4HGAC

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
molecule keywords Death domain-associated protein 6
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4hgaC00
4QLCC 3MGRD 3MNNC 3AZHA 3AZGD 3AZFC 5AV9B 3KUYC 5CPJC 1HQ3C 3X1VD 5B33B 5GT0C 5GXQA 3VH6A 4LD9C 1H3OA 3WA9A 2NZDC 2AROB 3WAAA 4Z5TA 3A6NB 4AWLB 1P3KB 5GSUA 2RVQC 3AZJC 2F8NB 4Z66B 4YM6A 3KUYD 4J8UD 5B31G 3REKB 3VH5T 3VH5W 2HIOB 5B32B 3LELC 1P3BD 5B32A 5B2ID 4DRAA 5GSUC 3REJB 2F8NH 3VH6T 2F8ND 3AZEC 4WU9C 1KX3C 4X23B 5B32C 4UUZA 5B0YB 3WA9B 1P3BB 5B0YA 3AZED 5CP6A 3AZJD 1F66A 3AV1B 3TU4B 3WTPD 3X1TC 5JRGD 1N1JB 1U35B 1P3GC 5B0ZA 5CP6C 1F1EA 3B6GB 5B1LD 4ZBJC 2YFVA 3AN2C 5F99D 1P3LA 5CPJB 3AFAD 3AZFB 4XZQA 2PYOA 5B40B 1BH8A 3AZNB 3RELD 5CPKB 3MVDD 1M1AB 1M1AA 3C1CD 5F99B 3O62A 4WU8A 4CAYB 4NE6A 1HTAA 5DNNB 4YM6C 3TU4D 3AZGB 4Z66C 1BH9B 3AZND 5CPKD 1M1AC 5B2JA 1S32D 3WKJC 5B24C 5B40C 5B33C 1P34B 3W99A 3X1TD 2BYMA 3AZIA 3REID 4KUDD 4X23D 5GT3A 5AV9C 3KUYB 3W96D 1AOID 5E5AA 3X1UC 1P3FC 3W96A 4X23A 5B1MA 3REIA 3X1TB 1P3AD 3REIB 3X1TA 5AV8B 3KWQB 3AZIC 4KGCA 3X1UA 1P3GA 2CWEA 5E5AC 3REHD 4KHAA 5B1MC 3AZEB 4J8XB 5AV6C 1P3FA 2BYKB 5AY8A 2LY8A 4KGCC 5GSUB 4Z66D 3REJC 3TU4A 3LJAB 4WU8D 3WTPE 1P3LB 1AOIB 1M1AD 3KXBA 1WWIA 3O62C 5B2IB 5B31A 1KX4B 3A6ND 3RELA 2FJ7C 4J8UC 2F8NK 5DNMA 4AWLC 4ZUXA 2NQBA 4XZQD 3LJAD 2PYOD 3AFAA 5B2JC 3AYWB 5F99A 3AV2A 1P3LD 3WTPC 4R8PC 4Z2MH 5B24A 4H9PB 3KXBC 2NZDD 4JJNC 1ID3B 5DNMC 1B6WA 3MGSC 5JRGB 1TZYA 5JRGA 3WTPA 3AYWD 4HGAC 4CAYA 4WU8B 4H9OB 1F66D 3AZEA 5B1LB 1H3OB 1KX3A 3AYWC 5B2JB 4WU9D 5BT1D 3VH5A 1P3OA 3V9RB 1P34D 4YS3B 2F8NA 3NQJB 4WNNA 2PYOB 4YS3A 3C1CC 3W96B 5B2IA 5B32D 1BFMA 5GXQC 3MGQB 4KGCB 4NE5A 4H9NB 5DNND 2FJ7D 1B67A 1BH8B 4Z5TC 3AZLB 1TZYB 5GSUD 5AVBD 5AY8C 3UTBA 1S32C 1P3IA 3WKJD 1KU5A 5B1MB 1ZLAC 4M6BA 3WAAD 1ID3A 3B6FD 3MVDB 3WA9D 3AN2B 4E45A 3UT9B 1ZLAD 3MGQD 4NE3A 4R8PB 3X1VA 3VH6W 3WTPB 3B6FC 3AFAC 3C1BB 3NQUB 1N1JA 1P3FB 4WV4B 4ZUXC 3MGRA 3AZHD 1P3OB 2NQBC 3B6GD 3AV1C 3MVDC 5BO0A 5FUGB 1ZLAB 3WA9C 1S32B 5CPJD 3REKA 3AZMD 1P34C 3AZLA 5B40A 5AV8D 1P3PD 3RELB 3AZHB 2YFWA 3WKJB 5AV5D 3MNND 2HIOD 1EQZC 5AVCC 1KX5D 5B0ZC 4XUJA 3C1CB 5G49B 5AV5C 2CV5B 2HIOC 1P3IB 4YS3C 1P3PA 3REKC 5AV8A 1P3AB 1P3PB 3AZMA 3REIC 3LZ1D 1P3KC 1M18D 4XUJC 5CPKC 1EQZA 3B6GA 2L5AA 5GT0B 4LD9B 3W97B 1M19B 4H9QA 1P3KA 5DNMB 3AZFA 2IO5C 1M19A 1HQ3B 1ID3C 4J8WD 4ZBJB 3MGQA 5CPID 1ZLAA 3MNNB 3B6GC 4H9SA 3X1SC 3X1VC 1P3MA 1M18C 1ID3D 3B6FA 3W98D 3MGPD 3UTAC 2YFWB 1P3ID 3UTBD 3W97D 5AVBA 2FJ7B 1WWSA 3WKJA 1HQ3D 5AVBB 2FJ7A 5DNNA 3AV1A 5BT1C 3LZ1B 3X1SD 3O62B 4QLCD 3MGRC 5G49A 4H9PA 2CV5A 3AZKA 5F99C 5CPIC 4J8WC 4H9SC 1KX3B 3AZKB 4G91B 5BS7C 3MGPB 4YS3D 1P34A 3MGSA 1P3OD 5B31B 4J8WB 2HUEB 4WU9A 5CPIB 4NFTA 5BS7A 1P3MB 1KX3D 3LZ0A 1KX4D 1F66C 3B0CT 3AZJB 3AYWA 3NQJA 4H9RB 4WNNB 5KDMA 1TZYD 1ULYA 4J8VC 4ZUXB 4XZQB 1P3OC 2NQBB 3A6NC 5BNXA 1M18B 3B6FB 3TU4C 2NZDA 5B24D 3WAAC 3AN2A 3LZ0C 4R8PD 3AV2D 3LELD 2HUEC 3C1BD 5B31C 3UTAD 3LJAA 4X23C 1Q9CA 4ZUXD 1M19C 2NQBD 3W97C 5DNMD 3R45A 2BYKA 5AY8B 3KWQD 4Z5TB 3A6NA 5B31D 3MGQC 5FUGA 5GXQB 3KXBD 3LELB 4H9OA 3AZGC 5DNNC 4YM6B 4Z66A 5AY8D 5AVBC 4CSRB 5JA4A 5GT0A 5AV5B 2CV5C 1P3FD 3REJA 3V9RA 4LD9A 3REHA 2AROC 1P3GD 3X1UD 3B0BA 4KGCD 5B1LC 3AV2B 1R4VA 5CHLB 4J8VD 1P3AA 5B1MD 4H9NA 5AVCD 2AROA 3WAAB 4QLCB 1JFIB 5CP6B 3UT9D 3UT9A 1U35C 1P3GB 5E5AD 4JJNB 1KX5B 5C3IC 1AOIA 2AROD 4EO5B 5AVCA 5GT3D 4XZQC 4KUDA 4J8VB 3AZID 3NQUA 3B0CW 4J8VA 1P3PC 3W99D 1P3AC 4J8UB 3UT9C 1P3BC 1S32A 5B0YC 1P3IC 5B0ZB 5B2JD 4WU9B 4KUDC 3W98B 5CPKA 3REJD 1AOIC 3UTBB 5GT0D 4LD9D 4WZSB 3AZNA 3MGPC 3LJAC 4G91C 3O62D 3C1CA 5AV6B 3W98C 3MVDA 2PYOC 3KWQA 3UTAB 3UTAA 3KSYA 3C1BA 3REHC 3LELA 4R8PA 4KHAB 3X1SB 3X1VB 3AN2D 5B1LA 5B0ZD 4HGAB 4WU8C 5JRGC 3MGSB 1TAFA 2IO5B 1TZYC 1A7WA 1KX4A 5CP6D 5B0YD 4XUJB 5B24B 3LZ0D 3REHB 3B0DB 3AZMB 3MGSD 1KX4C 5B2IC 4G92C 5AVCB 1EQZB 2JSSA 1P3BA 4E44A 1P3LC 3AZKD 2CV5D 4QLCA 3AZHC 3RELC 1JFIA 3X1SA 5BNVA 4J8UA 5GT3B 3KUYA 3AV1D 4YM6D 1HQ3A 3UTBC 2BYMB 3AZNC 3W97A 4KUDB 3MGPA 3W99B 3W98A 4Z5TD 1P3MD 2YFVB 3LZ0B 5BO0B 3KWQC 5GXQD 3KXBB 4J8WA 5CPIA 1TAFB 3C1BC 3AFAB 3AZFD 4CSRA 5JA4B 1P3KD 1M19D 4EO5C 3AZGA 3AZJA 4J8XA 1F66B 1EQZD 5AV6D 3W99C 5B33A 1P3MC 1M18A 3LZ1A 4Z2MG 3AZLC 1BH9A 5GT3C 3R45B 5AV9A 3AV2C 5BNVB 1U35D 4XUJD 4JJNA 1KX5A 4J8XC 5B32G 3W96C 4G92B 3AZKC 5E5AB 4JJND 2HIOA 3MNNA 1U35A 5AV5A 3MGRB 2F8NG 3LZ1C 3B0DC 3AZMC 3AZIB 4DRBA 5B40D 5AV9D 3AZLD 4H9QB 5AV8C 4H9RA 5KDMB 3REKD 5CPJA 5B33D 5C3IB 5AV6A 3X1UB 1KX5C 2NZDB 4UUZB 4J8XD 2RVQD 5BNXB
