1P3AC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aC00
3UT9D 3AZNB 1P3AA 1P3PD 3LELA 3AZHA 5AVCB 5G49B 3LZ0C 4ZUXD 5GSUC 5BT1D 2YFVB 4KHAB 5CPKD 2F8ND 1P3AB 3KXBD 5DNMC 3C1CC 4EO5B 3LELB 3AZHB 4YS3D 3R45B 4HGAC 2F8NH 4R8PC 3LZ1A 3AYWD 4YM6A 5DNND 3B0DC 3X1UA 3AV1D 3TU4C 5B0ZB 3A6NA 4AWLC 4NFTA 4H9OA 3VH5A 4Z5TD 3LZ1B 5CHLB 3WKJC 2FJ7D 3C1BD 4YM6B 3X1UB 3RELA 5B0YB 1HQ3A 2F8NA 5CP6C 3AN2A 1BFMA 4KUDD 3AZNC 3AZGA 3A6NB 3AZIA 4H9OB 3AV2D 1B6WA 1AOIC 4Z2MG 5GSUD 1P3LA 1ULYA 4NE6A 3RELB 3AFAD 3AZFA 1HQ3B 3WTPC 3AN2B 3MNNA 3X1VA 2HIOC 4KGCD 3AZGB 3AZIB 1P3KD 2HUEB 3WA9A 4NE5A 1P34C 2NQBC 3REKD 4J8XA 1P3LB 4E45A 3REJD 2F8NK 3B6GD 3UTBD 3AZFB 4J8WC 3MNNB 3X1VB 1HTAA 1EQZD 5GXQC 1BH9A 1P3OC 3KWQD 3WA9B 5B0ZC 1P3BC 3LZ0A 3W99D 4J8XB 3MGRD 3WKJD 5GSUA 1M1AD 3MGPC 3LJAC 2PYOC 5B0YC 3AZND 5DNMA 4M6BA 1BH9B 3C1CA 5GT0C 3LZ0B 5AVCD 3AZJC 1KX5B 5B1LC 4R8PA 2AROC 3TU4A 1P3MC 1P3AD 5DNMB 3MGQB 3C1CB 5CPIA 3LELD 3AZHD 4HGAB 4R8PB 4E44A 3B0DB 5B33C 4J8WD 3TU4B 3AZFC 5CP6A 3AZNA 5CPIB 4WU8C 3W98C 5B0ZD 5B40C 3REHC 1P3GC 4WU9C 1AOIA 3LZ1D 4H9NA 3MGPD 3AZKC 4WNNA 4YM6D 3X1UD 5B0YD 4X23B 5CP6B 4JJNC 3WTPA 5AVBC 2HIOA 3A6ND 5AV8C 1P34A 2NQBA 3R45A 1KX5C 1AOIB 4H9NB 1M18C 5AV9C 3AZLC 1KX3C 4WNNB 3RELD 1P3IC 1HQ3D 4J8WA 3WTPB 2RVQD 3AN2D 3AZEC 3W96C 2HIOB 5GXQA 3MGQC 3AZGD 3AZID 1P3OA 5AY8C 5B0ZA 4LD9C 1P3BA 1P34B 2NQBB 3WTPE 4XUJC 1P3LD 1F66C 3KSYA 3MGPA 3B0CT 3LJAA 3AZFD 2IO5C 2PYOA 4J8WB 5B0YA 3MNND 3X1VD 5GXQB 3B6FC 3W98D 1P3OB 5CPIC 3WA9D 1P3BB 5GT0A 3AZJA 5B1LA 4J8XD 3MGPB 5B31C 1H3OA 3LJAB 2AROA 2PYOB 5CPJA 4X23C 1P3MA 4J8VC 1KX4C 3UTAC 1TAFA 4J8UC 2F8NG 5GT0B 3AZJB 3LZ0D 5BNXB 5F99C 1KX5D 1ZLAC 5B1LB 5B24C 1M19C 3V9RA 4QLCA 3X1TC 4XZQC 1TZYA 3REIC 2LY8A 1H3OB 2AROB 5B33A 3MVDC 5CPJB 4G92C 1P3MB 3AZMC 5DNMD 5B2JC 3MGQD 3C1CD 4WU8A 4Z66C 3W98A 1TAFB 4LD9D 5B40A 3REHA 3X1SC 1P3GA 4QLCB 3V9RB 1F1EA 1R4VA 5GT3C 4WU9A 5B32C 4R8PD 1TZYB 4H9SC 5AV5C 3AZKA 5B33B 3TU4D 4JJNA 3B0CW 3B6FD 5AVBA 4WU8B 3KUYC 5CPID 3W98B 5B40B 3REHB 5AV8A 1U35C 1P3GB 1KX5A 4WU9B 1M18A 5AV9A 3AZKB 3AZLA 1KX3A 5AV6C 1BH8A 4WV4B 4X23D 1P3IA 4JJNB 5CP6D 3AZEA 3W96A 5AVBB 3MGQA 5AY8A 5E5AC 4LD9A 5AV8B 4XUJA 3X1TD 1AOID 1M18B 1F66A 5AV9B 3AZLB 1KX3B 1KU5A 1BH8B 5B2IC 3MVDD 1P3IB 3VH6W 2CV5A 3WTPD 5CPJC 3AZEB 2NZDA 3W96B 2HIOD 3B6FA 1P3FC 5AY8B 4LD9B 5JRGC 1P34D 2NQBD 4XUJB 4QLCC 1Q9CA 4G91C 3UT9C 3MGSA 1F66B 1TZYC 5B31A 4DRAA 1P3PC 2IO5B 2L5AA 2CV5B 4X23A 2NZDB 4J8VA 5GXQD 4ZUXC 1KX4A 3B6FB 3UTAA 1P3OD 4J8UA 5BT1C 1P3BD 5F99A 1ZLAA 2BYMB 5B24A 5CPKC 1M19A 3NQJA 3X1TA 3MGSB 4XZQA 3REIA 3KXBC 5B31B 3LJAD 2PYOD 3MVDA 3AZMA 4YS3C 4J8VB 2BYKA 1KX4B 3WAAB 5B2JA 3W97A 5KDMA 4Z66A 3UTAB 4J8UB 3AYWC 5GT0D 3AZJD 5F99B 5DNNC 1ZLAB 3X1SA 5B1LD 5B24B 3AV1C 1WWIA 3NQJB 5GT3A 3X1TB 5B32A 1M19B 1JFIA 4XZQB 4H9SA 5B1MC 3REIB 5AV5A 2JSSA 2AROD 3MVDB 5CPJD 4G92B 3AZMB 1P3MD 2BYKB 4Z5TC 5B2JB 5KDMB 3W97B 4Z66B 3KUYA 4CSRA 5JRGD 3C1BC 2FJ7C 1U35A 3X1SB 4QLCD 5GT3B 1JFIB 5B32B 2YFWA 1TZYD 5AV5B 4KUDC 5AV6A 5B33D 2CV5C 2NZDC 1S32C 3AV2C 3KUYB 4WU8D 4CSRB 5E5AA 5B40D 3REHD 1U35B 5BNVA 1P3GD 5BNXA 3AFAC 4WU9D 2YFWB 4ZBJC 3MGSC 3AZKD 5AV6B 4KGCC 5B2IA 5BS7C 5C3IC 1P3KC 4JJND 5AVBD 3REKC 3WAAC 3REJC 1P3FA 1ID3A 5E5AB 3O62A 5JRGA 4Z2MH 5BNVB 5AV8D 3B6GC 3UTBC 5B1MD 3UT9A 4H9PA 1M18D 5AV9D 3VH6T 3AZLD 1KX3D 1EQZC 5B2IB 1P3PA 3KWQC 1P3ID 3AZED 3W99C 3W96D 4ZUXA 1P3FB 3MGRC 3W97C 1ID3B 5AY8D 1M1AC 3O62B 5JRGB 4XUJD 5CPKA 4G91B 4H9PB 4H9QA 3UT9B 1F66D 4UUZA 3KXBA 1P3PB 2CV5D 2NZDD 4YS3A 1S32D 5AVCC 1N1JA 4ZUXB 4H9RA 3AYWA 5DNNA 5CPKB 3AV1A 2F8NB 4H9QB 3MGSD 5B1MA 1P3AC 4UUZB 3KXBB 4NE3A 5B31D 5BO0A 4EO5C 3LELC 3AZHC 4YS3B 1N1JB 4J8VD 1KX4D 4Z5TA 3WAAD 4H9RB 3UTAD 3AYWB 4J8UD 2FJ7A 3C1BA 5DNNB 5F99D 1ZLAD 5B24D 3AV1B 1M19D 4WZSB 3VH5T 5B1MB 4XZQD 3REID 4KUDA 5BO0B 4DRBA 1WWSA 3B0BA 3AZMD 1S32A 4Z5TB 1B67A 5B2JD 3AV2A 3W97D 4Z66D 3LZ1C 1ID3C 3C1BB 2FJ7B 4YM6C 3O62C 3X1UC 5JA4A 3X1SD 3AFAA 5GT3D 2BYMA 5FUGA 5B32D 4CAYA 5AV5D 4KUDB 4KGCA 5BS7A 3A6NC 1P3KA 1S32B 5B31G 3AV2B 3REKA 3KUYD 5GSUB 3REJA 3WAAA 1U35D 3B6GA 5JA4B 3RELC 3AFAB 3UTBA 5FUGB 4CAYB 1HQ3C 4ZBJB 2RVQC 3AN2C 3NQUA 1EQZA 5AV6D 4KGCB 3AZGC 5C3IB 1P3KB 3AZIC 3KWQA 2HUEC 3W99A 3REKB 3REJB 1P3LC 3MGRA 3WKJA 5E5AD 1M1AA 3B6GB 3UTBB 2CWEA 3X1VC 1A7WA 3NQUB 3MNNC 1EQZB 3VH5W 5B2ID 4AWLB 3KWQB 3WA9C 5B32G 3W99B 5AVCA 5G49A 4J8XC 3MGRB 1P3FD 3VH6A 3WKJB 1ID3D 1M1AB 3O62D 2YFVA 4KHAA
