 3B0CT
chains in the Genus database with same CATH superfamily
3UTBA 3A6ND 5CP6C 5B0ZD 5CPKC 4XUJD 4YM6D 1P3OA 3X1SB 4ZBJB 3EG5B 1BH9B 2BYMA 3AZKD 5AV5A 1P34A 2FJ7C 3WA9B 3KWQA 3MGPC 1F66D 1S32D 4KUDD 4J8WC 1KX3D 3UT9D 5DNND 1TZYC 3O62C 4J8VC 2CV5D 3AV1B 5GT3D 3LELA 3REIA 4LD9C 2HIOD 3AN2B 2YFWA 4H9NA 1Q9CA 3AZJD 4UPKA 3B6GC 3X1UC 1KX4B 3WKJC 1B67A 3REJC 2PYOB 1B6WA 2NQBD 4H9RA 3AFAC 3AZHD 5CP6D 5AY8A 5FUGA 4ZUXB 1P3LA 3EPHA 4AWLB 2DF4C 3W98A 5B32A 5CPIA 2FJ7D 4R8PB 5B2IA 3MGPD 1P34C 3A1IA 3W96A 4J8WD 1AOIC 3C1CA 1BH8A 4J8VD 1WWIA 3A6NB 2J8PA 5B0ZB 3LZ1A 5AVBA 3REIC 1P3MD 3B6GD 2HUEC 3KXBD 4NE6A 5C3IC 3WKJD 3WAAA 3AZKB 3AFAD 3X1TB 1EQZD 4H9QB 1F66B 1S32B 4KUDB 3AZLB 1KX3B 3UT9B 5DNNB 2RVQC 3AZMA 2CV5B 5GT3B 3KUYD 4YS3A 1TAFA 2HIOB 5AV9A 4DRBA 5BS7A 5AV6B 1P3LC 4NE5A 3AZJB 4DRAA 4CSRA 3MNNC 3B0DB 5CPIC 5B32C 3MGQD 1P34D 3AZIA 5AV8B 3VH6A 2NQBB 4EO5C 5B2IC 1AOID 4KGCA 1ULYA 5CP6B 3KFUG 5BO0A 4H9PA 5B31G 5CPKB 3LZ0C 3REHC 3V9RB 1P3IC 3B6FD 5AVBC 3AZGA 2FJ7B 1P3PA 2ZY2A 3WAAC 5B33D 3MGPB 5GXQA 3VH5W 4WU8D 4J8WB 1P3GC 1TZYB 3O62B 4J8VB 2F8NK 2Y2OA 3NQUA 2LY8A 5B40A 4WV4B 3AZEC 3AZMC 4YS3C 3B6GB 3MNND 4WNNB 5AV9C 5E5AA 5BNVA 5BS7C 4WU9C 3WKJB 5B32D 4KHAB 3AFAB 5KDMB 4Z66C 5CPJC 2AROA 4KGCC 3REKC 3LZ0D 3REHD 4Z5TA 1ZLAC 3KUYB 3B0BA 1P3ID 2UWXA 3WTPE 3VH6T 1KX4D 1P3BC 2BYMB 1HQ3A 4E45A 1P34B 1P3PC 5B1LC 1W2EA 1T3UA 5B0YD 1P3GD 5GXQC 1M19A 5G49A 3NQJA 1AOIB 5AVCC 3EPJA 1WWSA 3AZED 2Y2JA 4YS3D 4NE3A 2HUEB 2F8ND 4WU9D 3B6FB 3WTPC 2YFWB 4H9NB 5C3IB 3C1BA 4JJNA 3W99A 3F6TA 3MVDA 5JRGC 4J8XA 2NZDA 4Z66D 5CPJD 4KGCD 3REKD 3EPKA 1P3FA 4XZQA 3AV2A 5F99A 2AROC 3P5JB 5B1MA 1ZLAD 4UUZA 5FUGB 5BNXA 1P3LB 4Z5TC 1P3KA 1HTAA 1H3OA 3MNNB 1P3BD 4G92B 5B32B 5CPIB 3X1TD 5B1LD 3MGSA 4EO5B 2Y2PA 2BYKB 5AVCD 3AZNC 3AZLD 2F2AC 5BT1C 1P3AC 3X1VA 4X23A 3TU4A 3LZ0B 4H9SA 3REHB 3VH5A 5AV6D 1M18A 5B2JA 1KX5A 1P3IB 3MGRC 3WTPD 2RIQA 1M1AC 5CHLB 4J8UC 5DNMA 5AV8D 3LJAA 3WAAB 5JRGD 3W99C 5B0YB 1P3GB 4J8XC 3AYWC 2NZDC 2AROD 4H9OA 1N1JB 5CPKD 3KSYA 3UTBC 3R45B 4XZQC 3AV2C 3AZEB 3AZMB 4YS3B 5GT0A 1P3OC 4WU9B 4Z2MH 2F8NB 2Y2LA 1ID3A 2JE5A 3UTAA 5AV5C 1U35A 3AZND 3KWQC 4Z66B 5BT1D 5B24A 1TZYD 3O62D 5CPJB 3H0LC 3REKB 1P3AD 5B31A 4G91C 3W97A 4KGCB 4LD9D 1ZLAB 1R4VA 3B0CW 4X23C 3H0RC 4H9PB 3TU4C 3MGRD 3LELC 3X1UD 1M18C 1M1AD 3REJD 1P3BB 4J8UD 3X1SA 5B1LB 3AZFA 3LJAC 4J8XD 3AYWD 5AVCB 3VH5T 3WA9A 3UTBD 5AY8C 1P3OD 3WTPB 3AV1A 3AL0C 2L5AA 3W98C 3AN2A 5AV5D 2CWEA 5JRGB 3KWQD 2F8NH 3W96C 2PYOA 3C1CC 5B24C 2AROB 5B31C 3REID 3LELD 4Z5TB 3LZ1C 4E44A 4ZUXA 3RELA 3AZNB 2Y2HA 4R8PA 3AZFC 1P3AB 2RVQD 2G5IC 3NQJB 5G49B 1JFIB 4LD9B 5AY8D 1P3LD 3MGRB 4CAYA 3X1UB 3A6NA 1M1AB 3W98D 5B0ZA 3REJB 5CPID 4XUJA 4J8UB 4QLCA 4YM6A 5B2ID 5JA4B 1KU5A 3AN2C 3AZIC 3W96D 4J8XB 3AYWB 3AZKA 3C1CD 3UTBB 4XZQB 3AV2B 1F66A 4KUDA 3LZ1D 1KX3A 2Y2IA 3UT9A 5DNNA 5AVBD 1P3OB 2CV5A 5GT3A 3WAAD 2Y2QA 2HIOA 3AZGC 2G5HC 5AV5B 3AZJA 3KWQB 3AZFD 4AWLC 3RELC 4G91B 1A7WA 2NQBA 3AZMD 2YFVA 3REIB 3LELB 3TU4B 4HGAC 3AZHA 5AV9D 5CP6A 5B40C 3A6NC 5E5AC 2ZY4A 4XUJC 4QLCC 4YM6C 2FFFB 3LJAB 3AZID 4H9RB 2FJ7A 2Y2MA 3MGPA 3AZKC 3A1KA 4J8WA 5AY8B 4J8VA 5DNNC 2BG1A 3AZGD 2CV5C 3W98B 1P3PD 1P3MA 3B6GA 5B2IB 3KXBA 4WNNA 5GXQD 1HQ3C 2ZY3A 4WZSB 3W96B 4KHAA 3C1CB 1M19C 5B24B 1BH8B 2VQRA 3AFAA 5B31B 1EQZA 2W8SA 5KDMA 5B40D 3LZ1B 3AZHC 5AVBB 5E5AD 3KUYA 3C1BC 2IO5C 4JJNC 4QLCD 3VH6W 3AZFB 3MVDC 3MGQA 1P3FC 1AOIA 5F99C 4Z5TD 5B1MC 2JCHA 1TAFB 5AV9B 1P3KC 2JSSA 4CSRB 2Y2NA 3B6FA 1HQ3D 3H0MC 4WJ3C 3AZIB 3MGSC 1P3MC 3KXBC 1M19D 5GSUA 5B33A 3X1VC 4WU8A 5BO0B 1EQZC 4H9SC 1KX5C 5B2JC 3C1BD 4JJND 3AZGB 3KUYC 3W99D 1P3PB 5DNMC 3MNNA 1BH9A 5GXQB 3MVDD 2NZDD 3RELB 1P3FD 2Y2GA 4XZQD 3AV2D 2BYKA 5F99D 3MGQC 5B1MD 4HGAB 3NQUB 5B40B 1P3KD 2Y2KA 4CAYB 5GT0C 3LZ0A 5E5AB 3REHA 5BNVB 1P3IA 1BFMA 