4HGAC

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/apoptosis
molecule keywords Death domain-associated protein 6
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4hgaC00
5AVCA 4Z2MH 1F66B 3AZNA 3REJC 1P3PA 5B32G 3WTPC 5B2JB 3W98B 3UT9D 4J8UD 4EO5B 1ID3B 3KUYC 4YS3D 5BNXB 3W96A 5AVCD 3WKJC 4QLCD 3AZND 5AV5D 1ZLAA 1P3PD 2NZDA 5BO0B 5JA4A 2YFVB 3MVDB 4WU8C 2LY8A 3TU4A 3KWQD 3AZLA 4XUJA 3LJAC 1TZYD 4J8WB 5E5AB 3AYWB 5CPJC 3B6GC 5AVBB 1AOID 4H9SC 3X1VA 3LELD 4J8VD 5GSUD 5FUGB 5BNVB 4Z66C 5CPKA 5CPID 1P3FB 2AROD 5AV6D 2F8NA 1P34A 2NZDD 1KX4A 3REKA 3AZJD 2HIOC 4HGAB 3B6FA 1KX3C 1B6WA 3AV1C 5B40A 3LZ0C 4H9QA 5AV8A 4X23C 4DRAA 3X1VD 1EQZD 1P3GD 2BYMA 1HQ3C 5CPKD 3W99A 5AV9B 1U35C 4WU9C 4Z5TC 2F8ND 3AN2C 1P3IB 5CP6B 1S32D 4UUZA 3MNND 3AZHA 5B1LC 1N1JA 2RVQD 4R8PB 3LZ1C 5AV8D 3MGPB 3A6NA 1P3OA 3AZIB 5B33A 3UT9C 3X1SA 3X1UA 1P3BD 4CAYB 1M19D 3AZHD 5KDMA 3AFAA 1KX5D 5AVCC 3AZNC 5AV5C 1P3PC 3AV2D 1P3OD 3AZEB 3MGRA 3MGSD 3KWQC 2L5AA 3X1SD 4KGCA 5B31G 5B24A 1M18D 3V9RA 4XZQD 4G91C 3AZGB 3O62B 5DNNA 4KHAB 2YFWA 3UTAA 1ZLAC 2CV5A 3NQUA 5AV6C 1P3AA 2NZDC 1TAFA 3UTBB 3MGRD 5DNMD 3TU4C 1P3KA 4WU8A 2PYOB 4XUJC 3C1CA 5GT0B 1P3LA 4CSRB 4NE6A 5B24D 3AZFD 3LJAA 4KUDD 2JSSA 3X1VC 4WNNB 4NE3A 5DNND 3REIA 3UTAD 3KXBB 4WV4B 3WTPE 5CPKC 3REJB 1P3AD 1M1AA 1P34C 3WTPB 1KX4C 3REKC 5B0ZB 3C1CD 3WAAD 5GXQA 3KUYB 1R4VA 5CHLB 1KX3A 5B40C 5AV8C 3WKJB 3W99C 4LD9D 1U35A 3WA9A 2HUEC 3AZKD 4ZUXD 3AZHC 5B32B 3B6GB 5CPJB 3X1TD 1P3MA 5F99D 3RELA 4Z66B 3A6NC 3MGQA 1P3OC 5B33C 4ZBJC 4H9RA 2CWEA 3VH5T 3X1SC 3WA9D 3X1UC 3UT9A 4J8UA 5JRGA 1BH8B 2HIOB 4H9PA 4YS3A 3AV1B 3AFAC 3LZ0B 4X23B 3RELD 4QLCA 5AV5A 1HQ3B 2FJ7A 3MGQD 4H9NA 3MGRC 4WU9B 4Z5TB 5DNMC 3KWQA 4KGCC 5B0YD 4YM6D 5B24C 4KUDC 1TZYA 5JRGD 5B1LB 5GT3A 5DNNC 1AOIA 3LZ1B 3UTAC 3LELA 5B1MA 4J8VA 5GSUA 4M6BA 5BO0A 5CPIA 2CV5C 1P3AC 1ULYA 2AROA 2FJ7D 3W98D 5AV6A 1P3KC 1ID3D 3C1CC 5E5AA 1P3LC 3AZJA 5GT3D 3REIC 1EQZA 5B1MD 1P3GA 3AZNB 1M1AC 4E44A 4ZUXC 4NE5A 4J8WD 5E5AD 1S32A 5GXQC 5AVBD 3MNNA 3W97A 3VH6W 3W96B 4G91B 5F99C 1JFIB 2BYKA 3NQJA 1ZLAB 5CP6A 2NZDB 5JA4B 3C1BA 5BS7A 3REHA 3TU4B 3AZLB 3WA9C 4XUJB 1P3BA 1M19A 3W97D 1P3MC 3X1VB 1KX5A 5B31B 3RELC 4G92C 5CPKB 3MGQC 1P3ID 5CP6D 3AV2A 2F8NB 1P34B 3C1BD 3MGSA 1KX4B 3REHD 3REKB 4J8UC 3B0CW 5JRGC 4R8PD 1M18A 2F8NK 3B6FB 4YS3C 2NQBB 3MGPD 4XZQA 5B40B 4H9QB 3R45A 2BYMB 4QLCC 2FJ7C 3W99B 4EO5C 5DNMA 2HUEB 4UUZB 3AZHB 1TZYC 3AZFA 2IO5C 4KUDA 4JJNA 4J8XA 5GT3C 1AOIC 2F8NG 3LELC 5B1MC 4J8VC 5GSUC 3AZED 5CPIC 3A6NB 2AROC 2PYOA 5B33B 4ZBJB 4CSRA 1HTAA 5E5AC 3X1UB 1BH9A 5AVBC 3AZGD 3AZJC 3WAAA 3O62D 5AY8A 2F8NH 5KDMB 4JJND 3KXBA 4J8XD 3AFAB 1EQZC 1P3GC 4LD9A 5B0ZA 2PYOD 3VH6T 5GT0D 1S32C 3AZKA 4ZUXA 4KGCB 3MNNC 5B24B 3V9RB 5AY8D 3W97C 2RVQC 3X1TA 3KXBD 5DNNB 5F99A 2YFWB 3UTAB 3REJD 1A7WA 3WTPD 5CP6C 2CV5B 3NQUB 1P3AB 5B0ZD 3C1BC 5BS7C 1WWSA 1B67A 5B32A 3REHC 4WU8B 1P3KB 1P3BC 1P3LB 1M19C 3LJAB 5BT1D 5G49A 3WKJD 1KX5C 3AZMA 3REIB 5B2IA 3B0CT 4H9OA 3AV2C 1M1AB 1Q9CA 3MGSC 5B32D 3KSYA 5B0YA 5CPJD 4YM6A 5GXQB 1M18C 3B6GD 4XZQC 1KX3B 1F66A 1H3OB 3B0BA 3AZMD 5B2ID 5B2JA 3W98A 1U35B 3VH5A 3AN2B 3WA9B 1ID3A 2HIOD 5BNXA 3AV1D 3AZFC 3LZ0D 4JJNC 4X23D 4J8XC 1P3MB 1F66D 1HQ3D 4WU9D 4Z5TD 3MVDA 2YFVA 5B2JD 2PYOC 4H9RB 3UT9B 5B1LD 4J8UB 4J8WA 3AYWA 3WAAC 5JRGB 5AY8C 5AVBA 3LZ1D 4H9PB 4YS3B 3KXBC 5FUGA 5BNVA 1P3FA 5AVCB 4QLCB 5AV5B 2FJ7B 3MVDD 4LD9C 4H9NB 5B0ZC 1P3PB 3KWQB 3AZKC 3AYWD 1TZYB 1JFIA 5BT1C 2IO5B 3X1TC 5GT3B 1AOIB 3LELB 5B1MB 5AV9A 4J8VB 1P3FD 5GSUB 5CPIB 2AROB 1P3IA 5AV6B 5B32C 4WZSB 3B0DC 4AWLC 3AZJB 3W96D 4R8PA 5B31A 3MGPA 3AZMC 1ZLAD 1EQZB 5B2IC 5AV9D 1P3GB 3AZIA 5C3IC 3TU4D 4DRBA 3AZLD 4XUJD 4CAYA 2NQBA 1S32B 5B0YC 4YM6C 3MNNB 3W97B 5B31D 1F66C 5AV8B 2BYKB 3NQJB 1P34D 3AZEA 3AZID 5B2JC 1KX4D 3W98C 3REKD 3C1BB 1WWIA 3REHB 1ID3C 2NQBD 3B6FD 1P3BB 1M19B 5B40D 3AZGA 3O62A 1N1JB 4KHAA 1KX5B 3W99D 3MVDC 3UTBA 3AV2B 1P3OB 3MGSB 5GT0A 3X1SB 4J8WC 3AYWC 3VH5W 1M18B 4WNNA 4XZQB 3R45B 3A6ND 1P3FC 3REJA 5B33D 3UTBD 3WTPA 3X1UD 3MGRB 5DNMB 4HGAC 3KUYA 3W96C 3AFAD 3AZFB 4KUDB 4JJNB 4J8XB 3WKJA 1F1EA 4NFTA 5AV9C 3AZLC 1P3IC 3VH6A 1TAFB 4KGCD 1KU5A 1BH9B 3KUYD 3C1CB 3B6GA 5CPJA 4R8PC 3WAAB 1BFMA 5AY8B 5B31C 4H9SA 3MGPC 4Z66A 2CV5D 3AZIC 1P3KD 4LD9B 4WU8D 4E45A 1P3LD 3B6FC 2NQBC 3LJAD 1BH8A 3AZKB 2HIOA 4ZUXB 3AV1A 1H3OA 3LZ0A 4X23A 3REID 3X1TB 5F99B 4Z66D 1HQ3A 1M1AD 3AZEC 4WU9A 4Z5TA 3AN2A 5GXQD 5B1LA 1KX3D 3AZGC 3B0DB 4AWLB 3O62C 3LZ1A 5G49B 4Z2MG 3AZMB 5B2IB 1U35D 3UTBC 4H9OB 3RELB 4G92B 5C3IB 3MGQB 3AN2D 5GT0C 5B0YB 4YM6B 1P3MD
