3AZEA

Crystal structure of human nucleosome core particle containing h3k64q mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRQLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azeA00
3WKJA 3WTPE 5CPJB 4YM6B 2NZDA 5AV9B 3MVDD 3UTBA 1KX5B 1P3KC 2F8ND 3WA9B 5BNXB 1P3BC 3X1VC 5GXQB 2F8NH 4YM6A 5C3IC 3AFAC 4LD9D 2IO5B 5GT3C 3AZMA 5BNXA 2L5AA 3LJAD 3W96D 3WAAA 3X1UA 3RELD 3AZJA 3W98D 3VH6A 1BH9A 3VH5A 4X23A 4H9RB 3LZ0D 4J8VB 3W97B 1TAFA 4J8XB 5CPJC 1P34D 5AV9C 1KX5C 1H3OB 3W97A 3REHD 3AZIB 3AZED 2HUEB 5B0ZB 5GXQC 3MGQC 5AVBC 4R8PA 4CAYB 4H9SA 5AV5B 3AYWA 1P3FC 3AZHD 2NQBA 3AZIA 1HQ3C 3O62A 3WTPB 4KGCD 4YS3D 3KXBB 3AV2A 5B1MB 3AZFA 1EQZB 5BS7A 4J8VC 5AV5A 4J8XC 3W99A 4KUDD 1P3MA 3WTPA 4WU8D 3KXBA 2AROB 3X1TA 1M18B 1EQZA 1ID3D 4HGAC 5B33D 5CP6A 5B2JB 3MGRB 3REID 1M1AC 5DNMB 1P3LA 5B24D 4Z66C 1M19C 2NZDD 2YFVB 5JRGD 3MNNA 3UTBD 1S32B 1ZLAA 5B32C 4EO5C 4H9NB 3KWQA 5DNMA 5B0YC 4YM6D 1WWIA 1AOIC 2YFVA 3B6GC 5AV6B 3WA9D 4CSRA 3AZMD 3WAAD 5CPIC 2JSSA 5F99B 1TZYA 3X1SC 3AZJD 3NQJA 4XUJC 1M18C 5AV8A 3B6FA 5GSUB 3MGRC 5GT0A 1P3IC 3UTAB 2PYOB 5F99A 5B2IB 3AZLA 4KHAA 5B31B 1BFMA 3W97D 5GSUA 3C1CA 3W98B 2PYOA 5B2IA 2RVQD 1U35A 2HIOB 3AYWD 3AZID 3O62D 5B0ZD 3REKA 3MVDC 3NQUB 3KUYA 1P3GB 4WZSB 5AV5D 1P3MD 3WTPD 3KXBD 1F66B 4LD9C 5B1MD 4JJNB 5KDMB 4Z5TB 3NQUA 1EQZD 4QLCA 3LJAC 3MGPB 3W96C 5CP6D 3RELC 3W98C 3LZ0C 4JJNA 5KDMA 2AROD 4Z5TA 2CV5B 4KUDB 3KWQD 4ZUXA 5B2JD 1P34C 3AN2B 5DNMD 3A6NB 1S32D 3AZEC 3REHC 3REIB 3AV1A 3WKJB 1HTAA 1TZYD 3AZHC 5AV6D 3LZ1B 5E5AA 4KGCC 4YS3C 5F99D 3AZLD 5BO0A 3AZMB 1KX3A 4KUDC 3LZ1A 3WAAB 5GSUD 3AZGC 5BNVB 4WU8C 3X1UB 3UTAD 3AZJB 4H9OB 2PYOD 1BH9B 5B2ID 4X23B 4G91C 1P3KA 1ID3C 5B33C 1TAFB 5B31D 3REIC 4WU9B 1P3AB 5B24C 5BNVA 5DNNA 2NZDC 4H9OA 4Z2MH 5JRGC 3UTBC 1P3OA 5GT3A 3AZNA 1Q9CA 2HIOD 3AZKA 4WU9A 3TU4B 1P3AA 4YM6C 4R8PB 3AYWB 2NQBB 3WA9C 3AZMC 1P3GD 3O62B 3WAAC 3TU4A 5AVCA 3AZJC 4NE3A 3AV2B 1F66D 3AZFB 1KU5A 2IO5C 4JJND 4Z5TD 3W99B 1JFIA 3MGPD 1P3MB 3LELA 3MGSB 5AVBA 3X1TB 1B67A 1P3FA 3W97C 3UT9B 2CV5D 1HQ3A 5CP6B 3B0CT 3AV1D 1P3LB 1P3PB 3MGSA 3AN2D 2RVQC 3A6ND 3MNNB 1ZLAB 1F1EA 4H9SC 3AYWC 3AZIC 3UT9A 3O62C 3KWQB 2HUEC 5E5AD 5B0ZC 3WKJD 5B32G 1P3PA 5AY8A 1WWSA 5BS7C 4NE5A 5AV5C 4ZBJB 4CSRB 1KX3D 2YFWB 3LZ1D 1P3MC 3WTPC 3KXBC 1TZYB 5BT1C 5B1MC 3NQJB 1KX4B 5B40B 5B32A 1EQZC 5AV8B 3KSYA 5CP6C 3B6FB 2YFWA 5GT0B 3C1BB 5DNND 3X1UD 3AZLB 4H9QB 4KHAB 1KX4A 1P3OD 2AROC 2FJ7B 5B40A 3AZND 4X23D 1N1JA 3KWQC 3AZKD 5B2JC 3C1BA 5CPIA 3C1CB 2BYMA 5DNMC 4WU9D 1P3AD 4XZQB 4H9QA 1U35B 1S32C 2FJ7A 1P3IA 1TZYC 4G92B 3REKB 5AVCD 3TU4D 4XZQA 4R8PD 3B0CW 3KUYB 5JA4A 5AV6C 2NQBD 3LELD 5F99C 2F8NG 3AZLC 3AV2D 3AZFD 4QLCB 3REJA 4J8WB 5GSUC 3W99D 3UTAC 3MVDA 3MGSD 2PYOC 5B2IC 3X1TD 2F8NA 5B31C 3UT9D 4J8WA 4ZUXB 1P3LD 1P3PD 5AY8D 3MNND 1ZLAD 2HIOC 3LJAA 5G49A 3AV1B 5CPKA 4M6BA 4AWLB 3LZ0A 4J8UB 1P3GC 3B0DB 5E5AB 2LY8A 3V9RA 1P34A 1F66C 4JJNC 1KX4D 4UUZB 5B1LB 4Z5TC 5B40D 4E44A 5BO0B 4J8UA 1KX3B 5AV8D 3MGPC 3B6FD 2CWEA 3R45A 3C1BD 5GT0D 4H9PA 4WNNB 1P3KB 4UUZA 2FJ7D 5B1LA 2CV5C 1P3BB 3X1VB 4YS3A 3AV1C 4KGCA 3AN2C 5DNNB 3C1CD 5C3IB 3A6NC 4WNNA 1P3OB 4XZQD 5GT3B 3AZNB 1U35D 3B0DC 3AZKB 5E5AC 1P3BA 3AZGA 3X1VA 1BH8B 4NE6A 3WKJC 3REKD 3AFAA 5B33A 3KUYD 1KX3C 3LZ1C 3REJD 5B24A 1BH8A 5AVCB 5JRGA 4QLCD 5FUGA 1JFIB 4J8WD 3LELB 5DNNC 3X1UC 5CPJA 3MGQB 5AVBB 5AV9A 1KX5A 1P3OC 3AZNC 4X23C 1P3FB 3WA9A 1HQ3B 3AZKC 3VH6T 3VH5T 4WU9C 4ZUXD 5GXQA 5CPKD 1P3AC 3MGQA 1R4VA 3TU4C 5AVCC 5AY8B 4R8PC 4H9RA 4J8VA 2NQBC 4HGAB 4J8XA 4J8UD 1M1AB 1ULYA 4NFTA 3LELC 4Z66B 1M19B 3AV2C 1H3OA 3AZFC 5B32B 4EO5B 5B1LD 3W99C 1M1AA 5B0ZA 5B0YB 3MGSC 4Z66A 1M19A 2BYKB 1AOIB 4CAYA 3B6GB 3X1TC 1P3KD 3UT9C 1N1JB 4WV4B 1P3BD 5CPIB 3AZGD 3X1VD 2BYMB 5B0YA 3X1SB 1P3LC 1P3PC 5B1MA 4XUJB 5AY8C 2BYKA 3MNNC 3AFAD 3B0BA 1AOIA 1ZLAC 3B6GA 5GT3D 4DRAA 1P3IB 3X1SA 4XUJA 3VH6W 2AROA 3VH5W 1M18A 4DRBA 5JA4B 4ZBJC 5B2JA 3MGRA 5CPJD 5AV9D 1KX4C 1S32A 1KX5D 5B40C 5AV8C 4H9NA 3REJB 3B6FC 3C1BC 5GT0C 5GXQD 3MVDB 1B6WA 3MGQD 5AVBD 2FJ7C 2F8NB 5AV6A 1P3FD 1HQ3D 4E45A 3C1CC 4Z2MG 5B31G 4LD9B 4XZQC 1U35C 4J8VD 3LJAB 5G49B 3W96B 1A7WA 4J8XD 3RELB 3UTAA 5CPKB 4G92C 3REKC 4LD9A 3LZ0B 3KUYC 5B31A 3REJC 3W96A 3V9RB 1P34B 1M1AD 3RELA 3W98A 4Z66D 1M19D 3AZEB 3REHB 2HIOA 5B32D 4QLCC 4J8WC 3R45B 4H9PB 5B0YD 5BT1D 5CHLB 1AOID 3B6GD 3AZHB 3AZEA 3REHA 1P3GA 4KGCB 4YS3B 4ZUXC 5CPKC 5CPID 1F66A 3X1SD 4XUJD 3AZHA 1M18D 3MGPA 4WU8B 3MGRD 3AZGB 1P3ID 4AWLC 3AFAB 4G91B 1ID3B 2CV5A 5B33B 4J8UC 4KUDA 5B24B 4WU8A 3AN2A 2NZDB 3A6NA 5JRGB 3UTBB 2F8NK 5B1LC 1ID3A 3REIA 5FUGB