chains in the Genus database with same CATH superfamily
4QLCC 3MGRD 3MNNC 3AZHA 3IP4C 3AZGD 3AZFC 5AV9B 3KUYC 5CPJC 1HQ3C 3X1VD 3KFUG 2Y2OA 5B33B 5GT0C 5GXQA 3VH6A 4LD9C 2J8PA 1H3OA 3WA9A 2NZDC 2AROB 3WAAA 4Z5TA 3A6NB 4AWLB 1P3KB 5GSUA 2RVQC 3AZJC 2F8NB 4Z66B 4YM6A 3KUYD 4J8UD 5B31G 3REKB 3VH5T 3VH5W 2HIOB 5B32B 3LELC 1P3BD 5B32A 5B2ID 4DRAA 5GSUC 3REJB 2F8NH 3VH6T 2DQNC 2VQRA 2F8ND 3AZEC 4WU9C 1KX3C 4X23B 5B32C 2Y2NA 4UUZA 5B0YB 3WA9B 1P3BB 5B0YA 3AZED 5CP6A 3AZJD 1F66A 2ZY4A 3AV1B 3TU4B 3WTPD 3X1TC 5JRGD 1N1JB 1U35B 1P3GC 5B0ZA 5CP6C 1F1EA 2Y2LA 3B6GB 5B1LD 4ZBJC 2YFVA 3AN2C 5F99D 1P3LA 5CPJB 3AFAD 3AZFB 4XZQA 2PYOA 5B40B 3F6TA 1BH8A 4UPKA 3AZNB 3RELD 5CPKB 3MVDD 1M1AB 1M1AA 3C1CD 5F99B 3O62A 4WU8A 4CAYB 4NE6A 1HTAA 5DNNB 4YM6C 3TU4D 3AZGB 4Z66C 1BH9B 3AZND 5CPKD 1M1AC 5B2JA 1S32D 3WKJC 5B24C 5B40C 5B33C 1P34B 3W99A 3X1TD 2BYMA 3AZIA 3REID 4KUDD 4X23D 5GT3A 5AV9C 3KUYB 3W96D 1AOID 5E5AA 2F2AC 3X1UC 1P3FC 3W96A 4X23A 5B1MA 3REIA 3X1TB 1P3AD 3REIB 3X1TA 5AV8B 3KWQB 3AZIC 4KGCA 3X1UA 1P3GA 2CWEA 5E5AC 3REHD 4KHAA 5B1MC 3AZEB 4J8XB 5AV6C 3A1IA 1P3FA 2BYKB 5AY8A 2LY8A 4KGCC 5GSUB 4Z66D 3REJC 3TU4A 3LJAB 4WU8D 3WTPE 1P3LB 2DF4C 1AOIB 1M1AD 2UWXA 3KXBA 1WWIA 3O62C 5B2IB 5B31A 1KX4B 3A6ND 3RELA 2FJ7C 4J8UC 2F8NK 5DNMA 4AWLC 4ZUXA 2NQBA 4XZQD 3LJAD 2PYOD 3AFAA 5B2JC 3AYWB 5F99A 3AV2A 1P3LD 3WTPC 4R8PC 4Z2MH 5B24A 4DQYB 4H9PB 3KXBC 2NZDD 4JJNC 1ID3B 5DNMC 1B6WA 3MGSC 5JRGB 2W8SA 1TZYA 5JRGA 3WTPA 3AYWD 4HGAC 4CAYA 4WU8B 4H9OB 1F66D 1PZRA 3AZEA 5B1LB 1H3OB 1KX3A 3AYWC 5B2JB 4WU9D 5BT1D 3VH5A 1P3OA 3V9RB 1P34D 4YS3B 2ZY5A 2F8NA 3NQJB 4WNNA 2PYOB 4YS3A 3C1CC 3W96B 5B2IA 5B32D 3AL0C 1BFMA 5GXQC 3MGQB 4KGCB 4NE5A 4H9NB 5DNND 2FJ7D 1B67A 1BH8B 4Z5TC 3AZLB 1TZYB 5GSUD 5AVBD 5AY8C 3UTBA 1S32C 1P3IA 3WKJD 1KU5A 5B1MB 1ZLAC 1T3UA 4M6BA 3WAAD 1ID3A 3B6FD 3MVDB 3WA9D 3AN2B 4E45A 3UT9B 3H0LC 2Y2JA 1ZLAD 3MGQD 4NE3A 4R8PB 3X1VA 3VH6W 3WTPB 3B6FC 3AFAC 3C1BB 3NQUB 1N1JA 1P3FB 4WV4B 4ZUXC 3MGRA 3AZHD 1P3OB 2NQBC 3B6GD 3AV1C 3MVDC 5BO0A 5FUGB 1ZLAB 3WA9C 1S32B 5CPJD 3REKA 3AZMD 1P34C 3AZLA 5B40A 5AV8D 1P3PD 3RELB 3AZHB 2YFWA 3WKJB 5AV5D 3MNND 2HIOD 1EQZC 5AVCC 1KX5D 5B0ZC 4XUJA 3C1CB 5G49B 5AV5C 2CV5B 2HIOC 1P3IB 3H0RC 4YS3C 1P3PA 3REKC 5AV8A 1P3AB 1P3PB 3AZMA 3REIC 3LZ1D 1P3KC 2Y2PA 1M18D 2FFFB 4XUJC 2ZY3A 2G5HC 5CPKC 1EQZA 3B6GA 2JE5A 2L5AA 5GT0B 4LD9B 3W97B 1M19B 2JCHA 4H9QA 1P3KA 5DNMB 3AZFA 2IO5C 1M19A 1HQ3B 1ID3C 4J8WD 4ZBJB 3MGQA 5CPID 1ZLAA 3MNNB 3B6GC 4H9SA 3X1SC 3X1VC 1P3MA 1M18C 1ID3D 3B6FA 3W98D 3MGPD 3UTAC 2YFWB 1P3ID 3UTBD 3W97D 5AVBA 2FJ7B 1WWSA 3WKJA 1HQ3D 5AVBB 2FJ7A 5DNNA 3EPKA 5BT1C 3AV1A 3LZ1B 3X1SD 3O62B 4QLCD 3MGRC 5G49A 4H9PA 3EPLA 2CV5A 3AZKA 5F99C 5CPIC 4J8WC 4H9SC 1KX3B 3AZKB 4G91B 5BS7C 3MGPB 2G5IC 4YS3D 1P34A 3MGSA 1P3OD 5B31B 4J8WB 2HUEB 4WU9A 5CPIB 4NFTA 5BS7A 1P3MB 1KX3D 3LZ0A 1KX4D 1F66C 3B0CT 3AZJB 3AYWA 2BG1A 3NQJA 4H9RB 4WNNB 5KDMA 1TZYD 1ULYA 4J8VC 4ZUXB 4XZQB 1P3OC 2NQBB 3A6NC 5BNXA 1M18B 3B6FB 3TU4C 2NZDA 5B24D 3WAAC 3AN2A 3LZ0C 4R8PD 3AV2D 3LELD 2HUEC 3C1BD 5B31C 3UTAD 3LJAA 4X23C 1Q9CA 4ZUXD 1M19C 2NQBD 3W97C 5DNMD 3R45A 2BYKA 5AY8B 3KWQD 4Z5TB 3A6NA 5B31D 3MGQC 5FUGA 5GXQB 3KXBD 2Y2KA 3LELB 4H9OA 3AZGC 5DNNC 4YM6B 4Z66A 1Z2CB 5AY8D 5AVBC 4CSRB 5JA4A 5GT0A 5AV5B 2CV5C 1P3FD 3REJA 3V9RA 4LD9A 3REHA 2AROC 1P3GD 3X1UD 3B0BA 4KGCD 5B1LC 3AV2B 1R4VA 5CHLB 4J8VD 1P3AA 5B1MD 4H9NA 5AVCD 2AROA 3WAAB 4QLCB 1JFIB 5CP6B 3UT9D 3UT9A 1U35C 1P3GB 5E5AD 4JJNB 1KX5B 5C3IC 1AOIA 2AROD 4EO5B 5AVCA 5GT3D 4XZQC 3H0MC 4KUDA 4J8VB 3EPJA 3AZID 3NQUA 2RIQA 3B0CW 4J8VA 1P3PC 3W99D 2XD1A 1P3AC 4J8UB 3UT9C 1P3BC 1S32A 5B0YC 1P3IC 2ZY2A 5B0ZB 5B2JD 4WU9B 4KUDC 3W98B 5CPKA 3REJD 3FDDA 1AOIC 3UTBB 5GT0D 4LD9D 4WZSB 3AZNA 3MGPC 3LJAC 4G91C 3O62D 3C1CA 2Y2IA 5AV6B 3W98C 3A1KA 3MVDA 2ZM5A 2PYOC 3KWQA 3UTAB 3UTAA 3KSYA 3C1BA 3REHC 3LELA 4R8PA 4KHAB 3X1SB 3X1VB 3AN2D 5B1LA 3P5JB 5B0ZD 4HGAB 4WU8C 3EG5B 5JRGC 3MGSB 1TAFA 2IO5B 1TZYC 1A7WA 1KX4A 5CP6D 5B0YD 4XUJB 5B24B 3LZ0D 3REHB 2Y2HA 3B0DB 3AZMB 3MGSD 2Y2GA 1KX4C 5B2IC 4G92C 5AVCB 1EQZB 2JSSA 1P3BA 4E44A 1P3LC 3AZKD 2CV5D 4QLCA 3AZHC 3RELC 1JFIA 3X1SA 5BNVA 4J8UA 5GT3B 3KUYA 3AV1D 4YM6D 1HQ3A 3UTBC 2BYMB 3AZNC 3W97A 4KUDB 3MGPA 3W99B 3W98A 4Z5TD 1P3MD 2YFVB 3LZ0B 5BO0B 3KWQC 5GXQD 3KXBB 4J8WA 5CPIA 1TAFB 3C1BC 3AFAB 3AZFD 4CSRA 5JA4B 1P3KD 1M19D 4EO5C 3AZGA 3AZJA 4J8XA 1F66B 1EQZD 5AV6D 3EPHA 3W99C 5B33A 1P3MC 1M18A 3LZ1A 4Z2MG 3AZLC 1BH9A 5GT3C 3R45B 5AV9A 3AV2C 2XD5A 5BNVB 1W2EA 1U35D 4XUJD 4JJNA 1KX5A 4J8XC 5B32G 3W96C 4G92B 3AZKC 5E5AB 4JJND 2HIOA 3MNNA 1U35A 5AV5A 3MGRB 2F8NG 3LZ1C 3B0DC 3AZMC 3AZIB 4DRBA 5B40D 5AV9D 3AZLD 4H9QB 5AV8C 4WJ3C 4H9RA 5KDMB 3REKD 5CPJA 5B33D 2Y2QA 2Y2MA 5C3IB 5AV6A 3X1UB 1KX5C 2NZDB 4UUZB 4J8XD 2RVQD 5BNXB
