4HGAC

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death domain-associated protein 6
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4hgaC00
3LELB 5B32G 1M19B 3LELD 1P3ID 2IO5B 3X1TB 1P3IA 1M19D 1M19A 4KHAA 1KX3B 5GSUC 3X1TD 3X1TA 1BH8B 4XZQD 4XZQA 1KX5B 2AROB 2BYMA 3AZJC 4ZBJB 5AVBB 5B24C 3X1UA 5CPJC 1ID3C 1BFMA 2AROD 3B0BA 5AVBD 3LZ0A 5AVBA 1F66A 1M1AC 2BYKB 5B40A 3VH5W 3AZHB 3AZLA 4LD9B 3X1SC 3LZ1D 3LJAA 3LZ1A 5B2JD 5AVCB 3AZED 5B2JA 3AZEA 1P3OC 4KGCA 4WV4B 1WWSA 5B31C 4XUJC 4J8XC 5AV8A 2CV5B 4HGAB 4LD9D 3RELB 3W98B 4H9QB 5FUGA 5B0YD 3X1VC 5BS7A 5B0YA 3B6GB 1HQ3D 4H9OA 1HQ3A 5BO0B 3RELD 3KUYC 3W98D 5AV9A 1BH9B 3C1BC 4YM6C 4Z66B 2HIOC 4ZUXB 3AYWB 1P3FC 4G92C 2NZDB 3AZKB 3AV2B 4Z66D 3MNNC 5JRGB 3AYWD 3AYWA 3WAAB 3AZIC 2NZDD 3REIC 3UT9A 3AZKD 3AZKA 5CHLB 5JRGD 4J8WC 5JRGA 5AV5C 5B31G 1P3AC 2HUEB 3REKA 1P3BC 5E5AC 5B2IC 4WU8C 4H9NA 3W97D 3W97A 2RVQD 1ZLAC 5C3IB 4UUZB 3UTAD 3UTAA 4J8VB 3O62C 1TZYB 3W99A 4QLCC 4J8VD 3AZGC 5CPIC 2PYOB 3TU4C 1P3MB 3WA9B 3MGQC 2PYOD 3KXBB 2PYOA 1P3MD 3WA9D 3WA9A 4WU9A 1WWIA 3KXBD 1U35B 2FJ7C 4CAYB 5CP6B 1U35D 3UTBC 4YS3C 1P3GB 1N1JB 3AZFC 1EQZA 1P3PD 5CP6D 1P3PA 5CP6A 3AFAD 5B32B 4JJNA 3AFAA 1KX4B 4Z5TB 1P3GD 2LY8A 1N1JA 3A6NC 3AZMB 2F8NK 2JSSA 5B32D 4Z5TD 5AY8C 4EO5B 3AZMD 3AZMA 3MGSD 3MGSA 3WTPC 3KWQC 3WKJA 4R8PB 3AV1C 5G49A 5BNXA 5GT3B 5DNNA 1P3LB 3V9RA 4R8PD 3B0DB 1H3OB 3REHB 3MGPA 5GT3D 1P3LD 3MGRB 1P3LA 1M18C 3REHD 5BT1D 4AWLC 5DNMA 5GT0D 5GT0A 3MGRD 3B6FD 1TAFA 3B6FA 4CSRB 3C1CC 5B33B 5B1MD 5B1MA 5B1LD 5B1LA 5B0ZD 5B0ZA 4X23C 5B33D 5JA4B 3LELA 5B33A 5B24B 3AZNC 3AZJB 1AOIC 4Z2MH 4J8UC 5CPJB 1S32C 1ID3B 5CPKC 1M1AB 5CPJD 5GXQC 1ID3D 1KX3D 1KX3A 3X1SB 3REJC 4KUDC 1BH8A 1P3OB 1KX5D 4H9PB 1KX5A 2AROA 5B31B 4XUJB 4J8XB 3X1SD 3VH6T 1P3OD 4WNNB 3X1VB 5AV6B 5B31D 3KUYB 2BYKA 4NE5A 5AV6D 5AV6A 3AZHD 3AZHA 3C1BB 4LD9A 5AVCD 5AVCA 2HIOB 1P3IC 4H9SA 1M19C 2CV5D 2CV5A 1P3FB 4G92B 4G91C 3RELA 3W98A 3MNNB 4H9QA 3B6GD 3X1TC 3B6GA 3VH6A 4XZQC 2YFVB 5BO0A 3REIB 3X1UC 3MNND 1BH9A 4J8WB 3REID 3LZ0C 4ZUXD 5AVBC 1F66C 4ZUXA 4Z66A 4J8WD 4J8WA 5B40C 3AZLC 2NZDA 3AV2D 1P3BB 3AV2A 3LJAC 5E5AB 5B2IB 3LZ1C 4KGCC 5B2JC 3AZEC 3WAAD 3WAAA 5AV8C 5BS7C 5B0YC 1ZLAB 1HQ3C 3O62B 5AV9C 3AZGB 5CPIB 3WTPE 3TU4B 3MGQB 3UT9C 4UUZA 3AZKC 1TZYD 4J8VA 1P3KC 1TZYA 5JRGC 4WZSB 3MGQD 3AN2B 4NFTA 2FJ7B 3REKC 1F1EA 5BNVB 3UTBB 3AN2D 4YS3B 3AN2A 1P3MA 3AZFB 3MVDB 3KXBA 3W96B 3MVDD 4M6BA 3A6NB 3MVDA 3W97C 2RVQC 1U35A 3W96D 3NQJB 3W96A 5AY8B 3UTAC 3W99C 4CAYA 3WTPB 2F8NG 3KWQB 5C3IC 1P3GA 3NQJA 3AV1B 1P34B 5B32A 1KX4D 1KX4A 4Z5TA 5F99B 4H9RB 3AV1D 1P34D 1P34A 2NQBB 1M18B 5F99D 2PYOC 5F99A 4AWLB 3WA9C 4WU9C 2NQBD 1M18D 2NQBA 4R8PA 5GT3A 3C1CB 5KDMB 3REHA 1H3OA 1A7WA 1EQZC 3NQUB 1P3PC 5CP6C 3MGRA 4JJNC 2YFWB 3AFAC 4X23B 1AOIB 3AZNB 4J8UB 1S32B 2CWEA 4X23D 5GSUB 5CPKB 3AZMC 5GXQB 3MGSC 1S32D 4E45A 4CSRA 3WKJC 4EO5C 5GSUD 5CPKD 5GSUA 3REJB 4NE3A 4KUDB 5DNNC 4E44A 3AZJD 3AZJA 5JA4A 5B24D 5B24A 3R45B 1HTAA 3MGPC 5CPJA 4KUDD 1ID3A 1P3LC 1KU5A 3VH6W 1M1AD 5BT1C 5DNMC 1M1AA 3R45A 5GT0C 3B6FC 1JFIB 3X1SA 1P3IB 1P3OA 1KX5C 4H9PA 4XUJD 4J8XD 4KHAB 4XUJA 5B31A 4J8XA 1JFIA 4G91B 5B1MC 3X1VD 4WNNA 5B1LC 3X1VA 5B0ZC 4XZQB 4YM6B 2BYMB 3LELC 3KUYD 3KUYA 5B33C 3X1UB 3C1BD 3C1BA 4YM6D 4YM6A 3LZ0B 3X1UD 2HIOD 1F66B 2HIOA 2IO5C 3KSYA 1P3FD 3AZIB 5B40B 1P3FA 3AZLB 3LZ0D 1KX3C 1F66D 3MNNA 3LZ1B 3LJAB 4KGCB 5B2JB 3AZEB 5AV5B 2YFVA 3AZID 5B40D 2AROC 3AZIA 3AZLD 1P3AB 3REIA 5AV8B 4ZBJC 3LJAD 4KGCD 5FUGB 5AV5D 5B0YB 5AV5A 1P3AD 4H9OB 1P3AA 1HQ3B 5AV8D 3B0CW 4WU8B 3VH5T 5AV9B 5AV6C 1P3BD 3AZHC 4LD9C 1P3BA 5E5AD 5B2ID 4WU8D 5E5AA 5B2IA 5AVCC 4WU8A 5AV9D 3B0CT 4H9SC 2CV5C 4HGAC 3RELC 3W98C 3B6GC 1ZLAD 1ZLAA 2F8NB 4QLCB 3UT9B 3O62D 1P3KB 3O62A 3VH5A 2F8ND 4QLCD 2F8NA 4QLCA 3UT9D 4ZUXC 4Z66C 3AZGD 3AZGA 1P3KD 3REKB 1P3KA 3AYWC 5CPID 2NZDC 5CPIA 3TU4D 3AV2C 3TU4A 3REKD 1Q9CA 3WAAC 3MGQA 4H9NB 3W97B 2FJ7D 2HUEC 3UTAB 2FJ7A 3W99B 5BNVA 3UTBD 4YS3D 3UTBA 4YS3A 3AZFD 3AZFA 3W99D 3A6ND 3A6NA 5AY8D 5AY8A 4J8VC 1TZYC 4WU9B 3WTPD 3WTPA 3KWQD 3KWQA 4DRAA 4WU9D 3AV1A 4Z2MG 3AN2C 1P3MC 4H9RA 1EQZB 4NE6A 1P3PB 4JJNB 3AFAB 3KXBC 1M18A 1EQZD 3MVDC 4DRBA 4JJND 1U35C 3W96C 1ULYA 3MGSB 3C1CD 3C1CA 1P3GC 5KDMA 3WKJB 3NQUA 5G49B 5BNXB 5B32C 2YFWA 5DNNB 1KX4C 4Z5TC 1AOID 1R4VA 4X23A 3V9RB 3AZND 3AZNA 1AOIA 4J8UD 3WKJD 4J8UA 3MGPB 5DNND 1S32A 1P34C 5F99C 5CPKA 5GXQD 3MGPD 1B6WA 1B67A 5GXQA 5GT0B 5DNMB 1TAFB 3B6FB 2NQBC 3REJD 4R8PC 5DNMD 3REJA 4KUDA 5GT3C 3REHC 3B0DC 2F8NH 5B1MB 5B1LB 3MGRC 5B0ZB 2L5AA