chains in the Genus database with same CATH superfamily
3WKJA 3WTPE 5CPJB 4YM6B 2NZDA 5AV9B 1PZRA 3MVDD 3UTBA 1KX5B 1P3KC 2F8ND 3WA9B 5BNXB 1P3BC 3X1VC 5GXQB 2F8NH 4YM6A 5C3IC 2Y2GA 3AFAC 4LD9D 2IO5B 2ZY3A 5GT3C 3AZMA 5BNXA 2L5AA 3LJAD 3W96D 2G5IC 3WAAA 3X1UA 3RELD 3AZJA 3W98D 3VH6A 1BH9A 3VH5A 4X23A 4H9RB 3LZ0D 4J8VB 3W97B 1TAFA 4J8XB 5CPJC 1P34D 5AV9C 1KX5C 1H3OB 3W97A 3REHD 3AZIB 3AZED 2HUEB 5B0ZB 5GXQC 3MGQC 5AVBC 4R8PA 4CAYB 4H9SA 5AV5B 3AYWA 1P3FC 2ZY4A 3AZHD 3AZIA 2NQBA 1HQ3C 3O62A 3WTPB 4KGCD 4YS3D 3KXBB 3AV2A 5B1MB 3AZFA 1EQZB 5BS7A 4J8VC 5AV5A 4J8XC 3W99A 4KUDD 1P3MA 3WTPA 4WU8D 3KXBA 2AROB 3X1TA 1M18B 1EQZA 1ID3D 4HGAC 5B33D 5CP6A 5B2JB 3MGRB 3REID 1M1AC 5DNMB 1P3LA 5B24D 4Z66C 1M19C 2NZDD 2YFVB 5JRGD 3MNNA 3UTBD 1S32B 1ZLAA 5B32C 4EO5C 4H9NB 2JCHA 3KWQA 5DNMA 5B0YC 4YM6D 1WWIA 1AOIC 2YFVA 3B6GC 5AV6B 3WA9D 4CSRA 3AZMD 3WAAD 5CPIC 2JSSA 5F99B 1TZYA 3X1SC 3AZJD 3NQJA 4XUJC 1M18C 5AV8A 3B6FA 5GSUB 3MGRC 5GT0A 1P3IC 3UTAB 2PYOB 5F99A 5B2IB 1Z2CB 3AZLA 4KHAA 5B31B 1BFMA 3W97D 5GSUA 3C1CA 3W98B 2PYOA 5B2IA 2RVQD 1U35A 2HIOB 1W2EA 2UWXA 3AYWD 3AZID 3O62D 2Y2IA 5B0ZD 3REKA 3MVDC 3P5JB 3NQUB 3KUYA 1P3GB 4WZSB 5AV5D 1P3MD 3F6TA 3WTPD 3KXBD 1F66B 4LD9C 5B1MD 2BG1A 4JJNB 5KDMB 4Z5TB 3NQUA 1EQZD 4QLCA 3LJAC 3MGPB 3W96C 5CP6D 2Y2HA 3RELC 3W98C 3FDDA 2XD1A 3LZ0C 4JJNA 5KDMA 2AROD 4Z5TA 2CV5B 4KUDB 3KWQD 4ZUXA 5B2JD 1P34C 3AN2B 5DNMD 3A6NB 1S32D 3AZEC 3REHC 3REIB 3AV1A 3WKJB 1HTAA 1TZYD 3H0RC 2F2AC 3AZHC 5AV6D 2W8SA 3LZ1B 5E5AA 4KGCC 4YS3C 5F99D 3AZLD 2ZY5A 5BO0A 3AZMB 1KX3A 4KUDC 3LZ1A 3WAAB 5GSUD 3AZGC 5BNVB 4WU8C 3X1UB 3UTAD 3AZJB 4H9OB 2PYOD 1BH9B 5B2ID 4X23B 4G91C 1P3KA 1ID3C 5B33C 1TAFB 5B31D 3REIC 2FFFB 4WU9B 1P3AB 5B24C 5BNVA 5DNNA 2NZDC 3IP4C 4H9OA 4Z2MH 5JRGC 2ZM5A 3UTBC 1P3OA 5GT3A 3AZNA 1Q9CA 2HIOD 3AZKA 4WU9A 3TU4B 1P3AA 4YM6C 4R8PB 3AYWB 2NQBB 3WA9C 3AZMC 1P3GD 3H0MC 3O62B 3WAAC 3TU4A 5AVCA 4DQYB 4NE3A 3AZJC 3AV2B 1F66D 3AZFB 1KU5A 2IO5C 4JJND 4Z5TD 3W99B 1JFIA 3MGPD 1P3MB 3LELA 3MGSB 5AVBA 3X1TB 1B67A 1P3FA 3W97C 3UT9B 2CV5D 1HQ3A 5CP6B 3B0CT 3AV1D 1P3LB 1P3PB 3MGSA 3AN2D 2RVQC 3A6ND 3MNNB 1ZLAB 1F1EA 4H9SC 3AYWC 3AZIC 3UT9A 3O62C 3KWQB 2HUEC 5E5AD 5B0ZC 3WKJD 5B32G 1P3PA 5AY8A 1WWSA 5BS7C 4NE5A 5AV5C 4ZBJB 4CSRB 1KX3D 2YFWB 2Y2QA 3LZ1D 1P3MC 3WTPC 3KXBC 1TZYB 2G5HC 5BT1C 5B1MC 3NQJB 1KX4B 5B40B 5B32A 1EQZC 5AV8B 3KSYA 5CP6C 3B6FB 2YFWA 5GT0B 3C1BB 5DNND 3X1UD 3AZLB 4H9QB 4KHAB 1KX4A 1P3OD 2AROC 2FJ7B 5B40A 3AZND 4X23D 2Y2OA 1N1JA 3KWQC 3AZKD 5B2JC 3C1BA 5CPIA 3C1CB 2BYMA 2Y2NA 5DNMC 4WU9D 1P3AD 4XZQB 4H9QA 1U35B 1S32C 2FJ7A 1P3IA 1TZYC 4G92B 3REKB 5AVCD 3TU4D 4XZQA 4R8PD 3B0CW 3KUYB 5JA4A 5AV6C 2NQBD 3LELD 5F99C 2F8NG 3AZLC 3AV2D 3AZFD 4QLCB 3REJA 4J8WB 5GSUC 3W99D 3A1KA 3UTAC 3EG5B 3MVDA 3MGSD 5B2IC 2PYOC 3X1TD 2F8NA 5B31C 3UT9D 4J8WA 4ZUXB 3EPHA 1P3LD 1P3PD 3EPJA 5AY8D 3MNND 1ZLAD 2HIOC 3LJAA 5G49A 3AV1B 5CPKA 4M6BA 4AWLB 3LZ0A 4J8UB 1P3GC 3B0DB 5E5AB 2LY8A 3V9RA 1P34A 1F66C 4JJNC 1KX4D 4UUZB 5B1LB 4Z5TC 5B40D 2J8PA 4E44A 5BO0B 4J8UA 5AV8D 1KX3B 3MGPC 3B6FD 2CWEA 3R45A 3C1BD 5GT0D 4H9PA 2Y2PA 4WNNB 1P3KB 4UUZA 2FJ7D 5B1LA 2CV5C 1P3BB 3X1VB 4YS3A 3AV1C 4KGCA 2VQRA 3AN2C 5DNNB 3C1CD 5C3IB 3A6NC 4WNNA 1T3UA 1P3OB 4XZQD 2JE5A 5GT3B 3AZNB 1U35D 3B0DC 3AZKB 5E5AC 1P3BA 3AZGA 3X1VA 1BH8B 4NE6A 3WKJC 3REKD 3AFAA 5B33A 3KUYD 1KX3C 3LZ1C 3REJD 2DQNC 5B24A 1BH8A 5AVCB 5JRGA 3EPLA 3H0LC 4QLCD 3AL0C 5FUGA 1JFIB 4J8WD 3LELB 5DNNC 3X1UC 5CPJA 3MGQB 5AVBB 5AV9A 1KX5A 1P3OC 3AZNC 4X23C 1P3FB 3KFUG 3WA9A 1HQ3B 3AZKC 3VH6T 3A1IA 3VH5T 4WU9C 4ZUXD 5GXQA 5CPKD 1P3AC 3MGQA 2Y2MA 1R4VA 3TU4C 5AVCC 5AY8B 4R8PC 4H9RA 4J8VA 2NQBC 4HGAB 4J8XA 4J8UD 1M1AB 1ULYA 4NFTA 3LELC 4Z66B 1M19B 3AV2C 1H3OA 3AZFC 5B32B 4EO5B 5B1LD 3W99C 1M1AA 2RIQA 5B0ZA 5B0YB 3MGSC 4Z66A 1M19A 2BYKB 1AOIB 4CAYA 3B6GB 3X1TC 2Y2LA 1P3KD 3UT9C 1N1JB 4WV4B 1P3BD 5CPIB 3AZGD 3X1VD 2BYMB 5B0YA 3X1SB 1P3LC 1P3PC 5B1MA 4XUJB 5AY8C 2BYKA 3MNNC 3AFAD 3B0BA 1AOIA 1ZLAC 3B6GA 5GT3D 4WJ3C 4DRAA 1P3IB 3X1SA 4XUJA 3VH6W 2AROA 3VH5W 1M18A 4DRBA 5JA4B 4ZBJC 5B2JA 3MGRA 5CPJD 5AV9D 1KX4C 1S32A 1KX5D 5B40C 5AV8C 4H9NA 3REJB 3B6FC 3C1BC 5GT0C 5GXQD 3MVDB 1B6WA 3MGQD 5AVBD 2Y2JA 2FJ7C 2F8NB 5AV6A 1P3FD 1HQ3D 4E45A 2XD5A 3C1CC 4Z2MG 5B31G 4LD9B 4XZQC 1U35C 4J8VD 3LJAB 5G49B 3W96B 1A7WA 4J8XD 3RELB 3UTAA 5CPKB 4G92C 3REKC 4LD9A 4UPKA 3LZ0B 2Y2KA 3KUYC 5B31A 2ZY2A 3REJC 3W96A 3V9RB 1P34B 1M1AD 3RELA 3W98A 4Z66D 1M19D 3AZEB 3REHB 2HIOA 5B32D 2DF4C 4QLCC 4J8WC 3R45B 4H9PB 5B0YD 5BT1D 5CHLB 1AOID 3B6GD 3AZHB 3AZEA 3REHA 1P3GA 4KGCB 4YS3B 4ZUXC 5CPKC 5CPID 1F66A 3X1SD 4XUJD 3AZHA 1M18D 3MGPA 4WU8B 3MGRD 3AZGB 1P3ID 4AWLC 3AFAB 4G91B 1ID3B 2CV5A 5B33B 4J8UC 4KUDA 5B24B 4WU8A 3AN2A 2NZDB 3A6NA 5JRGB 3UTBB 3EPKA 2F8NK 5B1LC 1ID3A 3REIA 5FUGB