chains in the Genus database with same CATH topology
4QLCC 3MGRD 3MNNC 3AZHA 3IP4C 3AZGD 3AZFC 5AV9B 3KUYC 5CPJC 1HQ3C 3X1VD 3KFUG 2Y2OA 5B33B 5GT0C 5GXQA 3VH6A 4LD9C 2J8PA 1H3OA 3WA9A 2NZDC 2AROB 3WAAA 4Z5TA 3A6NB 4AWLB 1P3KB 5GSUA 2RVQC 3AZJC 2F8NB 4Z66B 4YM6A 3KUYD 4J8UD 5B31G 3REKB 3VH5T 3VH5W 2HIOB 5B32B 3LELC 1P3BD 5B32A 5B2ID 4DRAA 5GSUC 3REJB 2F8NH 3VH6T 2DQNC 2VQRA 2F8ND 3AZEC 4WU9C 1KX3C 4X23B 5B32C 2Y2NA 4UUZA 5B0YB 3WA9B 1P3BB 5B0YA 3AZED 5CP6A 3AZJD 1F66A 2ZY4A 3AV1B 3TU4B 3WTPD 3X1TC 5JRGD 1N1JB 1U35B 1P3GC 5B0ZA 5CP6C 1F1EA 2Y2LA 3B6GB 5B1LD 4ZBJC 2YFVA 3AN2C 5F99D 1P3LA 5CPJB 3AFAD 3AZFB 4XZQA 2PYOA 5B40B 3F6TA 1BH8A 4UPKA 3AZNB 3RELD 5CPKB 3MVDD 1M1AB 1M1AA 3C1CD 5F99B 3O62A 4WU8A 4CAYB 4NE6A 1HTAA 5DNNB 4YM6C 3TU4D 3AZGB 4Z66C 1BH9B 3AZND 5CPKD 1M1AC 5B2JA 1S32D 3WKJC 5B24C 5B40C 5B33C 1P34B 3W99A 3X1TD 2BYMA 3AZIA 3REID 4KUDD 4X23D 5GT3A 5AV9C 3KUYB 3W96D 1AOID 5E5AA 2F2AC 3X1UC 1P3FC 3W96A 4X23A 5B1MA 3REIA 3X1TB 1P3AD 3REIB 3X1TA 5AV8B 3KWQB 3AZIC 4KGCA 3X1UA 1P3GA 2CWEA 5E5AC 3REHD 4KHAA 5B1MC 3AZEB 4J8XB 5AV6C 3A1IA 1P3FA 2BYKB 5AY8A 2LY8A 4KGCC 5GSUB 4Z66D 3REJC 3TU4A 3LJAB 4WU8D 3WTPE 1P3LB 2DF4C 1AOIB 1M1AD 2UWXA 3KXBA 1WWIA 3O62C 5B2IB 5B31A 1KX4B 3A6ND 3RELA 2FJ7C 4J8UC 2F8NK 5DNMA 4AWLC 4ZUXA 2NQBA 4XZQD 3LJAD 2PYOD 3AFAA 5B2JC 3AYWB 5F99A 3AV2A 1P3LD 3WTPC 4R8PC 4Z2MH 5B24A 4DQYB 4H9PB 3KXBC 2NZDD 4JJNC 1ID3B 5DNMC 1B6WA 3MGSC 5JRGB 2W8SA 1TZYA 5JRGA 3WTPA 3AYWD 4HGAC 4CAYA 4WU8B 4H9OB 1F66D 1PZRA 3AZEA 5B1LB 1H3OB 1KX3A 3AYWC 5B2JB 4WU9D 5BT1D 3VH5A 1P3OA 3V9RB 1P34D 4YS3B 2ZY5A 2F8NA 3NQJB 4WNNA 2PYOB 4YS3A 3C1CC 3W96B 5B2IA 5B32D 3AL0C 1BFMA 5GXQC 3MGQB 4KGCB 4NE5A 4H9NB 5DNND 2FJ7D 1B67A 1BH8B 4Z5TC 3AZLB 1TZYB 5GSUD 5AVBD 5AY8C 3UTBA 1S32C 1P3IA 3WKJD 1KU5A 5B1MB 1ZLAC 1T3UA 4M6BA 3WAAD 1ID3A 3B6FD 3MVDB 3WA9D 3AN2B 4E45A 3UT9B 3H0LC 2Y2JA 1ZLAD 3MGQD 4NE3A 4R8PB 3X1VA 3VH6W 3WTPB 3B6FC 3AFAC 3C1BB 3NQUB 1N1JA 1P3FB 4WV4B 4ZUXC 3MGRA 3AZHD 1P3OB 2NQBC 3B6GD 3AV1C 3MVDC 5BO0A 5FUGB 1ZLAB 3WA9C 1S32B 5CPJD 3REKA 3AZMD 1P34C 3AZLA 5B40A 5AV8D 1P3PD 3RELB 3AZHB 2YFWA 3WKJB 5AV5D 3MNND 2HIOD 1EQZC 5AVCC 1KX5D 5B0ZC 4XUJA 3C1CB 5G49B 5AV5C 2CV5B 2HIOC 1P3IB 3H0RC 4YS3C 1P3PA 3REKC 5AV8A 1P3AB 1P3PB 3AZMA 3REIC 3LZ1D 1P3KC 2Y2PA 1M18D 2FFFB 4XUJC 2ZY3A 2G5HC 5CPKC 1EQZA 3B6GA 2JE5A 2L5AA 5GT0B 4LD9B 3W97B 1M19B 2JCHA 4H9QA 1P3KA 5DNMB 3AZFA 2IO5C 1M19A 1HQ3B 1ID3C 4J8WD 4ZBJB 3MGQA 5CPID 1ZLAA 3MNNB 3B6GC 4H9SA 3X1SC 3X1VC 1P3MA 1M18C 1ID3D 3B6FA 3W98D 3MGPD 3UTAC 2YFWB 1P3ID 3UTBD 3W97D 5AVBA 2FJ7B 1WWSA 3WKJA 1HQ3D 5AVBB 2FJ7A 5DNNA 3EPKA 5BT1C 3AV1A 3LZ1B 3X1SD 3O62B 4QLCD 3MGRC 5G49A 4H9PA 3EPLA 2CV5A 3AZKA 5F99C 5CPIC 4J8WC 4H9SC 1KX3B 3AZKB 4G91B 5BS7C 3MGPB 2G5IC 4YS3D 1P34A 3MGSA 1P3OD 5B31B 4J8WB 2HUEB 4WU9A 5CPIB 4NFTA 5BS7A 1P3MB 1KX3D 3LZ0A 1KX4D 1F66C 3B0CT 3AZJB 3AYWA 2BG1A 3NQJA 4H9RB 4WNNB 5KDMA 1TZYD 1ULYA 4J8VC 4ZUXB 4XZQB 1P3OC 2NQBB 3A6NC 5BNXA 1M18B 3B6FB 3TU4C 2NZDA 5B24D 3WAAC 3AN2A 3LZ0C 4R8PD 3AV2D 3LELD 2HUEC 3C1BD 5B31C 3UTAD 3LJAA 4X23C 1Q9CA 4ZUXD 1M19C 2NQBD 3W97C 5DNMD 3R45A 2BYKA 5AY8B 3KWQD 4Z5TB 3A6NA 5B31D 3MGQC 5FUGA 5GXQB 3KXBD 2Y2KA 3LELB 4H9OA 3AZGC 5DNNC 4YM6B 4Z66A 1Z2CB 5AY8D 5AVBC 4CSRB 5JA4A 5GT0A 5AV5B 2CV5C 1P3FD 3REJA 3V9RA 4LD9A 3REHA 2AROC 1P3GD 3X1UD 3B0BA 4KGCD 5B1LC 3AV2B 1R4VA 5CHLB 4J8VD 1P3AA 5B1MD 4H9NA 5AVCD 2AROA 3WAAB 4QLCB 1JFIB 5CP6B 3UT9D 3UT9A 1U35C 1P3GB 5E5AD 4JJNB 1KX5B 5C3IC 1AOIA 2AROD 4EO5B 5AVCA 5GT3D 4XZQC 3H0MC 4KUDA 4J8VB 3EPJA 3AZID 3NQUA 2RIQA 3B0CW 4J8VA 1P3PC 3W99D 2XD1A 1P3AC 4J8UB 3UT9C 1P3BC 1S32A 5B0YC 1P3IC 2ZY2A 5B0ZB 5B2JD 4WU9B 4KUDC 3W98B 5CPKA 3REJD 3FDDA 1AOIC 3UTBB 5GT0D 4LD9D 4WZSB 3AZNA 3MGPC 3LJAC 4G91C 3O62D 3C1CA 2Y2IA 5AV6B 3W98C 3A1KA 3MVDA 