3AZEA

Crystal structure of human nucleosome core particle containing h3k64q mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRQLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azeA00
1P3IA 3UTBA 4YS3A 3KWQB 3AN2A 4XZQB 5AV6A 3AZMC 5CP6A 3C1CA 5AVBB 2LY8A 4NE6A 4JJNC 3LZ0C 4X23B 3X1TC 1KX5D 1P3FC 4Z5TD 2BYKB 5AV8B 1P3MA 5DNNB 1P3BB 4YM6B 3REJB 5G49A 2HIOB 5B40C 3X1SC 2NZDB 3REHB 3AZKB 1P3KC 3KUYC 3WKJC 3AZID 2NQBA 5E5AA 5B2IA 4ZUXC 3W98B 4QLCB 3KWQC 4XZQC 1JFIA 5BT1D 3WTPE 1U35D 1P3LA 4LD9B 3AZNA 2BYMB 4NE5A 4R8PB 5AV5B 5AV8C 3AYWC 3NQUB 2F8NH 3REJC 2CWEA 2HIOC 2RVQD 2AROC 5B33C 2NZDC 5AVCA 3REHC 3C1BA 3AZKC 5B1MB 2FJ7D 5B0YB 1EQZD 1S32A 5B2JD 3VH6T 5CPIC 3MVDD 3AFAB 3WA9D 3W96B 5AV9D 4Z66B 3W98C 4QLCC 1M1AD 2CV5B 4H9PB 3UTBB 3LZ1B 4YS3B 1KX4B 3MNNB 4H9QA 3W99D 3AZLD 2F8NB 3AV1D 3B6GA 3B0CW 1ID3D 1KX5A 4R8PC 4Z5TA 3AZJB 4H9OB 3AZED 5B1MC 5B0YC 2F8NG 4J8XD 4J8WD 3AZIA 5F99C 3B6FD 1BH9A 3UT9B 3W96C 4Z66C 4H9SA 5GT3D 4EO5B 2PYOC 3AZGB 1HQ3B 5E5AB 5B2IB 2CV5C 4J8VB 5DNMB 1P3IC 3UTBC 4YS3C 1KX4C 3KSYA 1JFIB 5AV6C 5B24B 1P3PD 5KDMA 1P3AD 1M18D 5AY8D 3VH5W 3AZJC 4HGAB 3AZNB 3NQJB 4WU8D 3UTAB 1P3GB 3RELA 3MVDA 3C1BB 4WV4B 3WA9A 5AV9A 3R45A 2NQBC 5E5AC 5B2IC 3A6ND 4CSRB 1P3OD 3LELA 4J8VC 3REKA 3MGSA 4KHAB 5B31D 5B24C 3AZMB 4XUJD 4H9QB 3AZHD 1P3LC 3B6GB 4KGCD 5B0ZA 4HGAC 3AZNC 3MGRA 1P3FB 5BNVA 4KUDD 3AZEA 1P3GC 4J8WA 3B6FA 5AVCC 3C1BC 3KUYB 3REIA 3WKJB 1S32C 5JA4B 4ZUXB 1KX3D 3MGPD 1F66A 3B0BA 3X1VA 3AV2D 1P3AA 1M18A 3AZFD 4CAYB 4H9NB 3B6GC 1KX5C 5GXQA 3W97D 3AYWB 3KXBD 2AROB 5B33B 5CPJD 5B1LB 3AZIC 3RELB 1N1JA 2YFVA 1TZYA 5JRGD 1AOID 1P3OA 5CPIB 3WTPD 4H9SC 3R45B 3MGQA 1BH8B 1B6WA 3LELB 3REKB 3O62D 1P34B 3LJAA 1TAFB 4XUJA 3MGSB 4JJND 3LZ0D 3AZHA 3TU4D 5CPKA 3X1TD 5B32D 5GSUD 5B0ZB 3X1UA 3MGRB 5B40D 3X1SD 4M6BA 4WU9A 1P3KD 4Z2MG 5B1LC 3RELC 5F99B 3WA9C 3WAAB 3KWQD 3REIB 2PYOB 5FUGA 4XZQD 3MGPA 1H3OA 3LELC 3REKC 1P34C 4H9RA 1P3IB 3AV2A 5AVBD 3MGSC 3AZFA 3AN2B 1F66B 4X23D 5AV6B 3X1VB 5C3IB 5CP6B 3C1CB 1ZLAD 4G91C 5DNND 1P3BD 4YM6D 4UUZA 3REJD 5B0ZC 3W97A 2HIOD 3MGRC 2NZDD 3REHD 5GXQB 3AZKD 1P3MB 3AZEC 5G49B 1M19D 5JRGA 1AOIA 3WTPA 3W98D 3WAAC 3REIC 2NQBB 1TZYB 3VH5A 5BO0A 3O62A 3MGQB 4LD9D 3AN2C 3LJAB 1U35A 1F66C 3TU4A 3X1VC 5C3IC 5CP6C 3C1CC 4R8PD 1P3AC 5AV5D 5GT0D 4DRBA 5B32A 1M18C 5CPKB 1P3LB 5GSUA 5GXQC 1P3KA 5B1MD 5B0YD 3X1UB 1P3MC 2FJ7A 3W96D 3AFAD 4WU9B 1EQZA 4Z66D 5B2JA 5AVCB 3B0DB 2CV5D 1S32B 1TZYC 4XZQA 1P3OC 1M1AA 3UTBD 2F8NK 3LZ1D 4YS3D 1KX4D 3MNND 3MGQC 2F8ND 5AVBA 3B0CT 1H3OB 4H9RB 3LJAC 4X23A 3AZLA 3W99A 3AV1A 1ZLAA 4NE3A 4WZSB 