4XUJB 4QLCB 4YM6B 3MGSD 1ID3C 3FDDA 3UTAC 1KX4A 3B6FC 1U35C 3X1VD 4X23D 3W97C 3TU4D 5GSUC 5B0YA 5B33C 1P3GA 2ZY5A 4WU8C 1M18D 5B2JD 1KX5D 1N1JA 4Z2MG 3R45A 3AZEA 5DNMD 3LJAD 2F8NA 4WU9A 1HQ3B 3X1SC 4ZBJC 4G92C 1M19B 5B32G 3WA9C 1Z2CB 4Z66A 5CPJA 1F1EA 3REKA 2YFVB 3AZHB 5GT0D 1ZLAA 3C1BB 2IO5B 4JJNB 3AV1C 1ID3D 3UTAD 3W99B 1P3BA 1U35D 3MVDB 2NZDB 5B24D 1KX4C 3X1TA 5B31D 5B1LA 3W97D 3IP4C 5GSUD 1P3FB 2PYOC 4H9QA 5F99B 5B1MB 5AVCA 1S32A 4UUZB 2XD1A 1PZRA 3AZLA 5B0YC 4M6BA 5BNXB 1P3KB 1H3OB 5AV6A 4ZUXC 3WTPA 3X1SD 3EPLA 3MGSB 1P3MB 2F8NG 3KXBB 4R8PC 5AV8A 3WA9D 5JRGA 3X1VB 4X23B 4NFTA 1EQZB 2ZM5A 1KX5B 1M18B 5B2JB 3AV1D 5CPKA 3V9RA 5B0ZC 3AN2D 5DNMB 2PYOD 4H9OB 3MGQB 3AZNA 3X1TC 1P3AA 1TZYA 3O62A 2DQNC 1F66C 1S32C 1JFIA 3AZLC 1KX3C 3UT9C 4KUDC 5GT0B 4LD9A 4ZUXD 5GT3C 3MGRA 3X1UA 1ID3B 2HIOC 3UTAB 5AV6C 1M1AA 3WKJA 3REJA 3RELD 3AZJC 1U35B 4J8UA 4R8PD 3B0DC 5JA4A 4DQYB 3W97B 5GSUB 5B33B 5AV8C 2XD5A 3AYWA 2NQBC 4WU8B 3B0CT
chains in the Genus database with same CATH topology
3UTBA 3A6ND 5CP6C 5B0ZD 5CPKC 4XUJD 4YM6D 1P3OA 3X1SB 4ZBJB 3EG5B 1BH9B 2BYMA 3AZKD 5AV5A 1P34A 2FJ7C 3WA9B 3KWQA 3MGPC 1F66D 1S32D 4KUDD 4J8WC 1KX3D 3UT9D 5DNND 1TZYC 3O62C 4J8VC 2CV5D 3AV1B 5GT3D 3LELA 3REIA 4LD9C 2HIOD 3AN2B 2YFWA 4H9NA 1Q9CA 3AZJD 4UPKA 3B6GC 3X1UC 1KX4B 3WKJC 1B67A 3REJC 2PYOB 1B6WA 2NQBD 4H9RA 3AFAC 3AZHD 5CP6D 5AY8A 5FUGA 4ZUXB 1P3LA 3EPHA 4AWLB 2DF4C 3W98A 5B32A 5CPIA 2FJ7D 4R8PB 5B2IA 3MGPD 1P34C 3A1IA 3W96A 4J8WD 1AOIC 3C1CA 1BH8A 4J8VD 1WWIA 3A6NB 2J8PA 5B0ZB 3LZ1A 5AVBA 3REIC 1P3MD 3B6GD 2HUEC 3KXBD 4NE6A 5C3IC 3WKJD 3WAAA 3AZKB 3AFAD 3X1TB 1EQZD 4H9QB 1F66B 1S32B 4KUDB 3AZLB 1KX3B 3UT9B 5DNNB 2RVQC 3AZMA 2CV5B 5GT3B 3KUYD 4YS3A 1TAFA 2HIOB 5AV9A 4DRBA 5BS7A 5AV6B 1P3LC 4NE5A 3AZJB 4DRAA 4CSRA 3MNNC 3B0DB 5CPIC 5B32C 3MGQD 1P34D 3AZIA 5AV8B 3VH6A 2NQBB 4EO5C 5B2IC 1AOID 4KGCA 1ULYA 5CP6B 3KFUG 5BO0A 4H9PA 5B31G 5CPKB 3LZ0C 3REHC 3V9RB 1P3IC 3B6FD 5AVBC 3AZGA 2FJ7B 1P3PA 2ZY2A 3WAAC 5B33D 3MGPB 5GXQA 3VH5W 4WU8D 4J8WB 1P3GC 1TZYB 3O62B 4J8VB 2F8NK 2Y2OA 3NQUA 2LY8A 5B40A 4WV4B 3AZEC 3AZMC 4YS3C 3B6GB 3MNND 4WNNB 5AV9C 5E5AA 5BNVA 5BS7C 4WU9C 3WKJB 5B32D 4KHAB 3AFAB 5KDMB 4Z66C 5CPJC 2AROA 4KGCC 3REKC 3LZ0D 3REHD 4Z5TA 1ZLAC 3KUYB 3B0BA 1P3ID 2UWXA 3WTPE 3VH6T 1KX4D 1P3BC 2BYMB 1HQ3A 4E45A 1P34B 1P3PC 5B1LC 1W2EA 1T3UA 5B0YD 1P3GD 5GXQC 1M19A 5G49A 3NQJA 1AOIB 5AVCC 3EPJA 1WWSA 3AZED 2Y2JA 4YS3D 4NE3A 2HUEB 2F8ND 4WU9D 3B6FB 3WTPC 2YFWB 4H9NB 5C3IB 3C1BA 4JJNA 3W99A 3F6TA 3MVDA 5JRGC 4J8XA 2NZDA 4Z66D 5CPJD 4KGCD 3REKD 3EPKA 1P3FA 4XZQA 3AV2A 5F99A 2AROC 3P5JB 5B1MA 1ZLAD 4UUZA 5FUGB 5BNXA 1P3LB 4Z5TC 1P3KA 1HTAA 1H3OA 3MNNB 1P3BD 4G92B 5B32B 5CPIB 3X1TD 5B1LD 3MGSA 4EO5B 2Y2PA 2BYKB 5AVCD 3AZNC 3AZLD 2F2AC 5BT1C 1P3AC 3X1VA 4X23A 3TU4A 3LZ0B 4H9SA 3REHB 3VH5A 5AV6D 1M18A 5B2JA 1KX5A 1P3IB 3MGRC 3WTPD 2RIQA 1M1AC 5CHLB 4J8UC 5DNMA 5AV8D 3LJAA 3WAAB 5JRGD 3W99C 5B0YB 1P3GB 4J8XC 3AYWC 2NZDC 2AROD 4H9OA 1N1JB 5CPKD 3KSYA 3UTBC 3R45B 4XZQC 3AV2C 3AZEB 3AZMB 4YS3B 5GT0A 1P3OC 4WU9B 4Z2MH 2F8NB 2Y2LA 1ID3A 2JE5A 3UTAA 5AV5C 1U35A 3AZND 3KWQC 4Z66B 5BT1D 5B24A 1TZYD 3O62D 5CPJB 3H0LC 3REKB 1P3AD 5B31A 4G91C 3W97A 4KGCB 4LD9D 1ZLAB 1R4VA 3B0CW 4X23C 3H0RC 4H9PB 3TU4C 3MGRD 3LELC 3X1UD 1M18C 1M1AD 3REJD 1P3BB 4J8UD 3X1SA 5B1LB 3AZFA 3LJAC 4J8XD 3AYWD 5AVCB 3VH5T 3WA9A 3UTBD 5AY8C 1P3OD 3WTPB 3AV1A 3AL0C 2L5AA 3W98C 3AN2A 5AV5D 2CWEA 5JRGB 3KWQD 2F8NH 3W96C 2PYOA 3C1CC 5B24C 2AROB 5B31C 3REID 3LELD 4Z5TB 3LZ1C 4E44A 4ZUXA 3RELA 3AZNB 2Y2HA 4R8PA 3AZFC 1P3AB 2RVQD 2G5IC 3NQJB 5G49B 1JFIB 4LD9B 5AY8D 1P3LD 3MGRB 4CAYA 3X1UB 3A6NA 1M1AB 3W98D 5B0ZA 3REJB 5CPID 4XUJA 4J8UB 4QLCA 4YM6A 5B2ID 5JA4B 1KU5A 3AN2C 3AZIC 3W96D 4J8XB 3AYWB 3AZKA 3C1CD 3UTBB 4XZQB 3AV2B 1F66A 4KUDA 3LZ1D 1KX3A 2Y2IA 