chains in the Genus database with same CATH topology
3WKJA 3WTPE 5CPJB 4YM6B 2NZDA 5AV9B 1PZRA 3MVDD 3UTBA 1KX5B 1P3KC 2F8ND 3WA9B 5BNXB 1P3BC 3X1VC 5GXQB 2F8NH 4YM6A 5C3IC 2Y2GA 3AFAC 4LD9D 2IO5B 2ZY3A 5GT3C 3AZMA 5BNXA 2L5AA 3LJAD 3W96D 2G5IC 3WAAA 3X1UA 3RELD 3AZJA 3W98D 3VH6A 1BH9A 3VH5A 4X23A 4H9RB 3LZ0D 4J8VB 3W97B 1TAFA 4J8XB 5CPJC 1P34D 5AV9C 1KX5C 1H3OB 3W97A 3REHD 3AZIB 3AZED 2HUEB 5B0ZB 5GXQC 3MGQC 5AVBC 4R8PA 4CAYB 4H9SA 5AV5B 3AYWA 1P3FC 2ZY4A 3AZHD 3AZIA 2NQBA 1HQ3C 3O62A 3WTPB 4KGCD 4YS3D 3KXBB 3AV2A 5B1MB 3AZFA 1EQZB 5BS7A 4J8VC 5AV5A 4J8XC 3W99A 4KUDD 1P3MA 3WTPA 4WU8D 3KXBA 2AROB 3X1TA 1M18B 1EQZA 1ID3D 4HGAC 5B33D 5CP6A 5B2JB 3MGRB 3REID 1M1AC 5DNMB 1P3LA 5B24D 4Z66C 1M19C 2NZDD 2YFVB 5JRGD 3MNNA 3UTBD 1S32B 1ZLAA 5B32C 4EO5C 4H9NB 2JCHA 3KWQA 5DNMA 5B0YC 4YM6D 1WWIA 1AOIC 2YFVA 3B6GC 5AV6B 3WA9D 4CSRA 3AZMD 3WAAD 5CPIC 2JSSA 5F99B 1TZYA 3X1SC 3AZJD 3NQJA 4XUJC 1M18C 5AV8A 3B6FA 5GSUB 3MGRC 5GT0A 1P3IC 3UTAB 2PYOB 5F99A 5B2IB 1Z2CB 3AZLA 4KHAA 5B31B 1BFMA 3W97D 5GSUA 3C1CA 3W98B 2PYOA 5B2IA 2RVQD 1U35A 2HIOB 1W2EA 2UWXA 3AYWD 3AZID 3O62D 2Y2IA 5B0ZD 3REKA 3MVDC 3P5JB 3NQUB 3KUYA 1P3GB 4WZSB 5AV5D 1P3MD 3F6TA 3WTPD 3KXBD 1F66B 4LD9C 5B1MD 2BG1A 4JJNB 5KDMB 4Z5TB 3NQUA 1EQZD 4QLCA 3LJAC 3MGPB 3W96C 5CP6D 2Y2HA 3RELC 3W98C 3FDDA 2XD1A 3LZ0C 4JJNA 5KDMA 2AROD 4Z5TA 2CV5B 4KUDB 3KWQD 4ZUXA 5B2JD 1P34C 3AN2B 5DNMD 3A6NB 1S32D 3AZEC 3REHC 3REIB 3AV1A 3WKJB 1HTAA 1TZYD 3H0RC 2F2AC 3AZHC 5AV6D 2W8SA 3LZ1B 5E5AA 4KGCC 4YS3C 5F99D 3AZLD 2ZY5A 5BO0A 3AZMB 1KX3A 4KUDC 3LZ1A 3WAAB 5GSUD 3AZGC 5BNVB 4WU8C 3X1UB 3UTAD 3AZJB 4H9OB 2PYOD 1BH9B 5B2ID 4X23B 4G91C 1P3KA 1ID3C 5B33C 1TAFB 5B31D 3REIC 2FFFB 4WU9B 1P3AB 5B24C 5BNVA 5DNNA 2NZDC 3IP4C 4H9OA 4Z2MH 5JRGC 2ZM5A 3UTBC 1P3OA 5GT3A 3AZNA 1Q9CA 2HIOD 3AZKA 4WU9A 3TU4B 1P3AA 4YM6C 4R8PB 3AYWB 2NQBB 3WA9C 3AZMC 1P3GD 3H0MC 3O62B 3WAAC 3TU4A 5AVCA 4DQYB 4NE3A 3AZJC 3AV2B 1F66D 3AZFB 1KU5A 2IO5C 4JJND 4Z5TD 3W99B 1JFIA 3MGPD 1P3MB 3LELA 3MGSB 5AVBA 3X1TB 1B67A 1P3FA 3W97C 3UT9B 2CV5D 1HQ3A 5CP6B 3B0CT 3AV1D 1P3LB 1P3PB 3MGSA 3AN2D 2RVQC 3A6ND 3MNNB 1ZLAB 1F1EA 4H9SC 3AYWC 3AZIC 3UT9A 3O62C 3KWQB 2HUEC 5E5AD 5B0ZC 3WKJD 5B32G 1P3PA 5AY8A 1WWSA 5BS7C 4NE5A 5AV5C 4ZBJB 4CSRB 1KX3D 2YFWB 2Y2QA 3LZ1D 1P3MC 3WTPC 3KXBC 1TZYB 2G5HC 5BT1C 5B1MC 3NQJB 1KX4B 5B40B 5B32A 1EQZC 5AV8B 3KSYA 5CP6C 3B6FB 2YFWA 5GT0B 3C1BB 5DNND 3X1UD 3AZLB 4H9QB 4KHAB 1KX4A 1P3OD 2AROC 2FJ7B 5B40A 3AZND 4X23D 2Y2OA 1N1JA 3KWQC 3AZKD 5B2JC 3C1BA 5CPIA 3C1CB 2BYMA 2Y2NA 5DNMC 4WU9D 1P3AD 4XZQB 4H9QA 1U35B 1S32C 2FJ7A 1P3IA 1TZYC 4G92B 3REKB 5AVCD 3TU4D 4XZQA 4R8PD 3B0CW 3KUYB 5JA4A 5AV6C 2NQBD 3LELD 5F99C 2F8NG 3AZLC 3AV2D 3AZFD 4QLCB 3REJA 4J8WB 5GSUC 3W99D 3A1KA 3UTAC 3EG5B 3MVDA 3MGSD 5B2IC 2PYOC 3X1TD 2F8NA 5B31C 3UT9D 4J8WA 4ZUXB 3EPHA 1P3LD 1P3PD 3EPJA 5AY8D 3MNND 1ZLAD 2HIOC 3LJAA 5G49A 3AV1B 5CPKA 4M6BA 4AWLB 3LZ0A 4J8UB 1P3GC 3B0DB 5E5AB 2LY8A 3V9RA 1P34A 1F66C 4JJNC 1KX4D 4UUZB 5B1LB 4Z5TC 5B40D 2J8PA 4E44A 5BO0B 4J8UA 5AV8D 1KX3B 3MGPC 3B6FD 2CWEA 3R45A 3C1BD 5GT0D 4H9PA 2Y2PA 4WNNB 1P3KB 4UUZA 2FJ7D 5B1LA 2CV5C 1P3BB 3X1VB 4YS3A 3AV1C 4KGCA 2VQRA 3AN2C 5DNNB 3C1CD 5C3IB 3A6NC 4WNNA 1T3UA 1P3OB 4XZQD 2JE5A 5GT3B 3AZNB 1U35D 3B0DC 3AZKB 5E5AC 1P3BA 3AZGA 3X1VA 1BH8B 4NE6A 3WKJC 3REKD 3AFAA 5B33A 3KUYD 1KX3C 3LZ1C 3REJD 2DQNC 5B24A 1BH8A 5AVCB 5JRGA 3EPLA 3H0LC 4QLCD 3AL0C 5FUGA 1JFIB 4J8WD 3LELB 5DNNC 3X1UC 5CPJA 3MGQB 5AVBB 5AV9A 1KX5A 1P3OC 3AZNC 4X23C 1P3FB 3KFUG 3WA9A 1HQ3B 3AZKC 3VH6T 3A1IA 3VH5T 4WU9C 4ZUXD 5GXQA 5CPKD 1P3AC 3MGQA 2Y2MA 1R4VA 3TU4C 5AVCC 5AY8B 4R8PC 4H9RA 4J8VA 2NQBC 4HGAB 4J8XA 4J8UD 1M1AB 1ULYA 4NFTA 3LELC 4Z66B 1M19B 3AV2C 1H3OA 3AZFC 5B32B 4EO5B 5B1LD 3W99C 1M1AA 2RIQA 5B0ZA 5B0YB 3MGSC 4Z66A 1M19A 