chains in the Genus database with same CATH superfamily
5AVCA 4Z2MH 1F66B 3AZNA 3REJC 1P3PA 5B32G 3WTPC 5B2JB 3W98B 3UT9D 4J8UD 4EO5B 1ID3B 3KUYC 4YS3D 5BNXB 3W96A 5AVCD 3WKJC 4QLCD 3AZND 5AV5D 1ZLAA 1P3PD 2NZDA 5BO0B 5JA4A 2YFVB 3MVDB 4WU8C 2LY8A 3TU4A 3KWQD 3AZLA 4XUJA 3LJAC 1TZYD 4J8WB 5E5AB 3AYWB 5CPJC 3B6GC 5AVBB 1AOID 4H9SC 3X1VA 3LELD 4J8VD 1PZRA 5GSUD 5FUGB 5BNVB 4Z66C 5CPKA 5CPID 1P3FB 2AROD 5AV6D 2F8NA 1P34A 2NZDD 1KX4A 3REKA 3AZJD 2HIOC 4HGAB 3B6FA 1KX3C 1B6WA 3AV1C 5B40A 3LZ0C 4H9QA 5AV8A 4X23C 4DRAA 3X1VD 1EQZD 1P3GD 2BYMA 1HQ3C 5CPKD 3W99A 5AV9B 1U35C 4WU9C 4Z5TC 2F8ND 3AN2C 2XD5A 1P3IB 5CP6B 1S32D 4UUZA 3MNND 3AZHA 5B1LC 1N1JA 2Y2PA 2RVQD 4R8PB 3LZ1C 5AV8D 3MGPB 3H0RC 3A6NA 2Y2NA 1P3OA 3AZIB 5B33A 3UT9C 3X1SA 3X1UA 1P3BD 4CAYB 2W8SA 1M19D 3AZHD 5KDMA 2JE5A 3AFAA 1KX5D 5AVCC 3AZNC 5AV5C 1P3PC 3AV2D 1P3OD 3AZEB 3MGRA 3MGSD 3KWQC 2L5AA 3X1SD 2ZM5A 4KGCA 5B31G 5B24A 1M18D 3V9RA 4XZQD 4G91C 3AZGB 3O62B 5DNNA 4KHAB 2YFWA 3UTAA 1ZLAC 2CV5A 3NQUA 5AV6C 1P3AA 2NZDC 1TAFA 3UTBB 3MGRD 5DNMD 3TU4C 1P3KA 4WU8A 2PYOB 4XUJC 3C1CA 5GT0B 1P3LA 4CSRB 4NE6A 5B24D 3AZFD 3LJAA 4KUDD 2G5HC 2JSSA 3X1VC 4WNNB 4NE3A 5DNND 3REIA 1T3UA 3UTAD 3KXBB 4WV4B 3WTPE 5CPKC 3REJB 2Y2HA 1P3AD 1P34C 1M1AA 3WTPB 1KX4C 3REKC 5B0ZB 3C1CD 3WAAD 5GXQA 3KUYB 1R4VA 5CHLB 1KX3A 5B40C 5AV8C 3WKJB 3W99C 4LD9D 1U35A 3EPHA 3WA9A 2HUEC 3AZKD 4ZUXD 3AZHC 5B32B 3B6GB 5CPJB 3X1TD 1P3MA 5F99D 3RELA 4Z66B 3A6NC 3MGQA 1P3OC 5B33C 4ZBJC 4H9RA 2CWEA 3VH5T 3X1SC 3WA9D 3X1UC 3UT9A 4J8UA 5JRGA 1BH8B 2HIOB 4H9PA 3EPLA 4YS3A 3AV1B 3AFAC 3LZ0B 4X23B 3H0LC 3RELD 4QLCA 5AV5A 1HQ3B 2FJ7A 3MGQD 4H9NA 3MGRC 4WU9B 4Z5TB 5DNMC 3KWQA 2XD1A 2Y2JA 4KGCC 5B0YD 4YM6D 5B24C 4KUDC 1TZYA 4UPKA 5B1LB 5JRGD 2ZY5A 5GT3A 5DNNC 1AOIA 3LZ1B 3UTAC 3LELA 5B1MA 4J8VA 5GSUA 4M6BA 5BO0A 5CPIA 2CV5C 1P3AC 1ULYA 2AROA 2FJ7D 3W98D 5AV6A 1P3KC 1ID3D 3C1CC 5E5AA 1P3LC 3AZJA 2FFFB 5GT3D 3REIC 2JCHA 1EQZA 5B1MD 1P3GA 3AZNB 1M1AC 4E44A 4ZUXC 4NE5A 4J8WD 5E5AD 1S32A 5GXQC 5AVBD 3MNNA 3W97A 3VH6W 3W96B 4G91B 5F99C 1JFIB 2BYKA 3NQJA 2Y2LA 1ZLAB 5CP6A 2NZDB 5JA4B 3C1BA 5BS7A 3REHA 3TU4B 3AZLB 3WA9C 2F2AC 4XUJB 1P3BA 1M19A 2Y2IA 3W97D 1P3MC 3X1VB 1KX5A 5B31B 3RELC 4G92C 5CPKB 3MGQC 1P3ID 5CP6D 3AV2A 2F8NB 1P34B 3C1BD 3MGSA 1KX4B 3REHD 3REKB 4J8UC 3B0CW 4WJ3C 5JRGC 4R8PD 1M18A 2F8NK 3B6FB 4YS3C 3FDDA 2NQBB 3MGPD 4XZQA 5B40B 4H9QB 3R45A 3EPJA 2ZY2A 2BYMB 4QLCC 2FJ7C 3W99B 4EO5C 5DNMA 2HUEB 4UUZB 3AZHB 1TZYC 3AZFA 2RIQA 2IO5C 4KUDA 4JJNA 4J8XA 5GT3C 1AOIC 2F8NG 3LELC 5B1MC 4J8VC 5GSUC 3AZED 5CPIC 3A6NB 2AROC 2PYOA 5B33B 4ZBJB 4CSRA 1HTAA 5E5AC 3A1IA 3X1UB 1BH9A 5AVBC 3AZGD 2J8PA 3AZJC 3O62D 3WAAA 5AY8A 2F8NH 5KDMB 4JJND 3KXBA 4J8XD 3AFAB 1EQZC 1P3GC 4LD9A 5B0ZA 3P5JB 2PYOD 3VH6T 5GT0D 1S32C 3AZKA 4ZUXA 4KGCB 3MNNC 5B24B 3V9RB 5AY8D 3W97C 2RVQC 3X1TA 3KXBD 5DNNB 5F99A 2YFWB 3UTAB 3REJD 1A7WA 3WTPD 5CP6C 2CV5B 3NQUB 1P3AB 5B0ZD 3C1BC 5BS7C 1WWSA 1B67A 5B32A 3REHC 4WU8B 1P3KB 2Y2QA 1P3BC 1P3LB 1M19C 3LJAB 3KFUG 5BT1D 5G49A 3WKJD 1KX5C 3AZMA 3REIB 5B2IA 3B0CT 4H9OA 3AV2C 1M1AB 1Q9CA 3MGSC 5B32D 3KSYA 5B0YA 5CPJD 4YM6A 5GXQB 1M18C 3B6GD 4XZQC 1KX3B 1F66A 1H3OB 3B0BA 3AZMD 5B2ID 5B2JA 3W98A 2ZY4A 2BG1A 1U35B 3VH5A 3AN2B 3WA9B 1ID3A 2HIOD 5BNXA 3AV1D 3AZFC 3LZ0D 4JJNC 4X23D 4J8XC 1P3MB 1F66D 1HQ3D 4WU9D 4Z5TD 3MVDA 2YFVA 5B2JD 2PYOC 4H9RB 3UT9B 5B1LD 4J8UB 4J8WA 3AYWA 3WAAC 5JRGB 5AY8C 5AVBA 3LZ1D 4H9PB 4YS3B 3KXBC 5FUGA 5BNVA 1P3FA 5AVCB 4QLCB 5AV5B 2FJ7B 3MVDD 4LD9C 2G5IC 4H9NB 5B0ZC 1P3PB 3KWQB 3AZKC 2Y2OA 3AYWD 1TZYB 3EG5B 1JFIA 5BT1C 2IO5B 3X1TC 3F6TA 5GT3B 1AOIB 3LELB 5B1MB 5AV9A 4J8VB 1P3FD 5GSUB 2Y2GA 5CPIB 2AROB 1P3IA 3EPKA 5AV6B 5B32C 4WZSB 3A1KA 3B0DC 4AWLC 3AZJB 3W96D 4R8PA 5B31A 3MGPA 3AZMC 1ZLAD 1EQZB 5B2IC 5AV9D 1P3GB 3AZIA 5C3IC 3TU4D 4DRBA 3AZLD 4XUJD 4CAYA 2NQBA 1S32B 5B0YC 4YM6C 3MNNB 2DQNC 3W97B 5B31D 1F66C 5AV8B 2BYKB 3NQJB 1P34D 3AZEA 3AZID 3IP4C 5B2JC 1KX4D 3W98C 3REKD 3C1BB 1WWIA 3REHB 1ID3C 2NQBD 3B6FD 1P3BB 1M19B 5B40D 3AZGA 3O62A 1N1JB 4KHAA 1KX5B 3W99D 3MVDC 3UTBA 3AV2B 1P3OB 3MGSB 5GT0A 2UWXA 1W2EA 3X1SB 4J8WC 3AYWC 3VH5W 1M18B 4WNNA 4XZQB 3R45B 3A6ND 1P3FC 3REJA 3H0MC 5B33D 3UTBD 3WTPA 3X1UD 3MGRB 5DNMB 4HGAC 3KUYA 3W96C 3AFAD 2Y2MA 3AZFB 4KUDB 4JJNB 4J8XB 3WKJA 1F1EA 4NFTA 5AV9C 1Z2CB 3AZLC 1P3IC 3VH6A 1TAFB 4KGCD 1KU5A 1BH9B 3KUYD 3C1CB 2VQRA 3B6GA 5CPJA 4R8PC 3WAAB 1BFMA 5AY8B 5B31C 4H9SA 3MGPC 4Z66A 2CV5D 3AZIC 1P3KD 4LD9B 4WU8D 4E45A 1P3LD 2Y2KA 3B6FC 3AL0C 2NQBC 3LJAD 1BH8A 3AZKB 2HIOA 4ZUXB 3AV1A 1H3OA 3LZ0A 4X23A 3REID 3X1TB 4DQYB 5F99B 4Z66D 1HQ3A 1M1AD 3AZEC 4WU9A 4Z5TA 3AN2A 5GXQD 5B1LA 1KX3D 3AZGC 3B0DB 4AWLB 3O62C 3LZ1A 5G49B 4Z2MG 2ZY3A 3AZMB 5B2IB 2DF4C 1U35D 3UTBC 4H9OB 3RELB 4G92B 5C3IB 3MGQB 3AN2D 5GT0C 5B0YB 4YM6B 1P3MD