1ID3A 3AZHC 3AZJD 5DNNA 1P3BA 5CPKC 4YM6A 2HIOA 1KX5B 4NFTA 4J8UD 4Z5TB 3X1UC 3UT9D 4WU9C 1Q9CA 4J8XA 1M19A 3B0DC 3AZGD 2IO5C 1HQ3D 5E5AD 5B2ID 3AZIB 5GT3A 4J8VD 1BH9B 5DNMD 2HUEC 5B24D 4LD9A 4G92B 1P3PA 3VH5T 2BYMA 4R8PA 5AV5A 5GT0A 1B67A 3AZFC 1U35B 3AZND 3NQUA 5AY8A 5KDMB 5B32B 4E45A 3UTAD 1P3GD 4Z5TC 4Z2MH 4WU8A 2L5AA 1WWIA 3AFAA 2FJ7B 1EQZB 4H9PA 5B2JB 1AOIC 3MVDB 3WA9B 3A6NA 3WTPC 3LZ1A 5AV9B 5B32G 3MNNA 1KX4A 1ULYA 3VH6W 2F8NA 3AZMD 1M1AB 4G92C 3O62C 5B31A 5BS7A 5BT1C 3W99B 3AZLB 1U35C 3AZJA 3TU4C 3B6GD 3AV1B 1ZLAB 4H9OA 4AWLC 4KGCA 1P3FD 5B32C 1ID3B 4G91B 4J8UA 5GSUC 5CHLB 4KUDA 3UT9A 1R4VA 2RVQC 3KUYD 5BNVB 3WKJD 3AZGA 3AZEB 1HQ3A 2FJ7C 1BFMA 4J8XB 4J8WB 2JSSA 1EQZC 4J8VA 5B2JC 1M19B 3B6FB 5DNMA 4ZUXD 5BNXA 3MVDC 5AV9C 5GT3B 5B24A 1KX3A 1M1AC 2YFWA 5AVBC 3W99C 3AZLC 4X23C 1P3PB 3AV1C 1ZLAC 3NQJA 1P3AB 5GT0B 4ZBJB 1M18B 1ID3C 5DNNC 5AV8D 1P3BC 4YM6C 3UTAA 5AY8B 3AYWD 1P3GA 2AROD 5B33D 3KXBA 5B1LD 4WU8B 1HTAA 3RELD 5CPJA 4J8XC 4CSRA 4J8WC 5CPID 1M19C 3B6FC 4QLCD 5GT3C 1N1JB 2YFVB 4KHAA 3LELD 3REKD 1P34D 3AZMA 3A6NB 1P3OB 3MGSD 4LD9C 5B31B 4JJNA 3LZ0A 1P3PC 3X1TA 4XUJB 5AV5C 5GT0C 1P3FA 4ZBJC 5B0ZD 3AZHB 5AY8C 3MGRD 1WWSA 4WNNA 4KGCB 3X1SA 5B40A 4J8UB 3V9RA 3KUYA 4WU8C 3WKJA 4KUDB 5F99D 3AFAC 5B31G 5JA4A 3WAAD 3REID 4ZUXA 2PYOD 2IO5B 3KWQA 4E44A 5BNXB 3A6NC 1P3ID 2HUEB 3LZ1C 3MNNC 3AN2D 4CAYA 5FUGB 1F66D 1KX3B 5AV6D 4H9NA 2YFWB 3MGPB 5B31C 5CP6D 3C1CD 3X1VD 5BS7C 4DRAA 3AV2B 4XUJC 3AZFB 2BYKA 5AV8A 3AYWA 5GXQD 3REJA 4KGCC 1KU5A 2AROA 5B33A 1P3MD 4J8UC 3REHA 2NZDA 5B1LA 3AZKA 4UUZB 4KUDC 3W97B 3UT9C 3KXBB 5CPIA 1F1EA 4EO5C 1BH8A 3AZGC 2NQBD 1HQ3C 1TZYD 5CPJB 3W98A 4QLCA 1P34A 3MGQD 5DNMC 5JRGB 1AOIB 1TAFA 1A7WA 3WTPB 3LJAD 1KX3C 3MGPC 5BO0B 3O62B 3AV2C 5CPKD 1P3LD 4JJNB 3LZ0B 3TU4B 3X1TB 4AWLB 3X1UD 3UTAC 3VH6A 5B1MA 5GSUB 4WNNB 5B0YA 4WU9D 3W97C 5F99A 5B40B 3X1SB 3KXBC 3W96A 5AVCD 3C1BD 3V9RB 1P3KB 3WAAA 4Z66A 2PYOA 1S32D 5CPJC 2CV5A 5JRGC
chains in the Genus database with same CATH superfamily
1P3IA 3UTBA 4YS3A 3KWQB 3AN2A 4XZQB 5AV6A 3AZMC 5CP6A 3C1CA 5AVBB 2LY8A 4NE6A 4JJNC 3LZ0C 4X23B 3FDDA 3X1TC 1KX5D 1P3FC 4Z5TD 2BYKB 5AV8B 1P3MA 5DNNB 1P3BB 4YM6B 3REJB 5G49A 2HIOB 4DQYB 5B40C 3X1SC 2NZDB 3REHB 3AZKB 1P3KC 3KUYC 3WKJC 3AZID 2NQBA 5E5AA 5B2IA 4ZUXC 3W98B 4QLCB 3KWQC 4XZQC 1JFIA 5BT1D 3WTPE 1U35D 1P3LA 4LD9B 3A1KA 3AZNA 2BYMB 4NE5A 4R8PB 5AV5B 5AV8C 3AYWC 3NQUB 2F8NH 3REJC 2CWEA 2HIOC 2RVQD 2AROC 2Y2MA 5B33C 2NZDC 5AVCA 3REHC 3C1BA 3AZKC 5B1MB 2FJ7D 5B0YB 1EQZD 1W2EA 1S32A 5B2JD 3VH6T 5CPIC 3MVDD 3AFAB 3WA9D 3W96B 5AV9D 4Z66B 