3UT9A 5DNNA 5AVBD 1P3OB 2CV5A 5GT3A 3WAAD 2Y2QA 2HIOA 3AZGC 2G5HC 5AV5B 3AZJA 3KWQB 3AZFD 4AWLC 3RELC 4G91B 1A7WA 2NQBA 3AZMD 2YFVA 3REIB 3LELB 3TU4B 4HGAC 3AZHA 5AV9D 5CP6A 5B40C 3A6NC 5E5AC 2ZY4A 4XUJC 4QLCC 4YM6C 2FFFB 3LJAB 3AZID 4H9RB 2FJ7A 2Y2MA 3MGPA 3AZKC 3A1KA 4J8WA 5AY8B 4J8VA 5DNNC 2BG1A 3AZGD 2CV5C 3W98B 1P3PD 1P3MA 3B6GA 5B2IB 3KXBA 4WNNA 5GXQD 1HQ3C 2ZY3A 4WZSB 3W96B 4KHAA 3C1CB 1M19C 5B24B 1BH8B 2VQRA 3AFAA 5B31B 1EQZA 2W8SA 5KDMA 5B40D 3LZ1B 3AZHC 5AVBB 5E5AD 3KUYA 3C1BC 2IO5C 4JJNC 4QLCD 3VH6W 3AZFB 3MVDC 3MGQA 1P3FC 1AOIA 5F99C 4Z5TD 5B1MC 2JCHA 1TAFB 5AV9B 1P3KC 2JSSA 4CSRB 2Y2NA 3B6FA 1HQ3D 3H0MC 4WJ3C 3AZIB 3MGSC 1P3MC 3KXBC 1M19D 5GSUA 5B33A 3X1VC 4WU8A 5BO0B 1EQZC 4H9SC 1KX5C 5B2JC 3C1BD 4JJND 3AZGB 3KUYC 3W99D 1P3PB 5DNMC 3MNNA 1BH9A 5GXQB 3MVDD 2NZDD 3RELB 1P3FD 2Y2GA 4XZQD 3AV2D 2BYKA 5F99D 3MGQC 5B1MD 4HGAB 3NQUB 5B40B 1P3KD 2Y2KA 4CAYB 5GT0C 3LZ0A 5E5AB 3REHA 5BNVB 1P3IA 1BFMA 4XUJB 4QLCB 4YM6B 3MGSD 1ID3C 3FDDA 3UTAC 1KX4A 3B6FC 1U35C 3X1VD 4X23D 3W97C 3TU4D 5GSUC 5B0YA 5B33C 1P3GA 2ZY5A 4WU8C 1M18D 5B2JD 1KX5D 1N1JA 4Z2MG 3R45A 3AZEA 5DNMD 3LJAD 2F8NA 4WU9A 1HQ3B 3X1SC 4ZBJC 4G92C 1M19B 5B32G 3WA9C 1Z2CB 4Z66A 5CPJA 1F1EA 3REKA 2YFVB 3AZHB 5GT0D 1ZLAA 3C1BB 2IO5B 4JJNB 3AV1C 1ID3D 3UTAD 3W99B 1P3BA 1U35D 3MVDB 2NZDB 5B24D 1KX4C 3X1TA 5B31D 5B1LA 3W97D 3IP4C 5GSUD 1P3FB 2PYOC 4H9QA 5F99B 5B1MB 5AVCA 1S32A 4UUZB 2XD1A 1PZRA 3AZLA 5B0YC 4M6BA 5BNXB 1P3KB 1H3OB 5AV6A 4ZUXC 3WTPA 3X1SD 3EPLA 3MGSB 1P3MB 2F8NG 3KXBB 4R8PC 5AV8A 3WA9D 5JRGA 3X1VB 4X23B 4NFTA 1EQZB 2ZM5A 1KX5B 1M18B 5B2JB 3AV1D 5CPKA 3V9RA 5B0ZC 3AN2D 5DNMB 2PYOD 4H9OB 3MGQB 3AZNA 3X1TC 1P3AA 1TZYA 3O62A 2DQNC 1F66C 1S32C 1JFIA 3AZLC 1KX3C 3UT9C 4KUDC 5GT0B 4LD9A 4ZUXD 5GT3C 3MGRA 3X1UA 1ID3B 2HIOC 3UTAB 5AV6C 1M1AA 3WKJA 3REJA 3RELD 3AZJC 1U35B 4J8UA 4R8PD 3B0DC 5JA4A 4DQYB 3W97B 5GSUB 5B33B 5AV8C 2XD5A 3AYWA 2NQBC 4WU8B 3B0CT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB A;  3A6N D;  5CP6 C;  5B0Z D;  5CPK C;  4XUJ D;  4YM6 D;  1P3O A;  3X1S B;  4ZBJ B;  1BH9 B;  2BYM A;  3AZK D;  5AV5 A;  1P34 A;  2FJ7 C;  3WA9 B;  3KWQ A;  3MGP C;  1F66 D;  1S32 D;  4KUD D;  4J8W C;  1KX3 D;  3UT9 D;  5DNN D;  1TZY C;  3O62 C;  4J8V C;  2CV5 D;  3AV1 B;  5GT3 D;  3LEL A;  3REI A;  4LD9 C;  2HIO D;  3AN2 B;  2YFW A;  4H9N A;  1Q9C A;  3AZJ D;  3B6G C;  3X1U C;  1KX4 B;  3WKJ C;  1B67 A;  3REJ C;  2PYO B;  1B6W A;  2NQB D;  4H9R A;  3AFA C;  3AZH D;  5CP6 D;  5AY8 A;  5FUG A;  4ZUX B;  1P3L A;  4AWL B;  3W98 A;  5B32 A;  5CPI A;  2FJ7 D;  4R8P B;  5B2I A;  3MGP D;  1P34 C;  3W96 A;  4J8W D;  1AOI C;  3C1C A;  1BH8 A;  4J8V D;  1WWI A;  3A6N B;  5B0Z B;  3LZ1 A;  5AVB A;  3REI C;  1P3M D;  3B6G D;  2HUE C;  3KXB D;  4NE6 A;  5C3I C;  3WKJ D;  3WAA A;  3AZK B;  3AFA D;  3X1T B;  1EQZ D;  4H9Q B;  1F66 B;  1S32 B;  4KUD B;  3AZL B;  1KX3 B;  3UT9 B;  5DNN B;  2RVQ C;  3AZM A;  2CV5 B;  5GT3 B;  3KUY D;  4YS3 A;  1TAF A;  2HIO B;  5AV9 A;  4DRB A;  5BS7 A;  5AV6 B;  1P3L C;  4NE5 A;  3AZJ B;  4DRA A;  4CSR A;  3MNN C;  3B0D B;  5CPI C;  5B32 C;  3MGQ D;  1P34 D;  3AZI A;  5AV8 B;  3VH6 A;  2NQB B;  4EO5 C;  5B2I C;  1AOI D;  4KGC A;  1ULY A;  5CP6 B;  5BO0 A;  4H9P A;  5B31 G;  5CPK B;  3LZ0 C;  3REH C;  3V9R B;  1P3I C;  3B6F D;  5AVB C;  3AZG A;  2FJ7 B;  1P3P A;  3WAA C;  5B33 D;  3MGP B;  5GXQ A;  3VH5 W;  4WU8 D;  4J8W B;  1P3G C;  1TZY B;  3O62 B;  4J8V B;  2F8N K;  3NQU A;  2LY8 A;  5B40 A;  4WV4 B;  3AZE C;  3AZM C;  4YS3 C;  3B6G B;  3MNN D;  4WNN B;  5E5A A;  5BNV A;  5BS7 C;  5AV9 C;  4WU9 C;  3WKJ B;  5B32 D;  4KHA B;  3AFA B;  5KDM B;  4Z66 C;  5CPJ C;  2ARO A;  4KGC C;  3REK C;  3LZ0 D;  3REH D;  4Z5T A;  1ZLA C;  3KUY B;  3B0B A;  1P3I D;  3WTP E;  3VH6 T;  1KX4 D;  1P3B C;  2BYM