2BYKB 1AOIB 4CAYA 3B6GB 3X1TC 2Y2LA 1P3KD 3UT9C 1N1JB 4WV4B 1P3BD 5CPIB 3AZGD 3X1VD 2BYMB 5B0YA 3X1SB 1P3LC 1P3PC 5B1MA 4XUJB 5AY8C 2BYKA 3MNNC 3AFAD 3B0BA 1AOIA 1ZLAC 3B6GA 5GT3D 4WJ3C 4DRAA 1P3IB 3X1SA 4XUJA 3VH6W 2AROA 3VH5W 1M18A 4DRBA 5JA4B 4ZBJC 5B2JA 3MGRA 5CPJD 5AV9D 1KX4C 1S32A 1KX5D 5B40C 5AV8C 4H9NA 3REJB 3B6FC 3C1BC 5GT0C 5GXQD 3MVDB 1B6WA 3MGQD 5AVBD 2Y2JA 2FJ7C 2F8NB 5AV6A 1P3FD 1HQ3D 4E45A 2XD5A 3C1CC 4Z2MG 5B31G 4LD9B 4XZQC 1U35C 4J8VD 3LJAB 5G49B 3W96B 1A7WA 4J8XD 3RELB 3UTAA 5CPKB 4G92C 3REKC 4LD9A 4UPKA 3LZ0B 2Y2KA 3KUYC 5B31A 2ZY2A 3REJC 3W96A 3V9RB 1P34B 1M1AD 3RELA 3W98A 4Z66D 1M19D 3AZEB 3REHB 2HIOA 5B32D 2DF4C 4QLCC 4J8WC 3R45B 4H9PB 5B0YD 5BT1D 5CHLB 1AOID 3B6GD 3AZHB 3AZEA 3REHA 1P3GA 4KGCB 4YS3B 4ZUXC 5CPKC 5CPID 1F66A 3X1SD 4XUJD 3AZHA 1M18D 3MGPA 4WU8B 3MGRD 3AZGB 1P3ID 4AWLC 3AFAB 4G91B 1ID3B 2CV5A 5B33B 4J8UC 4KUDA 5B24B 4WU8A 3AN2A 2NZDB 3A6NA 5JRGB 3UTBB 3EPKA 2F8NK 5B1LC 1ID3A 3REIA 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ A;  3WTP E;  5CPJ B;  4YM6 B;  2NZD A;  5AV9 B;  3MVD D;  3UTB A;  1KX5 B;  1P3K C;  2F8N D;  3WA9 B;  5BNX B;  1P3B C;  3X1V C;  5GXQ B;  2F8N H;  4YM6 A;  5C3I C;  3AFA C;  4LD9 D;  2IO5 B;  5GT3 C;  3AZM A;  5BNX A;  2L5A A;  3LJA D;  3W96 D;  3WAA A;  3X1U A;  3REL D;  3AZJ A;  3W98 D;  3VH6 A;  1BH9 A;  3VH5 A;  4X23 A;  4H9R B;  3LZ0 D;  4J8V B;  3W97 B;  1TAF A;  4J8X B;  5CPJ C;  1P34 D;  5AV9 C;  1KX5 C;  1H3O B;  3W97 A;  3REH D;  3AZI B;  3AZE D;  2HUE B;  5B0Z B;  5GXQ C;  3MGQ C;  5AVB C;  4R8P A;  4CAY B;  4H9S A;  5AV5 B;  3AYW A;  1P3F C;  3AZH D;  2NQB A;  3AZI A;  1HQ3 C;  3O62 A;  3WTP B;  4KGC D;  4YS3 D;  3KXB B;  3AV2 A;  5B1M B;  3AZF A;  1EQZ B;  5BS7 A;  4J8V C;  5AV5 A;  4J8X C;  3W99 A;  4KUD D;  1P3M A;  3WTP A;  4WU8 D;  3KXB A;  2ARO B;  3X1T A;  1M18 B;  1EQZ A;  1ID3 D;  4HGA C;  5B33 D;  5CP6 A;  5B2J B;  3MGR B;  3REI D;  1M1A C;  5DNM B;  1P3L A;  5B24 D;  4Z66 C;  1M19 C;  2NZD D;  2YFV B;  5JRG D;  3MNN A;  3UTB D;  1S32 B;  1ZLA A;  5B32 C;  4EO5 C;  4H9N B;  3KWQ A;  5DNM A;  5B0Y C;  4YM6 D;  1WWI A;  1AOI C;  2YFV A;  3B6G C;  5AV6 B;  3WA9 D;  4CSR A;  3AZM D;  3WAA D;  5CPI C;  2JSS A;  5F99 B;  1TZY A;  3X1S C;  3AZJ D;  3NQJ A;  4XUJ C;  1M18 C;  5AV8 A;  3B6F A;  5GSU B;  3MGR C;  5GT0 A;  1P3I C;  3UTA B;  2PYO B;  5F99 A;  5B2I B;  3AZL A;  4KHA A;  5B31 B;  1BFM A;  3W97 D;  5GSU A;  3C1C A;  3W98 B;  2PYO A;  5B2I A;  2RVQ D;  1U35 A;  2HIO B;  3AYW D;  3AZI D;  3O62 D;  5B0Z D;  3REK A;  3MVD C;  3NQU B;  3KUY A;  1P3G B;  4WZS B;  5AV5 D;  1P3M D;  3WTP D;  3KXB D;  1F66 B;  4LD9 C;  5B1M D;  4JJN B;  5KDM B;  4Z5T B;  3NQU A;  1EQZ D;  4QLC A;  3LJA C;  3MGP B;  3W96 C;  5CP6 D;  3REL C;  3W98 C;  3LZ0 C;  4JJN A;  5KDM A;  2ARO D;  4Z5T A;  2CV5 B;  4KUD B;  3KWQ D;  4ZUX A;  5B2J D;  1P34 C;  3AN2 B;  5DNM D;  3A6N B;  1S32 D;  3AZE C;  3REH C;  3REI B;  3AV1 A;  3WKJ B;  1HTA A;  1TZY D;  3AZH C;  5AV6 D;  3LZ1 B;  5E5A A;  4KGC C;  4YS3 C;  5F99 D;  3AZL D;  5BO0 A;  3AZM B;  1KX3 A;  4KUD C;  3LZ1 A;  3WAA B;  5GSU D;  3AZG C;  5BNV B;  4WU8 C;  3X1U B;  3UTA D;  3AZJ B;  4H9O B;  2PYO D;  1BH9 B;  5B2I D;  4X23 B;  4G91 C;  1P3K A;  1ID3 C;  5B33 C;  1TAF B;  5B31 D;  3REI C;  4WU9 B;  1P3A B;  5B24 C;  5BNV A;  5DNN A;  2NZD C;  4H9O A;  4Z2M H;  5JRG C;  3UTB C;  1P3O A;  5GT3 A;  3AZN A;  1Q9C A;  2HIO D;  3AZK A;  4WU9 A;  3TU4 B;  1P3A A;  4YM6 C;  4R8P B;  3AYW B;  2NQB B;  3WA9 C;  3AZM C;  1P3G D;  3O62 B;  3WAA C;  3TU4 A;  5AVC A;  3AZJ C;  4NE3 A;  3AV2 B;  1F66 D;  3AZF B;  1KU5 A;  2IO5 C;  4JJN D;  4Z5T D;  3W99 B;  1JFI A;  3MGP D;  1P3M B;  3LEL A;  3MGS B;  5AVB A;  3X1T B;  1B67 A;  1P3F A;  3W97 C;  3UT9 B;  2CV5 D;  1HQ3 A;  5CP6 B;  3B0C T;  3AV1 D;  1P3L B;  1P3P B;  3MGS A;  3AN2 D;  2RVQ C;  3A6N D;  3MNN B;  1ZLA B;  1F1E A;  4H9S C;  3AYW C;  3AZI C;  3UT9 A;  3O62 C;  3KWQ B;  2HUE C;  5E5A D;  5B0Z C;  3WKJ D;  5B32 G;  1P3P A;  5AY8 A;  1WWS A;  5BS7 C;  4NE5 A;  5AV5 C;  4ZBJ B;  4CSR B;  1KX3 D;  2YFW B;  3LZ1 D;  1P3M C;  3WTP C;  3KXB C;  1TZY B;  5BT1 C;  5B1M C;  3NQJ B;  1KX4 B;  5B40 B;  5B32 A;  1EQZ C;  5AV8 B;  3KSY A;  5CP6 C;  3B6F B;  2YFW A;  5GT0 B;  3C1B B;  5DNN D;  3X1U D;  3AZL B;  4H9Q B;  4KHA B;  1KX4 A;  1P3O D;  2ARO C;  