chains in the Genus database with same CATH topology
5AVCA 4Z2MH 1F66B 3AZNA 3REJC 1P3PA 5B32G 3WTPC 5B2JB 3W98B 3UT9D 4J8UD 4EO5B 1ID3B 3KUYC 4YS3D 5BNXB 3W96A 5AVCD 3WKJC 4QLCD 3AZND 5AV5D 1ZLAA 1P3PD 2NZDA 5BO0B 5JA4A 2YFVB 3MVDB 4WU8C 2LY8A 3TU4A 3KWQD 3AZLA 4XUJA 3LJAC 1TZYD 4J8WB 5E5AB 3AYWB 5CPJC 3B6GC 5AVBB 1AOID 4H9SC 3X1VA 3LELD 4J8VD 1PZRA 5GSUD 5FUGB 5BNVB 4Z66C 5CPKA 5CPID 1P3FB 2AROD 5AV6D 2F8NA 1P34A 2NZDD 1KX4A 3REKA 3AZJD 2HIOC 4HGAB 3B6FA 1KX3C 1B6WA 3AV1C 5B40A 3LZ0C 4H9QA 5AV8A 4X23C 4DRAA 3X1VD 1EQZD 1P3GD 2BYMA 1HQ3C 5CPKD 3W99A 5AV9B 1U35C 4WU9C 4Z5TC 2F8ND 3AN2C 2XD5A 1P3IB 5CP6B 1S32D 4UUZA 3MNND 3AZHA 5B1LC 1N1JA 2Y2PA 2RVQD 4R8PB 3LZ1C 5AV8D 3MGPB 3H0RC 3A6NA 2Y2NA 1P3OA 3AZIB 5B33A 3UT9C 3X1SA 3X1UA 1P3BD 4CAYB 2W8SA 1M19D 3AZHD 5KDMA 2JE5A 3AFAA 1KX5D 5AVCC 3AZNC 5AV5C 1P3PC 3AV2D 1P3OD 3AZEB 3MGRA 3MGSD 3KWQC 2L5AA 3X1SD 2ZM5A 4KGCA 5B31G 5B24A 1M18D 3V9RA 4XZQD 4G91C 3AZGB 3O62B 5DNNA 4KHAB 2YFWA 3UTAA 1ZLAC 2CV5A 3NQUA 5AV6C 1P3AA 2NZDC 1TAFA 3UTBB 3MGRD 5DNMD 3TU4C 1P3KA 4WU8A 2PYOB 4XUJC 3C1CA 5GT0B 1P3LA 4CSRB 4NE6A 5B24D 3AZFD 3LJAA 4KUDD 2G5HC 2JSSA 3X1VC 4WNNB 4NE3A 5DNND 3REIA 1T3UA 3UTAD 3KXBB 4WV4B 3WTPE 5CPKC 3REJB 2Y2HA 1P3AD 1P34C 1M1AA 3WTPB 1KX4C 3REKC 5B0ZB 3C1CD 3WAAD 5GXQA 3KUYB 1R4VA 5CHLB 1KX3A 5B40C 5AV8C 3WKJB 3W99C 4LD9D 1U35A 3EPHA 3WA9A 2HUEC 3AZKD 4ZUXD 3AZHC 5B32B 3B6GB 5CPJB 3X1TD 1P3MA 5F99D 3RELA 4Z66B 3A6NC 3MGQA 1P3OC 5B33C 4ZBJC 4H9RA 2CWEA 3VH5T 3X1SC 3WA9D 3X1UC 3UT9A 4J8UA 5JRGA 1BH8B 2HIOB 4H9PA 3EPLA 4YS3A 3AV1B 3AFAC 3LZ0B 4X23B 3H0LC 3RELD 4QLCA 5AV5A 1HQ3B 2FJ7A 3MGQD 4H9NA 3MGRC 4WU9B 4Z5TB 5DNMC 3KWQA 2XD1A 2Y2JA 4KGCC 5B0YD 4YM6D 5B24C 4KUDC 1TZYA 4UPKA 5B1LB 5JRGD 2ZY5A 5GT3A 5DNNC 1AOIA 3LZ1B 3UTAC 3LELA 5B1MA 4J8VA 5GSUA 4M6BA 5BO0A 5CPIA 2CV5C 1P3AC 1ULYA 2AROA 2FJ7D 3W98D 5AV6A 1P3KC 1ID3D 3C1CC 5E5AA 1P3LC 3AZJA 2FFFB 5GT3D 3REIC 2JCHA 1EQZA 5B1MD 1P3GA 3AZNB 1M1AC 4E44A 4ZUXC 4NE5A 4J8WD 5E5AD 1S32A 5GXQC 5AVBD 3MNNA 3W97A 3VH6W 3W96B 4G91B 5F99C 1JFIB 2BYKA 3NQJA 2Y2LA 1ZLAB 5CP6A 2NZDB 5JA4B 3C1BA 5BS7A 3REHA 3TU4B 3AZLB 3WA9C 2F2AC 4XUJB 1P3BA 1M19A 2Y2IA 3W97D 1P3MC 3X1VB 1KX5A 5B31B 3RELC 4G92C 5CPKB 3MGQC 1P3ID 5CP6D 3AV2A 2F8NB 1P34B 3C1BD 3MGSA 1KX4B 3REHD 3REKB 4J8UC 3B0CW 4WJ3C 5JRGC 4R8PD 1M18A 2F8NK 3B6FB 4YS3C 3FDDA 2NQBB 3MGPD 4XZQA 5B40B 4H9QB 3R45A 3EPJA 2ZY2A 2BYMB 4QLCC 2FJ7C 3W99B 4EO5C 5DNMA 2HUEB 4UUZB 3AZHB 1TZYC 3AZFA 2RIQA 2IO5C 4KUDA 4JJNA 4J8XA 5GT3C 1AOIC 2F8NG 3LELC 5B1MC 4J8VC 5GSUC 3AZED 5CPIC 3A6NB 2AROC 2PYOA 5B33B 4ZBJB 4CSRA 1HTAA 5E5AC 3A1IA 3X1UB 1BH9A 5AVBC 3AZGD 2J8PA 3AZJC 3O62D 3WAAA 5AY8A 2F8NH 5KDMB 4JJND 3KXBA 4J8XD 3AFAB 1EQZC 1P3GC 4LD9A 5B0ZA 3P5JB 2PYOD 3VH6T 5GT0D 1S32C 3AZKA 4ZUXA 4KGCB 3MNNC 5B24B 3V9RB 5AY8D 3W97C 2RVQC 3X1TA 3KXBD 5DNNB 5F99A 2YFWB 3UTAB 3REJD 1A7WA 3WTPD 5CP6C 2CV5B 3NQUB 1P3AB 5B0ZD 3C1BC 5BS7C 1WWSA 1B67A 5B32A 3REHC 4WU8B 1P3KB 2Y2QA 1P3BC 1P3LB 1M19C 3LJAB 3KFUG 5BT1D 5G49A 3WKJD 1KX5C 3AZMA 3REIB 5B2IA 3B0CT 4H9OA 3AV2C 1M1AB 1Q9CA 3MGSC 5B32D 3KSYA 5B0YA 5CPJD 4YM6A 5GXQB 1M18C 3B6GD 4XZQC 1KX3B 1F66A 1H3OB 3B0BA 3AZMD 5B2ID 5B2JA 3W98A 2ZY4A 2BG1A 1U35B 3VH5A 3AN2B 3WA9B 1ID3A 2HIOD 5BNXA 3AV1D 3AZFC 3LZ0D 4JJNC 4X23D 4J8XC 1P3MB 1F66D 1HQ3D 4WU9D 4Z5TD 3MVDA 2YFVA 5B2JD 2PYOC 4H9RB 3UT9B 5B1LD 4J8UB 4J8WA 3AYWA 3WAAC 5JRGB 5AY8C 5AVBA 3LZ1D 4H9PB 4YS3B 3KXBC 5FUGA 5BNVA 1P3FA 5AVCB 4QLCB 5AV5B 2FJ7B 3MVDD 4LD9C 2G5IC 4H9NB 5B0ZC 1P3PB 3KWQB 3AZKC 2Y2OA 3AYWD 1TZYB 3EG5B 1JFIA 5BT1C 2IO5B 3X1TC 3F6TA 5GT3B 1AOIB 3LELB 5B1MB 5AV9A 4J8VB 1P3FD 5GSUB 2Y2GA 5CPIB 2AROB 1P3IA 3EPKA 5AV6B 5B32C 4WZSB 3A1KA 3B0DC 4AWLC 3AZJB 3W96D 4R8PA 5B31A 3MGPA 3AZMC 1ZLAD 1EQZB 5B2IC 5AV9D 1P3GB 3AZIA 5C3IC 3TU4D 4DRBA 3AZLD 4XUJD 4CAYA 2NQBA 1S32B 5B0YC 4YM6C 3MNNB 2DQNC 3W97B 5B31D 1F66C 5AV8B 2BYKB 3NQJB 1P34D 3AZEA 3AZID 3IP4C 5B2JC 1KX4D 3W98C 3REKD 3C1BB 1WWIA 3REHB 1ID3C 2NQBD 3B6FD 1P3BB 1M19B 5B40D 3AZGA 3O62A 1N1JB 4KHAA 1KX5B 3W99D 3MVDC 3UTBA 3AV2B 1P3OB 3MGSB 5GT0A 2UWXA 1W2EA 3X1SB 4J8WC 3AYWC 3VH5W 1M18B 4WNNA 4XZQB 3R45B 3A6ND 1P3FC 3REJA 3H0MC 5B33D 3UTBD 3WTPA 3X1UD 3MGRB 5DNMB 4HGAC 3KUYA 3W96C 3AFAD 2Y2MA 3AZFB 4KUDB 4JJNB 4J8XB 3WKJA 1F1EA 4NFTA 5AV9C 1Z2CB 3AZLC 1P3IC 3VH6A 1TAFB 4KGCD 1KU5A 1BH9B 3KUYD 3C1CB 2VQRA 3B6GA 5CPJA 4R8PC 3WAAB 1BFMA 5AY8B 5B31C 4H9SA 3MGPC 4Z66A 2CV5D 3AZIC 1P3KD 4LD9B 4WU8D 4E45A 1P3LD 2Y2KA 3B6FC 3AL0C 2NQBC 3LJAD 1BH8A 3AZKB 2HIOA 4ZUXB 3AV1A 1H3OA 3LZ0A 4X23A 3REID 3X1TB 4DQYB 5F99B 4Z66D 1HQ3A 1M1AD 3AZEC 4WU9A 4Z5TA 3AN2A 5GXQD 5B1LA 1KX3D 3AZGC 3B0DB 4AWLB 3O62C 3LZ1A 5G49B 4Z2MG 2ZY3A 3AZMB 5B2IB 2DF4C 1U35D 3UTBC 4H9OB 3RELB 4G92B 5C3IB 3MGQB 3AN2D 5GT0C 5B0YB 4YM6B 1P3MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC A;  4Z2M H;  1F66 B;  3AZN A;  3REJ C;  1P3P A;  5B32 G;  3WTP C;  5B2J B;  3W98 B;  3UT9 D;  4J8U D;  4EO5 B;  1ID3 B;  3KUY C;  4YS3 D;  5BNX B;  3W96 A;  5AVC D;  3WKJ C;  4QLC D;  3AZN D;  5AV5 D;  1ZLA A;  1P3P D;  2NZD A;  5BO0 B;  5JA4 A;  2YFV B;  3MVD B;  4WU8 C;  2LY8 A;  3TU4 A;  3KWQ D;  3AZL A;  4XUJ A;  3LJA C;  1TZY D;  4J8W B;  5E5A B;  3AYW B;  5CPJ C;  3B6G C;  5AVB B;  1AOI D;  4H9S C;  3X1V A;  3LEL D;  4J8V D;  5GSU D;  5FUG B;  5BNV B;  4Z66 C;  5CPK A;  5CPI D;  1P3F B;  2ARO D;  5AV6 D;  2F8N A;  1P34 A;  2NZD D;  1KX4 A;  3REK A;  3AZJ D;  2HIO C;  4HGA B;  3B6F A;  1KX3 C;  1B6W A;  3AV1 C;  5B40 A;  3LZ0 C;  4H9Q A;  5AV8 A;  4X23 C;  4DRA A;  3X1V D;  1EQZ D;  1P3G D;  2BYM A;  1HQ3 C;  5CPK D;  3W99 A;  5AV9 B;  1U35 C;  4WU9 C;  4Z5T C;  2F8N D;  3AN2 C;  1P3I B;  5CP6 B;  1S32 D;  4UUZ A;  3MNN D;  3AZH A;  5B1L C;  1N1J A;  2RVQ D;  4R8P B;  3LZ1 C;  5AV8 D;  3MGP B;  3A6N A;  1P3O A;  3AZI B;  5B33 A;  3UT9 C;  3X1S A;  3X1U A;  1P3B D;  4CAY B;  1M19 D;  3AZH D;  5KDM A;  3AFA A;  1KX5 D;  5AVC C;  3AZN C;  5AV5 C;  1P3P C;  3AV2 D;  1P3O D;  3AZE B;  3MGR A;  3MGS D;  3KWQ C;  2L5A A;  3X1S D;  4KGC A;  5B31 G;  5B24 A;  1M18 D;  3V9R A;  4XZQ D;  4G91 C;  3AZG B;  3O62 B;  5DNN A;  4KHA B;  2YFW A;  3UTA A;  1ZLA C;  2CV5 A;  3NQU A;  5AV6 C;  1P3A A;  2NZD C;  1TAF A;  3UTB B;  3MGR D;  5DNM D;  3TU4 C;  1P3K A;  4WU8 A;  2PYO B;  4XUJ C;  3C1C A;  5GT0 B;  1P3L A;  4CSR B;  4NE6 A;  5B24 D;  3AZF D;  3LJA A;  4KUD D;  2JSS A;  3X1V C;  4WNN B;  4NE3 A;  5DNN D;  3REI A;  3UTA D;  3KXB B;  4WV4 B;  3WTP E;  5CPK C;  3REJ B;  1P3A D;  1M1A A;  1P34 C;  3WTP B;  1KX4 C;  3REK C;  5B0Z B;  3C1C D;  3WAA D;  5GXQ A;  3KUY B;  1R4V A;  5CHL B;  1KX3 A;  5B40 C;  5AV8 C;  3WKJ B;  3W99 C;  4LD9 D;  1U35 A;  3WA9 A;  2HUE C;  3AZK D;  4ZUX D;  3AZH C;  5B32 B;  3B6G B;  5CPJ B;  3X1T D;  1P3M A;  5F99 D;  3REL A;  4Z66 B;  3A6N C;  3MGQ A;  1P3O C;  5B33 C;  4ZBJ C;  4H9R A;  2CWE A;  3VH5 T;  3X1S C;  3WA9 D;  3X1U C;  3UT9 A;  4J8U A;  5JRG A;  1BH8 B;  2HIO B;  4H9P A;  4YS3 A;  3AV1 B;  3AFA C;  3LZ0 B;  4X23 B;  3REL D;  4QLC A;  5AV5 A;  1HQ3 B;  2FJ7 A;  3MGQ D;  4H9N A;  3MGR C;  4WU9 B;  4Z5T B;  5DNM C;  3KWQ A;  4KGC C;  5B0Y D;  4YM6 D;  5B24 C;  4KUD C;  1TZY A;  5JRG D;  5B1L B;  5GT3 A;  5DNN C;  1AOI A;  3LZ1 B;  3UTA C;  3LEL A;  5B1M A;  4J8V A;  5GSU A;  4M6B A;  5BO0 A;  5CPI A;  2CV5 C;  1P3A C;  1ULY A;  2ARO A;  2FJ7 D;  3W98 D;  5AV6 A;  1P3K C;  1ID3 D;  3C1C C;  5E5A A;  1P3L C;  3AZJ A;  5GT3 D;  3REI C;  1EQZ A;  5B1M D;  1P3G A;  3AZN B;  1M1A C;  4E44 A;  4ZUX C;  4NE5 A;  4J8W D;  5E5A D;  1S32 A;  5GXQ C;  5AVB D;  3MNN A;  3W97 A;  3VH6 W;  3W96 B;  4G91 B;  5F99 C;  1JFI B;  2BYK A;  3NQJ A;  1ZLA B;  5CP6 A;  2NZD B;  5JA4 B;  3C1B A;  5BS7 A;  3REH A;  3TU4 B;  3AZL B;  3WA9 C;  4XUJ B;  1P3B A;  1M19 A;  3W97 D;  1P3M C;  3X1V B;  1KX5 A;  5B31 B;  3REL C;  4G92 C;  5CPK B;  3MGQ C;  1P3I D;  5CP6 D;  3AV2 A;  2F8N B;  1P34 B;  3C1B D;  3MGS A;  1KX4 B;  3REH D;  3REK B;  4J8U C;  3B0C W;  5JRG C;  4R8P D;  1M18 A;  2F8N K;  3B6F B;  4YS3 C;  2NQB B;  3MGP D;  4XZQ A;  5B40 B;  4H9Q B;  3R45 A;  2BYM B;  4QLC C;  2FJ7 C;  3W99 B;  4EO5 C;  5DNM A;  2HUE B;  4UUZ B;  3AZH B;  