3W98C 4QLCC 1M1AD 2CV5B 4H9PB 3UTBB 3LZ1B 4YS3B 1KX4B 3MNNB 4H9QA 3W99D 3AZLD 2F8NB 3AV1D 3B6GA 3B0CW 3F6TA 1ID3D 1KX5A 4R8PC 4Z5TA 2ZM5A 3AZJB 3AL0C 4H9OB 3AZED 5B1MC 5B0YC 2F8NG 4J8XD 4J8WD 3AZIA 5F99C 3B6FD 1BH9A 1T3UA 3UT9B 3W96C 2F2AC 4Z66C 4H9SA 5GT3D 4EO5B 2PYOC 3AZGB 1HQ3B 5E5AB 5B2IB 2CV5C 4J8VB 5DNMB 1P3IC 2Y2HA 3UTBC 4YS3C 1KX4C 2Y2QA 2JCHA 3KSYA 1JFIB 5AV6C 5B24B 1P3PD 5KDMA 1P3AD 1M18D 5AY8D 3VH5W 3AZJC 4HGAB 3IP4C 3AZNB 3NQJB 4WU8D 3UTAB 1P3GB 3RELA 3MVDA 3C1BB 4WV4B 3WA9A 5AV9A 3R45A 2NQBC 5E5AC 5B2IC 3A6ND 4CSRB 1P3OD 3LELA 4J8VC 3REKA 2Y2OA 3MGSA 4KHAB 5B31D 5B24C 3AZMB 4XUJD 4H9QB 3AZHD 1P3LC 3B6GB 3H0RC 4KGCD 5B0ZA 4HGAC 3AZNC 3MGRA 3P5JB 1P3FB 5BNVA 4KUDD 3AZEA 1P3GC 4J8WA 3B6FA 5AVCC 3C1BC 3KUYB 3REIA 3WKJB 2ZY4A 1S32C 5JA4B 4ZUXB 1KX3D 3MGPD 1F66A 3B0BA 3X1VA 3AV2D 1P3AA 1M18A 3AZFD 4CAYB 4H9NB 3B6GC 1KX5C 5GXQA 3W97D 3AYWB 3KXBD 2AROB 5B33B 5CPJD 5B1LB 3AZIC 3RELB 1N1JA 2YFVA 1TZYA 5JRGD 1AOID 1P3OA 5CPIB 3WTPD 4H9SC 2Y2NA 3R45B 3MGQA 1BH8B 1B6WA 3LELB 3REKB 3O62D 1P34B 3LJAA 1TAFB 2ZY5A 4XUJA 3EPKA 3MGSB 4JJND 3LZ0D 3AZHA 3TU4D 5CPKA 3X1TD 1PZRA 5B32D 5GSUD 5B0ZB 3X1UA 2ZY2A 3MGRB 5B40D 3X1SD 4M6BA 4WU9A 1P3KD 4Z2MG 5B1LC 3RELC 3KFUG 5F99B 3WA9C 3WAAB 3KWQD 3REIB 2PYOB 5FUGA 4XZQD 3MGPA 1H3OA 3LELC 3REKC 1P34C 4H9RA 1P3IB 3AV2A 5AVBD 2Y2KA 3EPJA 3MGSC 3AZFA 3AN2B 1F66B 4X23D 5AV6B 3X1VB 5C3IB 5CP6B 3C1CB 1ZLAD 4G91C 5DNND 1P3BD 4YM6D 4UUZA 3REJD 5B0ZC 3W97A 2HIOD 2G5HC 2UWXA 3MGRC 2NZDD 3REHD 5GXQB 3AZKD 4UPKA 1P3MB 3AZEC 5G49B 1M19D 2VQRA 5JRGA 1AOIA 3WTPA 3W98D 3WAAC 3EPLA 3REIC 2NQBB 1TZYB 3VH5A 5BO0A 3O62A 3MGQB 4LD9D 3AN2C 3LJAB 1U35A 1F66C 2XD1A 3TU4A 3X1VC 5C3IC 5CP6C 3C1CC 4R8PD 1P3AC 5AV5D 5GT0D 4DRBA 5B32A 1M18C 5CPKB 1P3LB 5GSUA 5GXQC 1P3KA 5B1MD 5B0YD 3X1UB 1P3MC 2FJ7A 3W96D 3AFAD 4WU9B 1EQZA 4Z66D 5B2JA 5AVCB 3B0DB 2CV5D 1S32B 1TZYC 4XZQA 1P3OC 1M1AA 3UTBD 2F8NK 3LZ1D 4YS3D 1KX4D 3MNND 3MGQC 2F8ND 5AVBA 3B0CT 1H3OB 4H9RB 3LJAC 4X23A 3AZLA 3W99A 3AV1A 1ZLAA 4NE3A 4WZSB 1ID3A 3AZHC 3AZJD 5DNNA 1P3BA 5CPKC 4YM6A 3A1IA 2G5IC 2HIOA 1KX5B 4NFTA 4J8UD 4WJ3C 4Z5TB 3X1UC 2BG1A 3UT9D 4WU9C 1Q9CA 4J8XA 1M19A 2Y2JA 3B0DC 2IO5C 3AZGD 1HQ3D 5E5AD 5B2ID 3AZIB 5GT3A 4J8VD 1BH9B 5DNMD 2HUEC 5B24D 4LD9A 4G92B 3EG5B 1P3PA 3VH5T 2BYMA 4R8PA 5AV5A 5GT0A 1B67A 3AZFC 2Y2PA 1U35B 3AZND 3NQUA 5AY8A 5KDMB 5B32B 4E45A 3UTAD 1P3GD 4Z5TC 4Z2MH 4WU8A 2L5AA 2XD5A 1WWIA 3AFAA 2FJ7B 1EQZB 4H9PA 5B2JB 1AOIC 3MVDB 3WA9B 3A6NA 3WTPC 3LZ1A 5AV9B 5B32G 3MNNA 1KX4A 1ULYA 3VH6W 2F8NA 3AZMD 1M1AB 4G92C 3O62C 5B31A 2ZY3A 5BS7A 5BT1C 3W99B 3AZLB 