chains in the Genus database with same CATH superfamily
3LELB 5B32G 1M19B 3LELD 2Y2JA 1P3ID 2IO5B 3X1TB 1P3IA 1M19D 1M19A 4KHAA 3F6TA 1KX3B 5GSUC 2Y2GA 3X1TD 3X1TA 1BH8B 4XZQD 4XZQA 1KX5B 2AROB 2BYMA 3AZJC 4ZBJB 5AVBB 5B24C 3X1UA 5CPJC 1ID3C 1BFMA 2AROD 3B0BA 5AVBD 3LZ0A 5AVBA 1F66A 1M1AC 2BYKB 5B40A 3VH5W 3AZHB 3AZLA 4LD9B 3X1SC 3LZ1D 3LJAA 3LZ1A 5B2JD 5AVCB 3AZED 5B2JA 3AZEA 1P3OC 4KGCA 4WV4B 1WWSA 5B31C 4XUJC 2ZY2A 5AV8A 4J8XC 4HGAB 2CV5B 3RELB 4LD9D 3W98B 4H9QB 5B0YD 5FUGA 3X1VC 5BS7A 5B0YA 3B6GB 1HQ3D 4H9OA 1HQ3A 5BO0B 3RELD 3KUYC 3W98D 5AV9A 1BH9B 3C1BC 4YM6C 2ZM5A 4Z66B 2HIOC 4ZUXB 3AYWB 1P3FC 4G92C 2NZDB 3AZKB 3AV2B 4Z66D 3MNNC 5JRGB 3AYWD 3AYWA 3WAAB 3AZIC 2NZDD 3REIC 3UT9A 3AZKD 3AZKA 5CHLB 5JRGD 4J8WC 5JRGA 5AV5C 5B31G 1P3AC 2F2AC 2HUEB 3REKA 2XD5A 2Y2QA 1P3BC 5E5AC 5B2IC 4WU8C 4H9NA 3W97D 3W97A 2RVQD 1ZLAC 5C3IB 4UUZB 3FDDA 3UTAD 3UTAA 4J8VB 3O62C 1TZYB 3W99A 2ZY4A 4QLCC 4J8VD 3AZGC 4DQYB 5CPIC 2PYOB 3TU4C 1P3MB 3WA9B 2W8SA 3MGQC 2PYOD 3KXBB 2PYOA 1P3MD 3WA9D 3WA9A 4WU9A 1WWIA 3KXBD 1U35B 2J8PA 2FJ7C 4CAYB 5CP6B 1U35D 3UTBC 4YS3C 1P3GB 1N1JB 3AZFC 1EQZA 1P3PD 5CP6D 1P3PA 5CP6A 3AFAD 5B32B 4JJNA 3AFAA 1KX4B 4Z5TB 1P3GD 2LY8A 1N1JA 3A6NC 2UWXA 3AZMB 2F8NK 2JSSA 2JE5A 5B32D 4Z5TD 5AY8C 4EO5B 3AZMD 3AZMA 3MGSD 3MGSA 3WTPC 3KWQC 3WKJA 4R8PB 3AV1C 5G49A 5BNXA 5GT3B 5DNNA 1P3LB 3V9RA 4R8PD 3B0DB 1H3OB 3REHB 3MGPA 5GT3D 1P3LD 3MGRB 1P3LA 1M18C 3REHD 5BT1D 4AWLC 5DNMA 5GT0D 5GT0A 3MGRD 3B6FD 1TAFA 3B6FA 4CSRB 3C1CC 5B33B 5B1MD 5B1MA 5B1LD 5B1LA 5B0ZD 5B0ZA 4X23C 2Y2LA 5JA4B 1W2EA 5B33A 5B33D 5B24B 3LELA 3AZNC 4Z2MH 4J8UC 5CPJB 1S32C 1ID3B 5CPKC 1M1AB 5CPJD 5GXQC 1ID3D 1KX3D 3A1KA 3X1SB 3REJC 1KX3A 4KUDC 1BH8A 1P3OB 1KX5D 4H9PB 1KX5A 2AROA 5B31B 4XUJB 4J8XB 3AL0C 3X1SD 3VH6T 1P3OD 4WNNB 3X1VB 5AV6B 5B31D 3KUYB 2BYKA 4NE5A 5AV6D 5AV6A 2Y2MA 3AZHD 3AZHA 3C1BB 4LD9A 2ZY5A 5AVCD 5AVCA 2HIOB 1P3IC 4H9SA 1M19C 2CV5D 2CV5A 3EPKA 1P3FB 1T3UA 3EG5B 4G91C 4G92B 3RELA 3W98A 3MNNB 4H9QA 3B6GD 3X1TC 3B6GA 3VH6A 4XZQC 2YFVB 5BO0A 3REIB 3X1UC 3MNND 1BH9A 4J8WB 3REID 3LZ0C 4ZUXD 5AVBC 1F66C 4ZUXA 4Z66A 4J8WD 4J8WA 5B40C 3AZLC 2NZDA 3AV2D 1P3BB 3AV2A 3LJAC 5B2IB 5E5AB 3LZ1C 4KGCC 5B2JC 3AZEC 3WAAD 3WAAA 5AV8C 5BS7C 5B0YC 2Y2HA 1ZLAB 1HQ3C 3O62B 5AV9C 3AZGB 2FFFB 2JCHA 5CPIB 3WTPE 3TU4B 3EPLA 3MGQB 3UT9C 4UUZA 3AZKC 1TZYD 4J8VA 2G5HC 1TZYA 1P3KC 5JRGC 4WZSB 3MGQD 3A1IA 3AN2B 4NFTA 2FJ7B 3REKC 1F1EA 5BNVB 3UTBB 3AN2D 4YS3B 3AN2A 1P3MA 3AZFB 3MVDB 3AZJB 3KXBA 3W96B 3KFUG 3MVDD 4M6BA 3A6NB 3MVDA 3W97C 2RVQC 1U35A 3W96D 3NQJB 3W96A 5AY8B 3UTAC 3P5JB 4UPKA 3W99C 4CAYA 3WTPB 2F8NG 3KWQB 5C3IC 1P3GA 3NQJA 3EPJA 3AV1B 1P34B 5B32A 1KX4D 1KX4A 4Z5TA 5F99B 4H9RB 3AV1D 1P34D 1P34A 2NQBB 1M18B 5F99D 2PYOC 5F99A 4AWLB 3WA9C 4WU9C 2NQBD 1M18D 2NQBA 2Y2PA 2DQNC 4R8PA 5GT3A 3C1CB 5KDMB 3REHA 1H3OA 1A7WA 1EQZC 3NQUB 1P3PC 5CP6C 3MGRA 4JJNC 2YFWB 3AFAC 4X23B 1AOIB 3AZNB 4J8UB 1AOIC 1S32B 2CWEA 4X23D 5GSUB 5CPKB 3AZMC 5GXQB 3MGSC 1S32D 4E45A 4CSRA 3WKJC 4EO5C 5GSUD 5CPKD 5GSUA 3H0LC 4NE3A 3REJB 4KUDB 5DNNC 4E44A 3AZJD 3AZJA 5JA4A 5B24D 5B24A 3R45B 1HTAA 3MGPC 5CPJA 4KUDD 1ID3A 1P3LC 1KU5A 3VH6W 2VQRA 1M1AD 5BT1C 5DNMC 1M1AA 3R45A 5GT0C 3B6FC 1JFIB 2Y2IA 1Z2CB 3X1SA 1P3IB 1P3OA 1KX5C 4H9PA 4XUJD 4J8XD 4KHAB 2G5IC 4XUJA 5B31A 4J8XA 1JFIA 4G91B 5B1MC 3X1VD 4WNNA 5B1LC 3X1VA 5B0ZC 4XZQB 1PZRA 2BYMB 4YM6B 3LELC 3KUYA 3KUYD 5B33C 3X1UB 3EPHA 2DF4C 3C1BD 3C1BA 4YM6D 4YM6A 3LZ0B 3X1UD 2HIOD 1F66B 2HIOA 2IO5C 3KSYA 1P3FD 3AZIB 5B40B 1P3FA 3AZLB 3LZ0D 1KX3C 1F66D 3MNNA 3LZ1B 3LJAB 4KGCB 5B2JB 3AZEB 5AV5B 2YFVA 3AZID 5B40D 2AROC 3AZIA 3AZLD 1P3AB 3REIA 5AV8B 4ZBJC 3LJAD 4KGCD 5FUGB 5AV5D 5B0YB 5AV5A 2BG1A 1P3AD 4H9OB 1P3AA 1HQ3B 5AV8D 3B0CW 4WU8B 3VH5T 5AV9B 5AV6C 1P3BD 3AZHC 4LD9C 1P3BA 5E5AD 5B2ID 4WU8D 5E5AA 5B2IA 5AVCC 4WU8A 5AV9D 2RIQA 3B0CT 4H9SC 2CV5C 4HGAC 3RELC 3W98C 3B6GC 1ZLAD 1ZLAA 2F8NB 4QLCB 3UT9B 3O62D 1P3KB 3O62A 2Y2OA 3VH5A 2F8ND 4QLCD 3H0RC 4QLCA 3UT9D 2F8NA 4ZUXC 4Z66C 3AZGD 3AZGA 1P3KD 3REKB 1P3KA 3AYWC 5CPID 2NZDC 5CPIA 3TU4D 3AV2C 3TU4A 3REKD 1Q9CA 3WAAC 3MGQA 4H9NB 3W97B 2XD1A 2FJ7D 2HUEC 3UTAB 2FJ7A 3W99B 5BNVA 3UTBD 4YS3D 3UTBA 4YS3A 3AZFD 3AZFA 3W99D 2ZY3A 3A6ND 3A6NA 2Y2KA 5AY8D 5AY8A 4J8VC 1TZYC 4WU9B 3WTPD 3WTPA 3KWQD 3KWQA 2Y2NA 4DRAA 4WU9D 3AV1A 4Z2MG 3AN2C 1P3MC 4H9RA 1EQZB 4NE6A 1P3PB 4JJNB 3AFAB 3KXBC 3IP4C 1M18A 1EQZD 3MVDC 4DRBA 4JJND 4WJ3C 1U35C 3W96C 1ULYA 3MGSB 3C1CD 3C1CA 1P3GC 5KDMA 3WKJB 3NQUA 5G49B 5BNXB 5B32C 2YFWA 5DNNB 1KX4C 4Z5TC 1AOID 1R4VA 4X23A 3V9RB 3AZND 3AZNA 1AOIA 4J8UD 3WKJD 4J8UA 3MGPB 5DNND 1S32A 1P34C 5F99C 5CPKA 5GXQD 3MGPD 1B6WA 1B67A 5GXQA 5GT0B 5DNMB 1TAFB 3B6FB 2NQBC 3REJD 4R8PC 3H0MC 5DNMD 3REJA 4KUDA 5GT3C 3REHC 3B0DC 2F8NH 5B1MB 5B1LB 3MGRC 5B0ZB 2L5AA