chains in the Genus database with same CATH superfamily
3UT9D 3AZNB 1P3AA 1P3PD 3LELA 3AZHA 5AVCB 5G49B 3LZ0C 4ZUXD 3AL0C 5GSUC 5BT1D 2YFVB 4KHAB 5CPKD 2F8ND 1P3AB 3KXBD 5DNMC 2W8SA 3C1CC 4EO5B 3LELB 3AZHB 4YS3D 3R45B 4HGAC 2F8NH 3A1IA 4R8PC 3LZ1A 3AYWD 4YM6A 5DNND 3B0DC 2VQRA 3X1UA 3AV1D 3TU4C 5B0ZB 3A6NA 4AWLC 4NFTA 4H9OA 3VH5A 4Z5TD 3LZ1B 5CHLB 3WKJC 2FJ7D 3C1BD 4YM6B 3X1UB 3RELA 5B0YB 1HQ3A 2F8NA 5CP6C 3AN2A 1BFMA 4KUDD 3AZNC 3AZGA 3A6NB 3AZIA 4H9OB 3AV2D 1B6WA 3P5JB 1AOIC 4Z2MG 5GSUD 1P3LA 3F6TA 1ULYA 4NE6A 3RELB 3AFAD 3AZFA 1HQ3B 3WTPC 3AN2B 3MNNA 3X1VA 3KFUG 2HIOC 4KGCD 3AZGB 3AZIB 1P3KD 2HUEB 3WA9A 4NE5A 1P34C 2NQBC 3REKD 4J8XA 1P3LB 4E45A 3REJD 2F8NK 3B6GD 3UTBD 3AZFB 4J8WC 2XD1A 3MNNB 3X1VB 1HTAA 1EQZD 2ZY4A 5GXQC 1BH9A 1P3OC 3KWQD 3WA9B 5B0ZC 1P3BC 3LZ0A 3W99D 4J8XB 4UPKA 3MGRD 3WKJD 5GSUA 1M1AD 3MGPC 3LJAC 2PYOC 5B0YC 3AZND 5DNMA 4M6BA 1BH9B 3C1CA 2ZM5A 5GT0C 3LZ0B 5AVCD 3AZJC 1KX5B 5B1LC 4R8PA 2AROC 3TU4A 1P3MC 1P3AD 5DNMB 3MGQB 3C1CB 5CPIA 3LELD 3AZHD 4HGAB 4R8PB 4E44A 3B0DB 5B33C 4J8WD 3TU4B 3AZFC 5CP6A 3AZNA 5CPIB 4WU8C 3W98C 5B0ZD 5B40C 3REHC 1P3GC 4WU9C 1AOIA 3LZ1D 4H9NA 3MGPD 3AZKC 4WNNA 4YM6D 3X1UD 2JCHA 5B0YD 4X23B 5CP6B 4JJNC 3WTPA 2FFFB 5AVBC 2HIOA 3A6ND 5AV8C 1P34A 2NQBA 3R45A 1KX5C 1AOIB 4H9NB 1M18C 5AV9C 3AZLC 1KX3C 4WNNB 3RELD 1P3IC 1HQ3D 4J8WA 3WTPB 2RVQD 3AN2D 3AZEC 3W96C 2HIOB 5GXQA 3MGQC 3AZGD 3AZID 1P3OA 5AY8C 5B0ZA 4LD9C 2DQNC 1P3BA 1P34B 2NQBB 2F2AC 3WTPE 4XUJC 1P3LD 2Y2MA 1F66C 3KSYA 3MGPA 3B0CT 3LJAA 3AZFD 2IO5C 2PYOA 4J8WB 5B0YA 3MNND 3X1VD 5GXQB 3B6FC 3W98D 1P3OB 2JE5A 5CPIC 3WA9D 1P3BB 5GT0A 3AZJA 5B1LA 4J8XD 1Z2CB 3MGPB 5B31C 1H3OA 3LJAB 2AROA 2PYOB 5CPJA 4X23C 1P3MA 4J8VC 1KX4C 3UTAC 1TAFA 4J8UC 2F8NG 5GT0B 3AZJB 3LZ0D 5BNXB 5F99C 1KX5D 1ZLAC 5B1LB 5B24C 1M19C 3V9RA 4QLCA 3X1TC 1PZRA 4XZQC 1TZYA 3REIC 2LY8A 1H3OB 2Y2IA 2AROB 5B33A 3MVDC 5CPJB 4G92C 1P3MB 3AZMC 5DNMD 5B2JC 3MGQD 3C1CD 4WU8A 4Z66C 3W98A 1TAFB 4LD9D 5B40A 3REHA 3X1SC 1P3GA 3V9RB 4QLCB 1F1EA 1R4VA 5GT3C 4WU9A 5B32C 4R8PD 1TZYB 4H9SC 5AV5C 3AZKA 5B33B 3TU4D 4JJNA 3B0CW 3B6FD 5AVBA 4WU8B 3KUYC 5CPID 3W98B 5B40B 3REHB 5AV8A 1U35C 1P3GB 1KX5A 2Y2LA 4WU9B 2XD5A 1M18A 5AV9A 3AZKB 3AZLA 1KX3A 5AV6C 1BH8A 4WV4B 4DQYB 4X23D 1P3IA 4JJNB 5CP6D 3AZEA 3W96A 5AVBB 2Y2NA 3MGQA 5AY8A 5E5AC 4LD9A 5AV8B 4XUJA 3X1TD 2DF4C 1AOID 1M18B 1F66A 5AV9B 3AZLB 1KX3B 1KU5A 1BH8B 5B2IC 2Y2QA 3MVDD 1P3IB 3VH6W 2CV5A 3WTPD 5CPJC 3AZEB 2NZDA 3W96B 2HIOD 3B6FA 1P3FC 5AY8B 4LD9B 5JRGC 2ZY5A 1P34D 2NQBD 4XUJB 4QLCC 1Q9CA 4G91C 3UT9C 3MGSA 1F66B 1TZYC 5B31A 4DRAA 1P3PC 2IO5B 2L5AA 2CV5B 4X23A 2NZDB 4J8VA 5GXQD 4ZUXC 1KX4A 3B6FB 3UTAA 1P3OD 4J8UA 5BT1C 1P3BD 5F99A 3EPKA 1ZLAA 2BYMB 5B24A 5CPKC 1M19A 3NQJA 3X1TA 3MGSB 4XZQA 3REIA 3KXBC 5B31B 3LJAD 2PYOD 3MVDA 3AZMA 4YS3C 4J8VB 2BYKA 1KX4B 3WAAB 5B2JA 3W97A 5KDMA 4Z66A 3UTAB 4J8UB 3AYWC 5GT0D 3AZJD 5F99B 5DNNC 1ZLAB 3X1SA 5B1LD 5B24B 3AV1C 1WWIA 3NQJB 5GT3A 3X1TB 5B32A 1M19B 1JFIA 4XZQB 4H9SA 5B1MC 3REIB 5AV5A 2JSSA 2AROD 3MVDB 2ZY3A 5CPJD 4G92B 3AZMB 1P3MD 2BYKB 4Z5TC 5B2JB 5KDMB 3EG5B 4Z66B 3KUYA 3W97B 4CSRA 5JRGD 3C1BC 2FJ7C 1U35A 3X1SB 4QLCD 5GT3B 1JFIB 5B32B 2YFWA 1TZYD 5AV5B 4KUDC 5AV6A 5B33D 2CV5C 2NZDC 1S32C 3AV2C 3KUYB 4WU8D 3FDDA 4CSRB 5E5AA 5B40D 3REHD 1U35B 5BNVA 1P3GD 5BNXA 3AFAC 4WU9D 2YFWB 4ZBJC 3MGSC 3AZKD 5AV6B 4KGCC 5B2IA 5BS7C 5C3IC 1P3KC 2BG1A 4JJND 5AVBD 3REKC 3WAAC 3REJC 1P3FA 1ID3A 5E5AB 3O62A 5JRGA 4Z2MH 2Y2JA 5BNVB 5AV8D 3B6GC 3UTBC 5B1MD 3UT9A 4H9PA 1M18D 2G5IC 5AV9D 3VH6T 3AZLD 1KX3D 1EQZC 5B2IB 1P3PA 3KWQC 1P3ID 2ZY2A 3AZED 3W99C 3W96D 4ZUXA 1P3FB 3MGRC 3W97C 1ID3B 5AY8D 1M1AC 3O62B 5JRGB 3H0RC 4XUJD 2J8PA 5CPKA 4G91B 4H9PB 4H9QA 3UT9B 1F66D 4UUZA 1W2EA 3KXBA 1P3PB 2CV5D 2NZDD 4YS3A 1S32D 5AVCC 1N1JA 4ZUXB 3H0MC 2Y2HA 4H9RA 3AYWA 2G5HC 4WJ3C 5DNNA 5CPKB 3AV1A 2F8NB 4H9QB 3MGSD 5B1MA 1P3AC 4UUZB 3KXBB 4NE3A 5B31D 2Y2PA 5BO0A 4EO5C 3LELC 3AZHC 4YS3B 1N1JB 4J8VD 2Y2KA 1KX4D 4Z5TA 3WAAD 4H9RB 3UTAD 2Y2GA 3AYWB 4J8UD 2FJ7A 3C1BA 5DNNB 5F99D 1ZLAD 5B24D 3AV1B 1M19D 4WZSB 3VH5T 5B1MB 4XZQD 3REID 4KUDA 1T3UA 5BO0B 4DRBA 3A1KA 1WWSA 3B0BA 3AZMD 1S32A 4Z5TB 1B67A 5B2JD 3AV2A 3W97D 3H0LC 4Z66D 3LZ1C 1ID3C 3C1BB 2FJ7B 4YM6C 3O62C 3X1UC 5JA4A 3X1SD 3AFAA 5GT3D 2BYMA 5FUGA 5B32D 4CAYA 5AV5D 4KUDB 4KGCA 5BS7A 3A6NC 1P3KA 1S32B 5B31G 3AV2B 3REKA 3KUYD 5GSUB 3REJA 3WAAA 2RIQA 1U35D 3B6GA 5JA4B 3RELC 3AFAB 3UTBA 5FUGB 4CAYB 1HQ3C 2UWXA 4ZBJB 2RVQC 3AN2C 3EPHA 3NQUA 2Y2OA 1EQZA 5AV6D 4KGCB 3EPLA 3EPJA 3AZGC 5C3IB 1P3KB 3AZIC 3KWQA 2HUEC 3W99A 3REKB 3REJB 1P3LC 3MGRA 3WKJA 5E5AD 1M1AA 3B6GB 3UTBB 2CWEA 3X1VC 1A7WA 3NQUB 3MNNC 1EQZB 3VH5W 5B2ID 4AWLB 3KWQB 3WA9C 5B32G 3IP4C 3W99B 5AVCA 5G49A 4J8XC 3MGRB 1P3FD 3VH6A 3WKJB 1ID3D 1M1AB 3O62D 2YFVA 4KHAA