B;  1HQ3 A;  4E45 A;  1P34 B;  1P3P C;  5B1L C;  5B0Y D;  1AOI B;  1P3G D;  5GXQ C;  1M19 A;  5G49 A;  3NQJ A;  5AVC C;  1WWS A;  3AZE D;  4YS3 D;  4NE3 A;  2HUE B;  2F8N D;  4WU9 D;  3B6F B;  3WTP C;  2YFW B;  4H9N B;  5C3I B;  3C1B A;  4JJN A;  3W99 A;  3MVD A;  5JRG C;  4J8X A;  2NZD A;  4Z66 D;  5CPJ D;  4KGC D;  3REK D;  1P3F A;  4XZQ A;  3AV2 A;  5F99 A;  2ARO C;  5B1M A;  1ZLA D;  4UUZ A;  5FUG B;  5BNX A;  1P3L B;  4Z5T C;  1P3K A;  1HTA A;  1H3O A;  3MNN B;  1P3B D;  4G92 B;  5B32 B;  5CPI B;  3X1T D;  5B1L D;  3MGS A;  4EO5 B;  2BYK B;  5AVC D;  3AZN C;  3AZL D;  5BT1 C;  1P3A C;  3X1V A;  4X23 A;  3TU4 A;  3LZ0 B;  4H9S A;  3REH B;  3VH5 A;  5AV6 D;  1M18 A;  5B2J A;  1KX5 A;  1P3I B;  3MGR C;  3WTP D;  1M1A C;  5CHL B;  4J8U C;  5DNM A;  5AV8 D;  3LJA A;  3WAA B;  5JRG D;  3W99 C;  5B0Y B;  1P3G B;  4J8X C;  3AYW C;  2NZD C;  2ARO D;  4H9O A;  1N1J B;  5CPK D;  3KSY A;  3UTB C;  3R45 B;  4XZQ C;  3AV2 C;  3AZE B;  3AZM B;  4YS3 B;  5GT0 A;  1P3O C;  4WU9 B;  4Z2M H;  2F8N B;  1ID3 A;  3UTA A;  5AV5 C;  1U35 A;  3AZN D;  3KWQ C;  4Z66 B;  5BT1 D;  5B24 A;  1TZY D;  3O62 D;  5CPJ B;  1P3A D;  3REK B;  4KGC B;  5B31 A;  4G91 C;  3W97 A;  4LD9 D;  1ZLA B;  1R4V A;  3B0C W;  4X23 C;  4H9P B;  3TU4 C;  3MGR D;  3LEL C;  3X1U D;  1M18 C;  1M1A D;  3REJ D;  1P3B B;  4J8U D;  3X1S A;  5B1L B;  3AZF A;  3LJA C;  4J8X D;  3AYW D;  5AVC B;  3VH5 T;  3WA9 A;  3UTB D;  5AY8 C;  1P3O D;  3WTP B;  3AV1 A;  2L5A A;  3W98 C;  3AN2 A;  5AV5 D;  2CWE A;  5JRG B;  3KWQ D;  2F8N H;  3W96 C;  2PYO A;  3C1C C;  5B24 C;  2ARO B;  5B31 C;  3REI D;  3LEL D;  4Z5T B;  3LZ1 C;  4E44 A;  4ZUX A;  3REL A;  3AZN B;  4R8P A;  3AZF C;  1P3A B;  2RVQ D;  5G49 B;  3NQJ B;  1JFI B;  4LD9 B;  5AY8 D;  1P3L D;  3MGR B;  4CAY A;  3X1U B;  3A6N A;  1M1A B;  3W98 D;  5B0Z A;  3REJ B;  5CPI D;  4XUJ A;  4J8U B;  4QLC A;  4YM6 A;  5B2I D;  5JA4 B;  1KU5 A;  3AN2 C;  3AZI C;  3W96 D;  4J8X B;  3AYW B;  3AZK A;  3C1C D;  3UTB B;  4XZQ B;  3AV2 B;  1F66 A;  4KUD A;  3LZ1 D;  1KX3 A;  3UT9 A;  5DNN A;  5AVB D;  1P3O B;  2CV5 A;  5GT3 A;  3WAA D;  2HIO A;  3AZG C;  5AV5 B;  3AZJ A;  3KWQ B;  3AZF D;  4AWL C;  3REL C;  4G91 B;  1A7W A;  2NQB A;  3AZM D;  2YFV A;  3REI B;  3LEL B;  3TU4 B;  4HGA C;  3AZH A;  5AV9 D;  5CP6 A;  5B40 C;  3A6N C;  5E5A C;  4XUJ C;  4QLC C;  4YM6 C;  3LJA B;  3AZI D;  4H9R B;  2FJ7 A;  3MGP A;  3AZK C;  4J8W A;  5AY8 B;  4J8V A;  5DNN C;  3W98 B;  3AZG D;  2CV5 C;  1P3P D;  1P3M A;  3B6G A;  5B2I B;  3KXB A;  4WNN A;  5GXQ D;  1HQ3 C;  4WZS B;  3W96 B;  4KHA A;  3C1C B;  1M19 C;  5B24 B;  1BH8 B;  3AFA A;  5B31 B;  1EQZ A;  5KDM A;  5B40 D;  3LZ1 B;  3AZH C;  5AVB B;  5E5A D;  3KUY A;  3C1B C;  2IO5 C;  4JJN C;  4QLC D;  3VH6 W;  3AZF B;  3MVD C;  3MGQ A;  1P3F C;  1AOI A;  5F99 C;  4Z5T D;  5B1M C;  1TAF B;  5AV9 B;  1P3K C;  2JSS A;  4CSR B;  3B6F A;  1HQ3 D;  3AZI B;  3MGS C;  1P3M C;  3KXB C;  1M19 D;  5GSU A;  5B33 A;  3X1V C;  4WU8 A;  5BO0 B;  1EQZ C;  4H9S C;  1KX5 C;  5B2J C;  3C1B D;  4JJN D;  3AZG B;  3KUY C;  3W99 D;  1P3P B;  5DNM C;  3MNN A;  1BH9 A;  5GXQ B;  3MVD D;  2NZD D;  3REL B;  1P3F D;  4XZQ D;  3AV2 D;  2BYK A;  5F99 D;  3MGQ C;  5B1M D;  4HGA B;  3NQU B;  5B40 B;  1P3K D;  4CAY B;  5GT0 C;  3LZ0 A;  3REH A;  5E5A B;  5BNV B;  1P3I A;  1BFM A;  4XUJ B;  4QLC B;  4YM6 B;  3MGS D;  1ID3 C;  3UTA C;  1KX4 A;  3B6F C;  1U35 C;  3X1V D;  4X23 D;  3W97 C;  3TU4 D;  5GSU C;  5B0Y A;  5B33 C;  1P3G A;  4WU8 C;  1M18 D;  5B2J D;  1KX5 D;  1N1J A;  4Z2M G;  3R45 A;  3AZE A;  5DNM D;  3LJA D;  2F8N A;  4WU9 A;  1HQ3 B;  3X1S C;  4ZBJ C;  4G92 C;  1M19 B;  5B32 G;  3WA9 C;  4Z66 A;  5CPJ A;  1F1E A;  3REK A;  2YFV B;  3AZH B;  5GT0 D;  1ZLA A;  3C1B B;  2IO5 B;  4JJN