2ZM5A 2PYOC 3KWQA 3UTAB 3UTAA 3KSYA 3C1BA 3REHC 3LELA 4R8PA 4KHAB 3X1SB 3X1VB 3AN2D 5B1LA 3P5JB 5B0ZD 4HGAB 4WU8C 3EG5B 5JRGC 3MGSB 1TAFA 2IO5B 1TZYC 1A7WA 1KX4A 5CP6D 5B0YD 4XUJB 5B24B 3LZ0D 3REHB 2Y2HA 3B0DB 3AZMB 3MGSD 2Y2GA 1KX4C 5B2IC 4G92C 5AVCB 1EQZB 2JSSA 1P3BA 4E44A 1P3LC 3AZKD 2CV5D 4QLCA 3AZHC 3RELC 1JFIA 3X1SA 5BNVA 4J8UA 5GT3B 3KUYA 3AV1D 4YM6D 1HQ3A 3UTBC 2BYMB 3AZNC 3W97A 4KUDB 3MGPA 3W99B 3W98A 4Z5TD 1P3MD 2YFVB 3LZ0B 5BO0B 3KWQC 5GXQD 3KXBB 4J8WA 5CPIA 1TAFB 3C1BC 3AFAB 3AZFD 4CSRA 5JA4B 1P3KD 1M19D 4EO5C 3AZGA 3AZJA 4J8XA 1F66B 1EQZD 5AV6D 3EPHA 3W99C 5B33A 1P3MC 1M18A 3LZ1A 4Z2MG 3AZLC 1BH9A 5GT3C 3R45B 5AV9A 3AV2C 2XD5A 5BNVB 1W2EA 1U35D 4XUJD 4JJNA 1KX5A 4J8XC 5B32G 3W96C 4G92B 3AZKC 5E5AB 4JJND 2HIOA 3MNNA 1U35A 5AV5A 3MGRB 2F8NG 3LZ1C 3B0DC 3AZMC 3AZIB 4DRBA 5B40D 5AV9D 3AZLD 4H9QB 5AV8C 4WJ3C 4H9RA 5KDMB 3REKD 5CPJA 5B33D 2Y2QA 2Y2MA 5C3IB 5AV6A 3X1UB 1KX5C 2NZDB 4UUZB 4J8XD 2RVQD 5BNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC C;  3MGR D;  3MNN C;  3AZH A;  3AZG D;  3AZF C;  5AV9 B;  3KUY C;  5CPJ C;  1HQ3 C;  3X1V D;  5B33 B;  5GT0 C;  5GXQ A;  3VH6 A;  4LD9 C;  1H3O A;  3WA9 A;  2NZD C;  2ARO B;  3WAA A;  4Z5T A;  3A6N B;  4AWL B;  1P3K B;  5GSU A;  2RVQ C;  3AZJ C;  2F8N B;  4Z66 B;  4YM6 A;  3KUY D;  4J8U D;  5B31 G;  3REK B;  3VH5 T;  3VH5 W;  2HIO B;  5B32 B;  3LEL C;  1P3B D;  5B32 A;  5B2I D;  4DRA A;  5GSU C;  3REJ B;  2F8N H;  3VH6 T;  2F8N D;  3AZE C;  4WU9 C;  1KX3 C;  4X23 B;  5B32 C;  4UUZ A;  5B0Y B;  3WA9 B;  1P3B B;  5B0Y A;  3AZE D;  5CP6 A;  3AZJ D;  1F66 A;  3AV1 B;  3TU4 B;  3WTP D;  3X1T C;  5JRG D;  1N1J B;  1U35 B;  1P3G C;  5B0Z A;  5CP6 C;  1F1E A;  3B6G B;  5B1L D;  4ZBJ C;  2YFV A;  3AN2 C;  5F99 D;  1P3L A;  5CPJ B;  3AFA D;  3AZF B;  4XZQ A;  2PYO A;  5B40 B;  1BH8 A;  3AZN B;  3REL D;  5CPK B;  3MVD D;  1M1A B;  1M1A A;  3C1C D;  5F99 B;  3O62 A;  4WU8 A;  4CAY B;  4NE6 A;  1HTA A;  5DNN B;  4YM6 C;  3TU4 D;  3AZG B;  4Z66 C;  1BH9 B;  3AZN D;  5CPK D;  1M1A C;  5B2J A;  1S32 D;  3WKJ C;  5B24 C;  5B40 C;  5B33 C;  1P34 B;  3W99 A;  3X1T D;  2BYM A;  3AZI A;  3REI D;  4KUD D;  4X23 D;  5GT3 A;  5AV9 C;  3KUY B;  3W96 D;  1AOI D;  5E5A A;  3X1U C;  1P3F C;  3W96 A;  4X23 A;  5B1M A;  3REI A;  3X1T B;  1P3A D;  3REI B;  3X1T A;  5AV8 B;  3KWQ B;  3AZI C;  4KGC A;  3X1U A;  1P3G A;  2CWE A;  5E5A C;  3REH D;  4KHA A;  5B1M C;  3AZE B;  4J8X B;  5AV6 C;  1P3F A;  2BYK B;  5AY8 A;  2LY8 A;  4KGC C;  5GSU B;  4Z66 D;  3REJ C;  3TU4 A;  3LJA B;  4WU8 D;  3WTP E;  1P3L B;  1AOI B;  1M1A D;  3KXB A;  1WWI A;  3O62 C;  5B2I B;  5B31 A;  1KX4 B;  3A6N D;  3REL A;  2FJ7 C;  4J8U C;  2F8N K;  5DNM A;  4AWL C;  4ZUX A;  2NQB A;  4XZQ D;  3LJA D;  2PYO D;  3AFA A;  5B2J C;  3AYW B;  5F99 A;  3AV2 A;  1P3L D;  3WTP C;  4R8P C;  4Z2M H;  5B24 A;  4H9P B;  3KXB C;  2NZD D;  4JJN C;  1ID3 B;  5DNM C;  1B6W A;  3MGS C;  5JRG B;  1TZY A;  5JRG A;  3WTP A;  3AYW D;  4HGA C;  4CAY A;  4WU8 B;  4H9O B;  1F66 D;  3AZE A;  5B1L B;  1H3O B;  1KX3 A;  3AYW C;  5B2J B;  4WU9 D;  5BT1 D;  3VH5 A;  1P3O A;  3V9R B;  1P34 D;  4YS3 B;  2F8N A;  3NQJ B;  4WNN A;  2PYO B;  4YS3 A;  3C1C C;  3W96 B;  5B2I A;  5B32 D;  1BFM A;  5GXQ C;  3MGQ B;  4KGC B;  4NE5 A;  4H9N B;  5DNN D;  2FJ7 D;  1B67 A;  1BH8 B;  4Z5T C;  3AZL B;  1TZY B;  5GSU D;  5AVB D;  5AY8 C;  3UTB A;  1S32 C;  1P3I A;  3WKJ D;  1KU5 A;  5B1M B;  1ZLA C;  4M6B A;  3WAA D;  1ID3 A;  3B6F D;  3MVD B;  3WA9 D;  3AN2 B;  4E45 A;  3UT9 B;  1ZLA D;  3MGQ D;  4NE3 A;  4R8P B;  3X1V A;  3VH6 W;  3WTP B;  3B6F C;  3AFA C;  3C1B B;  3NQU B;  1N1J A;  1P3F B;  4WV4 B;  4ZUX C;  3MGR A;  3AZH D;  1P3O B;  2NQB C;  3B6G D;  3AV1 C;  3MVD C;  5BO0 A;  5FUG B;  1ZLA B;  3WA9 C;  1S32 B;  5CPJ D;  3REK A;  3AZM D;  1P34 C;  3AZL A;  5B40 A;  5AV8 D;  1P3P D;  3REL B;  3AZH B;  2YFW A;  3WKJ B;  5AV5 D;  3MNN D;  2HIO D;  1EQZ C;  5AVC C;  1KX5 D;  5B0Z C;  4XUJ A;  3C1C B;  5G49 B;  5AV5 C;  2CV5 B;  2HIO C;  1P3I B;  4YS3 C;  1P3P A;  3REK C;  5AV8 A;  1P3A B;  1P3P B;  3AZM A;  3REI C;  3LZ1 D;  1P3K C;  1M18 D;  4XUJ C;  5CPK C;  1EQZ A;  3B6G A;  2L5A A;  5GT0 B;  4LD9 B;  3W97 B;  1M19 B;  4H9Q A;  1P3K A;  5DNM B;  3AZF A;  2IO5 C;  1M19 A;  1HQ3 B;  1ID3 C;  4J8W D;  4ZBJ B;  3MGQ A;  5CPI D;  1ZLA A;  3MNN B;  3B6G