chains in the Genus database with same CATH topology
3UT9D 3AZNB 1P3AA 1P3PD 3LELA 3AZHA 5AVCB 5G49B 3LZ0C 4ZUXD 3AL0C 5GSUC 5BT1D 2YFVB 4KHAB 5CPKD 2F8ND 1P3AB 3KXBD 5DNMC 2W8SA 3C1CC 4EO5B 3LELB 3AZHB 4YS3D 3R45B 4HGAC 2F8NH 3A1IA 4R8PC 3LZ1A 3AYWD 4YM6A 5DNND 3B0DC 2VQRA 3X1UA 3AV1D 3TU4C 5B0ZB 3A6NA 4AWLC 4NFTA 4H9OA 3VH5A 4Z5TD 3LZ1B 5CHLB 3WKJC 2FJ7D 3C1BD 4YM6B 3X1UB 3RELA 5B0YB 1HQ3A 2F8NA 5CP6C 3AN2A 1BFMA 4KUDD 3AZNC 3AZGA 3A6NB 3AZIA 4H9OB 3AV2D 1B6WA 3P5JB 1AOIC 4Z2MG 5GSUD 1P3LA 3F6TA 1ULYA 4NE6A 3RELB 3AFAD 3AZFA 1HQ3B 3WTPC 3AN2B 3MNNA 3X1VA 3KFUG 2HIOC 4KGCD 3AZGB 3AZIB 1P3KD 2HUEB 3WA9A 4NE5A 1P34C 2NQBC 3REKD 4J8XA 1P3LB 4E45A 3REJD 2F8NK 3B6GD 3UTBD 3AZFB 4J8WC 2XD1A 3MNNB 3X1VB 1HTAA 1EQZD 2ZY4A 5GXQC 1BH9A 1P3OC 3KWQD 3WA9B 5B0ZC 1P3BC 3LZ0A 3W99D 4J8XB 4UPKA 3MGRD 3WKJD 5GSUA 1M1AD 3MGPC 3LJAC 2PYOC 5B0YC 3AZND 5DNMA 4M6BA 1BH9B 3C1CA 2ZM5A 5GT0C 3LZ0B 5AVCD 3AZJC 1KX5B 5B1LC 4R8PA 2AROC 3TU4A 1P3MC 1P3AD 5DNMB 3MGQB 3C1CB 5CPIA 3LELD 3AZHD 4HGAB 4R8PB 4E44A 3B0DB 5B33C 4J8WD 3TU4B 3AZFC 5CP6A 3AZNA 5CPIB 4WU8C 3W98C 5B0ZD 5B40C 3REHC 1P3GC 4WU9C 1AOIA 3LZ1D 4H9NA 3MGPD 3AZKC 4WNNA 4YM6D 3X1UD 2JCHA 5B0YD 4X23B 5CP6B 4JJNC 3WTPA 2FFFB 5AVBC 2HIOA 3A6ND 5AV8C 1P34A 2NQBA 3R45A 1KX5C 1AOIB 4H9NB 1M18C 5AV9C 3AZLC 1KX3C 4WNNB 3RELD 1P3IC 1HQ3D 4J8WA 3WTPB 2RVQD 3AN2D 3AZEC 3W96C 2HIOB 5GXQA 3MGQC 3AZGD 3AZID 1P3OA 5AY8C 5B0ZA 4LD9C 2DQNC 1P3BA 1P34B 2NQBB 2F2AC 3WTPE 4XUJC 1P3LD 2Y2MA 1F66C 3KSYA 3MGPA 3B0CT 3LJAA 3AZFD 2IO5C 2PYOA 4J8WB 5B0YA 3MNND 3X1VD 5GXQB 3B6FC 3W98D 1P3OB 2JE5A 5CPIC 3WA9D 1P3BB 5GT0A 3AZJA 5B1LA 4J8XD 1Z2CB 3MGPB 5B31C 1H3OA 3LJAB 2AROA 2PYOB 5CPJA 4X23C 1P3MA 4J8VC 1KX4C 3UTAC 1TAFA 4J8UC 2F8NG 5GT0B 3AZJB 3LZ0D 5BNXB 5F99C 1KX5D 1ZLAC 5B1LB 5B24C 1M19C 3V9RA 4QLCA 3X1TC 1PZRA 4XZQC 1TZYA 3REIC 2LY8A 1H3OB 2Y2IA 2AROB 5B33A 3MVDC 5CPJB 4G92C 1P3MB 3AZMC 5DNMD 5B2JC 3MGQD 3C1CD 4WU8A 4Z66C 3W98A 1TAFB 4LD9D 5B40A 3REHA 3X1SC 1P3GA 3V9RB 4QLCB 1F1EA 1R4VA 5GT3C 4WU9A 5B32C 4R8PD 1TZYB 4H9SC 5AV5C 3AZKA 5B33B 3TU4D 4JJNA 3B0CW 3B6FD 5AVBA 4WU8B 3KUYC 5CPID 3W98B 5B40B 3REHB 5AV8A 1U35C 1P3GB 1KX5A 2Y2LA 4WU9B 2XD5A 1M18A 5AV9A 3AZKB 3AZLA 1KX3A 5AV6C 1BH8A 4WV4B 4DQYB 4X23D 1P3IA 4JJNB 5CP6D 3AZEA 3W96A 5AVBB 2Y2NA 3MGQA 5AY8A 5E5AC 4LD9A 5AV8B 4XUJA 3X1TD 2DF4C 1AOID 1M18B 1F66A 5AV9B 3AZLB 1KX3B 1KU5A 1BH8B 5B2IC 2Y2QA 3MVDD 1P3IB 3VH6W 2CV5A 3WTPD 5CPJC 3AZEB 2NZDA 3W96B 2HIOD 3B6FA 1P3FC 5AY8B 4LD9B 5JRGC 2ZY5A 1P34D 2NQBD 4XUJB 4QLCC 1Q9CA 4G91C 3UT9C 3MGSA 1F66B 1TZYC 5B31A 4DRAA 1P3PC 2IO5B 2L5AA 2CV5B 4X23A 2NZDB 4J8VA 5GXQD 4ZUXC 1KX4A 3B6FB 3UTAA 1P3OD 4J8UA 5BT1C 1P3BD 5F99A 3EPKA 1ZLAA 2BYMB 5B24A 5CPKC 1M19A 3NQJA 3X1TA 3MGSB 4XZQA 3REIA 3KXBC 5B31B 3LJAD 2PYOD 3MVDA 3AZMA 4YS3C 4J8VB 2BYKA 1KX4B 3WAAB 5B2JA 3W97A 5KDMA 4Z66A 3UTAB 4J8UB 3AYWC 5GT0D 3AZJD 5F99B 5DNNC 1ZLAB 3X1SA 5B1LD 5B24B 3AV1C 1WWIA 3NQJB 5GT3A 3X1TB 5B32A 1M19B 1JFIA 4XZQB 4H9SA 5B1MC 3REIB 5AV5A 2JSSA 2AROD 3MVDB 2ZY3A 5CPJD 4G92B 3AZMB 1P3MD 2BYKB 4Z5TC 5B2JB 5KDMB 3EG5B 4Z66B 3KUYA 3W97B 4CSRA 5JRGD 3C1BC 2FJ7C 1U35A 3X1SB 4QLCD 5GT3B 1JFIB 5B32B 2YFWA 1TZYD 5AV5B 4KUDC 5AV6A 5B33D 2CV5C 2NZDC 1S32C 3AV2C 3KUYB 4WU8D 3FDDA 4CSRB 5E5AA 5B40D 3REHD 1U35B 5BNVA 1P3GD 5BNXA 3AFAC 4WU9D 2YFWB 4ZBJC 3MGSC 3AZKD 5AV6B 4KGCC 5B2IA 5BS7C 5C3IC 1P3KC 2BG1A 4JJND 5AVBD 3REKC 3WAAC 3REJC 1P3FA 1ID3A 5E5AB 3O62A 5JRGA 4Z2MH 2Y2JA 5BNVB 5AV8D 3B6GC 3UTBC 5B1MD 3UT9A 4H9PA 1M18D 2G5IC 5AV9D 3VH6T 3AZLD 1KX3D 1EQZC 5B2IB 1P3PA 3KWQC 1P3ID 2ZY2A 3AZED 3W99C 3W96D 4ZUXA 1P3FB 3MGRC 3W97C 1ID3B 5AY8D 1M1AC 3O62B 5JRGB 3H0RC 4XUJD 2J8PA 5CPKA 4G91B 4H9PB 4H9QA 3UT9B 1F66D 4UUZA 1W2EA 3KXBA 1P3PB 2CV5D 2NZDD 4YS3A 1S32D 5AVCC 1N1JA 4ZUXB 3H0MC 2Y2HA 4H9RA 3AYWA 2G5HC 4WJ3C 5DNNA 5CPKB 3AV1A 2F8NB 4H9QB 3MGSD 5B1MA 1P3AC 