1TZY C;  3AZF A;  2IO5 C;  4KUD A;  4JJN A;  4J8X A;  5GT3 C;  1AOI C;  2F8N G;  3LEL C;  5B1M C;  4J8V C;  5GSU C;  3AZE D;  5CPI C;  3A6N B;  2ARO C;  2PYO A;  5B33 B;  4ZBJ B;  4CSR A;  1HTA A;  5E5A C;  3X1U B;  1BH9 A;  5AVB C;  3AZG D;  3AZJ C;  3WAA A;  3O62 D;  5AY8 A;  2F8N H;  5KDM B;  4JJN D;  3KXB A;  4J8X D;  3AFA B;  1EQZ C;  1P3G C;  4LD9 A;  5B0Z A;  2PYO D;  3VH6 T;  5GT0 D;  1S32 C;  3AZK A;  4ZUX A;  4KGC B;  3MNN C;  5B24 B;  3V9R B;  5AY8 D;  3W97 C;  2RVQ C;  3X1T A;  3KXB D;  5DNN B;  5F99 A;  2YFW B;  3UTA B;  3REJ D;  1A7W A;  3WTP D;  5CP6 C;  2CV5 B;  3NQU B;  1P3A B;  5B0Z D;  3C1B C;  5BS7 C;  1WWS A;  1B67 A;  5B32 A;  3REH C;  4WU8 B;  1P3K B;  1P3B C;  1P3L B;  1M19 C;  3LJA B;  5BT1 D;  5G49 A;  3WKJ D;  1KX5 C;  3AZM A;  3REI B;  5B2I A;  3B0C T;  4H9O A;  3AV2 C;  1M1A B;  1Q9C A;  3MGS C;  5B32 D;  3KSY A;  5B0Y A;  5CPJ D;  4YM6 A;  5GXQ B;  1M18 C;  3B6G D;  4XZQ C;  1KX3 B;  1F66 A;  1H3O B;  3B0B A;  3AZM D;  5B2I D;  5B2J A;  3W98 A;  1U35 B;  3VH5 A;  3AN2 B;  3WA9 B;  1ID3 A;  2HIO D;  5BNX A;  3AV1 D;  3AZF C;  3LZ0 D;  4JJN C;  4X23 D;  4J8X C;  1P3M B;  1F66 D;  1HQ3 D;  4WU9 D;  4Z5T D;  3MVD A;  2YFV A;  5B2J D;  2PYO C;  4H9R B;  3UT9 B;  5B1L D;  4J8U B;  4J8W A;  3AYW A;  3WAA C;  5JRG B;  5AY8 C;  5AVB A;  3LZ1 D;  4H9P B;  4YS3 B;  3KXB C;  5FUG A;  5BNV A;  1P3F A;  5AVC B;  4QLC B;  5AV5 B;  2FJ7 B;  3MVD D;  4LD9 C;  4H9N B;  5B0Z C;  1P3P B;  3KWQ B;  3AZK C;  3AYW D;  1TZY B;  1JFI A;  5BT1 C;  2IO5 B;  3X1T C;  5GT3 B;  1AOI B;  3LEL B;  5B1M B;  5AV9 A;  4J8V B;  1P3F D;  5GSU B;  5CPI B;  2ARO B;  1P3I A;  5AV6 B;  5B32 C;  4WZS B;  3B0D C;  4AWL C;  3AZJ B;  3W96 D;  4R8P A;  5B31 A;  3MGP A;  3AZM C;  1ZLA D;  1EQZ B;  5B2I C;  5AV9 D;  1P3G B;  3AZI A;  5C3I C;  3TU4 D;  4DRB A;  3AZL D;  4XUJ D;  4CAY A;  2NQB A;  1S32 B;  5B0Y C;  4YM6 C;  3MNN B;  3W97 B;  5B31 D;  1F66 C;  5AV8 B;  2BYK B;  3NQJ B;  1P34 D;  3AZE A;  3AZI D;  5B2J C;  1KX4 D;  3W98 C;  3REK D;  3C1B B;  1WWI A;  3REH B;  1ID3 C;  2NQB D;  3B6F D;  1P3B B;  1M19 B;  5B40 D;  3AZG A;  3O62 A;  1N1J B;  4KHA A;  1KX5 B;  3W99 D;  3MVD C;  3UTB A;  3AV2 B;  1P3O B;  3MGS B;  5GT0 A;  3X1S B;  4J8W C;  3AYW C;  3VH5 W;  1M18 B;  4WNN A;  4XZQ B;  3R45 B;  3A6N D;  1P3F C;  3REJ A;  5B33 D;  3UTB D;  3WTP A;  3X1U D;  3MGR B;  5DNM B;  4HGA C;  3KUY A;  3W96 C;  3AFA D;  3AZF B;  4KUD B;  4JJN B;  4J8X B;  3WKJ A;  1F1E A;  4NFT A;  5AV9 C;  3AZL C;  1P3I C;  3VH6 A;  1TAF B;  4KGC D;  1KU5 A;  1BH9 B;  3KUY D;  3C1C B;  3B6G A;  5CPJ A;  4R8P C;  3WAA B;  1BFM A;  5AY8 B;  5B31 C;  4H9S A;  3MGP C;  4Z66 A;  2CV5 D;  3AZI C;  1P3K D;  4LD9 B;  4WU8 D;  4E45 A;  1P3L D;  3B6F C;  2NQB C;  3LJA D;  1BH8 A;  3AZK B;  2HIO A;  4ZUX B;  3AV1 A;  1H3O A;  3LZ0 A;  4X23 A;  3REI D;  3X1T B;  5F99 B;  4Z66 D;  1HQ3 A;  1M1A D;  3AZE C;  4WU9 A;  4Z5T A;  3AN2 A;  5GXQ D;  5B1L A;  1KX3 D;  3AZG C;  3B0D B;  4AWL B;  3O62 C;  3LZ1 A;  5G49 B;  4Z2M G;  3AZM B;  5B2I B;  1U35 D;  3UTB C;  4H9O B;  3REL B;  4G92 B;  5C3I B;  3MGQ B;  3AN2 D;  5GT0 C;  5B0Y B;  4YM6 B;  1P3M D; 
#chains in the Genus database with same CATH topology
 5AVC A;  4Z2M H;  1F66 B;  3AZN A;  3REJ C;  1P3P A;  5B32 G;  3WTP C;  5B2J B;  3W98 B;  3UT9 D;  4J8U D;  4EO5 B;  1ID3 B;  3KUY C;  4YS3 D;  5BNX B;  3W96 A;  5AVC D;  3WKJ C;  4QLC D;  3AZN D;  5AV5 D;  1ZLA A;  1P3P D;  2NZD A;  5BO0 B;  5JA4 A;  2YFV B;  3MVD B;  4WU8 C;  2LY8 A;  3TU4 A;  3KWQ D;  3AZL A;  4XUJ A;  3LJA C;  1TZY D;  4J8W B;  5E5A B;  3AYW B;  5CPJ C;  3B6G C;  5AVB B;  1AOI D;  4H9S C;  3X1V A;  3LEL D;  4J8V D;  1PZR A;  5GSU D;  5FUG B;  5BNV B;  4Z66 C;  5CPK A;  5CPI D;  1P3F B;  2ARO D;  5AV6 D;  2F8N A;  1P34 A;  2NZD D;  1KX4 A;  3REK A;  3AZJ D;  2HIO C;  4HGA B;  3B6F A;  1KX3 C;  1B6W A;  3AV1 C;  5B40 A;  3LZ0 C;  4H9Q A;  5AV8 A;  4X23 C;  4DRA A;  3X1V D;  1EQZ D;  1P3G D;  2BYM A;  1HQ3 C;  5CPK D;  3W99 A;  5AV9 B;  1U35 C;  4WU9 C;  4Z5T C;  2F8N D;  3AN2 C;  2XD5 A;  1P3I B;  5CP6 B;  1S32 D;  4UUZ A;  3MNN D;  3AZH A;  5B1L C;  1N1J A;  2Y2P A;  2RVQ D;  4R8P B;  3LZ1 C;  5AV8 D;  3MGP B;  3H0R C;  3A6N A;  2Y2N A;  1P3O A;  3AZI B;  5B33 A;  3UT9 C;  3X1S A;  3X1U A;  1P3B D;  4CAY B;  2W8S A;  1M19 D;  3AZH D;  