chains in the Genus database with same CATH topology
3LELB 5B32G 1M19B 3LELD 2Y2JA 1P3ID 2IO5B 3X1TB 1P3IA 1M19D 1M19A 4KHAA 3F6TA 1KX3B 5GSUC 2Y2GA 3X1TD 3X1TA 1BH8B 4XZQD 4XZQA 1KX5B 2AROB 2BYMA 3AZJC 4ZBJB 5AVBB 5B24C 3X1UA 5CPJC 1ID3C 1BFMA 2AROD 3B0BA 5AVBD 3LZ0A 5AVBA 1F66A 1M1AC 2BYKB 5B40A 3VH5W 3AZHB 3AZLA 4LD9B 3X1SC 3LZ1D 3LJAA 3LZ1A 5B2JD 5AVCB 3AZED 5B2JA 3AZEA 1P3OC 4KGCA 4WV4B 1WWSA 5B31C 4XUJC 2ZY2A 5AV8A 4J8XC 4HGAB 2CV5B 3RELB 4LD9D 3W98B 4H9QB 5B0YD 5FUGA 3X1VC 5BS7A 5B0YA 3B6GB 1HQ3D 4H9OA 1HQ3A 5BO0B 3RELD 3KUYC 3W98D 5AV9A 1BH9B 3C1BC 4YM6C 2ZM5A 4Z66B 2HIOC 4ZUXB 3AYWB 1P3FC 4G92C 2NZDB 3AZKB 3AV2B 4Z66D 3MNNC 5JRGB 3AYWD 3AYWA 3WAAB 3AZIC 2NZDD 3REIC 3UT9A 3AZKD 3AZKA 5CHLB 5JRGD 4J8WC 5JRGA 5AV5C 5B31G 1P3AC 2F2AC 2HUEB 3REKA 2XD5A 2Y2QA 1P3BC 5E5AC 5B2IC 4WU8C 4H9NA 3W97D 3W97A 2RVQD 1ZLAC 5C3IB 4UUZB 3FDDA 3UTAD 3UTAA 4J8VB 3O62C 1TZYB 3W99A 2ZY4A 4QLCC 4J8VD 3AZGC 4DQYB 5CPIC 2PYOB 3TU4C 1P3MB 3WA9B 2W8SA 3MGQC 2PYOD 3KXBB 2PYOA 1P3MD 3WA9D 3WA9A 4WU9A 1WWIA 3KXBD 1U35B 2J8PA 2FJ7C 4CAYB 5CP6B 1U35D 3UTBC 4YS3C 1P3GB 1N1JB 3AZFC 1EQZA 1P3PD 5CP6D 1P3PA 5CP6A 3AFAD 5B32B 4JJNA 3AFAA 1KX4B 4Z5TB 1P3GD 2LY8A 1N1JA 3A6NC 2UWXA 3AZMB 2F8NK 2JSSA 2JE5A 5B32D 4Z5TD 5AY8C 4EO5B 3AZMD 3AZMA 3MGSD 3MGSA 3WTPC 3KWQC 3WKJA 4R8PB 3AV1C 5G49A 5BNXA 5GT3B 5DNNA 1P3LB 3V9RA 4R8PD 3B0DB 1H3OB 3REHB 3MGPA 5GT3D 1P3LD 3MGRB 1P3LA 1M18C 3REHD 5BT1D 4AWLC 5DNMA 5GT0D 5GT0A 3MGRD 3B6FD 1TAFA 3B6FA 4CSRB 3C1CC 5B33B 5B1MD 5B1MA 5B1LD 5B1LA 5B0ZD 5B0ZA 4X23C 2Y2LA 5JA4B 1W2EA 5B33A 5B33D 5B24B 3LELA 3AZNC 4Z2MH 4J8UC 5CPJB 1S32C 1ID3B 5CPKC 1M1AB 5CPJD 5GXQC 1ID3D 1KX3D 3A1KA 3X1SB 3REJC 1KX3A 4KUDC 1BH8A 1P3OB 1KX5D 4H9PB 1KX5A 2AROA 5B31B 4XUJB 4J8XB 3AL0C 3X1SD 3VH6T 1P3OD 4WNNB 3X1VB 5AV6B 5B31D 3KUYB 2BYKA 4NE5A 5AV6D 5AV6A 2Y2MA 3AZHD 3AZHA 3C1BB 4LD9A 2ZY5A 5AVCD 5AVCA 2HIOB 1P3IC 4H9SA 1M19C 2CV5D 2CV5A 3EPKA 1P3FB 1T3UA 3EG5B 4G91C 4G92B 3RELA 3W98A 3MNNB 4H9QA 3B6GD 3X1TC 3B6GA 3VH6A 4XZQC 2YFVB 5BO0A 3REIB 3X1UC 3MNND 1BH9A 4J8WB 3REID 3LZ0C 4ZUXD 5AVBC 1F66C 4ZUXA 4Z66A 4J8WD 4J8WA 5B40C 3AZLC 2NZDA 3AV2D 1P3BB 3AV2A 3LJAC 5B2IB 5E5AB 3LZ1C 4KGCC 5B2JC 3AZEC 3WAAD 3WAAA 5AV8C 5BS7C 5B0YC 2Y2HA 1ZLAB 1HQ3C 3O62B 5AV9C 3AZGB 2FFFB 2JCHA 5CPIB 3WTPE 3TU4B 3EPLA 3MGQB 3UT9C 4UUZA 3AZKC 1TZYD 4J8VA 2G5HC 1TZYA 1P3KC 5JRGC 4WZSB 3MGQD 3A1IA 3AN2B 4NFTA 2FJ7B 3REKC 1F1EA 5BNVB 3UTBB 3AN2D 4YS3B 3AN2A 1P3MA 3AZFB 3MVDB 3AZJB 3KXBA 3W96B 3KFUG 3MVDD 4M6BA 3A6NB 3MVDA 3W97C 2RVQC 1U35A 3W96D 3NQJB 3W96A 5AY8B 3UTAC 3P5JB 4UPKA 3W99C 4CAYA 3WTPB 2F8NG 3KWQB 5C3IC 1P3GA 3NQJA 3EPJA 3AV1B 1P34B 5B32A 1KX4D 1KX4A 4Z5TA 5F99B 4H9RB 3AV1D 1P34D 1P34A 2NQBB 1M18B 5F99D 2PYOC 5F99A 4AWLB 3WA9C 4WU9C 2NQBD 1M18D 2NQBA 2Y2PA 2DQNC 4R8PA 5GT3A 3C1CB 5KDMB 3REHA 1H3OA 1A7WA 1EQZC 3NQUB 1P3PC 5CP6C 3MGRA 4JJNC 2YFWB 3AFAC 4X23B 1AOIB 3AZNB 4J8UB 1AOIC 1S32B 2CWEA 4X23D 5GSUB 5CPKB 3AZMC 5GXQB 3MGSC 1S32D 4E45A 4CSRA 3WKJC 4EO5C 5GSUD 5CPKD 5GSUA 3H0LC 4NE3A 3REJB 4KUDB 5DNNC 4E44A 3AZJD 3AZJA 5JA4A 5B24D 5B24A 3R45B 1HTAA 3MGPC 5CPJA 4KUDD 1ID3A 1P3LC 1KU5A 3VH6W 2VQRA 1M1AD 5BT1C 5DNMC 1M1AA 3R45A 5GT0C 3B6FC 1JFIB 2Y2IA 1Z2CB 3X1SA 1P3IB 1P3OA 1KX5C 4H9PA 4XUJD 4J8XD 4KHAB 2G5IC 4XUJA 5B31A 4J8XA 1JFIA 4G91B 5B1MC 3X1VD 4WNNA 5B1LC 3X1VA 5B0ZC 4XZQB 1PZRA 2BYMB 4YM6B 3LELC 3KUYA 3KUYD 5B33C 3X1UB 3EPHA 2DF4C 3C1BD 3C1BA 4YM6D 4YM6A 3LZ0B 3X1UD 2HIOD 1F66B 2HIOA 2IO5C 3KSYA 1P3FD 3AZIB 5B40B 1P3FA 3AZLB 3LZ0D 1KX3C 1F66D 3MNNA 3LZ1B 3LJAB 4KGCB 5B2JB 3AZEB 5AV5B 2YFVA 3AZID 5B40D 2AROC 3AZIA 3AZLD 1P3AB 3REIA 5AV8B 4ZBJC 3LJAD 4KGCD 5FUGB 5AV5D 5B0YB 5AV5A 2BG1A 1P3AD 4H9OB 1P3AA 1HQ3B 5AV8D 3B0CW 4WU8B 3VH5T 5AV9B 5AV6C 1P3BD 3AZHC 4LD9C 1P3BA 5E5AD 5B2ID 4WU8D 5E5AA 5B2IA 5AVCC 