4UUZB 3KXBB 4NE3A 5B31D 2Y2PA 5BO0A 4EO5C 3LELC 3AZHC 4YS3B 1N1JB 4J8VD 2Y2KA 1KX4D 4Z5TA 3WAAD 4H9RB 3UTAD 2Y2GA 3AYWB 4J8UD 2FJ7A 3C1BA 5DNNB 5F99D 1ZLAD 5B24D 3AV1B 1M19D 4WZSB 3VH5T 5B1MB 4XZQD 3REID 4KUDA 1T3UA 5BO0B 4DRBA 3A1KA 1WWSA 3B0BA 3AZMD 1S32A 4Z5TB 1B67A 5B2JD 3AV2A 3W97D 3H0LC 4Z66D 3LZ1C 1ID3C 3C1BB 2FJ7B 4YM6C 3O62C 3X1UC 5JA4A 3X1SD 3AFAA 5GT3D 2BYMA 5FUGA 5B32D 4CAYA 5AV5D 4KUDB 4KGCA 5BS7A 3A6NC 1P3KA 1S32B 5B31G 3AV2B 3REKA 3KUYD 5GSUB 3REJA 3WAAA 2RIQA 1U35D 3B6GA 5JA4B 3RELC 3AFAB 3UTBA 5FUGB 4CAYB 1HQ3C 2UWXA 4ZBJB 2RVQC 3AN2C 3EPHA 3NQUA 2Y2OA 1EQZA 5AV6D 4KGCB 3EPLA 3EPJA 3AZGC 5C3IB 1P3KB 3AZIC 3KWQA 2HUEC 3W99A 3REKB 3REJB 1P3LC 3MGRA 3WKJA 5E5AD 1M1AA 3B6GB 3UTBB 2CWEA 3X1VC 1A7WA 3NQUB 3MNNC 1EQZB 3VH5W 5B2ID 4AWLB 3KWQB 3WA9C 5B32G 3IP4C 3W99B 5AVCA 5G49A 4J8XC 3MGRB 1P3FD 3VH6A 3WKJB 1ID3D 1M1AB 3O62D 2YFVA 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 D;  3AZN B;  1P3A A;  1P3P D;  3LEL A;  3AZH A;  5AVC B;  5G49 B;  3LZ0 C;  4ZUX D;  5GSU C;  5BT1 D;  2YFV B;  4KHA B;  5CPK D;  2F8N D;  1P3A B;  3KXB D;  5DNM C;  3C1C C;  4EO5 B;  3LEL B;  3AZH B;  4YS3 D;  3R45 B;  4HGA C;  2F8N H;  4R8P C;  3LZ1 A;  3AYW D;  4YM6 A;  5DNN D;  3B0D C;  3X1U A;  3AV1 D;  3TU4 C;  5B0Z B;  3A6N A;  4AWL C;  4NFT A;  4H9O A;  3VH5 A;  4Z5T D;  3LZ1 B;  5CHL B;  3WKJ C;  2FJ7 D;  3C1B D;  4YM6 B;  3X1U B;  3REL A;  5B0Y B;  1HQ3 A;  2F8N A;  5CP6 C;  3AN2 A;  1BFM A;  4KUD D;  3AZN C;  3AZG A;  3A6N B;  3AZI A;  4H9O B;  3AV2 D;  1B6W A;  1AOI C;  4Z2M G;  5GSU D;  1P3L A;  1ULY A;  4NE6 A;  3REL B;  3AFA D;  3AZF A;  1HQ3 B;  3WTP C;  3AN2 B;  3MNN A;  3X1V A;  2HIO C;  4KGC D;  3AZG B;  3AZI B;  1P3K D;  2HUE B;  3WA9 A;  4NE5 A;  1P34 C;  2NQB C;  3REK D;  4J8X A;  1P3L B;  4E45 A;  3REJ D;  2F8N K;  3B6G D;  3UTB D;  3AZF B;  4J8W C;  3MNN B;  3X1V B;  1HTA A;  1EQZ D;  5GXQ C;  1BH9 A;  1P3O C;  3KWQ D;  3WA9 B;  5B0Z C;  1P3B C;  3LZ0 A;  3W99 D;  4J8X B;  3MGR D;  3WKJ D;  5GSU A;  1M1A D;  3MGP C;  3LJA C;  2PYO C;  5B0Y C;  3AZN D;  5DNM A;  4M6B A;  1BH9 B;  3C1C A;  5GT0 C;  3LZ0 B;  5AVC D;  3AZJ C;  1KX5 B;  5B1L C;  4R8P A;  2ARO C;  3TU4 A;  1P3M C;  1P3A D;  5DNM B;  3MGQ B;  3C1C B;  5CPI A;  3LEL D;  3AZH D;  4HGA B;  4R8P B;  4E44 A;  3B0D B;  5B33 C;  4J8W D;  3TU4 B;  3AZF C;  5CP6 A;  3AZN A;  5CPI B;  4WU8 C;  3W98 C;  5B0Z D;  5B40 C;  3REH C;  1P3G C;  4WU9 C;  1AOI A;  3LZ1 D;  4H9N A;  3MGP D;  3AZK C;  4WNN A;  4YM6 D;  3X1U D;  5B0Y D;  4X23 B;  5CP6 B;  4JJN C;  3WTP A;  5AVB C;  2HIO A;  3A6N D;  5AV8 C;  1P34 A;  2NQB A;  3R45 A;  1KX5 C;  1AOI B;  4H9N B;  1M18 C;  5AV9 C;  3AZL C;  1KX3 C;  4WNN B;  3REL D;  1P3I C;  1HQ3 D;  4J8W A;  3WTP B;  2RVQ D;  3AN2 D;  3AZE C;  3W96 C;  2HIO B;  5GXQ A;  3MGQ C;  3AZG D;  3AZI D;  1P3O A;  5AY8 C;  5B0Z A;  4LD9 C;  1P3B A;  1P34 B;  2NQB B;  3WTP E;  4XUJ C;  1P3L D;  1F66 C;  3KSY A;  3MGP A;  3B0C T;  3LJA A;  3AZF D;  2IO5 C;  2PYO A;  4J8W B;  5B0Y A;  3MNN D;  3X1V D;  5GXQ B;  3B6F C;  3W98 D;  1P3O B;  5CPI C;  3WA9 D;  1P3B B;  5GT0 A;  3AZJ A;  5B1L A;  4J8X D;  3MGP B;  5B31 C;  1H3O A;  3LJA B;  2ARO A;  2PYO B;  5CPJ A;  4X23 C;  1P3M A;  4J8V C;  1KX4 C;  3UTA C;  1TAF A;  4J8U C;  2F8N G;  5GT0 B;  3AZJ B;  3LZ0 D;  5BNX B;  5F99 C;  1KX5 D;  1ZLA C;  5B1L B;  5B24 C;  1M19 C;  3V9R A;  4QLC A;  3X1T C;  4XZQ C;  1TZY A;  3REI C;  2LY8 A;  1H3O B;  2ARO B;  5B33 A;  3MVD C;  5CPJ B;  4G92 C;  1P3M B;  3AZM C;  5DNM D;  5B2J C;  3MGQ D;  3C1C D;  4WU8 A;  4Z66 C;  3W98 A;  1TAF B;  4LD9 D;  5B40 A;  3REH A;  3X1S C;  1P3G A;  4QLC B;  3V9R B;  1F1E A;  1R4V A;  5GT3 C;  4WU9 A;  5B32 C;  4R8P D;  1TZY B;  4H9S C;  5AV5 C;  3AZK A;  5B33 B;  3TU4 D;  4JJN A;  3B0C W;  3B6F D;  5AVB A;  4WU8 B;  3KUY C;  5CPI D;  3W98 B;  5B40 B;  3REH B;  5AV8 A;  1U35 C;  1P3G B;  1KX5 A;  4WU9 B;  1M18 A;  5AV9 A;  3AZK B;  3AZL A;  1KX3 A;  5AV6 C;  1BH8 A;  4WV4 B;  4X23 D;  1P3I A;  4JJN B;  5CP6 D;  3AZE A;  3W96 A;  5AVB B;  3MGQ A;  5AY8 A;  5E5A C;  4LD9 A;  5AV8 B;  4XUJ A;  3X1T D;  1AOI D;  1M18 B;  1F66 A;  5AV9 B;  3AZL B;  1KX3 B;  1KU5 A;  1BH8 B;  5B2I C;  3MVD D;  1P3I B;  3VH6 W;  2CV5 A;  3WTP D;  5CPJ C;  3AZE B;  2NZD A;  3W96 B;  2HIO D;  3B6F A;  1P3F C;  5AY8 B;  4LD9 