5KDM A;  2JE5 A;  3AFA A;  1KX5 D;  5AVC C;  3AZN C;  5AV5 C;  1P3P C;  3AV2 D;  1P3O D;  3AZE B;  3MGR A;  3MGS D;  3KWQ C;  2L5A A;  3X1S D;  2ZM5 A;  4KGC A;  5B31 G;  5B24 A;  1M18 D;  3V9R A;  4XZQ D;  4G91 C;  3AZG B;  3O62 B;  5DNN A;  4KHA B;  2YFW A;  3UTA A;  1ZLA C;  2CV5 A;  3NQU A;  5AV6 C;  1P3A A;  2NZD C;  1TAF A;  3UTB B;  3MGR D;  5DNM D;  3TU4 C;  1P3K A;  4WU8 A;  2PYO B;  4XUJ C;  3C1C A;  5GT0 B;  1P3L A;  4CSR B;  4NE6 A;  5B24 D;  3AZF D;  3LJA A;  4KUD D;  2G5H C;  2JSS A;  3X1V C;  4WNN B;  4NE3 A;  5DNN D;  3REI A;  1T3U A;  3UTA D;  3KXB B;  4WV4 B;  3WTP E;  5CPK C;  3REJ B;  2Y2H A;  1P3A D;  1P34 C;  1M1A A;  3WTP B;  1KX4 C;  3REK C;  5B0Z B;  3C1C D;  3WAA D;  5GXQ A;  3KUY B;  1R4V A;  5CHL B;  1KX3 A;  5B40 C;  5AV8 C;  3WKJ B;  3W99 C;  4LD9 D;  1U35 A;  3EPH A;  3WA9 A;  2HUE C;  3AZK D;  4ZUX D;  3AZH C;  5B32 B;  3B6G B;  5CPJ B;  3X1T D;  1P3M A;  5F99 D;  3REL A;  4Z66 B;  3A6N C;  3MGQ A;  1P3O C;  5B33 C;  4ZBJ C;  4H9R A;  2CWE A;  3VH5 T;  3X1S C;  3WA9 D;  3X1U C;  3UT9 A;  4J8U A;  5JRG A;  1BH8 B;  2HIO B;  4H9P A;  3EPL A;  4YS3 A;  3AV1 B;  3AFA C;  3LZ0 B;  4X23 B;  3H0L C;  3REL D;  4QLC A;  5AV5 A;  1HQ3 B;  2FJ7 A;  3MGQ D;  4H9N A;  3MGR C;  4WU9 B;  4Z5T B;  5DNM C;  3KWQ A;  2XD1 A;  2Y2J A;  4KGC C;  5B0Y D;  4YM6 D;  5B24 C;  4KUD C;  1TZY A;  4UPK A;  5B1L B;  5JRG D;  2ZY5 A;  5GT3 A;  5DNN C;  1AOI A;  3LZ1 B;  3UTA C;  3LEL A;  5B1M A;  4J8V A;  5GSU A;  4M6B A;  5BO0 A;  5CPI A;  2CV5 C;  1P3A C;  1ULY A;  2ARO A;  2FJ7 D;  3W98 D;  5AV6 A;  1P3K C;  1ID3 D;  3C1C C;  5E5A A;  1P3L C;  3AZJ A;  2FFF B;  5GT3 D;  3REI C;  2JCH A;  1EQZ A;  5B1M D;  1P3G A;  3AZN B;  1M1A C;  4E44 A;  4ZUX C;  4NE5 A;  4J8W D;  5E5A D;  1S32 A;  5GXQ C;  5AVB D;  3MNN A;  3W97 A;  3VH6 W;  3W96 B;  4G91 B;  5F99 C;  1JFI B;  2BYK A;  3NQJ A;  2Y2L A;  1ZLA B;  5CP6 A;  2NZD B;  5JA4 B;  3C1B A;  5BS7 A;  3REH A;  3TU4 B;  3AZL B;  3WA9 C;  2F2A C;  4XUJ B;  1P3B A;  1M19 A;  2Y2I A;  3W97 D;  1P3M C;  3X1V B;  1KX5 A;  5B31 B;  3REL C;  4G92 C;  5CPK B;  3MGQ C;  1P3I D;  5CP6 D;  3AV2 A;  2F8N B;  1P34 B;  3C1B D;  3MGS A;  1KX4 B;  3REH D;  3REK B;  4J8U C;  3B0C W;  4WJ3 C;  5JRG C;  4R8P D;  1M18 A;  2F8N K;  3B6F B;  4YS3 C;  3FDD A;  2NQB B;  3MGP D;  4XZQ A;  5B40 B;  4H9Q B;  3R45 A;  3EPJ A;  2ZY2 A;  2BYM B;  4QLC C;  2FJ7 C;  3W99 B;  4EO5 C;  5DNM A;  2HUE B;  4UUZ B;  3AZH B;  1TZY C;  3AZF A;  2RIQ A;  2IO5 C;  4KUD A;  4JJN A;  4J8X A;  5GT3 C;  1AOI C;  2F8N G;  3LEL C;  5B1M C;  4J8V C;  5GSU C;  3AZE D;  5CPI C;  3A6N B;  2ARO C;  2PYO A;  5B33 B;  4ZBJ B;  4CSR A;  1HTA A;  5E5A C;  3A1I A;  3X1U B;  1BH9 A;  5AVB C;  3AZG D;  2J8P A;  3AZJ C;  3O62 D;  3WAA A;  5AY8 A;  2F8N H;  5KDM B;  4JJN D;  3KXB A;  4J8X D;  3AFA B;  1EQZ C;  1P3G C;  4LD9 A;  5B0Z A;  3P5J B;  2PYO D;  3VH6 T;  5GT0 D;  1S32 C;  3AZK A;  4ZUX A;  4KGC B;  3MNN C;  5B24 B;  3V9R B;  5AY8 D;  3W97 C;  2RVQ C;  3X1T A;  3KXB D;  5DNN B;  5F99 A;  2YFW B;  3UTA B;  3REJ D;  1A7W A;  3WTP D;  5CP6 C;  2CV5 B;  3NQU B;  1P3A B;  5B0Z D;  3C1B C;  5BS7 C;  1WWS A;  1B67 A;  5B32 A;  3REH C;  4WU8 B;  1P3K B;  2Y2Q A;  1P3B C;  1P3L B;  1M19 C;  3LJA B;  3KFU G;  5BT1 D;  5G49 A;  3WKJ D;  1KX5 C;  3AZM A;  3REI B;  5B2I A;  3B0C T;  4H9O A;  3AV2 C;  1M1A B;  1Q9C A;  3MGS C;  5B32 D;  3KSY A;  5B0Y A;  5CPJ D;  4YM6 A;  5GXQ B;  1M18 C;  3B6G D;  4XZQ C;  1KX3 B;  1F66 A;  1H3O B;  3B0B A;  3AZM D;  5B2I D;  5B2J A;  3W98 A;  2ZY4 A;  2BG1 A;  1U35 B;  3VH5 A;  3AN2 B;  3WA9 B;  1ID3 A;  2HIO D;  5BNX A;  3AV1 D;  3AZF C;  3LZ0 D;  4JJN C;  4X23 D;  4J8X C;  1P3M B;  1F66 D;  1HQ3 D;  4WU9 D;  4Z5T D;  3MVD A;  2YFV A;  5B2J D;  2PYO C;  4H9R B;  3UT9 B;  5B1L D;  4J8U B;  4J8W A;  3AYW A;  3WAA C;  5JRG B;  5AY8 C;  5AVB A;  3LZ1 D;  4H9P B;  4YS3 B;  3KXB C;  5FUG A;  5BNV A;  1P3F A;  5AVC B;  4QLC B;  5AV5 B;  2FJ7 B;  3MVD D;  4LD9 C;  2G5I C;  4H9N B;  5B0Z C;  1P3P B;  3KWQ B;  3AZK C;  2Y2O A;  3AYW D;  1TZY B;  3EG5 B;  1JFI A;  5BT1 C;  2IO5 B;  3X1T C;  3F6T A;  5GT3 B;  1AOI B;  3LEL B;  5B1M B;  5AV9 A;  4J8V B;  1P3F D;  5GSU B;  2Y2G A;  5CPI B;  2ARO B;  1P3I A;  3EPK A;  5AV6 B;  5B32 C;  4WZS B;  3A1K A;  3B0D C;  4AWL C;  3AZJ B;  3W96 D;  4R8P A;  