C;  4H9S A;  3X1S C;  3X1V C;  1P3M A;  1M18 C;  1ID3 D;  3B6F A;  3W98 D;  3MGP D;  3UTA C;  2YFW B;  1P3I D;  3UTB D;  3W97 D;  5AVB A;  2FJ7 B;  1WWS A;  3WKJ A;  1HQ3 D;  5AVB B;  2FJ7 A;  5DNN A;  3AV1 A;  5BT1 C;  3LZ1 B;  3X1S D;  3O62 B;  4QLC D;  3MGR C;  5G49 A;  4H9P A;  2CV5 A;  3AZK A;  5F99 C;  5CPI C;  4J8W C;  4H9S C;  1KX3 B;  3AZK B;  4G91 B;  5BS7 C;  3MGP B;  4YS3 D;  1P34 A;  3MGS A;  1P3O D;  5B31 B;  4J8W B;  2HUE B;  4WU9 A;  5CPI B;  4NFT A;  5BS7 A;  1P3M B;  1KX3 D;  3LZ0 A;  1KX4 D;  1F66 C;  3B0C T;  3AZJ B;  3AYW A;  3NQJ A;  4H9R B;  4WNN B;  5KDM A;  1TZY D;  1ULY A;  4J8V C;  4ZUX B;  4XZQ B;  1P3O C;  2NQB B;  3A6N C;  5BNX A;  1M18 B;  3B6F B;  3TU4 C;  2NZD A;  5B24 D;  3WAA C;  3AN2 A;  3LZ0 C;  4R8P D;  3AV2 D;  3LEL D;  2HUE C;  3C1B D;  5B31 C;  3UTA D;  3LJA A;  4X23 C;  1Q9C A;  4ZUX D;  1M19 C;  2NQB D;  3W97 C;  5DNM D;  3R45 A;  2BYK A;  5AY8 B;  3KWQ D;  4Z5T B;  3A6N A;  5B31 D;  3MGQ C;  5FUG A;  5GXQ B;  3KXB D;  3LEL B;  4H9O A;  3AZG C;  5DNN C;  4YM6 B;  4Z66 A;  5AY8 D;  5AVB C;  4CSR B;  5JA4 A;  5GT0 A;  5AV5 B;  2CV5 C;  1P3F D;  3REJ A;  3V9R A;  4LD9 A;  3REH A;  2ARO C;  1P3G D;  3X1U D;  3B0B A;  4KGC D;  5B1L C;  3AV2 B;  1R4V A;  5CHL B;  4J8V D;  1P3A A;  5B1M D;  4H9N A;  5AVC D;  2ARO A;  3WAA B;  4QLC B;  1JFI B;  5CP6 B;  3UT9 D;  3UT9 A;  1U35 C;  1P3G B;  5E5A D;  4JJN B;  1KX5 B;  5C3I C;  1AOI A;  2ARO D;  4EO5 B;  5AVC A;  5GT3 D;  4XZQ C;  4KUD A;  4J8V B;  3AZI D;  3NQU A;  3B0C W;  4J8V A;  1P3P C;  3W99 D;  1P3A C;  4J8U B;  3UT9 C;  1P3B C;  1S32 A;  5B0Y C;  1P3I C;  5B0Z B;  5B2J D;  4WU9 B;  4KUD C;  3W98 B;  5CPK A;  3REJ D;  1AOI C;  3UTB B;  5GT0 D;  4LD9 D;  4WZS B;  3AZN A;  3MGP C;  3LJA C;  4G91 C;  3O62 D;  3C1C A;  5AV6 B;  3W98 C;  3MVD A;  2PYO C;  3KWQ A;  3UTA B;  3UTA A;  3KSY A;  3C1B A;  3REH C;  3LEL A;  4R8P A;  4KHA B;  3X1S B;  3X1V B;  3AN2 D;  5B1L A;  5B0Z D;  4HGA B;  4WU8 C;  5JRG C;  3MGS B;  1TAF A;  2IO5 B;  1TZY C;  1A7W A;  1KX4 A;  5CP6 D;  5B0Y D;  4XUJ B;  5B24 B;  3LZ0 D;  3REH B;  3B0D B;  3AZM B;  3MGS D;  1KX4 C;  5B2I C;  4G92 C;  5AVC B;  1EQZ B;  2JSS A;  1P3B A;  4E44 A;  1P3L C;  3AZK D;  2CV5 D;  4QLC A;  3AZH C;  3REL C;  1JFI A;  3X1S A;  5BNV A;  4J8U A;  5GT3 B;  3KUY A;  3AV1 D;  4YM6 D;  1HQ3 A;  3UTB C;  2BYM B;  3AZN C;  3W97 A;  4KUD B;  3MGP A;  3W99 B;  3W98 A;  4Z5T D;  1P3M D;  2YFV B;  3LZ0 B;  5BO0 B;  3KWQ C;  5GXQ D;  3KXB B;  4J8W A;  5CPI A;  1TAF B;  3C1B C;  3AFA B;  3AZF D;  4CSR A;  5JA4 B;  1P3K D;  1M19 D;  4EO5 C;  3AZG A;  3AZJ A;  4J8X A;  1F66 B;  1EQZ D;  5AV6 D;  3W99 C;  5B33 A;  1P3M C;  1M18 A;  3LZ1 A;  4Z2M G;  3AZL C;  1BH9 A;  5GT3 C;  3R45 B;  5AV9 A;  3AV2 C;  5BNV B;  1U35 D;  4XUJ D;  4JJN A;  1KX5 A;  4J8X C;  5B32 G;  3W96 C;  4G92 B;  3AZK C;  5E5A B;  4JJN D;  2HIO A;  3MNN A;  1U35 A;  5AV5 A;  3MGR B;  2F8N G;  3LZ1 C;  3B0D C;  3AZM C;  3AZI B;  4DRB A;  5B40 D;  5AV9 D;  3AZL D;  4H9Q B;  5AV8 C;  4H9R A;  5KDM B;  3REK D;  5CPJ A;  5B33 D;  5C3I B;  5AV6 A;  3X1U B;  1KX5 C;  2NZD B;  4UUZ B;  4J8X D;  2RVQ D;  5BNX B; 
#chains in the Genus database with same CATH topology
 4QLC C;  3MGR D;  3MNN C;  3AZH A;  3IP4 C;  3AZG D;  3AZF C;  5AV9 B;  3KUY C;  5CPJ C;  1HQ3 C;  3X1V D;  3KFU G;  2Y2O A;  5B33 B;  5GT0 C;  5GXQ A;  3VH6 A;  4LD9 C;  2J8P A;  1H3O A;  3WA9 A;  2NZD C;  2ARO B;  3WAA A;  4Z5T A;  3A6N B;  4AWL B;  1P3K B;  5GSU A;  2RVQ C;  3AZJ C;  2F8N B;  4Z66 B;  4YM6 A;  3KUY D;  4J8U D;  5B31 G;  3REK B;  3VH5 T;  3VH5 W;  2HIO B;  5B32 B;  3LEL C;  1P3B D;  5B32 A;  5B2I D;  4DRA A;  5GSU C;  3REJ B;  2F8N H;  3VH6 T;  2DQN C;  2VQR A;  2F8N D;  3AZE C;  4WU9 C;  1KX3 C;  4X23 B;  5B32 C;  2Y2N A;  4UUZ A;  5B0Y B;  3WA9 B;  1P3B B;  5B0Y A;  3AZE D;  5CP6 A;  3AZJ D;  1F66 A;  2ZY4 A;  3AV1 B;  3TU4 B;  3WTP D;  3X1T C;  5JRG D;  1N1J B;  1U35 B;  1P3G C;  5B0Z A;  5CP6 C;  1F1E A;  2Y2L A;  3B6G B;  5B1L D;  4ZBJ C;  2YFV A;  3AN2 C;  5F99 D;  1P3L A;  5CPJ B;  3AFA D;  3AZF B;  4XZQ A;  2PYO A;  5B40 B;  3F6T A;  1BH8 A;  4UPK A;  3AZN B;  3REL D;  5CPK B;  3MVD D;  1M1A B;  1M1A A;  3C1C D;  5F99 B;  3O62 A;  4WU8 A;  4CAY B;  4NE6 A;  1HTA A;  5DNN B;  4YM6 C;  3TU4 D;  3AZG B;  4Z66 C;  1BH9 B;  3AZN D;  5CPK