B;  5JRG C;  1P34 D;  2NQB D;  4XUJ B;  4QLC C;  1Q9C A;  4G91 C;  3UT9 C;  3MGS A;  1F66 B;  1TZY C;  5B31 A;  4DRA A;  1P3P C;  2IO5 B;  2L5A A;  2CV5 B;  4X23 A;  2NZD B;  4J8V A;  5GXQ D;  4ZUX C;  1KX4 A;  3B6F B;  3UTA A;  1P3O D;  4J8U A;  5BT1 C;  1P3B D;  5F99 A;  1ZLA A;  2BYM B;  5B24 A;  5CPK C;  1M19 A;  3NQJ A;  3X1T A;  3MGS B;  4XZQ A;  3REI A;  3KXB C;  5B31 B;  3LJA D;  2PYO D;  3MVD A;  3AZM A;  4YS3 C;  4J8V B;  2BYK A;  1KX4 B;  3WAA B;  5B2J A;  3W97 A;  5KDM A;  4Z66 A;  3UTA B;  4J8U B;  3AYW C;  5GT0 D;  3AZJ D;  5F99 B;  5DNN C;  1ZLA B;  3X1S A;  5B1L D;  5B24 B;  3AV1 C;  1WWI A;  3NQJ B;  5GT3 A;  3X1T B;  5B32 A;  1M19 B;  1JFI A;  4XZQ B;  4H9S A;  5B1M C;  3REI B;  5AV5 A;  2JSS A;  2ARO D;  3MVD B;  5CPJ D;  4G92 B;  3AZM B;  1P3M D;  2BYK B;  4Z5T C;  5B2J B;  5KDM B;  3W97 B;  4Z66 B;  3KUY A;  4CSR A;  5JRG D;  3C1B C;  2FJ7 C;  1U35 A;  3X1S B;  4QLC D;  5GT3 B;  1JFI B;  5B32 B;  2YFW A;  1TZY D;  5AV5 B;  4KUD C;  5AV6 A;  5B33 D;  2CV5 C;  2NZD C;  1S32 C;  3AV2 C;  3KUY B;  4WU8 D;  4CSR B;  5E5A A;  5B40 D;  3REH D;  1U35 B;  5BNV A;  1P3G D;  5BNX A;  3AFA C;  4WU9 D;  2YFW B;  4ZBJ C;  3MGS C;  3AZK D;  5AV6 B;  4KGC C;  5B2I A;  5BS7 C;  5C3I C;  1P3K C;  4JJN D;  5AVB D;  3REK C;  3WAA C;  3REJ C;  1P3F A;  1ID3 A;  5E5A B;  3O62 A;  5JRG A;  4Z2M H;  5BNV B;  5AV8 D;  3B6G C;  3UTB C;  5B1M D;  3UT9 A;  4H9P A;  1M18 D;  5AV9 D;  3VH6 T;  3AZL D;  1KX3 D;  1EQZ C;  5B2I B;  1P3P A;  3KWQ C;  1P3I D;  3AZE D;  3W99 C;  3W96 D;  4ZUX A;  1P3F B;  3MGR C;  3W97 C;  1ID3 B;  5AY8 D;  1M1A C;  3O62 B;  5JRG B;  4XUJ D;  5CPK A;  4G91 B;  4H9P B;  4H9Q A;  3UT9 B;  1F66 D;  4UUZ A;  3KXB A;  1P3P B;  2CV5 D;  2NZD D;  4YS3 A;  1S32 D;  5AVC C;  1N1J A;  4ZUX B;  4H9R A;  3AYW A;  5DNN A;  5CPK B;  3AV1 A;  2F8N B;  4H9Q B;  3MGS D;  5B1M A;  1P3A C;  4UUZ B;  3KXB B;  4NE3 A;  5B31 D;  5BO0 A;  4EO5 C;  3LEL C;  3AZH C;  4YS3 B;  1N1J B;  4J8V D;  1KX4 D;  4Z5T A;  3WAA D;  4H9R B;  3UTA D;  3AYW B;  4J8U D;  2FJ7 A;  3C1B A;  5DNN B;  5F99 D;  1ZLA D;  5B24 D;  3AV1 B;  1M19 D;  4WZS B;  3VH5 T;  5B1M B;  4XZQ D;  3REI D;  4KUD A;  5BO0 B;  4DRB A;  1WWS A;  3B0B A;  3AZM D;  1S32 A;  4Z5T B;  1B67 A;  5B2J D;  3AV2 A;  3W97 D;  4Z66 D;  3LZ1 C;  1ID3 C;  3C1B B;  2FJ7 B;  4YM6 C;  3O62 C;  3X1U C;  5JA4 A;  3X1S D;  3AFA A;  5GT3 D;  2BYM A;  5FUG A;  5B32 D;  4CAY A;  5AV5 D;  4KUD B;  4KGC A;  5BS7 A;  3A6N C;  1P3K A;  1S32 B;  5B31 G;  3AV2 B;  3REK A;  3KUY D;  5GSU B;  3REJ A;  3WAA A;  1U35 D;  3B6G A;  5JA4 B;  3REL C;  3AFA B;  3UTB A;  5FUG B;  4CAY B;  1HQ3 C;  4ZBJ B;  2RVQ C;  3AN2 C;  3NQU A;  1EQZ A;  5AV6 D;  4KGC B;  3AZG C;  5C3I B;  1P3K B;  3AZI C;  3KWQ A;  2HUE C;  3W99 A;  3REK B;  3REJ B;  1P3L C;  3MGR A;  3WKJ A;  5E5A D;  1M1A A;  3B6G B;  3UTB B;  2CWE A;  3X1V C;  1A7W A;  3NQU B;  3MNN C;  1EQZ B;  3VH5 W;  5B2I D;  4AWL B;  3KWQ B;  3WA9 C;  5B32 G;  3W99 B;  5AVC A;  5G49 A;  4J8X C;  3MGR B;  1P3F D;  3VH6 A;  3WKJ B;  1ID3 D;  1M1A B;  3O62 D;  2YFV A;  4KHA A; 
#chains in the Genus database with same CATH topology
 3UT9 D;  3AZN B;  1P3A A;  1P3P D;  3LEL A;  3AZH A;  5AVC B;  5G49 B;  3LZ0 C;  4ZUX D;  3AL0 C;  5GSU C;  5BT1 D;  2YFV B;  4KHA B;  5CPK D;  2F8N D;  1P3A B;  3KXB D;  5DNM C;  2W8S A;  3C1C C;  4EO5 B;  3LEL B;  3AZH B;  4YS3 D;  3R45 B;  4HGA C;  2F8N H;  3A1I A;  4R8P C;  3LZ1 A;  3AYW D;  4YM6 A;  5DNN D;  3B0D C;  2VQR A;  3X1U A;  3AV1 D;  3TU4 C;  5B0Z B;  3A6N A;  4AWL C;  4NFT A;  4H9O A;  3VH5 A;  4Z5T D;  3LZ1 B;  5CHL B;  3WKJ C;  2FJ7 D;  3C1B D;  4YM6 B;  3X1U B;  3REL A;  5B0Y B;  1HQ3 A;  2F8N A;  5CP6 C;  3AN2 A;  1BFM A;  4KUD D;  3AZN C;  3AZG A;  3A6N B;  3AZI A;  4H9O B;  3AV2 D;  1B6W A;  3P5J B;  1AOI C;  4Z2M G;  5GSU D;  1P3L A;  3F6T A;  1ULY A;  4NE6 A;  3REL B;  3AFA D;  3AZF A;  1HQ3 B;  3WTP C;  3AN2 B;  3MNN A;  3X1V A;  3KFU G;  2HIO C;  4KGC D;  3AZG B;  3AZI B;  1P3K D;  2HUE B;  3WA9 A;  4NE5 A;  1P34 C;  2NQB C;  3REK D;  4J8X A;  1P3L B;  4E45 A;  3REJ D;  2F8N K;  3B6G D;  3UTB D;  3AZF B;  4J8W C;  2XD1 A;  3MNN B;  3X1V B;  1HTA A;  1EQZ D;  2ZY4 A;  5GXQ C;  1BH9 A;  1P3O C;  3KWQ D;  3WA9 B;  5B0Z C;  1P3B C;  3LZ0 A;  3W99 D;  4J8X B;  4UPK A;  3MGR D;  