1U35C 3AZJA 3TU4C 3B6GD 3AV1B 1ZLAB 4H9OA 4AWLC 4KGCA 1P3FD 5B32C 1ID3B 4G91B 4J8UA 5GSUC 5CHLB 2RIQA 4KUDA 3UT9A 1R4VA 2RVQC 3KUYD 5BNVB 3WKJD 3AZGA 3AZEB 1HQ3A 2FJ7C 1BFMA 4J8XB 4J8WB 2JSSA 1EQZC 4J8VA 5B2JC 1M19B 3B6FB 5DNMA 4ZUXD 5BNXA 3MVDC 5AV9C 1Z2CB 5GT3B 5B24A 1KX3A 1M1AC 2YFWA 5AVBC 3EPHA 2FFFB 3W99C 3AZLC 4X23C 1P3PB 3AV1C 1ZLAC 3NQJA 1P3AB 5GT0B 4ZBJB 1M18B 1ID3C 5DNNC 5AV8D 1P3BC 4YM6C 3UTAA 5AY8B 3AYWD 1P3GA 2AROD 5B33D 3KXBA 5B1LD 4WU8B 1HTAA 3RELD 5CPJA 4J8XC 4CSRA 4J8WC 5CPID 1M19C 3B6FC 4QLCD 3H0LC 5GT3C 1N1JB 2YFVB 4KHAA 3LELD 3REKD 1P34D 3AZMA 3A6NB 1P3OB 3MGSD 4LD9C 5B31B 4JJNA 3LZ0A 1P3PC 3X1TA 4XUJB 5AV5C 5GT0C 1P3FA 4ZBJC 5B0ZD 3AZHB 5AY8C 3MGRD 2Y2GA 1WWSA 4WNNA 4KGCB 3X1SA 5B40A 4J8UB 3V9RA 3KUYA 4WU8C 3WKJA 4KUDB 5F99D 3AFAC 5B31G 5JA4A 3WAAD 3REID 4ZUXA 2PYOD 2IO5B 3KWQA 2DQNC 4E44A 5BNXB 3A6NC 1P3ID 2HUEB 3LZ1C 3MNNC 3AN2D 4CAYA 5FUGB 1F66D 1KX3B 5AV6D 4H9NA 2YFWB 3MGPB 5B31C 5CP6D 3C1CD 3X1VD 5BS7C 2DF4C 4DRAA 3AV2B 4XUJC 3AZFB 2BYKA 5AV8A 3AYWA 5GXQD 3REJA 4KGCC 1KU5A 2AROA 5B33A 1P3MD 4J8UC 3REHA 2NZDA 5B1LA 3AZKA 4UUZB 4KUDC 3W97B 3UT9C 3KXBB 5CPIA 1F1EA 4EO5C 1BH8A 3AZGC 2NQBD 1HQ3C 1TZYD 5CPJB 3W98A 4QLCA 2Y2LA 1P34A 3MGQD 5DNMC 5JRGB 1AOIB 1TAFA 1A7WA 3WTPB 3LJAD 1KX3C 3MGPC 5BO0B 3O62B 3H0MC 3AV2C 5CPKD 1P3LD 2W8SA 4JJNB 3LZ0B 3TU4B 3X1TB 4AWLB 3X1UD 2J8PA 3UTAC 3VH6A 5B1MA 5GSUB 4WNNB 5B0YA 4WU9D 3W97C 5F99A 2Y2IA 5B40B 3X1SB 3KXBC 3W96A 2JE5A 5AVCD 3C1BD 3V9RB 1P3KB 3WAAA 4Z66A 2PYOA 1S32D 5CPJC 2CV5A 5JRGC
chains in the Genus database with same CATH topology
1P3IA 3UTBA 4YS3A 3KWQB 3AN2A 4XZQB 5AV6A 3AZMC 5CP6A 3C1CA 5AVBB 2LY8A 4NE6A 4JJNC 3LZ0C 4X23B 3FDDA 3X1TC 1KX5D 1P3FC 4Z5TD 2BYKB 5AV8B 1P3MA 5DNNB 1P3BB 4YM6B 3REJB 5G49A 2HIOB 4DQYB 5B40C 3X1SC 2NZDB 3REHB 3AZKB 1P3KC 3KUYC 3WKJC 3AZID 2NQBA 5E5AA 5B2IA 4ZUXC 3W98B 4QLCB 3KWQC 4XZQC 1JFIA 5BT1D 3WTPE 1U35D 1P3LA 4LD9B 3A1KA 3AZNA 2BYMB 4NE5A 4R8PB 5AV5B 5AV8C 3AYWC 3NQUB 2F8NH 3REJC 2CWEA 2HIOC 2RVQD 2AROC 2Y2MA 5B33C 2NZDC 5AVCA 3REHC 3C1BA 3AZKC 5B1MB 2FJ7D 5B0YB 1EQZD 1W2EA 1S32A 5B2JD 3VH6T 5CPIC 3MVDD 3AFAB 3WA9D 3W96B 5AV9D 4Z66B 3W98C 4QLCC 1M1AD 2CV5B 4H9PB 3UTBB 3LZ1B 4YS3B 1KX4B 3MNNB 4H9QA 3W99D 3AZLD 2F8NB 3AV1D 3B6GA 3B0CW 3F6TA 1ID3D 1KX5A 4R8PC 4Z5TA 2ZM5A 3AZJB 3AL0C 4H9OB 3AZED 5B1MC 5B0YC 2F8NG 4J8XD 4J8WD 3AZIA 5F99C 3B6FD 1BH9A 1T3UA 3UT9B 3W96C 2F2AC 4Z66C 4H9SA 5GT3D 4EO5B 2PYOC 3AZGB 1HQ3B 5E5AB 5B2IB 2CV5C 4J8VB 5DNMB 1P3IC 2Y2HA 3UTBC 4YS3C 1KX4C 2Y2QA 2JCHA 3KSYA 1JFIB 5AV6C 5B24B 1P3PD 5KDMA 1P3AD 1M18D 5AY8D 3VH5W 