4WU8A 5AV9D 2RIQA 3B0CT 4H9SC 2CV5C 4HGAC 3RELC 3W98C 3B6GC 1ZLAD 1ZLAA 2F8NB 4QLCB 3UT9B 3O62D 1P3KB 3O62A 2Y2OA 3VH5A 2F8ND 4QLCD 3H0RC 4QLCA 3UT9D 2F8NA 4ZUXC 4Z66C 3AZGD 3AZGA 1P3KD 3REKB 1P3KA 3AYWC 5CPID 2NZDC 5CPIA 3TU4D 3AV2C 3TU4A 3REKD 1Q9CA 3WAAC 3MGQA 4H9NB 3W97B 2XD1A 2FJ7D 2HUEC 3UTAB 2FJ7A 3W99B 5BNVA 3UTBD 4YS3D 3UTBA 4YS3A 3AZFD 3AZFA 3W99D 2ZY3A 3A6ND 3A6NA 2Y2KA 5AY8D 5AY8A 4J8VC 1TZYC 4WU9B 3WTPD 3WTPA 3KWQD 3KWQA 2Y2NA 4DRAA 4WU9D 3AV1A 4Z2MG 3AN2C 1P3MC 4H9RA 1EQZB 4NE6A 1P3PB 4JJNB 3AFAB 3KXBC 3IP4C 1M18A 1EQZD 3MVDC 4DRBA 4JJND 4WJ3C 1U35C 3W96C 1ULYA 3MGSB 3C1CD 3C1CA 1P3GC 5KDMA 3WKJB 3NQUA 5G49B 5BNXB 5B32C 2YFWA 5DNNB 1KX4C 4Z5TC 1AOID 1R4VA 4X23A 3V9RB 3AZND 3AZNA 1AOIA 4J8UD 3WKJD 4J8UA 3MGPB 5DNND 1S32A 1P34C 5F99C 5CPKA 5GXQD 3MGPD 1B6WA 1B67A 5GXQA 5GT0B 5DNMB 1TAFB 3B6FB 2NQBC 3REJD 4R8PC 3H0MC 5DNMD 3REJA 4KUDA 5GT3C 3REHC 3B0DC 2F8NH 5B1MB 5B1LB 3MGRC 5B0ZB 2L5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL B;  5B32 G;  1M19 B;  3LEL D;  1P3I D;  2IO5 B;  3X1T B;  1P3I A;  1M19 D;  1M19 A;  4KHA A;  1KX3 B;  5GSU C;  3X1T D;  3X1T A;  1BH8 B;  4XZQ D;  4XZQ A;  1KX5 B;  2ARO B;  2BYM A;  3AZJ C;  4ZBJ B;  5AVB B;  5B24 C;  3X1U A;  5CPJ C;  1ID3 C;  1BFM A;  2ARO D;  3B0B A;  5AVB D;  3LZ0 A;  5AVB A;  1F66 A;  1M1A C;  2BYK B;  5B40 A;  3VH5 W;  3AZH B;  3AZL A;  4LD9 B;  3X1S C;  3LZ1 D;  3LJA A;  3LZ1 A;  5B2J D;  5AVC B;  3AZE D;  5B2J A;  3AZE A;  1P3O C;  4KGC A;  4WV4 B;  1WWS A;  5B31 C;  4XUJ C;  4J8X C;  5AV8 A;  2CV5 B;  4HGA B;  4LD9 D;  3REL B;  3W98 B;  4H9Q B;  5FUG A;  5B0Y D;  3X1V C;  5BS7 A;  5B0Y A;  3B6G B;  1HQ3 D;  4H9O A;  1HQ3 A;  5BO0 B;  3REL D;  3KUY C;  3W98 D;  5AV9 A;  1BH9 B;  3C1B C;  4YM6 C;  4Z66 B;  2HIO C;  4ZUX B;  3AYW B;  1P3F C;  4G92 C;  2NZD B;  3AZK B;  3AV2 B;  4Z66 D;  3MNN C;  5JRG B;  3AYW D;  3AYW A;  3WAA B;  3AZI C;  2NZD D;  3REI C;  3UT9 A;  3AZK D;  3AZK A;  5CHL B;  5JRG D;  4J8W C;  5JRG A;  5AV5 C;  5B31 G;  1P3A C;  2HUE B;  3REK A;  1P3B C;  5E5A C;  5B2I C;  4WU8 C;  4H9N A;  3W97 D;  3W97 A;  2RVQ D;  1ZLA C;  5C3I B;  4UUZ B;  3UTA D;  3UTA A;  4J8V B;  3O62 C;  1TZY B;  3W99 A;  4QLC C;  4J8V D;  3AZG C;  5CPI C;  2PYO B;  3TU4 C;  1P3M B;  3WA9 B;  3MGQ C;  2PYO D;  3KXB B;  2PYO A;  1P3M D;  3WA9 D;  3WA9 A;  4WU9 A;  1WWI A;  3KXB D;  1U35 B;  2FJ7 C;  4CAY B;  5CP6 B;  1U35 D;  3UTB C;  4YS3 C;  1P3G B;  1N1J B;  3AZF C;  1EQZ A;  1P3P D;  5CP6 D;  1P3P A;  5CP6 A;  3AFA D;  5B32 B;  4JJN A;  3AFA A;  1KX4 B;  4Z5T B;  1P3G D;  2LY8 A;  1N1J A;  3A6N C;  3AZM B;  2F8N K;  2JSS A;  5B32 D;  4Z5T D;  5AY8 C;  4EO5 B;  3AZM D;  3AZM A;  3MGS D;  3MGS A;  3WTP C;  3KWQ C;  3WKJ A;  4R8P B;  3AV1 C;  5G49 A;  5BNX A;  5GT3 B;  5DNN A;  1P3L B;  3V9R A;  4R8P D;  3B0D B;  1H3O B;  3REH B;  3MGP A;  5GT3 D;  1P3L D;  3MGR B;  1P3L A;  1M18 C;  3REH D;  5BT1 D;  4AWL C;  5DNM A;  5GT0 D;  5GT0 A;  3MGR D;  3B6F D;  1TAF A;  3B6F A;  4CSR B;  3C1C C;  5B33 B;  5B1M D;  5B1M A;  5B1L D;  5B1L A;  5B0Z D;  5B0Z A;  4X23 C;  5B33 D;  5JA4 B;  3LEL A;  5B33 A;  5B24 B;  3AZN C;  3AZJ B;  1AOI C;  4Z2M H;  4J8U C;  5CPJ B;  1S32 C;  1ID3 B;  5CPK C;  1M1A B;  5CPJ D;  5GXQ C;  1ID3 D;  1KX3 D;  1KX3 A;  3X1S B;  3REJ C;  4KUD C;  1BH8 A;  1P3O B;  1KX5 D;  4H9P B;  1KX5 A;  2ARO A;  5B31 B;  4XUJ B;  4J8X B;  3X1S D;  3VH6 T;  1P3O D;  4WNN B;  3X1V B;  5AV6 B;  5B31 D;  3KUY B;  2BYK A;  4NE5 A;  5AV6 D;  5AV6 A;  3AZH D;  3AZH A;  3C1B B;  4LD9 A;  5AVC D;  5AVC A;  2HIO B;  1P3I C;  4H9S A;  1M19 C;  2CV5 D;  2CV5 A;  1P3F B;  4G92 B;  4G91 C;  3REL A;  3W98 A;  3MNN B;  4H9Q A;  3B6G D;  3X1T C;  3B6G A;  3VH6 A;  4XZQ C;  2YFV B;  5BO0 A;  3REI B;  3X1U C;  3MNN D;  1BH9 A;  4J8W B;  3REI D;  3LZ0 C;  4ZUX D;  5AVB C;  1F66 C;  4ZUX A;  4Z66 A;  4J8W D;  4J8W A;  5B40 C;  3AZL C;  2NZD A;  3AV2 D;  1P3B B;  3AV2 A;  3LJA C;  5E5A B;  5B2I B;  3LZ1 C;  4KGC C;  5B2J C;  3AZE C;  3WAA D;  3WAA A;  5AV8 C;  5BS7 C;  5B0Y C;  1ZLA B;  1HQ3 C;  3O62 B;  5AV9 C;  3AZG B;  5CPI B;  3WTP E;  3TU4 B;  3MGQ B;  3UT9 C;  4UUZ A;  3AZK C;  1TZY D;  4J8V A;  1P3K C;  1TZY A;  5JRG C;  4WZS B;  3MGQ D;  3AN2 B;  4NFT A;  2FJ7 B;  3REK C;  1F1E A;  5BNV B;  3UTB B;  3AN2 D;  4YS3 B;  3AN2 A;  1P3M A;  3AZF B;  3MVD