3WKJ D;  5GSU A;  1M1A D;  3MGP C;  3LJA C;  2PYO C;  5B0Y C;  3AZN D;  5DNM A;  4M6B A;  1BH9 B;  3C1C A;  2ZM5 A;  5GT0 C;  3LZ0 B;  5AVC D;  3AZJ C;  1KX5 B;  5B1L C;  4R8P A;  2ARO C;  3TU4 A;  1P3M C;  1P3A D;  5DNM B;  3MGQ B;  3C1C B;  5CPI A;  3LEL D;  3AZH D;  4HGA B;  4R8P B;  4E44 A;  3B0D B;  5B33 C;  4J8W D;  3TU4 B;  3AZF C;  5CP6 A;  3AZN A;  5CPI B;  4WU8 C;  3W98 C;  5B0Z D;  5B40 C;  3REH C;  1P3G C;  4WU9 C;  1AOI A;  3LZ1 D;  4H9N A;  3MGP D;  3AZK C;  4WNN A;  4YM6 D;  3X1U D;  2JCH A;  5B0Y D;  4X23 B;  5CP6 B;  4JJN C;  3WTP A;  2FFF B;  5AVB C;  2HIO A;  3A6N D;  5AV8 C;  1P34 A;  2NQB A;  3R45 A;  1KX5 C;  1AOI B;  4H9N B;  1M18 C;  5AV9 C;  3AZL C;  1KX3 C;  4WNN B;  3REL D;  1P3I C;  1HQ3 D;  4J8W A;  3WTP B;  2RVQ D;  3AN2 D;  3AZE C;  3W96 C;  2HIO B;  5GXQ A;  3MGQ C;  3AZG D;  3AZI D;  1P3O A;  5AY8 C;  5B0Z A;  4LD9 C;  2DQN C;  1P3B A;  1P34 B;  2NQB B;  2F2A C;  3WTP E;  4XUJ C;  1P3L D;  2Y2M A;  1F66 C;  3KSY A;  3MGP A;  3B0C T;  3LJA A;  3AZF D;  2IO5 C;  2PYO A;  4J8W B;  5B0Y A;  3MNN D;  3X1V D;  5GXQ B;  3B6F C;  3W98 D;  1P3O B;  2JE5 A;  5CPI C;  3WA9 D;  1P3B B;  5GT0 A;  3AZJ A;  5B1L A;  4J8X D;  1Z2C B;  3MGP B;  5B31 C;  1H3O A;  3LJA B;  2ARO A;  2PYO B;  5CPJ A;  4X23 C;  1P3M A;  4J8V C;  1KX4 C;  3UTA C;  1TAF A;  4J8U C;  2F8N G;  5GT0 B;  3AZJ B;  3LZ0 D;  5BNX B;  5F99 C;  1KX5 D;  1ZLA C;  5B1L B;  5B24 C;  1M19 C;  3V9R A;  4QLC A;  3X1T C;  1PZR A;  4XZQ C;  1TZY A;  3REI C;  2LY8 A;  1H3O B;  2Y2I A;  2ARO B;  5B33 A;  3MVD C;  5CPJ B;  4G92 C;  1P3M B;  3AZM C;  5DNM D;  5B2J C;  3MGQ D;  3C1C D;  4WU8 A;  4Z66 C;  3W98 A;  1TAF B;  4LD9 D;  5B40 A;  3REH A;  3X1S C;  1P3G A;  3V9R B;  4QLC B;  1F1E A;  1R4V A;  5GT3 C;  4WU9 A;  5B32 C;  4R8P D;  1TZY B;  4H9S C;  5AV5 C;  3AZK A;  5B33 B;  3TU4 D;  4JJN A;  3B0C W;  3B6F D;  5AVB A;  4WU8 B;  3KUY C;  5CPI D;  3W98 B;  5B40 B;  3REH B;  5AV8 A;  1U35 C;  1P3G B;  1KX5 A;  2Y2L A;  4WU9 B;  2XD5 A;  1M18 A;  5AV9 A;  3AZK B;  3AZL A;  1KX3 A;  5AV6 C;  1BH8 A;  4WV4 B;  4DQY B;  4X23 D;  1P3I A;  4JJN B;  5CP6 D;  3AZE A;  3W96 A;  5AVB B;  2Y2N A;  3MGQ A;  5AY8 A;  5E5A C;  4LD9 A;  5AV8 B;  4XUJ A;  3X1T D;  2DF4 C;  1AOI D;  1M18 B;  1F66 A;  5AV9 B;  3AZL B;  1KX3 B;  1KU5 A;  1BH8 B;  5B2I C;  2Y2Q A;  3MVD D;  1P3I B;  3VH6 W;  2CV5 A;  3WTP D;  5CPJ C;  3AZE B;  2NZD A;  3W96 B;  2HIO D;  3B6F A;  1P3F C;  5AY8 B;  4LD9 B;  5JRG C;  2ZY5 A;  1P34 D;  2NQB D;  4XUJ B;  4QLC C;  1Q9C A;  4G91 C;  3UT9 C;  3MGS A;  1F66 B;  1TZY C;  5B31 A;  4DRA A;  1P3P C;  2IO5 B;  2L5A A;  2CV5 B;  4X23 A;  2NZD B;  4J8V A;  5GXQ D;  4ZUX C;  1KX4 A;  3B6F B;  3UTA A;  1P3O D;  4J8U A;  5BT1 C;  1P3B D;  5F99 A;  3EPK A;  1ZLA A;  2BYM B;  5B24 A;  5CPK C;  1M19 A;  3NQJ A;  3X1T A;  3MGS B;  4XZQ A;  3REI A;  3KXB C;  5B31 B;  3LJA D;  2PYO D;  3MVD A;  3AZM A;  4YS3 C;  4J8V B;  2BYK A;  1KX4 B;  3WAA B;  5B2J A;  3W97 A;  5KDM A;  4Z66 A;  3UTA B;  4J8U B;  3AYW C;  5GT0 D;  3AZJ D;  5F99 B;  5DNN C;  1ZLA B;  3X1S A;  5B1L D;  5B24 B;  3AV1 C;  1WWI A;  3NQJ B;  5GT3 A;  3X1T B;  5B32 A;  1M19 B;  1JFI A;  4XZQ B;  4H9S A;  5B1M C;  3REI B;  5AV5 A;  2JSS A;  2ARO D;  3MVD B;  2ZY3 A;  5CPJ D;  4G92 B;  3AZM B;  1P3M D;  2BYK B;  4Z5T C;  5B2J B;  5KDM B;  3EG5 B;  4Z66 B;  3KUY A;  3W97 B;  4CSR A;  5JRG D;  3C1B C;  2FJ7 C;  1U35 A;  3X1S B;  4QLC D;  5GT3 B;  1JFI B;  5B32 B;  2YFW A;  1TZY D;  5AV5 B;  4KUD C;  5AV6 A;  5B33 D;  2CV5 C;  2NZD C;  1S32 C;  3AV2 C;  3KUY B;  4WU8 D;  3FDD A;  4CSR B;  5E5A A;  5B40 D;  3REH D;  1U35 B;  5BNV A;  1P3G D;  5BNX A;  3AFA C;  4WU9 D;  2YFW B;  4ZBJ C;  3MGS C;  3AZK D;  5AV6 B;  4KGC C;  5B2I A;  5BS7 C;  5C3I C;  1P3K C;  2BG1 A;  4JJN D;  5AVB D;  3REK C;  3WAA C;  3REJ C;  1P3F A;  1ID3 A;  5E5A B;  3O62 A;  5JRG A;  4Z2M H;  2Y2J A;  5BNV B;  5AV8 D;  3B6G C;  3UTB C;  5B1M D;  3UT9 A;  4H9P A;  1M18 D;  2G5I C;  5AV9 D;  3VH6 T;  3AZL D;  1KX3 D;  1EQZ C;  5B2I B;  1P3P A;  3KWQ C;  1P3I D;  2ZY2 A;  3AZE D;  3W99 C;  3W96 D;  4ZUX A;  1P3F B;  3MGR C;  3W97 C;  1ID3 B;  5AY8 D;  1M1A C;  3O62 B;  5JRG B;  3H0R C;  4XUJ D;  2J8P A;  5CPK A;  4G91 B;  4H9P B;  4H9Q A;  3UT9 B;  1F66 D;  4UUZ A;  1W2E A;  3KXB A;  1P3P B;  