B;  3AV1 C;  1ID3 D;  3UTA D;  3W99 B;  1P3B A;  1U35 D;  3MVD B;  2NZD B;  5B24 D;  1KX4 C;  3X1T A;  5B31 D;  5B1L A;  3W97 D;  5GSU D;  1P3F B;  2PYO C;  4H9Q A;  5F99 B;  5B1M B;  5AVC A;  1S32 A;  4UUZ B;  3AZL A;  5B0Y C;  4M6B A;  5BNX B;  1P3K B;  1H3O B;  5AV6 A;  4ZUX C;  3WTP A;  3X1S D;  3MGS B;  1P3M B;  2F8N G;  3KXB B;  4R8P C;  5AV8 A;  3WA9 D;  5JRG A;  3X1V B;  4X23 B;  4NFT A;  1EQZ B;  1KX5 B;  1M18 B;  5B2J B;  3AV1 D;  5CPK A;  3V9R A;  5B0Z C;  3AN2 D;  5DNM B;  2PYO D;  4H9O B;  3MGQ B;  3AZN A;  3X1T C;  1P3A A;  1TZY A;  3O62 A;  1F66 C;  1S32 C;  1JFI A;  3AZL C;  1KX3 C;  3UT9 C;  4KUD C;  5GT0 B;  4LD9 A;  4ZUX D;  5GT3 C;  3MGR A;  3X1U A;  1ID3 B;  2HIO C;  3UTA B;  5AV6 C;  1M1A A;  3WKJ A;  3REJ A;  3REL D;  3AZJ C;  1U35 B;  4J8U A;  4R8P D;  3B0D C;  5JA4 A;  3W97 B;  5GSU B;  5B33 B;  5AV8 C;  3AYW A;  2NQB C;  4WU8 B;  3B0C T; 
#chains in the Genus database with same CATH topology
 3UTB A;  3A6N D;  5CP6 C;  5B0Z D;  5CPK C;  4XUJ D;  4YM6 D;  1P3O A;  3X1S B;  4ZBJ B;  3EG5 B;  1BH9 B;  2BYM A;  3AZK D;  5AV5 A;  1P34 A;  2FJ7 C;  3WA9 B;  3KWQ A;  3MGP C;  1F66 D;  1S32 D;  4KUD D;  4J8W C;  1KX3 D;  3UT9 D;  5DNN D;  1TZY C;  3O62 C;  4J8V C;  2CV5 D;  3AV1 B;  5GT3 D;  3LEL A;  3REI A;  4LD9 C;  2HIO D;  3AN2 B;  2YFW A;  4H9N A;  1Q9C A;  3AZJ D;  4UPK A;  3B6G C;  3X1U C;  1KX4 B;  3WKJ C;  1B67 A;  3REJ C;  2PYO B;  1B6W A;  2NQB D;  4H9R A;  3AFA C;  3AZH D;  5CP6 D;  5AY8 A;  5FUG A;  4ZUX B;  1P3L A;  3EPH A;  4AWL B;  2DF4 C;  3W98 A;  5B32 A;  5CPI A;  2FJ7 D;  4R8P B;  5B2I A;  3MGP D;  1P34 C;  3A1I A;  3W96 A;  4J8W D;  1AOI C;  3C1C A;  1BH8 A;  4J8V D;  1WWI A;  3A6N B;  2J8P A;  5B0Z B;  3LZ1 A;  5AVB A;  3REI C;  1P3M D;  3B6G D;  2HUE C;  3KXB D;  4NE6 A;  5C3I C;  3WKJ D;  3WAA A;  3AZK B;  3AFA D;  3X1T B;  1EQZ D;  4H9Q B;  1F66 B;  1S32 B;  4KUD B;  3AZL B;  1KX3 B;  3UT9 B;  5DNN B;  2RVQ C;  3AZM A;  2CV5 B;  5GT3 B;  3KUY D;  4YS3 A;  1TAF A;  2HIO B;  5AV9 A;  4DRB A;  5BS7 A;  5AV6 B;  1P3L C;  4NE5 A;  3AZJ B;  4DRA A;  4CSR A;  3MNN C;  3B0D B;  5CPI C;  5B32 C;  3MGQ D;  1P34 D;  3AZI A;  5AV8 B;  3VH6 A;  2NQB B;  4EO5 C;  5B2I C;  1AOI D;  4KGC A;  1ULY A;  5CP6 B;  3KFU G;  5BO0 A;  4H9P A;  5B31 G;  5CPK B;  3LZ0 C;  3REH C;  3V9R B;  1P3I C;  3B6F D;  5AVB C;  3AZG A;  2FJ7 B;  1P3P A;  2ZY2 A;  3WAA C;  5B33 D;  3MGP B;  5GXQ A;  3VH5 W;  4WU8 D;  4J8W B;  1P3G C;  1TZY B;  3O62 B;  4J8V B;  2F8N K;  2Y2O A;  3NQU A;  2LY8 A;  5B40 A;  4WV4 B;  3AZE C;  3AZM C;  4YS3 C;  3B6G B;  3MNN D;  4WNN B;  5AV9 C;  5E5A A;  5BNV A;  5BS7 C;  4WU9 C;  3WKJ B;  5B32 D;  4KHA B;  3AFA B;  5KDM B;  4Z66 C;  5CPJ C;  2ARO A;  4KGC C;  3REK C;  3LZ0 D;  3REH D;  4Z5T A;  1ZLA C;  3KUY B;  3B0B A;  1P3I D;  2UWX A;  3WTP E;  3VH6 T;  1KX4 D;  1P3B C;  2BYM B;  1HQ3 A;  4E45 A;  1P34 B;  1P3P C;  5B1L C;  1W2E A;  1T3U A;  5B0Y D;  1P3G D;  5GXQ C;  1M19 A;  5G49 A;  3NQJ A;  1AOI B;  5AVC C;  3EPJ A;  1WWS A;  3AZE D;  2Y2J A;  4YS3 D;  4NE3 A;  2HUE B;  2F8N D;  4WU9 D;  3B6F B;  3WTP C;  2YFW B;  4H9N B;  5C3I B;  3C1B A;  4JJN A;  3W99 A;  3F6T A;  3MVD A;  5JRG C;  4J8X A;  2NZD A;  4Z66 D;  5CPJ D;  4KGC D;  3REK D;  3EPK A;  1P3F A;  4XZQ A;  3AV2 A;  5F99 A;  2ARO C;  3P5J B;  5B1M A;  1ZLA D;  4UUZ A;  5FUG B;  5BNX A;  1P3L B;  4Z5T C;  1P3K A;  1HTA A;  1H3O A;  3MNN B;  1P3B D;  4G92 B;  5B32 B;  5CPI B;  3X1T D;  5B1L D;  3MGS A;  4EO5 B;  2Y2P A;  2BYK B;  5AVC D;  3AZN C;  3AZL D;  2F2A C;  5BT1 C;  1P3A C;  3X1V A;  4X23 A;  3TU4 A;  3LZ0 B;  4H9S A;  3REH B;  3VH5 A;  5AV6 D;  1M18 A;  5B2J A;  1KX5 A;  1P3I B;  3MGR C;  3WTP D;  2RIQ A;  1M1A C;  5CHL B;  4J8U C;  5DNM A;  5AV8 D;  3LJA A;  