2FJ7 B;  5B40 A;  3AZN D;  4X23 D;  1N1J A;  3KWQ C;  3AZK D;  5B2J C;  3C1B A;  5CPI A;  3C1C B;  2BYM A;  5DNM C;  4WU9 D;  1P3A D;  4XZQ B;  4H9Q A;  1U35 B;  1S32 C;  2FJ7 A;  1P3I A;  1TZY C;  4G92 B;  3REK B;  5AVC D;  3TU4 D;  4XZQ A;  4R8P D;  3B0C W;  3KUY B;  5JA4 A;  5AV6 C;  2NQB D;  3LEL D;  5F99 C;  2F8N G;  3AZL C;  3AV2 D;  3AZF D;  4QLC B;  3REJ A;  4J8W B;  5GSU C;  3W99 D;  3UTA C;  3MVD A;  3MGS D;  2PYO C;  5B2I C;  3X1T D;  2F8N A;  5B31 C;  3UT9 D;  4J8W A;  4ZUX B;  1P3L D;  1P3P D;  5AY8 D;  3MNN D;  1ZLA D;  2HIO C;  3LJA A;  5G49 A;  3AV1 B;  5CPK A;  4M6B A;  4AWL B;  3LZ0 A;  4J8U B;  1P3G C;  3B0D B;  5E5A B;  2LY8 A;  3V9R A;  1P34 A;  1F66 C;  4JJN C;  1KX4 D;  4UUZ B;  5B1L B;  4Z5T C;  5B40 D;  4E44 A;  5BO0 B;  4J8U A;  1KX3 B;  5AV8 D;  3MGP C;  3B6F D;  2CWE A;  3R45 A;  3C1B D;  5GT0 D;  4H9P A;  4WNN B;  1P3K B;  4UUZ A;  2FJ7 D;  5B1L A;  2CV5 C;  1P3B B;  3X1V B;  4YS3 A;  3AV1 C;  4KGC A;  3AN2 C;  5DNN B;  3C1C D;  5C3I B;  3A6N C;  4WNN A;  1P3O B;  4XZQ D;  5GT3 B;  3AZN B;  1U35 D;  3B0D C;  3AZK B;  5E5A C;  1P3B A;  3AZG A;  3X1V A;  1BH8 B;  4NE6 A;  3WKJ C;  3REK D;  3AFA A;  5B33 A;  3KUY D;  1KX3 C;  3LZ1 C;  3REJ D;  5B24 A;  1BH8 A;  5AVC B;  5JRG A;  4QLC D;  5FUG A;  1JFI B;  4J8W D;  3LEL B;  5DNN C;  3X1U C;  5CPJ A;  3MGQ B;  5AVB B;  5AV9 A;  1KX5 A;  1P3O C;  3AZN C;  4X23 C;  1P3F B;  3WA9 A;  1HQ3 B;  3AZK C;  3VH6 T;  3VH5 T;  4WU9 C;  4ZUX D;  5GXQ A;  5CPK D;  1P3A C;  3MGQ A;  1R4V A;  3TU4 C;  5AVC C;  5AY8 B;  4R8P C;  4H9R A;  4J8V A;  2NQB C;  4HGA B;  4J8X A;  4J8U D;  1M1A B;  1ULY A;  4NFT A;  3LEL C;  4Z66 B;  1M19 B;  3AV2 C;  1H3O A;  3AZF C;  5B32 B;  4EO5 B;  5B1L D;  3W99 C;  1M1A A;  5B0Z A;  5B0Y B;  3MGS C;  4Z66 A;  1M19 A;  2BYK B;  1AOI B;  4CAY A;  3B6G B;  3X1T C;  1P3K D;  3UT9 C;  1N1J B;  4WV4 B;  1P3B D;  5CPI B;  3AZG D;  3X1V D;  2BYM B;  5B0Y A;  3X1S B;  1P3L C;  1P3P C;  5B1M A;  4XUJ B;  5AY8 C;  2BYK A;  3MNN C;  3AFA D;  3B0B A;  1AOI A;  1ZLA C;  3B6G A;  5GT3 D;  4DRA A;  1P3I B;  3X1S A;  4XUJ A;  3VH6 W;  2ARO A;  3VH5 W;  1M18 A;  4DRB A;  5JA4 B;  4ZBJ C;  5B2J A;  3MGR A;  5CPJ D;  5AV9 D;  1KX4 C;  1S32 A;  1KX5 D;  5B40 C;  5AV8 C;  4H9N A;  3REJ B;  3B6F C;  3C1B C;  5GT0 C;  5GXQ D;  3MVD B;  1B6W A;  3MGQ D;  5AVB D;  2FJ7 C;  2F8N B;  5AV6 A;  1P3F D;  1HQ3 D;  4E45 A;  3C1C C;  4Z2M G;  5B31 G;  4LD9 B;  4XZQ C;  1U35 C;  4J8V D;  3LJA B;  5G49 B;  3W96 B;  1A7W A;  4J8X D;  3REL B;  3UTA A;  5CPK B;  4G92 C;  3REK C;  4LD9 A;  3LZ0 B;  3KUY C;  5B31 A;  3REJ C;  3W96 A;  3V9R B;  1P34 B;  1M1A D;  3REL A;  3W98 A;  4Z66 D;  1M19 D;  3AZE B;  3REH B;  2HIO A;  5B32 D;  4QLC C;  4J8W C;  3R45 B;  4H9P B;  5B0Y D;  5BT1 D;  5CHL B;  1AOI D;  3B6G D;  3AZH B;  3AZE A;  3REH A;  1P3G A;  4KGC B;  4YS3 B;  4ZUX C;  5CPK C;  5CPI D;  1F66 A;  3X1S D;  4XUJ D;  3AZH A;  1M18 D;  3MGP A;  4WU8 B;  3MGR D;  3AZG B;  1P3I D;  4AWL C;  3AFA B;  4G91 B;  1ID3 B;  2CV5 A;  5B33 B;  4J8U C;  4KUD A;  5B24 B;  4WU8 A;  3AN2 A;  2NZD B;  3A6N A;  5JRG B;  3UTB B;  2F8N K;  5B1L C;  1ID3 A;  3REI A;  5FUG B; 
#chains in the Genus database with same CATH topology
 3WKJ A;  3WTP E;  5CPJ B;  4YM6 B;  2NZD A;  5AV9 B;  1PZR A;  3MVD D;  3UTB A;  1KX5 B;  1P3K C;  2F8N D;  3WA9 B;  5BNX B;  1P3B C;  3X1V C;  5GXQ B;  2F8N H;  4YM6 A;  5C3I C;  2Y2G A;  3AFA C;  4LD9 D;  2IO5 B;  2ZY3 A;  5GT3 C;  3AZM A;  5BNX A;  2L5A A;  3LJA D;  3W96 D;  2G5I C;  3WAA A;  3X1U A;  3REL D;  3AZJ A;  3W98 D;  3VH6 A;  1BH9 A;  3VH5 A;  4X23 A;  4H9R B;  3LZ0 D;  4J8V B;  3W97 B;  1TAF A;  4J8X B;  5CPJ C;  1P34 D;  5AV9 C;  1KX5 C;  1H3O B;  3W97 A;  3REH D;  3AZI B;  3AZE D;  2HUE B;  5B0Z B;  5GXQ C;  3MGQ C;  5AVB C;  4R8P A;  4CAY B;  4H9S A;  5AV5 B;  3AYW A;  1P3F C;  2ZY4 A;  3AZH D;  3AZI A;  2NQB A;  1HQ3 C;  3O62 A;  3WTP B;  4KGC D;  4YS3 D;  3KXB B;  3AV2 A;  5B1M B;  3AZF A;  1EQZ B;  5BS7 A;  4J8V C;  5AV5 A;  4J8X C;  3W99 A;  4KUD D;  1P3M A;  3WTP A;  4WU8 D;  3KXB A;  2ARO B;  3X1T A;  1M18 B;  1EQZ A;  1ID3 D;  4HGA C;  5B33 D;  5CP6 A;  5B2J B;  3MGR B;  3REI D;  1M1A C;  5DNM B;  1P3L A;  5B24 D;  4Z66 C;  1M19 C;  2NZD D;  2YFV B;  5JRG D;  3MNN A;  3UTB D;  1S32 B;  1ZLA A;  5B32 C;  4EO5 C;  4H9N B;  2JCH