3AZJC 4HGAB 3IP4C 3AZNB 3NQJB 4WU8D 3UTAB 1P3GB 3RELA 3MVDA 3C1BB 4WV4B 3WA9A 5AV9A 3R45A 2NQBC 5E5AC 5B2IC 3A6ND 4CSRB 1P3OD 3LELA 4J8VC 3REKA 2Y2OA 3MGSA 4KHAB 5B31D 5B24C 3AZMB 4XUJD 4H9QB 3AZHD 1P3LC 3B6GB 3H0RC 4KGCD 5B0ZA 4HGAC 3AZNC 3MGRA 3P5JB 1P3FB 5BNVA 4KUDD 3AZEA 1P3GC 4J8WA 3B6FA 5AVCC 3C1BC 3KUYB 3REIA 3WKJB 2ZY4A 1S32C 5JA4B 4ZUXB 1KX3D 3MGPD 1F66A 3B0BA 3X1VA 3AV2D 1P3AA 1M18A 3AZFD 4CAYB 4H9NB 3B6GC 1KX5C 5GXQA 3W97D 3AYWB 3KXBD 2AROB 5B33B 5CPJD 5B1LB 3AZIC 3RELB 1N1JA 2YFVA 1TZYA 5JRGD 1AOID 1P3OA 5CPIB 3WTPD 4H9SC 2Y2NA 3R45B 3MGQA 1BH8B 1B6WA 3LELB 3REKB 3O62D 1P34B 3LJAA 1TAFB 2ZY5A 4XUJA 3EPKA 3MGSB 4JJND 3LZ0D 3AZHA 3TU4D 5CPKA 3X1TD 1PZRA 5B32D 5GSUD 5B0ZB 3X1UA 2ZY2A 3MGRB 5B40D 3X1SD 4M6BA 4WU9A 1P3KD 4Z2MG 5B1LC 3RELC 3KFUG 5F99B 3WA9C 3WAAB 3KWQD 3REIB 2PYOB 5FUGA 4XZQD 3MGPA 1H3OA 3LELC 3REKC 1P34C 4H9RA 1P3IB 3AV2A 5AVBD 2Y2KA 3EPJA 3MGSC 3AZFA 3AN2B 1F66B 4X23D 5AV6B 3X1VB 5C3IB 5CP6B 3C1CB 1ZLAD 4G91C 5DNND 1P3BD 4YM6D 4UUZA 3REJD 5B0ZC 3W97A 2HIOD 2G5HC 2UWXA 3MGRC 2NZDD 3REHD 5GXQB 3AZKD 4UPKA 1P3MB 3AZEC 5G49B 1M19D 2VQRA 5JRGA 1AOIA 3WTPA 3W98D 3WAAC 3EPLA 3REIC 2NQBB 1TZYB 3VH5A 5BO0A 3O62A 3MGQB 4LD9D 3AN2C 3LJAB 1U35A 1F66C 2XD1A 3TU4A 3X1VC 5C3IC 5CP6C 3C1CC 4R8PD 1P3AC 5AV5D 5GT0D 4DRBA 5B32A 1M18C 5CPKB 1P3LB 5GSUA 5GXQC 1P3KA 5B1MD 5B0YD 3X1UB 1P3MC 2FJ7A 3W96D 3AFAD 4WU9B 1EQZA 4Z66D 5B2JA 5AVCB 3B0DB 2CV5D 1S32B 1TZYC 4XZQA 1P3OC 1M1AA 3UTBD 2F8NK 3LZ1D 4YS3D 1KX4D 3MNND 3MGQC 2F8ND 5AVBA 3B0CT 1H3OB 4H9RB 3LJAC 4X23A 3AZLA 3W99A 3AV1A 1ZLAA 4NE3A 4WZSB 1ID3A 3AZHC 3AZJD 5DNNA 1P3BA 5CPKC 4YM6A 3A1IA 2G5IC 2HIOA 1KX5B 4NFTA 4J8UD 4WJ3C 4Z5TB 3X1UC 2BG1A 3UT9D 4WU9C 1Q9CA 4J8XA 1M19A 2Y2JA 3B0DC 2IO5C 3AZGD 1HQ3D 5E5AD 5B2ID 3AZIB 5GT3A 4J8VD 1BH9B 5DNMD 2HUEC 5B24D 4LD9A 4G92B 3EG5B 1P3PA 3VH5T 2BYMA 4R8PA 5AV5A 5GT0A 1B67A 3AZFC 2Y2PA 1U35B 3AZND 3NQUA 5AY8A 5KDMB 5B32B 4E45A 3UTAD 1P3GD 4Z5TC 4Z2MH 4WU8A 2L5AA 2XD5A 1WWIA 3AFAA 2FJ7B 1EQZB 4H9PA 5B2JB 1AOIC 3MVDB 3WA9B 3A6NA 3WTPC 3LZ1A 5AV9B 5B32G 3MNNA 1KX4A 1ULYA 3VH6W 2F8NA 3AZMD 1M1AB 4G92C 3O62C 5B31A 2ZY3A 5BS7A 5BT1C 3W99B 3AZLB 1U35C 3AZJA 3TU4C 3B6GD 3AV1B 1ZLAB 4H9OA 4AWLC 4KGCA 1P3FD 5B32C 1ID3B 4G91B 4J8UA 5GSUC 5CHLB 2RIQA 4KUDA 3UT9A 1R4VA 2RVQC 3KUYD 5BNVB 3WKJD 3AZGA 3AZEB 1HQ3A 2FJ7C 1BFMA 4J8XB 4J8WB 2JSSA 1EQZC 4J8VA 5B2JC 1M19B 3B6FB 5DNMA 4ZUXD 5BNXA 3MVDC 5AV9C 1Z2CB 5GT3B 5B24A 1KX3A 1M1AC 2YFWA 5AVBC 3EPHA 2FFFB 3W99C 3AZLC 4X23C 1P3PB 3AV1C 1ZLAC 3NQJA 1P3AB 5GT0B 4ZBJB 1M18B 1ID3C 5DNNC 5AV8D 1P3BC 4YM6C 3UTAA 5AY8B 