D;  1M1A C;  5B2J A;  1S32 D;  3WKJ C;  5B24 C;  5B40 C;  5B33 C;  1P34 B;  3W99 A;  3X1T D;  2BYM A;  3AZI A;  3REI D;  4KUD D;  4X23 D;  5GT3 A;  5AV9 C;  3KUY B;  3W96 D;  1AOI D;  5E5A A;  2F2A C;  3X1U C;  1P3F C;  3W96 A;  4X23 A;  5B1M A;  3REI A;  3X1T B;  1P3A D;  3REI B;  3X1T A;  5AV8 B;  3KWQ B;  3AZI C;  4KGC A;  3X1U A;  1P3G A;  2CWE A;  5E5A C;  3REH D;  4KHA A;  5B1M C;  3AZE B;  4J8X B;  5AV6 C;  3A1I A;  1P3F A;  2BYK B;  5AY8 A;  2LY8 A;  4KGC C;  5GSU B;  4Z66 D;  3REJ C;  3TU4 A;  3LJA B;  4WU8 D;  3WTP E;  1P3L B;  2DF4 C;  1AOI B;  1M1A D;  2UWX A;  3KXB A;  1WWI A;  3O62 C;  5B2I B;  5B31 A;  1KX4 B;  3A6N D;  3REL A;  2FJ7 C;  4J8U C;  2F8N K;  5DNM A;  4AWL C;  4ZUX A;  2NQB A;  4XZQ D;  3LJA D;  2PYO D;  3AFA A;  5B2J C;  3AYW B;  5F99 A;  3AV2 A;  1P3L D;  3WTP C;  4R8P C;  4Z2M H;  5B24 A;  4DQY B;  4H9P B;  3KXB C;  2NZD D;  4JJN C;  1ID3 B;  5DNM C;  1B6W A;  3MGS C;  5JRG B;  2W8S A;  1TZY A;  5JRG A;  3WTP A;  3AYW D;  4HGA C;  4CAY A;  4WU8 B;  4H9O B;  1F66 D;  1PZR A;  3AZE A;  5B1L B;  1H3O B;  1KX3 A;  3AYW C;  5B2J B;  4WU9 D;  5BT1 D;  3VH5 A;  1P3O A;  3V9R B;  1P34 D;  4YS3 B;  2ZY5 A;  2F8N A;  3NQJ B;  4WNN A;  2PYO B;  4YS3 A;  3C1C C;  3W96 B;  5B2I A;  5B32 D;  3AL0 C;  1BFM A;  5GXQ C;  3MGQ B;  4KGC B;  4NE5 A;  4H9N B;  5DNN D;  2FJ7 D;  1B67 A;  1BH8 B;  4Z5T C;  3AZL B;  1TZY B;  5GSU D;  5AVB D;  5AY8 C;  3UTB A;  1S32 C;  1P3I A;  3WKJ D;  1KU5 A;  5B1M B;  1ZLA C;  1T3U A;  4M6B A;  3WAA D;  1ID3 A;  3B6F D;  3MVD B;  3WA9 D;  3AN2 B;  4E45 A;  3UT9 B;  3H0L C;  2Y2J A;  1ZLA D;  3MGQ D;  4NE3 A;  4R8P B;  3X1V A;  3VH6 W;  3WTP B;  3B6F C;  3AFA C;  3C1B B;  3NQU B;  1N1J A;  1P3F B;  4WV4 B;  4ZUX C;  3MGR A;  3AZH D;  1P3O B;  2NQB C;  3B6G D;  3AV1 C;  3MVD C;  5BO0 A;  5FUG B;  1ZLA B;  3WA9 C;  1S32 B;  5CPJ D;  3REK A;  3AZM D;  1P34 C;  3AZL A;  5B40 A;  5AV8 D;  1P3P D;  3REL B;  3AZH B;  2YFW A;  3WKJ B;  5AV5 D;  3MNN D;  2HIO D;  1EQZ C;  5AVC C;  1KX5 D;  5B0Z C;  4XUJ A;  3C1C B;  5G49 B;  5AV5 C;  2CV5 B;  2HIO C;  1P3I B;  3H0R C;  4YS3 C;  1P3P A;  3REK C;  5AV8 A;  1P3A B;  1P3P B;  3AZM A;  3REI C;  3LZ1 D;  1P3K C;  2Y2P A;  1M18 D;  2FFF B;  4XUJ C;  2ZY3 A;  2G5H C;  5CPK C;  1EQZ A;  3B6G A;  2JE5 A;  2L5A A;  5GT0 B;  4LD9 B;  3W97 B;  1M19 B;  2JCH A;  4H9Q A;  1P3K A;  5DNM B;  3AZF A;  2IO5 C;  1M19 A;  1HQ3 B;  1ID3 C;  4J8W D;  4ZBJ B;  3MGQ A;  5CPI D;  1ZLA A;  3MNN B;  3B6G C;  4H9S A;  3X1S C;  3X1V C;  1P3M A;  1M18 C;  1ID3 D;  3B6F A;  3W98 D;  3MGP D;  3UTA C;  2YFW B;  1P3I D;  3UTB D;  3W97 D;  5AVB A;  2FJ7 B;  1WWS A;  3WKJ A;  1HQ3 D;  5AVB B;  2FJ7 A;  5DNN A;  3EPK A;  5BT1 C;  3AV1 A;  3LZ1 B;  3X1S D;  3O62 B;  4QLC D;  3MGR C;  5G49 A;  4H9P A;  3EPL A;  2CV5 A;  3AZK A;  5F99 C;  5CPI C;  4J8W C;  4H9S C;  1KX3 B;  3AZK B;  4G91 B;  5BS7 C;  3MGP B;  2G5I C;  4YS3 D;  1P34 A;  3MGS A;  1P3O D;  5B31 B;  4J8W B;  2HUE B;  4WU9 A;  5CPI B;  4NFT A;  5BS7 A;  1P3M B;  1KX3 D;  3LZ0 A;  1KX4 D;  1F66 C;  3B0C T;  3AZJ B;  3AYW A;  2BG1 A;  3NQJ A;  4H9R B;  4WNN B;  5KDM A;  1TZY D;  1ULY A;  4J8V C;  4ZUX B;  4XZQ B;  1P3O C;  2NQB B;  3A6N C;  5BNX A;  1M18 B;  3B6F B;  3TU4 C;  2NZD A;  5B24 D;  3WAA C;  3AN2 A;  3LZ0 C;  4R8P D;  3AV2 D;  3LEL D;  2HUE C;  3C1B D;  5B31 C;  3UTA D;  3LJA A;  4X23 C;  1Q9C A;  4ZUX D;  1M19 C;  2NQB D;  3W97 C;  5DNM D;  3R45 A;  2BYK A;  5AY8 B;  3KWQ D;  4Z5T B;  3A6N A;  5B31 D;  3MGQ C;  5FUG A;  5GXQ B;  3KXB D;  2Y2K A;  3LEL B;  4H9O A;  3AZG C;  5DNN C;  4YM6 B;  4Z66 A;  1Z2C B;  5AY8 D;  5AVB C;  4CSR B;  5JA4 A;  5GT0 A;  5AV5 B;  2CV5 C;  1P3F D;  3REJ A;  3V9R A;  4LD9 A;  3REH A;  2ARO C;  1P3G D;  3X1U D;  3B0B A;  4KGC D;  5B1L C;  3AV2 B;  1R4V A;  5CHL B;  4J8V D;  1P3A A;  5B1M D;  4H9N A;  5AVC D;  2ARO A;  3WAA B;  4QLC B;  1JFI B;  5CP6 B;  3UT9 D;  3UT9 A;  1U35 C;  1P3G B;  5E5A D;  4JJN B;  1KX5 B;  5C3I C;  1AOI A;  2ARO D;  4EO5 B;  5AVC A;  5GT3 D;  4XZQ C;  3H0M C;  4KUD A;  4J8V B;  3EPJ A;  3AZI D;  3NQU A;  2RIQ A;  3B0C W;  4J8V A;  1P3P C;  3W99 D;  2XD1 A;  1P3A C;  4J8U B;  3UT9 C;  1P3B C;  1S32 A;  5B0Y C;  1P3I C;  2ZY2 A;  5B0Z B;  5B2J D;  4WU9 B;  4KUD C;  3W98 B;  5CPK A;  3REJ D;  3FDD A;  1AOI C;  3UTB B;  5GT0 D;  4LD9 