5B31 A;  3MGP A;  3AZM C;  1ZLA D;  1EQZ B;  5B2I C;  5AV9 D;  1P3G B;  3AZI A;  5C3I C;  3TU4 D;  4DRB A;  3AZL D;  4XUJ D;  4CAY A;  2NQB A;  1S32 B;  5B0Y C;  4YM6 C;  3MNN B;  2DQN C;  3W97 B;  5B31 D;  1F66 C;  5AV8 B;  2BYK B;  3NQJ B;  1P34 D;  3AZE A;  3AZI D;  3IP4 C;  5B2J C;  1KX4 D;  3W98 C;  3REK D;  3C1B B;  1WWI A;  3REH B;  1ID3 C;  2NQB D;  3B6F D;  1P3B B;  1M19 B;  5B40 D;  3AZG A;  3O62 A;  1N1J B;  4KHA A;  1KX5 B;  3W99 D;  3MVD C;  3UTB A;  3AV2 B;  1P3O B;  3MGS B;  5GT0 A;  2UWX A;  1W2E A;  3X1S B;  4J8W C;  3AYW C;  3VH5 W;  1M18 B;  4WNN A;  4XZQ B;  3R45 B;  3A6N D;  1P3F C;  3REJ A;  3H0M C;  5B33 D;  3UTB D;  3WTP A;  3X1U D;  3MGR B;  5DNM B;  4HGA C;  3KUY A;  3W96 C;  3AFA D;  2Y2M A;  3AZF B;  4KUD B;  4JJN B;  4J8X B;  3WKJ A;  1F1E A;  4NFT A;  5AV9 C;  1Z2C B;  3AZL C;  1P3I C;  3VH6 A;  1TAF B;  4KGC D;  1KU5 A;  1BH9 B;  3KUY D;  3C1C B;  2VQR A;  3B6G A;  5CPJ A;  4R8P C;  3WAA B;  1BFM A;  5AY8 B;  5B31 C;  4H9S A;  3MGP C;  4Z66 A;  2CV5 D;  3AZI C;  1P3K D;  4LD9 B;  4WU8 D;  4E45 A;  1P3L D;  2Y2K A;  3B6F C;  3AL0 C;  2NQB C;  3LJA D;  1BH8 A;  3AZK B;  2HIO A;  4ZUX B;  3AV1 A;  1H3O A;  3LZ0 A;  4X23 A;  3REI D;  3X1T B;  4DQY B;  5F99 B;  4Z66 D;  1HQ3 A;  1M1A D;  3AZE C;  4WU9 A;  4Z5T A;  3AN2 A;  5GXQ D;  5B1L A;  1KX3 D;  3AZG C;  3B0D B;  4AWL B;  3O62 C;  3LZ1 A;  5G49 B;  4Z2M G;  2ZY3 A;  3AZM B;  5B2I B;  2DF4 C;  1U35 D;  3UTB C;  4H9O B;  3REL B;  4G92 B;  5C3I B;  3MGQ B;  3AN2 D;  5GT0 C;  5B0Y B;  4YM6 B;  1P3M D; 
#chains in the Genus database with same CATH homology
 5AVC A;  4Z2M H;  1F66 B;  3AZN A;  3REJ C;  1P3P A;  5B32 G;  3WTP C;  5B2J B;  3W98 B;  3UT9 D;  4J8U D;  4EO5 B;  1ID3 B;  3KUY C;  4YS3 D;  5BNX B;  3W96 A;  5AVC D;  3WKJ C;  4QLC D;  3AZN D;  5AV5 D;  1ZLA A;  1P3P D;  2NZD A;  5BO0 B;  5JA4 A;  2YFV B;  3MVD B;  4WU8 C;  2LY8 A;  3TU4 A;  3KWQ D;  3AZL A;  4XUJ A;  3LJA C;  1TZY D;  4J8W B;  5E5A B;  3AYW B;  5CPJ C;  3B6G C;  5AVB B;  1AOI D;  4H9S C;  3X1V A;  3LEL D;  4J8V D;  1PZR A;  5GSU D;  5FUG B;  5BNV B;  4Z66 C;  5CPK A;  5CPI D;  1P3F B;  2ARO D;  5AV6 D;  2F8N A;  1P34 A;  2NZD D;  1KX4 A;  3REK A;  3AZJ D;  2HIO C;  4HGA B;  3B6F A;  1KX3 C;  1B6W A;  3AV1 C;  5B40 A;  3LZ0 C;  4H9Q A;  5AV8 A;  4X23 C;  4DRA A;  3X1V D;  1EQZ D;  1P3G D;  2BYM A;  1HQ3 C;  5CPK D;  3W99 A;  5AV9 B;  1U35 C;  4WU9 C;  4Z5T C;  2F8N D;  3AN2 C;  2XD5 A;  1P3I B;  5CP6 B;  1S32 D;  4UUZ A;  3MNN D;  3AZH A;  5B1L C;  1N1J A;  2Y2P A;  2RVQ D;  4R8P B;  3LZ1 C;  5AV8 D;  3MGP B;  3H0R C;  3A6N A;  2Y2N A;  1P3O A;  3AZI B;  5B33 A;  3UT9 C;  3X1S A;  3X1U A;  1P3B D;  4CAY B;  2W8S A;  1M19 D;  3AZH D;  5KDM A;  2JE5 A;  3AFA A;  1KX5 D;  5AVC C;  3AZN C;  5AV5 C;  1P3P C;  3AV2 D;  1P3O D;  3AZE B;  3MGR A;  3MGS D;  3KWQ C;  2L5A A;  3X1S D;  2ZM5 A;  4KGC A;  5B31 G;  5B24 A;  1M18 D;  3V9R A;  4XZQ D;  4G91 C;  3AZG B;  3O62 B;  5DNN A;  4KHA B;  2YFW A;  3UTA A;  1ZLA C;  2CV5 A;  3NQU A;  5AV6 C;  1P3A A;  2NZD C;  1TAF A;  3UTB B;  3MGR D;  5DNM D;  3TU4 C;  1P3K A;  4WU8 A;  2PYO B;  4XUJ C;  3C1C A;  5GT0 B;  1P3L A;  4CSR B;  4NE6 A;  5B24 D;  3AZF D;  3LJA A;  4KUD D;  2G5H C;  2JSS A;  3X1V C;  4WNN B;  4NE3 A;  5DNN D;  3REI A;  1T3U A;  3UTA D;  3KXB B;  4WV4 B;  3WTP E;  5CPK C;  3REJ B;  2Y2H A;  1P3A D;  1P34 C;  1M1A A;  3WTP B;  1KX4 C;  3REK C;  5B0Z B;  3C1C D;  3WAA D;  5GXQ A;  3KUY B;  1R4V A;  5CHL B;  1KX3 A;  5B40 C;  5AV8 C;  3WKJ B;  3W99 C;  4LD9 D;  1U35 A;  3EPH A;  3WA9 A;  2HUE C;  3AZK D;  4ZUX D;  3AZH C;  5B32 B;  3B6G B;  5CPJ B;  3X1T D;  1P3M A;  5F99 D;  3REL A;  4Z66 B;  3A6N C;  3MGQ A;  1P3O C;  5B33 C;  4ZBJ C;  4H9R A;  2CWE A;  3VH5 T;  3X1S C;  3WA9 D;  3X1U C;  3UT9 A;  4J8U A;  5JRG A;  1BH8 B;  2HIO B;  4H9P A;  3EPL A;  4YS3 A;  3AV1 B;  3AFA C;  3LZ0 B;  4X23 B;  3H0L C;  3REL D;  4QLC A;  5AV5 A;  1HQ3 B;  2FJ7 A;  3MGQ D;  4H9N A;  3MGR C;  4WU9 B;  4Z5T B;  5DNM C;  3KWQ A;  2XD1 A;  2Y2J A;  4KGC C;  5B0Y D;  4YM6 D;  5B24 C;  4KUD C;  1TZY A;  4UPK A;  5B1L B;  5JRG D;  2ZY5 A;  5GT3 A;  5DNN C;  1AOI A;  3LZ1 B;  3UTA C;  3LEL A;  5B1M A;  4J8V A;  5GSU A;  4M6B A;  5BO0 A;  5CPI A;  2CV5 C;  1P3A C;  1ULY A;  2ARO A;  2FJ7 D;  3W98 D;  5AV6 A;  1P3K C;  1ID3 D;  3C1C