3AYWD 1P3GA 2AROD 5B33D 3KXBA 5B1LD 4WU8B 1HTAA 3RELD 5CPJA 4J8XC 4CSRA 4J8WC 5CPID 1M19C 3B6FC 4QLCD 3H0LC 5GT3C 1N1JB 2YFVB 4KHAA 3LELD 3REKD 1P34D 3AZMA 3A6NB 1P3OB 3MGSD 4LD9C 5B31B 4JJNA 3LZ0A 1P3PC 3X1TA 4XUJB 5AV5C 5GT0C 1P3FA 4ZBJC 5B0ZD 3AZHB 5AY8C 3MGRD 2Y2GA 1WWSA 4WNNA 4KGCB 3X1SA 5B40A 4J8UB 3V9RA 3KUYA 4WU8C 3WKJA 4KUDB 5F99D 3AFAC 5B31G 5JA4A 3WAAD 3REID 4ZUXA 2PYOD 2IO5B 3KWQA 2DQNC 4E44A 5BNXB 3A6NC 1P3ID 2HUEB 3LZ1C 3MNNC 3AN2D 4CAYA 5FUGB 1F66D 1KX3B 5AV6D 4H9NA 2YFWB 3MGPB 5B31C 5CP6D 3C1CD 3X1VD 5BS7C 2DF4C 4DRAA 3AV2B 4XUJC 3AZFB 2BYKA 5AV8A 3AYWA 5GXQD 3REJA 4KGCC 1KU5A 2AROA 5B33A 1P3MD 4J8UC 3REHA 2NZDA 5B1LA 3AZKA 4UUZB 4KUDC 3W97B 3UT9C 3KXBB 5CPIA 1F1EA 4EO5C 1BH8A 3AZGC 2NQBD 1HQ3C 1TZYD 5CPJB 3W98A 4QLCA 2Y2LA 1P34A 3MGQD 5DNMC 5JRGB 1AOIB 1TAFA 1A7WA 3WTPB 3LJAD 1KX3C 3MGPC 5BO0B 3O62B 3H0MC 3AV2C 5CPKD 1P3LD 2W8SA 4JJNB 3LZ0B 3TU4B 3X1TB 4AWLB 3X1UD 2J8PA 3UTAC 3VH6A 5B1MA 5GSUB 4WNNB 5B0YA 4WU9D 3W97C 5F99A 2Y2IA 5B40B 3X1SB 3KXBC 3W96A 2JE5A 5AVCD 3C1BD 3V9RB 1P3KB 3WAAA 4Z66A 2PYOA 1S32D 5CPJC 2CV5A 5JRGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I A;  3UTB A;  4YS3 A;  3KWQ B;  3AN2 A;  4XZQ B;  5AV6 A;  3AZM C;  5CP6 A;  3C1C A;  5AVB B;  2LY8 A;  4NE6 A;  4JJN C;  3LZ0 C;  4X23 B;  3X1T C;  1KX5 D;  1P3F C;  4Z5T D;  2BYK B;  5AV8 B;  1P3M A;  5DNN B;  1P3B B;  4YM6 B;  3REJ B;  5G49 A;  2HIO B;  5B40 C;  3X1S C;  2NZD B;  3REH B;  3AZK B;  1P3K C;  3KUY C;  3WKJ C;  3AZI D;  2NQB A;  5E5A A;  5B2I A;  4ZUX C;  3W98 B;  4QLC B;  3KWQ C;  4XZQ C;  1JFI A;  5BT1 D;  3WTP E;  1U35 D;  1P3L A;  4LD9 B;  3AZN A;  2BYM B;  4NE5 A;  4R8P B;  5AV5 B;  5AV8 C;  3AYW C;  3NQU B;  2F8N H;  3REJ C;  2CWE A;  2HIO C;  2RVQ D;  2ARO C;  5B33 C;  2NZD C;  5AVC A;  3REH C;  3C1B A;  3AZK C;  5B1M B;  2FJ7 D;  5B0Y B;  1EQZ D;  1S32 A;  5B2J D;  3VH6 T;  5CPI C;  3MVD D;  3AFA B;  3WA9 D;  3W96 B;  5AV9 D;  4Z66 B;  3W98 C;  4QLC C;  1M1A D;  2CV5 B;  4H9P B;  3UTB B;  3LZ1 B;  4YS3 B;  1KX4 B;  3MNN B;  4H9Q A;  3W99 D;  3AZL D;  2F8N B;  3AV1 D;  3B6G A;  3B0C W;  1ID3 D;  1KX5 A;  4R8P C;  4Z5T A;  3AZJ B;  4H9O B;  3AZE D;  5B1M C;  5B0Y C;  2F8N G;  4J8X D;  4J8W D;  3AZI A;  5F99 C;  3B6F D;  1BH9 A;  3UT9 B;  3W96 C;  4Z66 C;  4H9S A;  5GT3 D;  4EO5 B;  2PYO C;  3AZG B;  1HQ3 B;  5E5A B;  5B2I B;  2CV5 C;  4J8V B;  5DNM B;  1P3I C;  3UTB C;  4YS3 C;  1KX4 C;  3KSY A;  1JFI B;  5AV6 C;  5B24 B;  1P3P D;  5KDM A;  1P3A D;  1M18 D;  5AY8 D;  3VH5 W;  3AZJ C;  4HGA B;  3AZN B;  3NQJ B;  4WU8 D;  3UTA B;  1P3G