2CV5 D;  2NZD D;  4YS3 A;  1S32 D;  5AVC C;  1N1J A;  4ZUX B;  3H0M C;  2Y2H A;  4H9R A;  3AYW A;  2G5H C;  4WJ3 C;  5DNN A;  5CPK B;  3AV1 A;  2F8N B;  4H9Q B;  3MGS D;  5B1M A;  1P3A C;  4UUZ B;  3KXB B;  4NE3 A;  5B31 D;  2Y2P A;  5BO0 A;  4EO5 C;  3LEL C;  3AZH C;  4YS3 B;  1N1J B;  4J8V D;  2Y2K A;  1KX4 D;  4Z5T A;  3WAA D;  4H9R B;  3UTA D;  2Y2G A;  3AYW B;  4J8U D;  2FJ7 A;  3C1B A;  5DNN B;  5F99 D;  1ZLA D;  5B24 D;  3AV1 B;  1M19 D;  4WZS B;  3VH5 T;  5B1M B;  4XZQ D;  3REI D;  4KUD A;  1T3U A;  5BO0 B;  4DRB A;  3A1K A;  1WWS A;  3B0B A;  3AZM D;  1S32 A;  4Z5T B;  1B67 A;  5B2J D;  3AV2 A;  3W97 D;  3H0L C;  4Z66 D;  3LZ1 C;  1ID3 C;  3C1B B;  2FJ7 B;  4YM6 C;  3O62 C;  3X1U C;  5JA4 A;  3X1S D;  3AFA A;  5GT3 D;  2BYM A;  5FUG A;  5B32 D;  4CAY A;  5AV5 D;  4KUD B;  4KGC A;  5BS7 A;  3A6N C;  1P3K A;  1S32 B;  5B31 G;  3AV2 B;  3REK A;  3KUY D;  5GSU B;  3REJ A;  3WAA A;  2RIQ A;  1U35 D;  3B6G A;  5JA4 B;  3REL C;  3AFA B;  3UTB A;  5FUG B;  4CAY B;  1HQ3 C;  2UWX A;  4ZBJ B;  2RVQ C;  3AN2 C;  3EPH A;  3NQU A;  2Y2O A;  1EQZ A;  5AV6 D;  4KGC B;  3EPL A;  3EPJ A;  3AZG C;  5C3I B;  1P3K B;  3AZI C;  3KWQ A;  2HUE C;  3W99 A;  3REK B;  3REJ B;  1P3L C;  3MGR A;  3WKJ A;  5E5A D;  1M1A A;  3B6G B;  3UTB B;  2CWE A;  3X1V C;  1A7W A;  3NQU B;  3MNN C;  1EQZ B;  3VH5 W;  5B2I D;  4AWL B;  3KWQ B;  3WA9 C;  5B32 G;  3IP4 C;  3W99 B;  5AVC A;  5G49 A;  4J8X C;  3MGR B;  1P3F D;  3VH6 A;  3WKJ B;  1ID3 D;  1M1A B;  3O62 D;  2YFV A;  4KHA A; 
#chains in the Genus database with same CATH homology
 3UT9 D;  3AZN B;  1P3A A;  1P3P D;  3LEL A;  3AZH A;  5AVC B;  5G49 B;  3LZ0 C;  4ZUX D;  3AL0 C;  5GSU C;  5BT1 D;  2YFV B;  4KHA B;  5CPK D;  2F8N D;  1P3A B;  3KXB D;  5DNM C;  2W8S A;  3C1C C;  4EO5 B;  3LEL B;  3AZH B;  4YS3 D;  3R45 B;  4HGA C;  2F8N H;  3A1I A;  4R8P C;  3LZ1 A;  3AYW D;  4YM6 A;  5DNN D;  3B0D C;  2VQR A;  3X1U A;  3AV1 D;  3TU4 C;  5B0Z B;  3A6N A;  4AWL C;  4NFT A;  4H9O A;  3VH5 A;  4Z5T D;  3LZ1 B;  5CHL B;  3WKJ C;  2FJ7 D;  3C1B D;  4YM6 B;  3X1U B;  3REL A;  5B0Y B;  1HQ3 A;  2F8N A;  5CP6 C;  3AN2 A;  1BFM A;  4KUD D;  3AZN C;  3AZG A;  3A6N B;  3AZI A;  4H9O B;  3AV2 D;  1B6W A;  3P5J B;  1AOI C;  4Z2M G;  5GSU D;  1P3L A;  3F6T A;  1ULY A;  4NE6 A;  3REL B;  3AFA D;  3AZF A;  1HQ3 B;  3WTP C;  3AN2 B;  3MNN A;  3X1V A;  3KFU G;  2HIO C;  4KGC D;  3AZG B;  3AZI B;  1P3K D;  2HUE B;  3WA9 A;  4NE5 A;  1P34 C;  2NQB C;  3REK D;  4J8X A;  1P3L B;  4E45 A;  3REJ D;  2F8N K;  3B6G D;  3UTB D;  3AZF B;  4J8W C;  2XD1 A;  3MNN B;  3X1V B;  1HTA A;  1EQZ D;  2ZY4 A;  5GXQ C;  1BH9 A;  1P3O C;  3KWQ D;  3WA9 B;  5B0Z C;  1P3B C;  3LZ0 A;  3W99 D;  4J8X B;  4UPK A;  3MGR D;  3WKJ D;  5GSU A;  1M1A D;  3MGP C;  3LJA C;  2PYO C;  5B0Y C;  3AZN D;  5DNM A;  4M6B A;  1BH9 B;  3C1C A;  2ZM5 A;  5GT0 C;  3LZ0 B;  5AVC D;  3AZJ C;  1KX5 B;  5B1L C;  4R8P A;  2ARO C;  3TU4 A;  1P3M C;  1P3A D;  5DNM B;  3MGQ B;  3C1C B;  5CPI A;  3LEL D;  3AZH D;  4HGA B;  4R8P B;  4E44 A;  3B0D B;  5B33 C;  4J8W D;  3TU4 B;  3AZF C;  5CP6 A;  3AZN A;  5CPI B;  4WU8 C;  3W98 C;  5B0Z D;  5B40 C;  3REH C;  1P3G C;  4WU9 C;  1AOI A;  3LZ1 D;  4H9N A;  3MGP D;  3AZK C;  4WNN A;  4YM6 D;  3X1U D;  2JCH A;  5B0Y D;  4X23 B;  5CP6 B;  4JJN C;  3WTP A;  2FFF B;  5AVB C;  2HIO A;  3A6N D;  5AV8 C;  1P34 A;  2NQB A;  3R45 A;  1KX5 C;  1AOI B;  4H9N B;  1M18 C;  5AV9 C;  3AZL C;  1KX3 C;  4WNN B;  3REL D;  1P3I C;  1HQ3 D;  4J8W A;  3WTP B;  2RVQ D;  3AN2 D;  3AZE C;  3W96 C;  2HIO B;  5GXQ A;  3MGQ C;  3AZG D;  3AZI D;  1P3O A;  5AY8 C;  5B0Z A;  4LD9 C;  2DQN C;  1P3B A;  1P34 B;  2NQB B;  2F2A C;  3WTP E;  4XUJ C;  1P3L D;  2Y2M A;  1F66 C;  3KSY A;  3MGP A;  3B0C T;  3LJA A;  3AZF D;  2IO5 C;  2PYO A;  4J8W B;  5B0Y A;  3MNN D;  3X1V D;  5GXQ B;  3B6F C;  3W98 D;  1P3O B;  2JE5 A;  5CPI C;  3WA9 D;  1P3B B;  5GT0 A;  3AZJ A;  5B1L A;  4J8X D;  1Z2C B;  3MGP B;  5B31 C;  1H3O A;  3LJA B;  2ARO A;  2PYO B;  5CPJ A;  4X23 C;  1P3M A;  4J8V C;  1KX4 C;  3UTA C;  1TAF A;  4J8U C;  2F8N G;  5GT0 B;  3AZJ B;  3LZ0 D;  5BNX B;  5F99 C;  1KX5 D;  1ZLA C;  5B1L B;  5B24 C;  1M19 C;  3V9R A;  4QLC A;  3X1T C;  1PZR A;  4XZQ C;  1TZY A;  3REI C;  2LY8 A;  1H3O B;  2Y2I A;  2ARO B;  5B33 A;  3MVD C;  5CPJ B;  4G92 C;  1P3M B;  3AZM C;  5DNM D;  5B2J C;  3MGQ D;  3C1C D;  4WU8 A;  4Z66 C;  3W98 A;  1TAF B;  4LD9 D;  5B40 A;  3REH A;  3X1S C;  1P3G A;  3V9R B;  4QLC B;  1F1E A;  1R4V A;  5GT3 C;  4WU9 A;  5B32 C;  4R8P D;  1TZY B;  4H9S C;  5AV5 C;  3AZK A;  5B33 B;  3TU4 D;  4JJN A;  3B0C W;  3B6F D;  5AVB A;  4WU8 B;  3KUY C;  5CPI D;  3W98 B;  5B40 B;  3REH B;  5AV8 A;  1U35 C;  1P3G B;  1KX5 A;  2Y2L A;  4WU9 B;  2XD5 A;  1M18 A;  5AV9 A;  3AZK B;  3AZL A;  1KX3 A;  5AV6 C;  1BH8 A;  4WV4 B;  4DQY B;  4X23 D;  1P3I A;  4JJN B;  5CP6 D;  3AZE A;  3W96 A;  5AVB B;  2Y2N A;  3MGQ A;  5AY8 A;  5E5A C;  4LD9 A;  5AV8 B;  4XUJ A;  3X1T D;  2DF4 C;  1AOI D;  1M18 B;  1F66 A;  5AV9 B;  3AZL B;  1KX3 B;  1KU5 A;  1BH8 B;  5B2I C;  2Y2Q A;  3MVD D;  1P3I B;  3VH6 W;  2CV5 A;  3WTP D;  5CPJ C;  3AZE B;  2NZD A;  3W96 B;  2HIO D;  3B6F A;  1P3F C;  5AY8 B;  4LD9 B;  5JRG C;  2ZY5 A;  1P34 D;  2NQB D;  4XUJ B;  4QLC C;  1Q9C A;  4G91 C;  3UT9 C;  3MGS A;  1F66 B;  1TZY C;  5B31 A;  4DRA A;  1P3P C;  2IO5 B;  2L5A A;  2CV5 B;  4X23 A;  2NZD B;  4J8V A;  5GXQ D;  4ZUX C;  1KX4 A;  3B6F B;  3UTA A;  1P3O D;  4J8U A;  5BT1 C;  1P3B D;  5F99 A;  3EPK A;  1ZLA A;  2BYM B;  5B24 A;  5CPK C;  1M19 A;  3NQJ A;  3X1T A;  3MGS B;  4XZQ A;  3REI A;  3KXB C;  5B31 B;  3LJA D;  2PYO D;  3MVD A;  3AZM A;  4YS3 C;  4J8V B;  2BYK A;  1KX4 B;  3WAA B;  5B2J A;  3W97 A;  5KDM A;  4Z66 A;  3UTA B;  4J8U B;  3AYW C;  5GT0 D;  3AZJ D;  5F99 B;  5DNN C;  1ZLA B;  3X1S A;  5B1L D;  5B24 B;  3AV1 C;  1WWI A;  3NQJ B;  5GT3 A;  3X1T B;  5B32 A;  1M19 B;  1JFI A;  4XZQ B;  4H9S A;  5B1M C;  3REI B;  5AV5 A;  2JSS A;  2ARO D;  3MVD B;  2ZY3 A;  5CPJ D;  4G92 B;  3AZM B;  1P3M D;  2BYK B;  4Z5T C;  5B2J B;  5KDM B;  3EG5 B;  4Z66 B;  3KUY A;  3W97 B;  4CSR A;  5JRG D;  3C1B C;  2FJ7 C;  1U35 A;  3X1S B;  4QLC D;  5GT3 B;  1JFI B;  5B32 B;  2YFW A;  1TZY D;  5AV5 B;  4KUD C;  5AV6 A;  5B33 D;  2CV5 C;  2NZD C;  1S32 C;  3AV2 C;  3KUY B;  4WU8 D;  3FDD A;  4CSR B;  5E5A A;  5B40 D;  3REH D;  1U35 B;  5BNV A;  1P3G D;  5BNX A;  3AFA C;  4WU9 D;  2YFW B;  4ZBJ C;  3MGS C;  3AZK D;  5AV6 B;  4KGC C;  5B2I A;  5BS7 C;  5C3I C;  1P3K C;  2BG1 A;  4JJN D;  5AVB D;  3REK C;  3WAA C;  3REJ C;  1P3F A;  1ID3 A;  5E5A B;  3O62 A;  5JRG A;  4Z2M H;  2Y2J A;  5BNV B;  5AV8 D;  3B6G C;  3UTB C;  5B1M D;  3UT9 A;  4H9P A;  1M18 D;  2G5I C;  5AV9 D;  3VH6 T;  3AZL D;  1KX3 D;  1EQZ C;  5B2I B;  1P3P A;  3KWQ C;  1P3I D;  2ZY2 A;  3AZE D;  3W99 C;  3W96 D;  4ZUX A;  1P3F B;  3MGR C;  3W97 C;  1ID3 B;  5AY8 D;  1M1A C;  3O62 B;  5JRG B;  3H0R C;  4XUJ D;  2J8P A;  5CPK A;  4G91 B;  4H9P B;  4H9Q A;  3UT9 B;  1F66 D;  4UUZ A;  1W2E A;  3KXB A;  1P3P B;  2CV5 D;  2NZD D;  4YS3 A;  1S32 D;  5AVC C;  1N1J A;  4ZUX B;  3H0M C;  2Y2H A;  4H9R A;  3AYW A;  2G5H C;  4WJ3 C;  5DNN A;  5CPK B;  3AV1 A;  2F8N B;  4H9Q B;  3MGS D;  5B1M A;  1P3A C;  4UUZ B;  3KXB B;  4NE3 A;  5B31 D;  2Y2P A;  5BO0 A;  4EO5 C;  3LEL C;  3AZH C;  4YS3 B;  1N1J B;  4J8V D;  2Y2K A;  1KX4 D;  4Z5T A;  3WAA D;  4H9R B;  3UTA D;  2Y2G A;  3AYW B;  4J8U D;  2FJ7 A;  3C1B A;  5DNN B;  5F99 D;  1ZLA D;  5B24 D;  3AV1 B;  1M19 D;  4WZS B;  3VH5 T;  5B1M B;  4XZQ D;  3REI D;  4KUD A;  1T3U A;  5BO0 B;  4DRB A;  3A1K A;  1WWS A;  3B0B A;  3AZM D;  1S32 A;  4Z5T B;  1B67 A;  5B2J D;  3AV2 A;  3W97 D;  3H0L C;  4Z66 D;  3LZ1 C;  1ID3 C;  3C1B B;  2FJ7 B;  4YM6 C;  3O62 C;  3X1U C;  5JA4 A;  3X1S D;  3AFA A;  5GT3 D;  2BYM A;  5FUG A;  5B32 D;  4CAY A;  5AV5 D;  4KUD B;  4KGC A;  5BS7 A;  3A6N C;  1P3K A;  1S32 B;  5B31 G;  3AV2 B;  3REK A;  3KUY D;  5GSU B;  3REJ A;  3WAA A;  2RIQ A;  1U35 D;  3B6G A;  5JA4 B;  3REL C;  3AFA B;  3UTB A;  5FUG B;  4CAY B;  1HQ3 C;  2UWX A;  4ZBJ B;  2RVQ C;  3AN2 C;  3EPH A;  3NQU A;  2Y2O A;  1EQZ A;  5AV6 D;  4KGC B;  3EPL A;  3EPJ A;  3AZG C;  5C3I B;  1P3K B;  3AZI C;  3KWQ A;  2HUE C;  3W99 A;  3REK B;  3REJ B;  1P3L C;  3MGR A;  3WKJ A;  5E5A D;  1M1A A;  3B6G B;  3UTB B;  2CWE A;  3X1V C;  1A7W A;  3NQU B;  3MNN C;  1EQZ B;  3VH5 W;  5B2I D;  4AWL B;  3KWQ B;  3WA9 C;  5B32 G;  3IP4 C;  3W99 B;  5AVC A;  5G49 A;  4J8X C;  3MGR B;  1P3F D;  3VH6 A;  3WKJ B;  1ID3 D;  1M1A B;  3O62 D;  2YFV A;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...