C;  5E5A A;  1P3L C;  3AZJ A;  2FFF B;  5GT3 D;  3REI C;  2JCH A;  1EQZ A;  5B1M D;  1P3G A;  3AZN B;  1M1A C;  4E44 A;  4ZUX C;  4NE5 A;  4J8W D;  5E5A D;  1S32 A;  5GXQ C;  5AVB D;  3MNN A;  3W97 A;  3VH6 W;  3W96 B;  4G91 B;  5F99 C;  1JFI B;  2BYK A;  3NQJ A;  2Y2L A;  1ZLA B;  5CP6 A;  2NZD B;  5JA4 B;  3C1B A;  5BS7 A;  3REH A;  3TU4 B;  3AZL B;  3WA9 C;  2F2A C;  4XUJ B;  1P3B A;  1M19 A;  2Y2I A;  3W97 D;  1P3M C;  3X1V B;  1KX5 A;  5B31 B;  3REL C;  4G92 C;  5CPK B;  3MGQ C;  1P3I D;  5CP6 D;  3AV2 A;  2F8N B;  1P34 B;  3C1B D;  3MGS A;  1KX4 B;  3REH D;  3REK B;  4J8U C;  3B0C W;  4WJ3 C;  5JRG C;  4R8P D;  1M18 A;  2F8N K;  3B6F B;  4YS3 C;  3FDD A;  2NQB B;  3MGP D;  4XZQ A;  5B40 B;  4H9Q B;  3R45 A;  3EPJ A;  2ZY2 A;  2BYM B;  4QLC C;  2FJ7 C;  3W99 B;  4EO5 C;  5DNM A;  2HUE B;  4UUZ B;  3AZH B;  1TZY C;  3AZF A;  2RIQ A;  2IO5 C;  4KUD A;  4JJN A;  4J8X A;  5GT3 C;  1AOI C;  2F8N G;  3LEL C;  5B1M C;  4J8V C;  5GSU C;  3AZE D;  5CPI C;  3A6N B;  2ARO C;  2PYO A;  5B33 B;  4ZBJ B;  4CSR A;  1HTA A;  5E5A C;  3A1I A;  3X1U B;  1BH9 A;  5AVB C;  3AZG D;  2J8P A;  3AZJ C;  3O62 D;  3WAA A;  5AY8 A;  2F8N H;  5KDM B;  4JJN D;  3KXB A;  4J8X D;  3AFA B;  1EQZ C;  1P3G C;  4LD9 A;  5B0Z A;  3P5J B;  2PYO D;  3VH6 T;  5GT0 D;  1S32 C;  3AZK A;  4ZUX A;  4KGC B;  3MNN C;  5B24 B;  3V9R B;  5AY8 D;  3W97 C;  2RVQ C;  3X1T A;  3KXB D;  5DNN B;  5F99 A;  2YFW B;  3UTA B;  3REJ D;  1A7W A;  3WTP D;  5CP6 C;  2CV5 B;  3NQU B;  1P3A B;  5B0Z D;  3C1B C;  5BS7 C;  1WWS A;  1B67 A;  5B32 A;  3REH C;  4WU8 B;  1P3K B;  2Y2Q A;  1P3B C;  1P3L B;  1M19 C;  3LJA B;  3KFU G;  5BT1 D;  5G49 A;  3WKJ D;  1KX5 C;  3AZM A;  3REI B;  5B2I A;  3B0C T;  4H9O A;  3AV2 C;  1M1A B;  1Q9C A;  3MGS C;  5B32 D;  3KSY A;  5B0Y A;  5CPJ D;  4YM6 A;  5GXQ B;  1M18 C;  3B6G D;  4XZQ C;  1KX3 B;  1F66 A;  1H3O B;  3B0B A;  3AZM D;  5B2I D;  5B2J A;  3W98 A;  2ZY4 A;  2BG1 A;  1U35 B;  3VH5 A;  3AN2 B;  3WA9 B;  1ID3 A;  2HIO D;  5BNX A;  3AV1 D;  3AZF C;  3LZ0 D;  4JJN C;  4X23 D;  4J8X C;  1P3M B;  1F66 D;  1HQ3 D;  4WU9 D;  4Z5T D;  3MVD A;  2YFV A;  5B2J D;  2PYO C;  4H9R B;  3UT9 B;  5B1L D;  4J8U B;  4J8W A;  3AYW A;  3WAA C;  5JRG B;  5AY8 C;  5AVB A;  3LZ1 D;  4H9P B;  4YS3 B;  3KXB C;  5FUG A;  5BNV A;  1P3F A;  5AVC B;  4QLC B;  5AV5 B;  2FJ7 B;  3MVD D;  4LD9 C;  2G5I C;  4H9N B;  5B0Z C;  1P3P B;  3KWQ B;  3AZK C;  2Y2O A;  3AYW D;  1TZY B;  3EG5 B;  1JFI A;  5BT1 C;  2IO5 B;  3X1T C;  3F6T A;  5GT3 B;  1AOI B;  3LEL B;  5B1M B;  5AV9 A;  4J8V B;  1P3F D;  5GSU B;  2Y2G A;  5CPI B;  2ARO B;  1P3I A;  3EPK A;  5AV6 B;  5B32 C;  4WZS B;  3A1K A;  3B0D C;  4AWL C;  3AZJ B;  3W96 D;  4R8P A;  5B31 A;  3MGP A;  3AZM C;  1ZLA D;  1EQZ B;  5B2I C;  5AV9 D;  1P3G B;  3AZI A;  5C3I C;  3TU4 D;  4DRB A;  3AZL D;  4XUJ D;  4CAY A;  2NQB A;  1S32 B;  5B0Y C;  4YM6 C;  3MNN B;  2DQN C;  3W97 B;  5B31 D;  1F66 C;  5AV8 B;  2BYK B;  3NQJ B;  1P34 D;  3AZE A;  3AZI D;  3IP4 C;  5B2J C;  1KX4 D;  3W98 C;  3REK D;  3C1B B;  1WWI A;  3REH B;  1ID3 C;  2NQB D;  3B6F D;  1P3B B;  1M19 B;  5B40 D;  3AZG A;  3O62 A;  1N1J B;  4KHA A;  1KX5 B;  3W99 D;  3MVD C;  3UTB A;  3AV2 B;  1P3O B;  3MGS B;  5GT0 A;  2UWX A;  1W2E A;  3X1S B;  4J8W C;  3AYW C;  3VH5 W;  1M18 B;  4WNN A;  4XZQ B;  3R45 B;  3A6N D;  1P3F C;  3REJ A;  3H0M C;  5B33 D;  3UTB D;  3WTP A;  3X1U D;  3MGR B;  5DNM B;  4HGA C;  3KUY A;  3W96 C;  3AFA D;  2Y2M A;  3AZF B;  4KUD B;  4JJN B;  4J8X B;  3WKJ A;  1F1E A;  4NFT A;  5AV9 C;  1Z2C B;  3AZL C;  1P3I C;  3VH6 A;  1TAF B;  4KGC D;  1KU5 A;  1BH9 B;  3KUY D;  3C1C B;  2VQR A;  3B6G A;  5CPJ A;  4R8P C;  3WAA B;  1BFM A;  5AY8 B;  5B31 C;  4H9S A;  3MGP C;  4Z66 A;  2CV5 D;  3AZI C;  1P3K D;  4LD9 B;  4WU8 D;  4E45 A;  1P3L D;  2Y2K A;  3B6F C;  3AL0 C;  2NQB C;  3LJA D;  1BH8 A;  3AZK B;  2HIO A;  4ZUX B;  3AV1 A;  1H3O A;  3LZ0 A;  4X23 A;  3REI D;  3X1T B;  4DQY B;  5F99 B;  4Z66 D;  1HQ3 A;  1M1A D;  3AZE C;  4WU9 A;  4Z5T A;  3AN2 A;  5GXQ D;  5B1L A;  1KX3 D;  3AZG C;  3B0D B;  4AWL B;  3O62 C;  3LZ1 A;  5G49 B;  4Z2M G;  2ZY3 A;  3AZM B;  5B2I B;  2DF4 C;  1U35 D;  3UTB C;  4H9O B;  3REL B;  4G92 B;  5C3I B;  3MGQ B;  3AN2 D;  5GT0 C;  5B0Y B;  4YM6 B;  1P3M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...