B;  3REL A;  3MVD A;  3C1B B;  4WV4 B;  3WA9 A;  5AV9 A;  3R45 A;  2NQB C;  5E5A C;  5B2I C;  3A6N D;  4CSR B;  1P3O D;  3LEL A;  4J8V C;  3REK A;  3MGS A;  4KHA B;  5B31 D;  5B24 C;  3AZM B;  4XUJ D;  4H9Q B;  3AZH D;  1P3L C;  3B6G B;  4KGC D;  5B0Z A;  4HGA C;  3AZN C;  3MGR A;  1P3F B;  5BNV A;  4KUD D;  3AZE A;  1P3G C;  4J8W A;  3B6F A;  5AVC C;  3C1B C;  3KUY B;  3REI A;  3WKJ B;  1S32 C;  5JA4 B;  4ZUX B;  1KX3 D;  3MGP D;  1F66 A;  3B0B A;  3X1V A;  3AV2 D;  1P3A A;  1M18 A;  3AZF D;  4CAY B;  4H9N B;  3B6G C;  1KX5 C;  5GXQ A;  3W97 D;  3AYW B;  3KXB D;  2ARO B;  5B33 B;  5CPJ D;  5B1L B;  3AZI C;  3REL B;  1N1J A;  2YFV A;  1TZY A;  5JRG D;  1AOI D;  1P3O A;  5CPI B;  3WTP D;  4H9S C;  3R45 B;  3MGQ A;  1BH8 B;  1B6W A;  3LEL B;  3REK B;  3O62 D;  1P34 B;  3LJA A;  1TAF B;  4XUJ A;  3MGS B;  4JJN D;  3LZ0 D;  3AZH A;  3TU4 D;  5CPK A;  3X1T D;  5B32 D;  5GSU D;  5B0Z B;  3X1U A;  3MGR B;  5B40 D;  3X1S D;  4M6B A;  4WU9 A;  1P3K D;  4Z2M G;  5B1L C;  3REL C;  5F99 B;  3WA9 C;  3WAA B;  3KWQ D;  3REI B;  2PYO B;  5FUG A;  4XZQ D;  3MGP A;  1H3O A;  3LEL C;  3REK C;  1P34 C;  4H9R A;  1P3I B;  3AV2 A;  5AVB D;  3MGS C;  3AZF A;  3AN2 B;  1F66 B;  4X23 D;  5AV6 B;  3X1V B;  5C3I B;  5CP6 B;  3C1C B;  1ZLA D;  4G91 C;  5DNN D;  1P3B D;  4YM6 D;  4UUZ A;  3REJ D;  5B0Z C;  3W97 A;  2HIO D;  3MGR C;  2NZD D;  3REH D;  5GXQ B;  3AZK D;  1P3M B;  3AZE C;  5G49 B;  1M19 D;  5JRG A;  1AOI A;  3WTP A;  3W98 D;  3WAA C;  3REI C;  2NQB B;  1TZY B;  3VH5 A;  5BO0 A;  3O62 A;  3MGQ B;  4LD9 D;  3AN2 C;  3LJA B;  1U35 A;  1F66 C;  3TU4 A;  3X1V C;  5C3I C;  5CP6 C;  3C1C C;  4R8P D;  1P3A C;  5AV5 D;  5GT0 D;  4DRB A;  5B32 A;  1M18 C;  5CPK B;  1P3L B;  5GSU A;  5GXQ C;  1P3K A;  5B1M D;  5B0Y D;  3X1U B;  1P3M C;  2FJ7 A;  3W96 D;  3AFA D;  4WU9 B;  1EQZ A;  4Z66 D;  5B2J A;  5AVC B;  3B0D B;  2CV5 D;  1S32 B;  1TZY C;  4XZQ A;  1P3O C;  1M1A A;  3UTB D;  2F8N K;  3LZ1 D;  4YS3 D;  1KX4 D;  3MNN D;  3MGQ C;  2F8N D;  5AVB A;  3B0C T;  1H3O B;  4H9R B;  3LJA C;  4X23 A;  3AZL A;  3W99 A;  3AV1 A;  1ZLA A;  4NE3 A;  4WZS B;  1ID3 A;  3AZH C;  3AZJ D;  5DNN A;  1P3B A;  5CPK C;  4YM6 A;  2HIO A;  1KX5 B;  4NFT A;  4J8U D;  4Z5T B;  3X1U C;  3UT9 D;  4WU9 C;  1Q9C A;  4J8X A;  1M19 A;  3B0D C;  3AZG D;  2IO5 C;  1HQ3 D;  5E5A D;  5B2I D;  3AZI B;  5GT3 A;  4J8V D;  1BH9 B;  5DNM D;  2HUE C;  5B24 D;  4LD9 A;  4G92 B;  1P3P A;  3VH5 T;  2BYM A;  4R8P A;  5AV5 A;  5GT0 A;  1B67 A;  3AZF C;  1U35 B;  3AZN D;  3NQU A;  5AY8 A;  5KDM B;  5B32 B;  4E45 