A;  3KWQ A;  5DNM A;  5B0Y C;  4YM6 D;  1WWI A;  1AOI C;  2YFV A;  3B6G C;  5AV6 B;  3WA9 D;  4CSR A;  3AZM D;  3WAA D;  5CPI C;  2JSS A;  5F99 B;  1TZY A;  3X1S C;  3AZJ D;  3NQJ A;  4XUJ C;  1M18 C;  5AV8 A;  3B6F A;  5GSU B;  3MGR C;  5GT0 A;  1P3I C;  3UTA B;  2PYO B;  5F99 A;  5B2I B;  1Z2C B;  3AZL A;  4KHA A;  5B31 B;  1BFM A;  3W97 D;  5GSU A;  3C1C A;  3W98 B;  2PYO A;  5B2I A;  2RVQ D;  1U35 A;  2HIO B;  1W2E A;  2UWX A;  3AYW D;  3AZI D;  3O62 D;  2Y2I A;  5B0Z D;  3REK A;  3MVD C;  3P5J B;  3NQU B;  3KUY A;  1P3G B;  4WZS B;  5AV5 D;  1P3M D;  3F6T A;  3WTP D;  3KXB D;  1F66 B;  4LD9 C;  5B1M D;  2BG1 A;  4JJN B;  5KDM B;  4Z5T B;  3NQU A;  1EQZ D;  4QLC A;  3LJA C;  3MGP B;  3W96 C;  5CP6 D;  2Y2H A;  3REL C;  3W98 C;  3FDD A;  2XD1 A;  3LZ0 C;  4JJN A;  5KDM A;  2ARO D;  4Z5T A;  2CV5 B;  4KUD B;  3KWQ D;  4ZUX A;  5B2J D;  1P34 C;  3AN2 B;  5DNM D;  3A6N B;  1S32 D;  3AZE C;  3REH C;  3REI B;  3AV1 A;  3WKJ B;  1HTA A;  1TZY D;  3H0R C;  2F2A C;  3AZH C;  5AV6 D;  2W8S A;  3LZ1 B;  5E5A A;  4KGC C;  4YS3 C;  5F99 D;  3AZL D;  2ZY5 A;  5BO0 A;  3AZM B;  1KX3 A;  4KUD C;  3LZ1 A;  3WAA B;  5GSU D;  3AZG C;  5BNV B;  4WU8 C;  3X1U B;  3UTA D;  3AZJ B;  4H9O B;  2PYO D;  1BH9 B;  5B2I D;  4X23 B;  4G91 C;  1P3K A;  1ID3 C;  5B33 C;  1TAF B;  5B31 D;  3REI C;  2FFF B;  4WU9 B;  1P3A B;  5B24 C;  5BNV A;  5DNN A;  2NZD C;  3IP4 C;  4H9O A;  4Z2M H;  5JRG C;  2ZM5 A;  3UTB C;  1P3O A;  5GT3 A;  3AZN A;  1Q9C A;  2HIO D;  3AZK A;  4WU9 A;  3TU4 B;  1P3A A;  4YM6 C;  4R8P B;  3AYW B;  2NQB B;  3WA9 C;  3AZM C;  1P3G D;  3H0M C;  3O62 B;  3WAA C;  3TU4 A;  5AVC A;  4DQY B;  4NE3 A;  3AZJ C;  3AV2 B;  1F66 D;  3AZF B;  1KU5 A;  2IO5 C;  4JJN D;  4Z5T D;  3W99 B;  1JFI A;  3MGP D;  1P3M B;  3LEL A;  3MGS B;  5AVB A;  3X1T B;  1B67 A;  1P3F A;  3W97 C;  3UT9 B;  2CV5 D;  1HQ3 A;  5CP6 B;  3B0C T;  3AV1 D;  1P3L B;  1P3P B;  3MGS A;  3AN2 D;  2RVQ C;  3A6N D;  3MNN B;  1ZLA B;  1F1E A;  4H9S C;  3AYW C;  3AZI C;  3UT9 A;  3O62 C;  3KWQ B;  2HUE C;  5E5A D;  5B0Z C;  3WKJ D;  5B32 G;  1P3P A;  5AY8 A;  1WWS A;  5BS7 C;  4NE5 A;  5AV5 C;  4ZBJ B;  4CSR B;  1KX3 D;  2YFW B;  2Y2Q A;  3LZ1 D;  1P3M C;  3WTP C;  3KXB C;  1TZY B;  2G5H C;  5BT1 C;  5B1M C;  3NQJ B;  1KX4 B;  5B40 B;  5B32 A;  1EQZ C;  5AV8 B;  3KSY A;  5CP6 C;  3B6F B;  2YFW A;  5GT0 B;  3C1B B;  5DNN D;  3X1U D;  3AZL B;  4H9Q B;  4KHA B;  1KX4 A;  1P3O D;  2ARO C;  2FJ7 B;  5B40 A;  3AZN D;  4X23 D;  2Y2O A;  1N1J A;  3KWQ C;  3AZK D;  5B2J C;  3C1B A;  5CPI A;  3C1C B;  2BYM A;  2Y2N A;  5DNM C;  4WU9 D;  1P3A D;  4XZQ B;  4H9Q A;  1U35 B;  1S32 C;  2FJ7 A;  1P3I A;  1TZY C;  4G92 B;  3REK B;  5AVC D;  3TU4 D;  4XZQ A;  4R8P D;  3B0C W;  3KUY B;  5JA4 A;  5AV6 C;  2NQB D;  3LEL D;  5F99 C;  2F8N G;  3AZL C;  3AV2 D;  3AZF D;  4QLC B;  3REJ A;  4J8W B;  5GSU C;  3W99 D;  3A1K A;  3UTA C;  3EG5 B;  3MVD A;  3MGS D;  5B2I C;  2PYO C;  3X1T D;  2F8N A;  5B31 C;  3UT9 D;  4J8W A;  4ZUX B;  3EPH A;  1P3L D;  1P3P D;  3EPJ A;  5AY8 D;  3MNN D;  1ZLA D;  2HIO C;  3LJA A;  5G49 A;  3AV1 B;  5CPK A;  4M6B A;  4AWL B;  3LZ0 A;  4J8U B;  1P3G C;  3B0D B;  5E5A B;  2LY8 A;  3V9R A;  1P34 A;  1F66 C;  4JJN C;  1KX4 D;  4UUZ B;  5B1L B;  4Z5T C;  5B40 D;  2J8P A;  4E44 A;  5BO0 B;  4J8U A;  5AV8 D;  1KX3 B;  3MGP C;  3B6F D;  2CWE A;  3R45 A;  3C1B D;  5GT0 D;  4H9P A;  2Y2P A;  4WNN B;  1P3K B;  4UUZ A;  2FJ7 D;  5B1L A;  2CV5 C;  1P3B B;  3X1V B;  4YS3 A;  3AV1 C;  4KGC A;  2VQR A;  3AN2 C;  5DNN B;  3C1C D;  5C3I B;  3A6N C;  4WNN A;  1T3U A;  1P3O B;  4XZQ D;  2JE5 A;  5GT3 B;  3AZN B;  1U35 D;  3B0D C;  3AZK B;  5E5A C;  1P3B A;  3AZG A;  3X1V A;  1BH8 B;  4NE6 A;  3WKJ C;  3REK D;  3AFA A;  5B33 A;  3KUY D;  1KX3 C;  3LZ1 C;  3REJ D;  2DQN C;  5B24 A;  1BH8 A;  5AVC B;  5JRG A;  3EPL A;  3H0L C;  4QLC D;  3AL0 C;  5FUG A;  1JFI B;  4J8W D;  3LEL B;  5DNN C;  3X1U C;  5CPJ A;  3MGQ B;  5AVB B;  5AV9 A;  1KX5 A;  1P3O C;  3AZN C;  4X23 C;  1P3F B;  3KFU G;  3WA9 A;  1HQ3 B;  3AZK C;  3VH6 T;  3A1I A;  3VH5 T;  4WU9 C;  4ZUX D;  5GXQ A;  5CPK D;  1P3A C;  3MGQ A;  2Y2M A;  1R4V A;  3TU4 C;  5AVC C;  5AY8 B;  4R8P C;  4H9R A;  4J8V A;  2NQB C;  4HGA B;  4J8X A;  4J8U D;  1M1A B;  1ULY A;  4NFT A;  3LEL C;  4Z66 B;  1M19 B;  3AV2 C;  1H3O A;  3AZF