D;  4WZS B;  3AZN A;  3MGP C;  3LJA C;  4G91 C;  3O62 D;  3C1C A;  2Y2I A;  5AV6 B;  3W98 C;  3A1K A;  3MVD A;  2ZM5 A;  2PYO C;  3KWQ A;  3UTA B;  3UTA A;  3KSY A;  3C1B A;  3REH C;  3LEL A;  4R8P A;  4KHA B;  3X1S B;  3X1V B;  3AN2 D;  5B1L A;  3P5J B;  5B0Z D;  4HGA B;  4WU8 C;  3EG5 B;  5JRG C;  3MGS B;  1TAF A;  2IO5 B;  1TZY C;  1A7W A;  1KX4 A;  5CP6 D;  5B0Y D;  4XUJ B;  5B24 B;  3LZ0 D;  3REH B;  2Y2H A;  3B0D B;  3AZM B;  3MGS D;  2Y2G A;  1KX4 C;  5B2I C;  4G92 C;  5AVC B;  1EQZ B;  2JSS A;  1P3B A;  4E44 A;  1P3L C;  3AZK D;  2CV5 D;  4QLC A;  3AZH C;  3REL C;  1JFI A;  3X1S A;  5BNV A;  4J8U A;  5GT3 B;  3KUY A;  3AV1 D;  4YM6 D;  1HQ3 A;  3UTB C;  2BYM B;  3AZN C;  3W97 A;  4KUD B;  3MGP A;  3W99 B;  3W98 A;  4Z5T D;  1P3M D;  2YFV B;  3LZ0 B;  5BO0 B;  3KWQ C;  5GXQ D;  3KXB B;  4J8W A;  5CPI A;  1TAF B;  3C1B C;  3AFA B;  3AZF D;  4CSR A;  5JA4 B;  1P3K D;  1M19 D;  4EO5 C;  3AZG A;  3AZJ A;  4J8X A;  1F66 B;  1EQZ D;  5AV6 D;  3EPH A;  3W99 C;  5B33 A;  1P3M C;  1M18 A;  3LZ1 A;  4Z2M G;  3AZL C;  1BH9 A;  5GT3 C;  3R45 B;  5AV9 A;  3AV2 C;  2XD5 A;  5BNV B;  1W2E A;  1U35 D;  4XUJ D;  4JJN A;  1KX5 A;  4J8X C;  5B32 G;  3W96 C;  4G92 B;  3AZK C;  5E5A B;  4JJN D;  2HIO A;  3MNN A;  1U35 A;  5AV5 A;  3MGR B;  2F8N G;  3LZ1 C;  3B0D C;  3AZM C;  3AZI B;  4DRB A;  5B40 D;  5AV9 D;  3AZL D;  4H9Q B;  5AV8 C;  4WJ3 C;  4H9R A;  5KDM B;  3REK D;  5CPJ A;  5B33 D;  2Y2Q A;  2Y2M A;  5C3I B;  5AV6 A;  3X1U B;  1KX5 C;  2NZD B;  4UUZ B;  4J8X D;  2RVQ D;  5BNX B; 
#chains in the Genus database with same CATH homology
 4QLC C;  3MGR D;  3MNN C;  3AZH A;  3IP4 C;  3AZG D;  3AZF C;  5AV9 B;  3KUY C;  5CPJ C;  1HQ3 C;  3X1V D;  3KFU G;  2Y2O A;  5B33 B;  5GT0 C;  5GXQ A;  3VH6 A;  4LD9 C;  2J8P A;  1H3O A;  3WA9 A;  2NZD C;  2ARO B;  3WAA A;  4Z5T A;  3A6N B;  4AWL B;  1P3K B;  5GSU A;  2RVQ C;  3AZJ C;  2F8N B;  4Z66 B;  4YM6 A;  3KUY D;  4J8U D;  5B31 G;  3REK B;  3VH5 T;  3VH5 W;  2HIO B;  5B32 B;  3LEL C;  1P3B D;  5B32 A;  5B2I D;  4DRA A;  5GSU C;  3REJ B;  2F8N H;  3VH6 T;  2DQN C;  2VQR A;  2F8N D;  3AZE C;  4WU9 C;  1KX3 C;  4X23 B;  5B32 C;  2Y2N A;  4UUZ A;  5B0Y B;  3WA9 B;  1P3B B;  5B0Y A;  3AZE D;  5CP6 A;  3AZJ D;  1F66 A;  2ZY4 A;  3AV1 B;  3TU4 B;  3WTP D;  3X1T C;  5JRG D;  1N1J B;  1U35 B;  1P3G C;  5B0Z A;  5CP6 C;  1F1E A;  2Y2L A;  3B6G B;  5B1L D;  4ZBJ C;  2YFV A;  3AN2 C;  5F99 D;  1P3L A;  5CPJ B;  3AFA D;  3AZF B;  4XZQ A;  2PYO A;  5B40 B;  3F6T A;  1BH8 A;  4UPK A;  3AZN B;  3REL D;  5CPK B;  3MVD D;  1M1A B;  1M1A A;  3C1C D;  5F99 B;  3O62 A;  4WU8 A;  4CAY B;  4NE6 A;  1HTA A;  5DNN B;  4YM6 C;  3TU4 D;  3AZG B;  4Z66 C;  1BH9 B;  3AZN D;  5CPK D;  1M1A C;  5B2J A;  1S32 D;  3WKJ C;  5B24 C;  5B40 C;  5B33 C;  1P34 B;  3W99 A;  3X1T D;  2BYM A;  3AZI A;  3REI D;  4KUD D;  4X23 D;  5GT3 A;  5AV9 C;  3KUY B;  3W96 D;  1AOI D;  5E5A A;  2F2A C;  3X1U C;  1P3F C;  3W96 A;  4X23 A;  5B1M A;  3REI A;  3X1T B;  1P3A D;  3REI B;  3X1T A;  5AV8 B;  3KWQ B;  3AZI C;  4KGC A;  3X1U A;  1P3G A;  2CWE A;  5E5A C;  3REH D;  4KHA A;  5B1M C;  3AZE B;  4J8X B;  5AV6 C;  3A1I A;  1P3F A;  2BYK B;  5AY8 A;  2LY8 A;  4KGC C;  5GSU B;  4Z66 D;  3REJ C;  3TU4 A;  3LJA B;  4WU8 D;  3WTP E;  1P3L B;  2DF4 C;  1AOI B;  1M1A D;  2UWX A;  3KXB A;  1WWI A;  3O62 C;  5B2I B;  5B31 A;  1KX4 B;  3A6N D;  3REL A;  2FJ7 C;  4J8U C;  2F8N K;  5DNM A;  4AWL C;  4ZUX A;  2NQB A;  4XZQ D;  3LJA D;  2PYO D;  3AFA A;  5B2J C;  3AYW B;  5F99 A;  3AV2 A;  1P3L D;  3WTP C;  4R8P C;  4Z2M H;  5B24 A;  4DQY B;  4H9P B;  3KXB C;  2NZD D;  4JJN C;  1ID3 B;  5DNM C;  1B6W A;  3MGS C;  5JRG B;  2W8S A;  1TZY A;  5JRG A;  3WTP A;  3AYW D;  4HGA C;  4CAY A;  4WU8 B;  4H9O B;  1F66 D;  1PZR A;  3AZE A;  5B1L B;  1H3O B;  1KX3 A;  3AYW C;  5B2J B;  4WU9 D;  5BT1 D;  3VH5 A;  1P3O A;  3V9R B;  1P34 D;  4YS3 B;  2ZY5 A;  2F8N A;  3NQJ B;  4WNN A;  2PYO B;  4YS3 A;  3C1C C;  3W96 B;  5B2I A;  5B32 D;  3AL0 C;  1BFM A;  5GXQ C;  3MGQ B;  4KGC B;  4NE5 A;  4H9N B;  5DNN D;  2FJ7 D;  1B67 A;  1BH8 B;  4Z5T C;  3AZL B;  1TZY B;  5GSU D;  5AVB D;  5AY8 C;  3UTB A;  1S32 C;  1P3I A;  3WKJ D;  1KU5 A;  5B1M B;  1ZLA C;  1T3U A;  4M6B A;  3WAA D;  1ID3 A;  3B6F D;  3MVD B;  3WA9 D;  3AN2 B;  4E45 A;  3UT9 B;  3H0L C;  2Y2J