3WAA B;  5JRG D;  3W99 C;  5B0Y B;  1P3G B;  4J8X C;  3AYW C;  2NZD C;  2ARO D;  4H9O A;  1N1J B;  5CPK D;  3KSY A;  3UTB C;  3R45 B;  4XZQ C;  3AV2 C;  3AZE B;  3AZM B;  4YS3 B;  5GT0 A;  1P3O C;  4WU9 B;  4Z2M H;  2F8N B;  2Y2L A;  1ID3 A;  2JE5 A;  3UTA A;  5AV5 C;  1U35 A;  3AZN D;  3KWQ C;  4Z66 B;  5BT1 D;  5B24 A;  1TZY D;  3O62 D;  5CPJ B;  3H0L C;  3REK B;  1P3A D;  5B31 A;  4G91 C;  3W97 A;  4KGC B;  4LD9 D;  1ZLA B;  1R4V A;  3B0C W;  4X23 C;  3H0R C;  4H9P B;  3TU4 C;  3MGR D;  3LEL C;  3X1U D;  1M18 C;  1M1A D;  3REJ D;  1P3B B;  4J8U D;  3X1S A;  5B1L B;  3AZF A;  3LJA C;  4J8X D;  3AYW D;  5AVC B;  3VH5 T;  3WA9 A;  3UTB D;  5AY8 C;  1P3O D;  3WTP B;  3AV1 A;  3AL0 C;  2L5A A;  3W98 C;  3AN2 A;  5AV5 D;  2CWE A;  5JRG B;  3KWQ D;  2F8N H;  3W96 C;  2PYO A;  3C1C C;  5B24 C;  2ARO B;  5B31 C;  3REI D;  3LEL D;  4Z5T B;  3LZ1 C;  4E44 A;  4ZUX A;  3REL A;  3AZN B;  2Y2H A;  4R8P A;  3AZF C;  1P3A B;  2RVQ D;  2G5I C;  3NQJ B;  5G49 B;  1JFI B;  4LD9 B;  5AY8 D;  1P3L D;  3MGR B;  4CAY A;  3X1U B;  3A6N A;  1M1A B;  3W98 D;  5B0Z A;  3REJ B;  5CPI D;  4XUJ A;  4J8U B;  4QLC A;  4YM6 A;  5B2I D;  5JA4 B;  1KU5 A;  3AN2 C;  3AZI C;  3W96 D;  4J8X B;  3AYW B;  3AZK A;  3C1C D;  3UTB B;  4XZQ B;  3AV2 B;  1F66 A;  4KUD A;  3LZ1 D;  1KX3 A;  2Y2I A;  3UT9 A;  5DNN A;  5AVB D;  1P3O B;  2CV5 A;  5GT3 A;  3WAA D;  2Y2Q A;  2HIO A;  3AZG C;  2G5H C;  5AV5 B;  3AZJ A;  3KWQ B;  3AZF D;  4AWL C;  3REL C;  4G91 B;  1A7W A;  2NQB A;  3AZM D;  2YFV A;  3REI B;  3LEL B;  3TU4 B;  4HGA C;  3AZH A;  5AV9 D;  5CP6 A;  5B40 C;  3A6N C;  5E5A C;  2ZY4 A;  4XUJ C;  4QLC C;  4YM6 C;  2FFF B;  3LJA B;  3AZI D;  4H9R B;  2FJ7 A;  2Y2M A;  3MGP A;  3AZK C;  3A1K A;  4J8W A;  5AY8 B;  4J8V A;  5DNN C;  2BG1 A;  3AZG D;  2CV5 C;  3W98 B;  1P3P D;  1P3M A;  3B6G A;  5B2I B;  3KXB A;  4WNN A;  5GXQ D;  1HQ3 C;  2ZY3 A;  4WZS B;  3W96 B;  4KHA A;  3C1C B;  1M19 C;  5B24 B;  1BH8 B;  2VQR A;  3AFA A;  5B31 B;  1EQZ A;  2W8S A;  5KDM A;  5B40 D;  3LZ1 B;  3AZH C;  5AVB B;  5E5A D;  3KUY A;  3C1B C;  2IO5 C;  4JJN C;  4QLC D;  3VH6 W;  3AZF B;  3MVD C;  3MGQ A;  1P3F C;  1AOI A;  5F99 C;  4Z5T D;  5B1M C;  2JCH A;  1TAF B;  5AV9 B;  1P3K C;  2JSS A;  4CSR B;  2Y2N A;  3B6F A;  1HQ3 D;  3H0M C;  4WJ3 C;  3AZI B;  3MGS C;  1P3M C;  3KXB C;  1M19 D;  5GSU A;  5B33 A;  3X1V C;  4WU8 A;  5BO0 B;  1EQZ C;  4H9S C;  1KX5 C;  5B2J C;  3C1B D;  4JJN D;  3AZG B;  3KUY C;  3W99 D;  1P3P B;  5DNM C;  3MNN A;  1BH9 A;  5GXQ B;  3MVD D;  2NZD D;  3REL B;  1P3F D;  2Y2G A;  4XZQ D;  3AV2 D;  2BYK A;  5F99 D;  3MGQ C;  5B1M D;  4HGA B;  3NQU B;  5B40 B;  1P3K D;  2Y2K A;  4CAY B;  5GT0 C;  3LZ0 A;  5E5A B;  3REH A;  5BNV B;  1P3I A;  1BFM A;  4XUJ B;  4QLC B;  4YM6 B;  3MGS D;  1ID3 C;  3FDD A;  3UTA C;  1KX4 A;  3B6F C;  1U35 C;  3X1V D;  4X23 D;  3W97 C;  3TU4 D;  5GSU C;  5B0Y A;  5B33 C;  1P3G A;  2ZY5 A;  4WU8 C;  1M18 D;  5B2J D;  1KX5 D;  1N1J A;  4Z2M G;  3R45 A;  3AZE A;  5DNM D;  3LJA D;  2F8N A;  4WU9 A;  1HQ3 B;  3X1S C;  4ZBJ C;  4G92 C;  1M19 B;  5B32 G;  3WA9 C;  1Z2C B;  4Z66 A;  5CPJ A;  1F1E A;  3REK A;  2YFV B;  3AZH B;  5GT0 D;  1ZLA A;  3C1B B;  2IO5 B;  4JJN B;  3AV1 C;  1ID3 D;  3UTA D;  3W99 B;  1P3B A;  1U35 D;  3MVD B;  2NZD B;  5B24 D;  1KX4 C;  3X1T A;  5B31 D;  5B1L A;  3W97 D;  3IP4 C;  5GSU D;  1P3F B;  2PYO C;  4H9Q A;  5F99 B;  5B1M B;  5AVC A;  1S32 A;  4UUZ B;  2XD1 A;  1PZR A;  3AZL A;  5B0Y C;  4M6B A;  5BNX B;  1P3K B;  1H3O B;  5AV6 A;  4ZUX C;  3WTP A;  3X1S D;  3EPL A;  3MGS B;  1P3M B;  2F8N G;  3KXB B;  4R8P C;  5AV8 A;  3WA9 D;  5JRG A;  3X1V B;  4X23 B;  4NFT A;  1EQZ B;  2ZM5 A;  1KX5 B;  1M18 B;  5B2J B;  3AV1 D;  5CPK A;  3V9R A;  5B0Z C;  3AN2 D;  5DNM B;  2PYO D;  4H9O B;  3MGQ B;  3AZN A;  3X1T C;  1P3A A;  1TZY A;  3O62 A;  2DQN C;  1F66 C;  1S32 C;  1JFI A;  3AZL C;  1KX3 C;  3UT9 C;  4KUD C;  5GT0 B;  4LD9 A;  4ZUX D;  5GT3 C;  3MGR A;  3X1U A;  1ID3 B;  2HIO C;  3UTA B;  5AV6 C;  1M1A A;  3WKJ A;  3REJ A;  3REL D;  3AZJ C;  1U35 B;  4J8U A;  4R8P D;  3B0D C;  5JA4 A;  4DQY B;  3W97 B;  5GSU B;  5B33 B;  5AV8 C;  2XD5 A;  3AYW A;  2NQB C;  4WU8 B;  3B0C T; 