C;  5B32 B;  4EO5 B;  5B1L D;  3W99 C;  1M1A A;  2RIQ A;  5B0Z A;  5B0Y B;  3MGS C;  4Z66 A;  1M19 A;  2BYK B;  1AOI B;  4CAY A;  3B6G B;  3X1T C;  2Y2L A;  1P3K D;  3UT9 C;  1N1J B;  4WV4 B;  1P3B D;  5CPI B;  3AZG D;  3X1V D;  2BYM B;  5B0Y A;  3X1S B;  1P3L C;  1P3P C;  5B1M A;  4XUJ B;  5AY8 C;  2BYK A;  3MNN C;  3AFA D;  3B0B A;  1AOI A;  1ZLA C;  3B6G A;  5GT3 D;  4WJ3 C;  4DRA A;  1P3I B;  3X1S A;  4XUJ A;  3VH6 W;  2ARO A;  3VH5 W;  1M18 A;  4DRB A;  5JA4 B;  4ZBJ C;  5B2J A;  3MGR A;  5CPJ D;  5AV9 D;  1KX4 C;  1S32 A;  1KX5 D;  5B40 C;  5AV8 C;  4H9N A;  3REJ B;  3B6F C;  3C1B C;  5GT0 C;  5GXQ D;  3MVD B;  1B6W A;  3MGQ D;  5AVB D;  2Y2J A;  2FJ7 C;  2F8N B;  5AV6 A;  1P3F D;  1HQ3 D;  4E45 A;  2XD5 A;  3C1C C;  4Z2M G;  5B31 G;  4LD9 B;  4XZQ C;  1U35 C;  4J8V D;  3LJA B;  5G49 B;  3W96 B;  1A7W A;  4J8X D;  3REL B;  3UTA A;  5CPK B;  4G92 C;  3REK C;  4LD9 A;  4UPK A;  3LZ0 B;  2Y2K A;  3KUY C;  5B31 A;  2ZY2 A;  3REJ C;  3W96 A;  3V9R B;  1P34 B;  1M1A D;  3REL A;  3W98 A;  4Z66 D;  1M19 D;  3AZE B;  3REH B;  2HIO A;  5B32 D;  2DF4 C;  4QLC C;  4J8W C;  3R45 B;  4H9P B;  5B0Y D;  5BT1 D;  5CHL B;  1AOI D;  3B6G D;  3AZH B;  3AZE A;  3REH A;  1P3G A;  4KGC B;  4YS3 B;  4ZUX C;  5CPK C;  5CPI D;  1F66 A;  3X1S D;  4XUJ D;  3AZH A;  1M18 D;  3MGP A;  4WU8 B;  3MGR D;  3AZG B;  1P3I D;  4AWL C;  3AFA B;  4G91 B;  1ID3 B;  2CV5 A;  5B33 B;  4J8U C;  4KUD A;  5B24 B;  4WU8 A;  3AN2 A;  2NZD B;  3A6N A;  5JRG B;  3UTB B;  3EPK A;  2F8N K;  5B1L C;  1ID3 A;  3REI A;  5FUG B; 
#chains in the Genus database with same CATH homology
 3WKJ A;  3WTP E;  5CPJ B;  4YM6 B;  2NZD A;  5AV9 B;  1PZR A;  3MVD D;  3UTB A;  1KX5 B;  1P3K C;  2F8N D;  3WA9 B;  5BNX B;  1P3B C;  3X1V C;  5GXQ B;  2F8N H;  4YM6 A;  5C3I C;  2Y2G A;  3AFA C;  4LD9 D;  2IO5 B;  2ZY3 A;  5GT3 C;  3AZM A;  5BNX A;  2L5A A;  3LJA D;  3W96 D;  2G5I C;  3WAA A;  3X1U A;  3REL D;  3AZJ A;  3W98 D;  3VH6 A;  1BH9 A;  3VH5 A;  4X23 A;  4H9R B;  3LZ0 D;  4J8V B;  3W97 B;  1TAF A;  4J8X B;  5CPJ C;  1P34 D;  5AV9 C;  1KX5 C;  1H3O B;  3W97 A;  3REH D;  3AZI B;  3AZE D;  2HUE B;  5B0Z B;  5GXQ C;  3MGQ C;  5AVB C;  4R8P A;  4CAY B;  4H9S A;  5AV5 B;  3AYW A;  1P3F C;  2ZY4 A;  3AZH D;  3AZI A;  2NQB A;  1HQ3 C;  3O62 A;  3WTP B;  4KGC D;  4YS3 D;  3KXB B;  3AV2 A;  5B1M B;  3AZF A;  1EQZ B;  5BS7 A;  4J8V C;  5AV5 A;  4J8X C;  3W99 A;  4KUD D;  1P3M A;  3WTP A;  4WU8 D;  3KXB A;  2ARO B;  3X1T A;  1M18 B;  1EQZ A;  1ID3 D;  4HGA C;  5B33 D;  5CP6 A;  5B2J B;  3MGR B;  3REI D;  1M1A C;  5DNM B;  1P3L A;  5B24 D;  4Z66 C;  1M19 C;  2NZD D;  2YFV B;  5JRG D;  3MNN A;  3UTB D;  1S32 B;  1ZLA A;  5B32 C;  4EO5 C;  4H9N B;  2JCH A;  3KWQ A;  5DNM A;  5B0Y C;  4YM6 D;  1WWI A;  1AOI C;  2YFV A;  3B6G C;  5AV6 B;  3WA9 D;  4CSR A;  3AZM D;  3WAA D;  5CPI C;  2JSS A;  5F99 B;  1TZY A;  3X1S C;  3AZJ D;  3NQJ A;  4XUJ C;  1M18 C;  5AV8 A;  3B6F A;  5GSU B;  3MGR C;  5GT0 A;  1P3I C;  3UTA B;  2PYO B;  5F99 A;  5B2I B;  1Z2C B;  3AZL A;  4KHA A;  5B31 B;  1BFM A;  3W97 D;  5GSU A;  3C1C A;  3W98 B;  2PYO A;  5B2I A;  2RVQ D;  1U35 A;  2HIO B;  1W2E A;  2UWX A;  3AYW D;  3AZI D;  3O62 D;  2Y2I A;  5B0Z D;  3REK A;  3MVD C;  3P5J B;  3NQU B;  3KUY A;  1P3G B;  4WZS B;  5AV5 D;  1P3M D;  3F6T A;  3WTP D;  3KXB D;  1F66 B;  4LD9 C;  5B1M D;  2BG1 A;  4JJN B;  5KDM B;  4Z5T B;  3NQU A;  1EQZ D;  4QLC A;  3LJA C;  3MGP B;  3W96 C;  5CP6 D;  2Y2H A;  3REL C;  3W98 C;  3FDD A;  2XD1 A;  3LZ0 C;  4JJN A;  5KDM A;  2ARO D;  4Z5T A;  2CV5 B;  4KUD B;  3KWQ D;  4ZUX A;  5B2J D;  1P34 C;  3AN2 B;  5DNM D;  3A6N B;  1S32 D;  3AZE C;  3REH C;  3REI B;  3AV1 A;  3WKJ B;  1HTA A;  1TZY D;  3H0R C;  2F2A C;  3AZH C;  5AV6 D;  2W8S A;  3LZ1 B;  5E5A A;  4KGC C;  4YS3 C;  5F99 D;  3AZL D;  2ZY5 A;  5BO0 A;  3AZM B;  1KX3 A;  4KUD C;  3LZ1 A;  3WAA B;  5GSU D;  3AZG C;  5BNV B;  4WU8 C;  3X1U B;  3UTA D;  3AZJ B;  4H9O B;  2PYO D;  1BH9 B;  5B2I D;  4X23 B;  4G91 C;  1P3K A;  1ID3 C;  5B33 C;  1TAF B;  5B31 D;  3REI C;  2FFF B;  4WU9 B;  1P3A B;  5B24 C;  5BNV A;  5DNN A;  2NZD C;  3IP4 C;  4H9O A;  4Z2M H;  5JRG C;  2ZM5 A;  3UTB C;  1P3O A;  5GT3 A;  3AZN A;  1Q9C A;  2HIO D;  3AZK A;  4WU9 A;  3TU4 B;  1P3A A;  4YM6 C;  4R8P B;  3AYW B;  2NQB B;  3WA9 C;  3AZM C;  1P3G