B;  3KXB A;  3W96 B;  3MVD D;  4M6B A;  3A6N B;  3MVD A;  3W97 C;  2RVQ C;  1U35 A;  3W96 D;  3NQJ B;  3W96 A;  5AY8 B;  3UTA C;  3W99 C;  4CAY A;  3WTP B;  2F8N G;  3KWQ B;  5C3I C;  1P3G A;  3NQJ A;  3AV1 B;  1P34 B;  5B32 A;  1KX4 D;  1KX4 A;  4Z5T A;  5F99 B;  4H9R B;  3AV1 D;  1P34 D;  1P34 A;  2NQB B;  1M18 B;  5F99 D;  2PYO C;  5F99 A;  4AWL B;  3WA9 C;  4WU9 C;  2NQB D;  1M18 D;  2NQB A;  4R8P A;  5GT3 A;  3C1C B;  5KDM B;  3REH A;  1H3O A;  1A7W A;  1EQZ C;  3NQU B;  1P3P C;  5CP6 C;  3MGR A;  4JJN C;  2YFW B;  3AFA C;  4X23 B;  1AOI B;  3AZN B;  4J8U B;  1S32 B;  2CWE A;  4X23 D;  5GSU B;  5CPK B;  3AZM C;  5GXQ B;  3MGS C;  1S32 D;  4E45 A;  4CSR A;  3WKJ C;  4EO5 C;  5GSU D;  5CPK D;  5GSU A;  3REJ B;  4NE3 A;  4KUD B;  5DNN C;  4E44 A;  3AZJ D;  3AZJ A;  5JA4 A;  5B24 D;  5B24 A;  3R45 B;  1HTA A;  3MGP C;  5CPJ A;  4KUD D;  1ID3 A;  1P3L C;  1KU5 A;  3VH6 W;  1M1A D;  5BT1 C;  5DNM C;  1M1A A;  3R45 A;  5GT0 C;  3B6F C;  1JFI B;  3X1S A;  1P3I B;  1P3O A;  1KX5 C;  4H9P A;  4XUJ D;  4J8X D;  4KHA B;  4XUJ A;  5B31 A;  4J8X A;  1JFI A;  4G91 B;  5B1M C;  3X1V D;  4WNN A;  5B1L C;  3X1V A;  5B0Z C;  4XZQ B;  4YM6 B;  2BYM B;  3LEL C;  3KUY D;  3KUY A;  5B33 C;  3X1U B;  3C1B D;  3C1B A;  4YM6 D;  4YM6 A;  3LZ0 B;  3X1U D;  2HIO D;  1F66 B;  2HIO A;  2IO5 C;  3KSY A;  1P3F D;  3AZI B;  5B40 B;  1P3F A;  3AZL B;  3LZ0 D;  1KX3 C;  1F66 D;  3MNN A;  3LZ1 B;  3LJA B;  4KGC B;  5B2J B;  3AZE B;  5AV5 B;  2YFV A;  3AZI D;  5B40 D;  2ARO C;  3AZI A;  3AZL D;  1P3A B;  3REI A;  5AV8 B;  4ZBJ C;  3LJA D;  4KGC D;  5FUG B;  5AV5 D;  5B0Y B;  5AV5 A;  1P3A D;  4H9O B;  1P3A A;  1HQ3 B;  5AV8 D;  3B0C W;  4WU8 B;  3VH5 T;  5AV9 B;  5AV6 C;  1P3B D;  3AZH C;  4LD9 C;  1P3B A;  5E5A D;  5B2I D;  4WU8 D;  5E5A A;  5B2I A;  5AVC C;  4WU8 A;  5AV9 D;  3B0C T;  4H9S C;  2CV5 C;  4HGA C;  3REL C;  3W98 C;  3B6G C;  1ZLA D;  1ZLA A;  2F8N B;  4QLC B;  3UT9 B;  3O62 D;  1P3K B;  3O62 A;  3VH5 A;  2F8N D;  4QLC D;  2F8N A;  4QLC A;  3UT9 D;  4ZUX C;  4Z66 C;  3AZG D;  3AZG A;  1P3K D;  3REK B;  1P3K A;  3AYW C;  5CPI D;  2NZD C;  5CPI A;  3TU4 D;  3AV2 C;  3TU4 A;  3REK D;  1Q9C A;  3WAA C;  3MGQ A;  4H9N B;  3W97 B;  2FJ7 D;  2HUE C;  3UTA B;  2FJ7 A;  3W99 B;  5BNV A;  3UTB D;  4YS3 D;  3UTB A;  4YS3 A;  3AZF D;  3AZF A;  3W99 D;  3A6N D;  3A6N A;  5AY8 D;  5AY8 A;  4J8V C;  1TZY C;  4WU9 B;  3WTP D;  3WTP A;  3KWQ D;  3KWQ A;  4DRA A;  4WU9 D;  3AV1 A;  4Z2M G;  3AN2 C;  1P3M C;  4H9R A;  1EQZ B;  4NE6 A;  1P3P B;  4JJN B;  3AFA B;  3KXB C;  1M18 A;  1EQZ D;  3MVD C;  4DRB A;  4JJN D;  1U35 C;  3W96 C;  1ULY A;  3MGS B;  3C1C D;  3C1C A;  1P3G C;  5KDM A;  3WKJ B;  3NQU A;  5G49 B;  5BNX B;  5B32 C;  2YFW A;  5DNN B;  1KX4 C;  4Z5T C;  1AOI D;  1R4V A;  4X23 A;  3V9R B;  3AZN D;  3AZN A;  1AOI A;  4J8U D;  3WKJ D;  4J8U A;  3MGP B;  5DNN D;  1S32 A;  1P34 C;  5F99 C;  5CPK A;  5GXQ D;  3MGP D;  1B6W A;  1B67 A;  5GXQ A;  5GT0 B;  5DNM B;  1TAF B;  3B6F B;  2NQB C;  3REJ D;  4R8P C;  5DNM D;  3REJ A;  4KUD A;  5GT3 C;  3REH C;  3B0D C;  2F8N H;  5B1M B;  5B1L B;  3MGR C;  5B0Z B;  2L5A A; 
#chains in the Genus database with same CATH topology
 3LEL B;  5B32 G;  1M19 B;  3LEL D;  2Y2J A;  1P3I D;  2IO5 B;  3X1T B;  1P3I A;  1M19 D;  1M19 A;  4KHA A;  3F6T A;  1KX3 B;  5GSU C;  2Y2G A;  3X1T D;  3X1T A;  1BH8 B;  4XZQ D;  4XZQ A;  1KX5 B;  2ARO B;  2BYM A;  3AZJ C;  4ZBJ B;  5AVB B;  5B24 C;  3X1U A;  5CPJ C;  1ID3 C;  1BFM A;  2ARO D;  3B0B A;  5AVB D;  3LZ0 A;  5AVB A;  1F66 A;  1M1A C;  2BYK B;  5B40 A;  3VH5 W;  3AZH B;  3AZL A;  4LD9 B;  3X1S C;  3LZ1 D;  3LJA A;  3LZ1 A;  5B2J D;  5AVC B;  3AZE D;  5B2J A;  3AZE A;  1P3O C;  4KGC A;  4WV4 B;  1WWS A;  5B31 C;  4XUJ C;  2ZY2 A;  5AV8 A;  4J8X C;  4HGA B;  2CV5 B;  3REL B;  4LD9 D;  3W98 B;  4H9Q B;  5B0Y D;  5FUG A;  3X1V C;  5BS7 A;  5B0Y A;  3B6G B;  1HQ3 D;  4H9O A;  1HQ3 A;  5BO0 B;  3REL D;  3KUY C;  3W98 D;  5AV9 A;  1BH9 B;  3C1B C;  4YM6 C;  2ZM5 A;  4Z66 B;  2HIO C;  4ZUX B;  3AYW B;  1P3F C;  4G92 C;  2NZD B;  3AZK B;  3AV2 B;  4Z66 D;  3MNN C;  5JRG B;  3AYW D;  3AYW A;  3WAA B;  3AZI C;  2NZD D;  3REI C;  3UT9 A;  3AZK D;  3AZK A;  5CHL B;  5JRG D;  4J8W C;  5JRG A;  5AV5 C;  5B31 G;  1P3A C;  2F2A C;  2HUE B;  3REK A;  2XD5 A;  2Y2Q A;  