#chains in the Genus database with same CATH homology
 3UTB A;  3A6N D;  5CP6 C;  5B0Z D;  5CPK C;  4XUJ D;  4YM6 D;  1P3O A;  3X1S B;  4ZBJ B;  3EG5 B;  1BH9 B;  2BYM A;  3AZK D;  5AV5 A;  1P34 A;  2FJ7 C;  3WA9 B;  3KWQ A;  3MGP C;  1F66 D;  1S32 D;  4KUD D;  4J8W C;  1KX3 D;  3UT9 D;  5DNN D;  1TZY C;  3O62 C;  4J8V C;  2CV5 D;  3AV1 B;  5GT3 D;  3LEL A;  3REI A;  4LD9 C;  2HIO D;  3AN2 B;  2YFW A;  4H9N A;  1Q9C A;  3AZJ D;  4UPK A;  3B6G C;  3X1U C;  1KX4 B;  3WKJ C;  1B67 A;  3REJ C;  2PYO B;  1B6W A;  2NQB D;  4H9R A;  3AFA C;  3AZH D;  5CP6 D;  5AY8 A;  5FUG A;  4ZUX B;  1P3L A;  3EPH A;  4AWL B;  2DF4 C;  3W98 A;  5B32 A;  5CPI A;  2FJ7 D;  4R8P B;  5B2I A;  3MGP D;  1P34 C;  3A1I A;  3W96 A;  4J8W D;  1AOI C;  3C1C A;  1BH8 A;  4J8V D;  1WWI A;  3A6N B;  2J8P A;  5B0Z B;  3LZ1 A;  5AVB A;  3REI C;  1P3M D;  3B6G D;  2HUE C;  3KXB D;  4NE6 A;  5C3I C;  3WKJ D;  3WAA A;  3AZK B;  3AFA D;  3X1T B;  1EQZ D;  4H9Q B;  1F66 B;  1S32 B;  4KUD B;  3AZL B;  1KX3 B;  3UT9 B;  5DNN B;  2RVQ C;  3AZM A;  2CV5 B;  5GT3 B;  3KUY D;  4YS3 A;  1TAF A;  2HIO B;  5AV9 A;  4DRB A;  5BS7 A;  5AV6 B;  1P3L C;  4NE5 A;  3AZJ B;  4DRA A;  4CSR A;  3MNN C;  3B0D B;  5CPI C;  5B32 C;  3MGQ D;  1P34 D;  3AZI A;  5AV8 B;  3VH6 A;  2NQB B;  4EO5 C;  5B2I C;  1AOI D;  4KGC A;  1ULY A;  5CP6 B;  3KFU G;  5BO0 A;  4H9P A;  5B31 G;  5CPK B;  3LZ0 C;  3REH C;  3V9R B;  1P3I C;  3B6F D;  5AVB C;  3AZG A;  2FJ7 B;  1P3P A;  2ZY2 A;  3WAA C;  5B33 D;  3MGP B;  5GXQ A;  3VH5 W;  4WU8 D;  4J8W B;  1P3G C;  1TZY B;  3O62 B;  4J8V B;  2F8N K;  2Y2O A;  3NQU A;  2LY8 A;  5B40 A;  4WV4 B;  3AZE C;  3AZM C;  4YS3 C;  3B6G B;  3MNN D;  4WNN B;  5AV9 C;  5E5A A;  5BNV A;  5BS7 C;  4WU9 C;  3WKJ B;  5B32 D;  4KHA B;  3AFA B;  5KDM B;  4Z66 C;  5CPJ C;  2ARO A;  4KGC C;  3REK C;  3LZ0 D;  3REH D;  4Z5T A;  1ZLA C;  3KUY B;  3B0B A;  1P3I D;  2UWX A;  3WTP E;  3VH6 T;  1KX4 D;  1P3B C;  2BYM B;  1HQ3 A;  4E45 A;  1P34 B;  1P3P C;  5B1L C;  1W2E A;  1T3U A;  5B0Y D;  1P3G D;  5GXQ C;  1M19 A;  5G49 A;  3NQJ A;  1AOI B;  5AVC C;  3EPJ A;  1WWS A;  3AZE D;  2Y2J A;  4YS3 D;  4NE3 A;  2HUE B;  2F8N D;  4WU9 D;  3B6F B;  3WTP C;  2YFW B;  4H9N B;  5C3I B;  3C1B A;  4JJN A;  3W99 A;  3F6T A;  3MVD A;  5JRG C;  4J8X A;  2NZD A;  4Z66 D;  5CPJ D;  4KGC D;  3REK D;  3EPK A;  1P3F A;  4XZQ A;  3AV2 A;  5F99 A;  2ARO C;  3P5J B;  5B1M A;  1ZLA D;  4UUZ A;  5FUG B;  5BNX A;  1P3L B;  4Z5T C;  1P3K A;  1HTA A;  1H3O A;  3MNN B;  1P3B D;  4G92 B;  5B32 B;  5CPI B;  3X1T D;  5B1L D;  3MGS A;  4EO5 B;  2Y2P A;  2BYK B;  5AVC D;  3AZN C;  3AZL D;  2F2A C;  5BT1 C;  1P3A C;  3X1V A;  4X23 A;  3TU4 A;  3LZ0 B;  4H9S A;  3REH B;  3VH5 A;  5AV6 D;  1M18 A;  5B2J A;  1KX5 A;  1P3I B;  3MGR C;  3WTP D;  2RIQ A;  1M1A C;  5CHL B;  4J8U C;  5DNM A;  5AV8 D;  3LJA A;  3WAA B;  5JRG D;  3W99 C;  5B0Y B;  1P3G B;  4J8X C;  3AYW C;  2NZD C;  2ARO D;  4H9O A;  1N1J B;  5CPK D;  3KSY A;  3UTB C;  3R45 B;  4XZQ C;  3AV2 C;  3AZE B;  3AZM B;  4YS3 B;  5GT0 A;  1P3O C;  4WU9 B;  4Z2M H;  2F8N B;  2Y2L A;  1ID3 A;  2JE5 A;  3UTA A;  5AV5 C;  1U35 A;  3AZN D;  3KWQ C;  4Z66 B;  5BT1 D;  5B24 A;  1TZY D;  3O62 D;  5CPJ B;  3H0L C;  3REK B;  1P3A D;  5B31 A;  4G91 C;  3W97 A;  4KGC B;  4LD9 D;  1ZLA B;  1R4V A;  3B0C W;  4X23 C;  3H0R C;  