A;  1ZLA D;  3MGQ D;  4NE3 A;  4R8P B;  3X1V A;  3VH6 W;  3WTP B;  3B6F C;  3AFA C;  3C1B B;  3NQU B;  1N1J A;  1P3F B;  4WV4 B;  4ZUX C;  3MGR A;  3AZH D;  1P3O B;  2NQB C;  3B6G D;  3AV1 C;  3MVD C;  5BO0 A;  5FUG B;  1ZLA B;  3WA9 C;  1S32 B;  5CPJ D;  3REK A;  3AZM D;  1P34 C;  3AZL A;  5B40 A;  5AV8 D;  1P3P D;  3REL B;  3AZH B;  2YFW A;  3WKJ B;  5AV5 D;  3MNN D;  2HIO D;  1EQZ C;  5AVC C;  1KX5 D;  5B0Z C;  4XUJ A;  3C1C B;  5G49 B;  5AV5 C;  2CV5 B;  2HIO C;  1P3I B;  3H0R C;  4YS3 C;  1P3P A;  3REK C;  5AV8 A;  1P3A B;  1P3P B;  3AZM A;  3REI C;  3LZ1 D;  1P3K C;  2Y2P A;  1M18 D;  2FFF B;  4XUJ C;  2ZY3 A;  2G5H C;  5CPK C;  1EQZ A;  3B6G A;  2JE5 A;  2L5A A;  5GT0 B;  4LD9 B;  3W97 B;  1M19 B;  2JCH A;  4H9Q A;  1P3K A;  5DNM B;  3AZF A;  2IO5 C;  1M19 A;  1HQ3 B;  1ID3 C;  4J8W D;  4ZBJ B;  3MGQ A;  5CPI D;  1ZLA A;  3MNN B;  3B6G C;  4H9S A;  3X1S C;  3X1V C;  1P3M A;  1M18 C;  1ID3 D;  3B6F A;  3W98 D;  3MGP D;  3UTA C;  2YFW B;  1P3I D;  3UTB D;  3W97 D;  5AVB A;  2FJ7 B;  1WWS A;  3WKJ A;  1HQ3 D;  5AVB B;  2FJ7 A;  5DNN A;  3EPK A;  5BT1 C;  3AV1 A;  3LZ1 B;  3X1S D;  3O62 B;  4QLC D;  3MGR C;  5G49 A;  4H9P A;  3EPL A;  2CV5 A;  3AZK A;  5F99 C;  5CPI C;  4J8W C;  4H9S C;  1KX3 B;  3AZK B;  4G91 B;  5BS7 C;  3MGP B;  2G5I C;  4YS3 D;  1P34 A;  3MGS A;  1P3O D;  5B31 B;  4J8W B;  2HUE B;  4WU9 A;  5CPI B;  4NFT A;  5BS7 A;  1P3M B;  1KX3 D;  3LZ0 A;  1KX4 D;  1F66 C;  3B0C T;  3AZJ B;  3AYW A;  2BG1 A;  3NQJ A;  4H9R B;  4WNN B;  5KDM A;  1TZY D;  1ULY A;  4J8V C;  4ZUX B;  4XZQ B;  1P3O C;  2NQB B;  3A6N C;  5BNX A;  1M18 B;  3B6F B;  3TU4 C;  2NZD A;  5B24 D;  3WAA C;  3AN2 A;  3LZ0 C;  4R8P D;  3AV2 D;  3LEL D;  2HUE C;  3C1B D;  5B31 C;  3UTA D;  3LJA A;  4X23 C;  1Q9C A;  4ZUX D;  1M19 C;  2NQB D;  3W97 C;  5DNM D;  3R45 A;  2BYK A;  5AY8 B;  3KWQ D;  4Z5T B;  3A6N A;  5B31 D;  3MGQ C;  5FUG A;  5GXQ B;  3KXB D;  2Y2K A;  3LEL B;  4H9O A;  3AZG C;  5DNN C;  4YM6 B;  4Z66 A;  1Z2C B;  5AY8 D;  5AVB C;  4CSR B;  5JA4 A;  5GT0 A;  5AV5 B;  2CV5 C;  1P3F D;  3REJ A;  3V9R A;  4LD9 A;  3REH A;  2ARO C;  1P3G D;  3X1U D;  3B0B A;  4KGC D;  5B1L C;  3AV2 B;  1R4V A;  5CHL B;  4J8V D;  1P3A A;  5B1M D;  4H9N A;  5AVC D;  2ARO A;  3WAA B;  4QLC B;  1JFI B;  5CP6 B;  3UT9 D;  3UT9 A;  1U35 C;  1P3G B;  5E5A D;  4JJN B;  1KX5 B;  5C3I C;  1AOI A;  2ARO D;  4EO5 B;  5AVC A;  5GT3 D;  4XZQ C;  3H0M C;  4KUD A;  4J8V B;  3EPJ A;  3AZI D;  3NQU A;  2RIQ A;  3B0C W;  4J8V A;  1P3P C;  3W99 D;  2XD1 A;  1P3A C;  4J8U B;  3UT9 C;  1P3B C;  1S32 A;  5B0Y C;  1P3I C;  2ZY2 A;  5B0Z B;  5B2J D;  4WU9 B;  4KUD C;  3W98 B;  5CPK A;  3REJ D;  3FDD A;  1AOI C;  3UTB B;  5GT0 D;  4LD9 D;  4WZS B;  3AZN A;  3MGP C;  3LJA C;  4G91 C;  3O62 D;  3C1C A;  2Y2I A;  5AV6 B;  3W98 C;  3A1K A;  3MVD A;  2ZM5 A;  2PYO C;  3KWQ A;  3UTA B;  3UTA A;  3KSY A;  3C1B A;  3REH C;  3LEL A;  4R8P A;  4KHA B;  3X1S B;  3X1V B;  3AN2 D;  5B1L A;  3P5J B;  5B0Z D;  4HGA B;  4WU8 C;  3EG5 B;  5JRG C;  3MGS B;  1TAF A;  2IO5 B;  1TZY C;  1A7W A;  1KX4 A;  5CP6 D;  5B0Y D;  4XUJ B;  5B24 B;  3LZ0 D;  3REH B;  2Y2H A;  3B0D B;  3AZM B;  3MGS D;  2Y2G A;  1KX4 C;  5B2I C;  4G92 C;  5AVC B;  1EQZ B;  2JSS A;  1P3B A;  4E44 A;  1P3L C;  3AZK D;  2CV5 D;  4QLC A;  3AZH C;  3REL C;  1JFI A;  3X1S A;  5BNV A;  4J8U A;  5GT3 B;  3KUY A;  3AV1 D;  4YM6 D;  1HQ3 A;  3UTB C;  2BYM B;  3AZN C;  3W97 A;  4KUD B;  3MGP A;  3W99 B;  3W98 A;  4Z5T D;  1P3M D;  2YFV B;  3LZ0 B;  5BO0 B;  3KWQ C;  5GXQ D;  3KXB B;  4J8W A;  5CPI A;  1TAF B;  3C1B C;  3AFA B;  3AZF D;  4CSR A;  5JA4 B;  1P3K D;  1M19 D;  4EO5 C;  3AZG A;  3AZJ A;  4J8X A;  1F66 B;  1EQZ D;  5AV6 D;  3EPH A;  3W99 C;  5B33 A;  1P3M C;  1M18 A;  3LZ1 A;  4Z2M G;  3AZL C;  1BH9 A;  5GT3 C;  3R45 B;  5AV9 A;  3AV2 C;  2XD5 A;  5BNV B;  1W2E A;  1U35 D;  4XUJ D;  4JJN A;  1KX5 A;  4J8X C;  5B32 G;  3W96 C;  4G92 B;  3AZK C;  5E5A B;  4JJN D;  2HIO A;  3MNN A;  1U35 A;  5AV5 A;  3MGR B;  2F8N G;  3LZ1 C;  3B0D C;  3AZM C;  3AZI B;  4DRB A;  5B40 D;  5AV9 D;  3AZL D;  4H9Q B;  5AV8 C;  4WJ3 C;  4H9R A;  5KDM B;  3REK D;  5CPJ A;  5B33 D;  2Y2Q A;  2Y2M A;  5C3I B;  5AV6 A;  3X1U B;  1KX5 C;  2NZD B;  4UUZ B;  4J8X D;  2RVQ D;  5BNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...