1P3B C;  5E5A C;  5B2I C;  4WU8 C;  4H9N A;  3W97 D;  3W97 A;  2RVQ D;  1ZLA C;  5C3I B;  4UUZ B;  3FDD A;  3UTA D;  3UTA A;  4J8V B;  3O62 C;  1TZY B;  3W99 A;  2ZY4 A;  4QLC C;  4J8V D;  3AZG C;  4DQY B;  5CPI C;  2PYO B;  3TU4 C;  1P3M B;  3WA9 B;  2W8S A;  3MGQ C;  2PYO D;  3KXB B;  2PYO A;  1P3M D;  3WA9 D;  3WA9 A;  4WU9 A;  1WWI A;  3KXB D;  1U35 B;  2J8P A;  2FJ7 C;  4CAY B;  5CP6 B;  1U35 D;  3UTB C;  4YS3 C;  1P3G B;  1N1J B;  3AZF C;  1EQZ A;  1P3P D;  5CP6 D;  1P3P A;  5CP6 A;  3AFA D;  5B32 B;  4JJN A;  3AFA A;  1KX4 B;  4Z5T B;  1P3G D;  2LY8 A;  1N1J A;  3A6N C;  2UWX A;  3AZM B;  2F8N K;  2JSS A;  2JE5 A;  5B32 D;  4Z5T D;  5AY8 C;  4EO5 B;  3AZM D;  3AZM A;  3MGS D;  3MGS A;  3WTP C;  3KWQ C;  3WKJ A;  4R8P B;  3AV1 C;  5G49 A;  5BNX A;  5GT3 B;  5DNN A;  1P3L B;  3V9R A;  4R8P D;  3B0D B;  1H3O B;  3REH B;  3MGP A;  5GT3 D;  1P3L D;  3MGR B;  1P3L A;  1M18 C;  3REH D;  5BT1 D;  4AWL C;  5DNM A;  5GT0 D;  5GT0 A;  3MGR D;  3B6F D;  1TAF A;  3B6F A;  4CSR B;  3C1C C;  5B33 B;  5B1M D;  5B1M A;  5B1L D;  5B1L A;  5B0Z D;  5B0Z A;  4X23 C;  2Y2L A;  5JA4 B;  1W2E A;  5B33 A;  5B33 D;  5B24 B;  3LEL A;  3AZN C;  4Z2M H;  4J8U C;  5CPJ B;  1S32 C;  1ID3 B;  5CPK C;  1M1A B;  5CPJ D;  5GXQ C;  1ID3 D;  1KX3 D;  3A1K A;  3X1S B;  3REJ C;  1KX3 A;  4KUD C;  1BH8 A;  1P3O B;  1KX5 D;  4H9P B;  1KX5 A;  2ARO A;  5B31 B;  4XUJ B;  4J8X B;  3AL0 C;  3X1S D;  3VH6 T;  1P3O D;  4WNN B;  3X1V B;  5AV6 B;  5B31 D;  3KUY B;  2BYK A;  4NE5 A;  5AV6 D;  5AV6 A;  2Y2M A;  3AZH D;  3AZH A;  3C1B B;  4LD9 A;  2ZY5 A;  5AVC D;  5AVC A;  2HIO B;  1P3I C;  4H9S A;  1M19 C;  2CV5 D;  2CV5 A;  3EPK A;  1P3F B;  1T3U A;  3EG5 B;  4G91 C;  4G92 B;  3REL A;  3W98 A;  3MNN B;  4H9Q A;  3B6G D;  3X1T C;  3B6G A;  3VH6 A;  4XZQ C;  2YFV B;  5BO0 A;  3REI B;  3X1U C;  3MNN D;  1BH9 A;  4J8W B;  3REI D;  3LZ0 C;  4ZUX D;  5AVB C;  1F66 C;  4ZUX A;  4Z66 A;  4J8W D;  4J8W A;  5B40 C;  3AZL C;  2NZD A;  3AV2 D;  1P3B B;  3AV2 A;  3LJA C;  5B2I B;  5E5A B;  3LZ1 C;  4KGC C;  5B2J C;  3AZE C;  3WAA D;  3WAA A;  5AV8 C;  5BS7 C;  5B0Y C;  2Y2H A;  1ZLA B;  1HQ3 C;  3O62 B;  5AV9 C;  3AZG B;  2FFF B;  2JCH A;  5CPI B;  3WTP E;  3TU4 B;  3EPL A;  3MGQ B;  3UT9 C;  4UUZ A;  3AZK C;  1TZY D;  4J8V A;  2G5H C;  1TZY A;  1P3K C;  5JRG C;  4WZS B;  3MGQ D;  3A1I A;  3AN2 B;  4NFT A;  2FJ7 B;  3REK C;  1F1E A;  5BNV B;  3UTB B;  3AN2 D;  4YS3 B;  3AN2 A;  1P3M A;  3AZF B;  3MVD B;  3AZJ B;  3KXB A;  3W96 B;  3KFU G;  3MVD D;  4M6B A;  3A6N B;  3MVD A;  3W97 C;  2RVQ C;  1U35 A;  3W96 D;  3NQJ B;  3W96 A;  5AY8 B;  3UTA C;  3P5J B;  4UPK A;  3W99 C;  4CAY A;  3WTP B;  2F8N G;  3KWQ B;  5C3I C;  1P3G A;  3NQJ A;  3EPJ A;  3AV1 B;  1P34 B;  5B32 A;  1KX4 D;  1KX4 A;  4Z5T A;  5F99 B;  4H9R B;  3AV1 D;  1P34 D;  1P34 A;  2NQB B;  1M18 B;  5F99 D;  2PYO C;  5F99 A;  4AWL B;  3WA9 C;  4WU9 C;  2NQB D;  1M18 D;  2NQB A;  2Y2P A;  2DQN C;  4R8P A;  5GT3 A;  3C1C B;  5KDM B;  3REH A;  1H3O A;  1A7W A;  1EQZ C;  3NQU B;  1P3P C;  5CP6 C;  3MGR A;  4JJN C;  2YFW B;  3AFA C;  4X23 B;  1AOI B;  3AZN B;  4J8U B;  1AOI C;  1S32 B;  2CWE A;  4X23 D;  5GSU B;  5CPK B;  3AZM C;  5GXQ B;  3MGS C;  1S32 D;  4E45 A;  4CSR A;  3WKJ C;  4EO5 C;  5GSU D;  5CPK D;  5GSU A;  3H0L C;  4NE3 A;  3REJ B;  4KUD B;  5DNN C;  4E44 A;  3AZJ D;  3AZJ A;  5JA4 A;  5B24 D;  5B24 A;  3R45 B;  1HTA A;  3MGP C;  5CPJ A;  4KUD D;  1ID3 A;  1P3L C;  1KU5 A;  3VH6 W;  2VQR A;  1M1A D;  5BT1 C;  5DNM C;  1M1A A;  3R45 A;  5GT0 C;  3B6F C;  1JFI B;  2Y2I A;  1Z2C B;  3X1S A;  1P3I B;  1P3O A;  1KX5 C;  4H9P A;  4XUJ D;  4J8X D;  4KHA B;  2G5I C;  4XUJ A;  5B31 A;  4J8X A;  1JFI A;  4G91 B;  5B1M C;  3X1V D;  4WNN A;  5B1L C;  3X1V A;  5B0Z C;  4XZQ B;  1PZR A;  2BYM B;  4YM6 B;  3LEL C;  3KUY A;  3KUY D;  5B33 C;  3X1U B;  3EPH A;  2DF4 C;  3C1B D;  3C1B A;  4YM6 D;  4YM6 A;  3LZ0 B;  3X1U D;  2HIO D;  1F66 B;  2HIO A;  2IO5 C;  3KSY A;  1P3F D;  3AZI B;  5B40 B;  1P3F A;  3AZL B;  3LZ0 D;  1KX3 C;  1F66 D;  3MNN A;  3LZ1 B;  3LJA B;  4KGC B;  5B2J B;  3AZE B;  5AV5 B;  2YFV A;  3AZI D;  5B40 D;  2ARO C;  3AZI A;  3AZL D;  1P3A B;  3REI A;  5AV8 B;  4ZBJ C;  3LJA D;  4KGC D;  5FUG B;  5AV5 D;  5B0Y B;  5AV5 A;  2BG1 A;  1P3A D;  4H9O B;  1P3A A;  1HQ3 B;  5AV8 D;  3B0C W;  