D;  3H0M C;  3O62 B;  3WAA C;  3TU4 A;  5AVC A;  4DQY B;  4NE3 A;  3AZJ C;  3AV2 B;  1F66 D;  3AZF B;  1KU5 A;  2IO5 C;  4JJN D;  4Z5T D;  3W99 B;  1JFI A;  3MGP D;  1P3M B;  3LEL A;  3MGS B;  5AVB A;  3X1T B;  1B67 A;  1P3F A;  3W97 C;  3UT9 B;  2CV5 D;  1HQ3 A;  5CP6 B;  3B0C T;  3AV1 D;  1P3L B;  1P3P B;  3MGS A;  3AN2 D;  2RVQ C;  3A6N D;  3MNN B;  1ZLA B;  1F1E A;  4H9S C;  3AYW C;  3AZI C;  3UT9 A;  3O62 C;  3KWQ B;  2HUE C;  5E5A D;  5B0Z C;  3WKJ D;  5B32 G;  1P3P A;  5AY8 A;  1WWS A;  5BS7 C;  4NE5 A;  5AV5 C;  4ZBJ B;  4CSR B;  1KX3 D;  2YFW B;  2Y2Q A;  3LZ1 D;  1P3M C;  3WTP C;  3KXB C;  1TZY B;  2G5H C;  5BT1 C;  5B1M C;  3NQJ B;  1KX4 B;  5B40 B;  5B32 A;  1EQZ C;  5AV8 B;  3KSY A;  5CP6 C;  3B6F B;  2YFW A;  5GT0 B;  3C1B B;  5DNN D;  3X1U D;  3AZL B;  4H9Q B;  4KHA B;  1KX4 A;  1P3O D;  2ARO C;  2FJ7 B;  5B40 A;  3AZN D;  4X23 D;  2Y2O A;  1N1J A;  3KWQ C;  3AZK D;  5B2J C;  3C1B A;  5CPI A;  3C1C B;  2BYM A;  2Y2N A;  5DNM C;  4WU9 D;  1P3A D;  4XZQ B;  4H9Q A;  1U35 B;  1S32 C;  2FJ7 A;  1P3I A;  1TZY C;  4G92 B;  3REK B;  5AVC D;  3TU4 D;  4XZQ A;  4R8P D;  3B0C W;  3KUY B;  5JA4 A;  5AV6 C;  2NQB D;  3LEL D;  5F99 C;  2F8N G;  3AZL C;  3AV2 D;  3AZF D;  4QLC B;  3REJ A;  4J8W B;  5GSU C;  3W99 D;  3A1K A;  3UTA C;  3EG5 B;  3MVD A;  3MGS D;  5B2I C;  2PYO C;  3X1T D;  2F8N A;  5B31 C;  3UT9 D;  4J8W A;  4ZUX B;  3EPH A;  1P3L D;  1P3P D;  3EPJ A;  5AY8 D;  3MNN D;  1ZLA D;  2HIO C;  3LJA A;  5G49 A;  3AV1 B;  5CPK A;  4M6B A;  4AWL B;  3LZ0 A;  4J8U B;  1P3G C;  3B0D B;  5E5A B;  2LY8 A;  3V9R A;  1P34 A;  1F66 C;  4JJN C;  1KX4 D;  4UUZ B;  5B1L B;  4Z5T C;  5B40 D;  2J8P A;  4E44 A;  5BO0 B;  4J8U A;  5AV8 D;  1KX3 B;  3MGP C;  3B6F D;  2CWE A;  3R45 A;  3C1B D;  5GT0 D;  4H9P A;  2Y2P A;  4WNN B;  1P3K B;  4UUZ A;  2FJ7 D;  5B1L A;  2CV5 C;  1P3B B;  3X1V B;  4YS3 A;  3AV1 C;  4KGC A;  2VQR A;  3AN2 C;  5DNN B;  3C1C D;  5C3I B;  3A6N C;  4WNN A;  1T3U A;  1P3O B;  4XZQ D;  2JE5 A;  5GT3 B;  3AZN B;  1U35 D;  3B0D C;  3AZK B;  5E5A C;  1P3B A;  3AZG A;  3X1V A;  1BH8 B;  4NE6 A;  3WKJ C;  3REK D;  3AFA A;  5B33 A;  3KUY D;  1KX3 C;  3LZ1 C;  3REJ D;  2DQN C;  5B24 A;  1BH8 A;  5AVC B;  5JRG A;  3EPL A;  3H0L C;  4QLC D;  3AL0 C;  5FUG A;  1JFI B;  4J8W D;  3LEL B;  5DNN C;  3X1U C;  5CPJ A;  3MGQ B;  5AVB B;  5AV9 A;  1KX5 A;  1P3O C;  3AZN C;  4X23 C;  1P3F B;  3KFU G;  3WA9 A;  1HQ3 B;  3AZK C;  3VH6 T;  3A1I A;  3VH5 T;  4WU9 C;  4ZUX D;  5GXQ A;  5CPK D;  1P3A C;  3MGQ A;  2Y2M A;  1R4V A;  3TU4 C;  5AVC C;  5AY8 B;  4R8P C;  4H9R A;  4J8V A;  2NQB C;  4HGA B;  4J8X A;  4J8U D;  1M1A B;  1ULY A;  4NFT A;  3LEL C;  4Z66 B;  1M19 B;  3AV2 C;  1H3O A;  3AZF C;  5B32 B;  4EO5 B;  5B1L D;  3W99 C;  1M1A A;  2RIQ A;  5B0Z A;  5B0Y B;  3MGS C;  4Z66 A;  1M19 A;  2BYK B;  1AOI B;  4CAY A;  3B6G B;  3X1T C;  2Y2L A;  1P3K D;  3UT9 C;  1N1J B;  4WV4 B;  1P3B D;  5CPI B;  3AZG D;  3X1V D;  2BYM B;  5B0Y A;  3X1S B;  1P3L C;  1P3P C;  5B1M A;  4XUJ B;  5AY8 C;  2BYK A;  3MNN C;  3AFA D;  3B0B A;  1AOI A;  1ZLA C;  3B6G A;  5GT3 D;  4WJ3 C;  4DRA A;  1P3I B;  3X1S A;  4XUJ A;  3VH6 W;  2ARO A;  3VH5 W;  1M18 A;  4DRB A;  5JA4 B;  4ZBJ C;  5B2J A;  3MGR A;  5CPJ D;  5AV9 D;  1KX4 C;  1S32 A;  1KX5 D;  5B40 C;  5AV8 C;  4H9N A;  3REJ B;  3B6F C;  3C1B C;  5GT0 C;  5GXQ D;  3MVD B;  1B6W A;  3MGQ D;  5AVB D;  2Y2J A;  2FJ7 C;  2F8N B;  5AV6 A;  1P3F D;  1HQ3 D;  4E45 A;  2XD5 A;  3C1C C;  4Z2M G;  5B31 G;  4LD9 B;  4XZQ C;  1U35 C;  4J8V D;  3LJA B;  5G49 B;  3W96 B;  1A7W A;  4J8X D;  3REL B;  3UTA A;  5CPK B;  4G92 C;  3REK C;  4LD9 A;  4UPK A;  3LZ0 B;  2Y2K A;  3KUY C;  5B31 A;  2ZY2 A;  3REJ C;  3W96 A;  3V9R B;  1P34 B;  1M1A D;  3REL A;  3W98 A;  4Z66 D;  1M19 D;  3AZE B;  3REH B;  2HIO A;  5B32 D;  2DF4 C;  4QLC C;  4J8W C;  3R45 B;  4H9P B;  5B0Y D;  5BT1 D;  5CHL B;  1AOI D;  3B6G D;  3AZH B;  3AZE A;  3REH A;  1P3G A;  4KGC B;  4YS3 B;  4ZUX C;  5CPK C;  5CPI D;  1F66 A;  3X1S D;  4XUJ D;  3AZH A;  1M18 D;  3MGP A;  4WU8 B;  3MGR D;  3AZG B;  1P3I D;  4AWL C;  3AFA B;  4G91 B;  1ID3 B;  2CV5 A;  5B33 B;  4J8U C;  4KUD A;  5B24 B;  4WU8 A;  3AN2 A;  2NZD B;  3A6N A;  5JRG B;  3UTB B;  3EPK A;  2F8N K;  5B1L C;  1ID3 A;  3REI A;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...