4H9P B;  3TU4 C;  3MGR D;  3LEL C;  3X1U D;  1M18 C;  1M1A D;  3REJ D;  1P3B B;  4J8U D;  3X1S A;  5B1L B;  3AZF A;  3LJA C;  4J8X D;  3AYW D;  5AVC B;  3VH5 T;  3WA9 A;  3UTB D;  5AY8 C;  1P3O D;  3WTP B;  3AV1 A;  3AL0 C;  2L5A A;  3W98 C;  3AN2 A;  5AV5 D;  2CWE A;  5JRG B;  3KWQ D;  2F8N H;  3W96 C;  2PYO A;  3C1C C;  5B24 C;  2ARO B;  5B31 C;  3REI D;  3LEL D;  4Z5T B;  3LZ1 C;  4E44 A;  4ZUX A;  3REL A;  3AZN B;  2Y2H A;  4R8P A;  3AZF C;  1P3A B;  2RVQ D;  2G5I C;  3NQJ B;  5G49 B;  1JFI B;  4LD9 B;  5AY8 D;  1P3L D;  3MGR B;  4CAY A;  3X1U B;  3A6N A;  1M1A B;  3W98 D;  5B0Z A;  3REJ B;  5CPI D;  4XUJ A;  4J8U B;  4QLC A;  4YM6 A;  5B2I D;  5JA4 B;  1KU5 A;  3AN2 C;  3AZI C;  3W96 D;  4J8X B;  3AYW B;  3AZK A;  3C1C D;  3UTB B;  4XZQ B;  3AV2 B;  1F66 A;  4KUD A;  3LZ1 D;  1KX3 A;  2Y2I A;  3UT9 A;  5DNN A;  5AVB D;  1P3O B;  2CV5 A;  5GT3 A;  3WAA D;  2Y2Q A;  2HIO A;  3AZG C;  2G5H C;  5AV5 B;  3AZJ A;  3KWQ B;  3AZF D;  4AWL C;  3REL C;  4G91 B;  1A7W A;  2NQB A;  3AZM D;  2YFV A;  3REI B;  3LEL B;  3TU4 B;  4HGA C;  3AZH A;  5AV9 D;  5CP6 A;  5B40 C;  3A6N C;  5E5A C;  2ZY4 A;  4XUJ C;  4QLC C;  4YM6 C;  2FFF B;  3LJA B;  3AZI D;  4H9R B;  2FJ7 A;  2Y2M A;  3MGP A;  3AZK C;  3A1K A;  4J8W A;  5AY8 B;  4J8V A;  5DNN C;  2BG1 A;  3AZG D;  2CV5 C;  3W98 B;  1P3P D;  1P3M A;  3B6G A;  5B2I B;  3KXB A;  4WNN A;  5GXQ D;  1HQ3 C;  2ZY3 A;  4WZS B;  3W96 B;  4KHA A;  3C1C B;  1M19 C;  5B24 B;  1BH8 B;  2VQR A;  3AFA A;  5B31 B;  1EQZ A;  2W8S A;  5KDM A;  5B40 D;  3LZ1 B;  3AZH C;  5AVB B;  5E5A D;  3KUY A;  3C1B C;  2IO5 C;  4JJN C;  4QLC D;  3VH6 W;  3AZF B;  3MVD C;  3MGQ A;  1P3F C;  1AOI A;  5F99 C;  4Z5T D;  5B1M C;  2JCH A;  1TAF B;  5AV9 B;  1P3K C;  2JSS A;  4CSR B;  2Y2N A;  3B6F A;  1HQ3 D;  3H0M C;  4WJ3 C;  3AZI B;  3MGS C;  1P3M C;  3KXB C;  1M19 D;  5GSU A;  5B33 A;  3X1V C;  4WU8 A;  5BO0 B;  1EQZ C;  4H9S C;  1KX5 C;  5B2J C;  3C1B D;  4JJN D;  3AZG B;  3KUY C;  3W99 D;  1P3P B;  5DNM C;  3MNN A;  1BH9 A;  5GXQ B;  3MVD D;  2NZD D;  3REL B;  1P3F D;  2Y2G A;  4XZQ D;  3AV2 D;  2BYK A;  5F99 D;  3MGQ C;  5B1M D;  4HGA B;  3NQU B;  5B40 B;  1P3K D;  2Y2K A;  4CAY B;  5GT0 C;  3LZ0 A;  5E5A B;  3REH A;  5BNV B;  1P3I A;  1BFM A;  4XUJ B;  4QLC B;  4YM6 B;  3MGS D;  1ID3 C;  3FDD A;  3UTA C;  1KX4 A;  3B6F C;  1U35 C;  3X1V D;  4X23 D;  3W97 C;  3TU4 D;  5GSU C;  5B0Y A;  5B33 C;  1P3G A;  2ZY5 A;  4WU8 C;  1M18 D;  5B2J D;  1KX5 D;  1N1J A;  4Z2M G;  3R45 A;  3AZE A;  5DNM D;  3LJA D;  2F8N A;  4WU9 A;  1HQ3 B;  3X1S C;  4ZBJ C;  4G92 C;  1M19 B;  5B32 G;  3WA9 C;  1Z2C B;  4Z66 A;  5CPJ A;  1F1E A;  3REK A;  2YFV B;  3AZH B;  5GT0 D;  1ZLA A;  3C1B B;  2IO5 B;  4JJN B;  3AV1 C;  1ID3 D;  3UTA D;  3W99 B;  1P3B A;  1U35 D;  3MVD B;  2NZD B;  5B24 D;  1KX4 C;  3X1T A;  5B31 D;  5B1L A;  3W97 D;  3IP4 C;  5GSU D;  1P3F B;  2PYO C;  4H9Q A;  5F99 B;  5B1M B;  5AVC A;  1S32 A;  4UUZ B;  2XD1 A;  1PZR A;  3AZL A;  5B0Y C;  4M6B A;  5BNX B;  1P3K B;  1H3O B;  5AV6 A;  4ZUX C;  3WTP A;  3X1S D;  3EPL A;  3MGS B;  1P3M B;  2F8N G;  3KXB B;  4R8P C;  5AV8 A;  3WA9 D;  5JRG A;  3X1V B;  4X23 B;  4NFT A;  1EQZ B;  2ZM5 A;  1KX5 B;  1M18 B;  5B2J B;  3AV1 D;  5CPK A;  3V9R A;  5B0Z C;  3AN2 D;  5DNM B;  2PYO D;  4H9O B;  3MGQ B;  3AZN A;  3X1T C;  1P3A A;  1TZY A;  3O62 A;  2DQN C;  1F66 C;  1S32 C;  1JFI A;  3AZL C;  1KX3 C;  3UT9 C;  4KUD C;  5GT0 B;  4LD9 A;  4ZUX D;  5GT3 C;  3MGR A;  3X1U A;  1ID3 B;  2HIO C;  3UTA B;  5AV6 C;  1M1A A;  3WKJ A;  3REJ A;  3REL D;  3AZJ C;  1U35 B;  4J8U A;  4R8P D;  3B0D C;  5JA4 A;  4DQY B;  3W97 B;  5GSU B;  5B33 B;  5AV8 C;  2XD5 A;  3AYW A;  2NQB C;  4WU8 B;  3B0C T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...