4WU8 B;  3VH5 T;  5AV9 B;  5AV6 C;  1P3B D;  3AZH C;  4LD9 C;  1P3B A;  5E5A D;  5B2I D;  4WU8 D;  5E5A A;  5B2I A;  5AVC C;  4WU8 A;  5AV9 D;  2RIQ A;  3B0C T;  4H9S C;  2CV5 C;  4HGA C;  3REL C;  3W98 C;  3B6G C;  1ZLA D;  1ZLA A;  2F8N B;  4QLC B;  3UT9 B;  3O62 D;  1P3K B;  3O62 A;  2Y2O A;  3VH5 A;  2F8N D;  4QLC D;  3H0R C;  4QLC A;  3UT9 D;  2F8N A;  4ZUX C;  4Z66 C;  3AZG D;  3AZG A;  1P3K D;  3REK B;  1P3K A;  3AYW C;  5CPI D;  2NZD C;  5CPI A;  3TU4 D;  3AV2 C;  3TU4 A;  3REK D;  1Q9C A;  3WAA C;  3MGQ A;  4H9N B;  3W97 B;  2XD1 A;  2FJ7 D;  2HUE C;  3UTA B;  2FJ7 A;  3W99 B;  5BNV A;  3UTB D;  4YS3 D;  3UTB A;  4YS3 A;  3AZF D;  3AZF A;  3W99 D;  2ZY3 A;  3A6N D;  3A6N A;  2Y2K A;  5AY8 D;  5AY8 A;  4J8V C;  1TZY C;  4WU9 B;  3WTP D;  3WTP A;  3KWQ D;  3KWQ A;  2Y2N A;  4DRA A;  4WU9 D;  3AV1 A;  4Z2M G;  3AN2 C;  1P3M C;  4H9R A;  1EQZ B;  4NE6 A;  1P3P B;  4JJN B;  3AFA B;  3KXB C;  3IP4 C;  1M18 A;  1EQZ D;  3MVD C;  4DRB A;  4JJN D;  4WJ3 C;  1U35 C;  3W96 C;  1ULY A;  3MGS B;  3C1C D;  3C1C A;  1P3G C;  5KDM A;  3WKJ B;  3NQU A;  5G49 B;  5BNX B;  5B32 C;  2YFW A;  5DNN B;  1KX4 C;  4Z5T C;  1AOI D;  1R4V A;  4X23 A;  3V9R B;  3AZN D;  3AZN A;  1AOI A;  4J8U D;  3WKJ D;  4J8U A;  3MGP B;  5DNN D;  1S32 A;  1P34 C;  5F99 C;  5CPK A;  5GXQ D;  3MGP D;  1B6W A;  1B67 A;  5GXQ A;  5GT0 B;  5DNM B;  1TAF B;  3B6F B;  2NQB C;  3REJ D;  4R8P C;  3H0M C;  5DNM D;  3REJ A;  4KUD A;  5GT3 C;  3REH C;  3B0D C;  2F8N H;  5B1M B;  5B1L B;  3MGR C;  5B0Z B;  2L5A A; 
#chains in the Genus database with same CATH homology
 3LEL B;  5B32 G;  1M19 B;  3LEL D;  2Y2J A;  1P3I D;  2IO5 B;  3X1T B;  1P3I A;  1M19 D;  1M19 A;  4KHA A;  3F6T A;  1KX3 B;  5GSU C;  2Y2G A;  3X1T D;  3X1T A;  1BH8 B;  4XZQ D;  4XZQ A;  1KX5 B;  2ARO B;  2BYM A;  3AZJ C;  4ZBJ B;  5AVB B;  5B24 C;  3X1U A;  5CPJ C;  1ID3 C;  1BFM A;  2ARO D;  3B0B A;  5AVB D;  3LZ0 A;  5AVB A;  1F66 A;  1M1A C;  2BYK B;  5B40 A;  3VH5 W;  3AZH B;  3AZL A;  4LD9 B;  3X1S C;  3LZ1 D;  3LJA A;  3LZ1 A;  5B2J D;  5AVC B;  3AZE D;  5B2J A;  3AZE A;  1P3O C;  4KGC A;  4WV4 B;  1WWS A;  5B31 C;  4XUJ C;  2ZY2 A;  5AV8 A;  4J8X C;  4HGA B;  2CV5 B;  3REL B;  4LD9 D;  3W98 B;  4H9Q B;  5B0Y D;  5FUG A;  3X1V C;  5BS7 A;  5B0Y A;  3B6G B;  1HQ3 D;  4H9O A;  1HQ3 A;  5BO0 B;  3REL D;  3KUY C;  3W98 D;  5AV9 A;  1BH9 B;  3C1B C;  4YM6 C;  2ZM5 A;  4Z66 B;  2HIO C;  4ZUX B;  3AYW B;  1P3F C;  4G92 C;  2NZD B;  3AZK B;  3AV2 B;  4Z66 D;  3MNN C;  5JRG B;  3AYW D;  3AYW A;  3WAA B;  3AZI C;  2NZD D;  3REI C;  3UT9 A;  3AZK D;  3AZK A;  5CHL B;  5JRG D;  4J8W C;  5JRG A;  5AV5 C;  5B31 G;  1P3A C;  2F2A C;  2HUE B;  3REK A;  2XD5 A;  2Y2Q A;  1P3B C;  5E5A C;  5B2I C;  4WU8 C;  4H9N A;  3W97 D;  3W97 A;  2RVQ D;  1ZLA C;  5C3I B;  4UUZ B;  3FDD A;  3UTA D;  3UTA A;  4J8V B;  3O62 C;  1TZY B;  3W99 A;  2ZY4 A;  4QLC C;  4J8V D;  3AZG C;  4DQY B;  5CPI C;  2PYO B;  3TU4 C;  1P3M B;  3WA9 B;  2W8S A;  3MGQ C;  2PYO D;  3KXB B;  2PYO A;  1P3M D;  3WA9 D;  3WA9 A;  4WU9 A;  1WWI A;  3KXB D;  1U35 B;  2J8P A;  2FJ7 C;  4CAY B;  5CP6 B;  1U35 D;  3UTB C;  4YS3 C;  1P3G B;  1N1J B;  3AZF C;  1EQZ A;  1P3P D;  5CP6 D;  1P3P A;  5CP6 A;  3AFA D;  5B32 B;  4JJN A;  3AFA A;  1KX4 B;  4Z5T B;  1P3G D;  2LY8 A;  1N1J A;  3A6N C;  2UWX A;  3AZM B;  2F8N K;  2JSS A;  2JE5 A;  5B32 D;  4Z5T D;  5AY8 C;  4EO5 B;  3AZM D;  3AZM A;  3MGS D;  3MGS A;  3WTP C;  3KWQ C;  3WKJ A;  4R8P B;  3AV1 C;  5G49 A;  5BNX A;  5GT3 B;  5DNN A;  1P3L B;  3V9R A;  4R8P D;  3B0D B;  1H3O B;  3REH B;  3MGP A;  5GT3 D;  1P3L D;  3MGR B;  1P3L A;  1M18 C;  3REH D;  5BT1 D;  4AWL C;  5DNM A;  5GT0 D;  5GT0 A;  3MGR D;  3B6F D;  1TAF A;  3B6F A;  4CSR B;  3C1C C;  5B33 B;  5B1M D;  5B1M A;  5B1L D;  5B1L A;  5B0Z D;  5B0Z A;  4X23 C;  2Y2L A;  5JA4 B;  1W2E A;  5B33 A;  5B33 D;  5B24 B;  3LEL A;  3AZN C;  4Z2M H;  4J8U C;  5CPJ B;  1S32 C;  1ID3 B;  5CPK C;  1M1A B;  5CPJ D;  5GXQ C;  1ID3 D;  1KX3 D;  3A1K A;  3X1S B;  3REJ C;  1KX3 A;  4KUD C;  1BH8 A;  1P3O B;  1KX5 D;  4H9P B;  1KX5 A;  2ARO A;  5B31 B;  4XUJ B;  4J8X B;  3AL0 C;  3X1S D;  3VH6 T;  1P3O D;  4WNN B;  3X1V B;  5AV6 B;  5B31 D;  3KUY B;  2BYK A;  4NE5 A;  5AV6 D;  5AV6 A;  2Y2M A;  3AZH D;  3AZH A;  3C1B B;  4LD9 A;  2ZY5 A;  5AVC D;  5AVC A;  2HIO B;  1P3I C;  4H9S A;  1M19 C;  2CV5 D;  2CV5 A;  3EPK A;  1P3F B;  1T3U A;  3EG5 B;  4G91 C;  4G92 B;  3REL A;  3W98 A;  3MNN B;  4H9Q A;  3B6G D;  3X1T C;  3B6G A;  3VH6 A;  4XZQ C;  2YFV B;  5BO0 A;  3REI B;  3X1U C;  3MNN D;  1BH9 A;  4J8W B;  3REI D;  3LZ0 C;  4ZUX D;  5AVB C;  1F66 C;  4ZUX A;  4Z66 A;  4J8W D;  4J8W A;  5B40 C;  3AZL C;  2NZD A;  3AV2 D;  1P3B B;  3AV2 A;  3LJA C;  5B2I B;  5E5A B;  3LZ1 C;  4KGC C;  5B2J C;  3AZE C;  3WAA D;  3WAA A;  5AV8 C;  5BS7 C;  5B0Y C;  2Y2H A;  1ZLA B;  1HQ3 C;  3O62 B;  5AV9 C;  3AZG B;  2FFF B;  2JCH A;  5CPI B;  3WTP E;  3TU4 B;  3EPL A;  3MGQ B;  3UT9 C;  4UUZ A;  3AZK C;  1TZY D;  4J8V A;  2G5H C;  1TZY A;  1P3K C;  5JRG C;  4WZS B;  3MGQ D;  3A1I A;  3AN2 B;  4NFT A;  2FJ7 B;  3REK C;  1F1E A;  5BNV B;  3UTB B;  3AN2 D;  4YS3 B;  3AN2 A;  1P3M A;  3AZF B;  3MVD B;  3AZJ B;  3KXB A;  3W96 B;  3KFU G;  3MVD D;  4M6B A;  3A6N B;  3MVD A;  3W97 C;  2RVQ C;  1U35 A;  3W96 D;  3NQJ B;  3W96 A;  5AY8 B;  3UTA C;  3P5J B;  4UPK A;  3W99 C;  4CAY A;  3WTP B;  2F8N G;  3KWQ B;  5C3I C;  1P3G A;  3NQJ A;  3EPJ A;  3AV1 B;  1P34 B;  5B32 A;  1KX4 D;  1KX4 A;  4Z5T A;  5F99 B;  4H9R B;  3AV1 D;  1P34 D;  1P34 A;  2NQB B;  1M18 B;  5F99 D;  2PYO C;  5F99 A;  4AWL B;  3WA9 C;  4WU9 C;  2NQB D;  1M18 D;  2NQB A;  2Y2P A;  2DQN C;  4R8P A;  5GT3 A;  3C1C B;  5KDM B;  3REH A;  1H3O A;  1A7W A;  1EQZ C;  3NQU B;  1P3P C;  5CP6 C;  3MGR A;  4JJN C;  2YFW B;  3AFA C;  4X23 B;  1AOI B;  3AZN B;  4J8U B;  1AOI C;  1S32 B;  2CWE A;  4X23 D;  5GSU B;  5CPK B;  3AZM C;  5GXQ B;  3MGS C;  1S32 D;  4E45 A;  4CSR A;  3WKJ C;  4EO5 C;  5GSU D;  5CPK D;  5GSU A;  3H0L C;  4NE3 A;  3REJ B;  4KUD B;  5DNN C;  4E44 A;  3AZJ D;  3AZJ A;  5JA4 A;  5B24 D;  5B24 A;  3R45 B;  1HTA A;  3MGP C;  5CPJ A;  4KUD D;  1ID3 A;  1P3L C;  1KU5 A;  3VH6 W;  2VQR A;  1M1A D;  5BT1 C;  5DNM C;  1M1A A;  3R45 A;  5GT0 C;  3B6F C;  1JFI B;  2Y2I A;  1Z2C B;  3X1S A;  1P3I B;  1P3O A;  1KX5 C;  4H9P A;  4XUJ D;  4J8X D;  4KHA B;  2G5I C;  4XUJ A;  5B31 A;  4J8X A;  1JFI A;  4G91 B;  5B1M C;  3X1V D;  4WNN A;  5B1L C;  3X1V A;  5B0Z C;  4XZQ B;  1PZR A;  2BYM B;  4YM6 B;  3LEL C;  3KUY A;  3KUY D;  5B33 C;  3X1U B;  3EPH A;  2DF4 C;  3C1B D;  3C1B A;  4YM6 D;  4YM6 A;  3LZ0 B;  3X1U D;  2HIO D;  1F66 B;  2HIO A;  2IO5 C;  3KSY A;  1P3F D;  3AZI B;  5B40 B;  1P3F A;  3AZL B;  3LZ0 D;  1KX3 C;  1F66 D;  3MNN A;  3LZ1 B;  3LJA B;  4KGC B;  5B2J B;  3AZE B;  5AV5 B;  2YFV A;  3AZI D;  5B40 D;  2ARO C;  3AZI A;  3AZL D;  1P3A B;  3REI A;  5AV8 B;  4ZBJ C;  3LJA D;  4KGC D;  5FUG B;  5AV5 D;  5B0Y B;  5AV5 A;  2BG1 A;  1P3A D;  4H9O B;  1P3A A;  1HQ3 B;  5AV8 D;  3B0C W;  4WU8 B;  3VH5 T;  5AV9 B;  5AV6 C;  1P3B D;  3AZH C;  4LD9 C;  1P3B A;  5E5A D;  5B2I D;  4WU8 D;  5E5A A;  5B2I A;  5AVC C;  4WU8 A;  5AV9 D;  2RIQ A;  3B0C T;  4H9S C;  2CV5 C;  4HGA C;  3REL C;  3W98 C;  3B6G C;  1ZLA D;  1ZLA A;  2F8N B;  4QLC B;  3UT9 B;  3O62 D;  1P3K B;  3O62 A;  2Y2O A;  3VH5 A;  2F8N D;  4QLC D;  3H0R C;  4QLC A;  3UT9 D;  2F8N A;  4ZUX C;  4Z66 C;  3AZG D;  3AZG A;  1P3K D;  3REK B;  1P3K A;  3AYW C;  5CPI D;  2NZD C;  5CPI A;  3TU4 D;  3AV2 C;  3TU4 A;  3REK D;  1Q9C A;  3WAA C;  3MGQ A;  4H9N B;  3W97 B;  2XD1 A;  2FJ7 D;  2HUE C;  3UTA B;  2FJ7 A;  3W99 B;  5BNV A;  3UTB D;  4YS3 D;  3UTB A;  4YS3 A;  3AZF D;  3AZF A;  3W99 D;  2ZY3 A;  3A6N D;  3A6N A;  2Y2K A;  5AY8 D;  5AY8 A;  4J8V C;  1TZY C;  4WU9 B;  3WTP D;  3WTP A;  3KWQ D;  3KWQ A;  2Y2N A;  4DRA A;  4WU9 D;  3AV1 A;  4Z2M G;  3AN2 C;  1P3M C;  4H9R A;  1EQZ B;  4NE6 A;  1P3P B;  4JJN B;  3AFA B;  3KXB C;  3IP4 C;  1M18 A;  1EQZ D;  3MVD C;  4DRB A;  4JJN D;  4WJ3 C;  1U35 C;  3W96 C;  1ULY A;  3MGS B;  3C1C D;  3C1C A;  1P3G C;  5KDM A;  3WKJ B;  3NQU A;  5G49 B;  5BNX B;  5B32 C;  2YFW A;  5DNN B;  1KX4 C;  4Z5T C;  1AOI D;  1R4V A;  4X23 A;  3V9R B;  3AZN D;  3AZN A;  1AOI A;  4J8U D;  3WKJ D;  4J8U A;  3MGP B;  5DNN D;  1S32 A;  1P34 C;  5F99 C;  5CPK A;  5GXQ D;  3MGP D;  1B6W A;  1B67 A;  5GXQ A;  5GT0 B;  5DNM B;  1TAF B;  3B6F B;  2NQB C;  3REJ D;  4R8P C;  3H0M C;  5DNM D;  3REJ A;  4KUD A;  5GT3 C;  3REH C;  3B0D C;  2F8N H;  5B1M B;  5B1L B;  3MGR C;  5B0Z B;  2L5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...