A;  3UTA D;  1P3G D;  4Z5T C;  4Z2M H;  4WU8 A;  2L5A A;  1WWI A;  3AFA A;  2FJ7 B;  1EQZ B;  4H9P A;  5B2J B;  1AOI C;  3MVD B;  3WA9 B;  3A6N A;  3WTP C;  3LZ1 A;  5AV9 B;  5B32 G;  3MNN A;  1KX4 A;  1ULY A;  3VH6 W;  2F8N A;  3AZM D;  1M1A B;  4G92 C;  3O62 C;  5B31 A;  5BS7 A;  5BT1 C;  3W99 B;  3AZL B;  1U35 C;  3AZJ A;  3TU4 C;  3B6G D;  3AV1 B;  1ZLA B;  4H9O A;  4AWL C;  4KGC A;  1P3F D;  5B32 C;  1ID3 B;  4G91 B;  4J8U A;  5GSU C;  5CHL B;  4KUD A;  3UT9 A;  1R4V A;  2RVQ C;  3KUY D;  5BNV B;  3WKJ D;  3AZG A;  3AZE B;  1HQ3 A;  2FJ7 C;  1BFM A;  4J8X B;  4J8W B;  2JSS A;  1EQZ C;  4J8V A;  5B2J C;  1M19 B;  3B6F B;  5DNM A;  4ZUX D;  5BNX A;  3MVD C;  5AV9 C;  5GT3 B;  5B24 A;  1KX3 A;  1M1A C;  2YFW A;  5AVB C;  3W99 C;  3AZL C;  4X23 C;  1P3P B;  3AV1 C;  1ZLA C;  3NQJ A;  1P3A B;  5GT0 B;  4ZBJ B;  1M18 B;  1ID3 C;  5DNN C;  5AV8 D;  1P3B C;  4YM6 C;  3UTA A;  5AY8 B;  3AYW D;  1P3G A;  2ARO D;  5B33 D;  3KXB A;  5B1L D;  4WU8 B;  1HTA A;  3REL D;  5CPJ A;  4J8X C;  4CSR A;  4J8W C;  5CPI D;  1M19 C;  3B6F C;  4QLC D;  5GT3 C;  1N1J B;  2YFV B;  4KHA A;  3LEL D;  3REK D;  1P34 D;  3AZM A;  3A6N B;  1P3O B;  3MGS D;  4LD9 C;  5B31 B;  4JJN A;  3LZ0 A;  1P3P C;  3X1T A;  4XUJ B;  5AV5 C;  5GT0 C;  1P3F A;  4ZBJ C;  5B0Z D;  3AZH B;  5AY8 C;  3MGR D;  1WWS A;  4WNN A;  4KGC B;  3X1S A;  5B40 A;  4J8U B;  3V9R A;  3KUY A;  4WU8 C;  3WKJ A;  4KUD B;  5F99 D;  3AFA C;  5B31 G;  5JA4 A;  3WAA D;  3REI D;  4ZUX A;  2PYO D;  2IO5 B;  3KWQ A;  4E44 A;  5BNX B;  3A6N C;  1P3I D;  2HUE B;  3LZ1 C;  3MNN C;  3AN2 D;  4CAY A;  5FUG B;  1F66 D;  1KX3 B;  5AV6 D;  4H9N A;  2YFW B;  3MGP B;  5B31 C;  5CP6 D;  3C1C D;  3X1V D;  5BS7 C;  4DRA A;  3AV2 B;  4XUJ C;  3AZF B;  2BYK A;  5AV8 A;  3AYW A;  5GXQ D;  3REJ A;  4KGC C;  1KU5 A;  2ARO A;  5B33 A;  1P3M D;  4J8U C;  3REH A;  2NZD A;  5B1L A;  3AZK A;  4UUZ B;  4KUD C;  3W97 B;  3UT9 C;  3KXB B;  5CPI A;  1F1E A;  4EO5 C;  1BH8 A;  3AZG C;  2NQB D;  1HQ3 C;  1TZY D;  5CPJ B;  3W98 A;  4QLC A;  1P34 A;  3MGQ D;  5DNM C;  5JRG B;  1AOI B;  1TAF A;  1A7W A;  3WTP B;  3LJA D;  1KX3 C;  3MGP C;  5BO0 B;  3O62 B;  3AV2 C;  5CPK D;  1P3L D;  4JJN B;  3LZ0 B;  3TU4 B;  3X1T B;  4AWL B;  3X1U D;  3UTA C;  3VH6 A;  5B1M A;  5GSU B;  4WNN B;  5B0Y A;  4WU9 D;  3W97 C;  5F99 A;  5B40 B;  3X1S B;  3KXB C;  3W96 A;  5AVC D;  3C1B D;  3V9R B;  1P3K B;  3WAA A;  4Z66 A;  2PYO A;  1S32 D;  5CPJ C;  2CV5 A;  5JRG C; 
#chains in the Genus database with same CATH topology
 1P3I A;  3UTB A;  4YS3 A;  3KWQ B;  3AN2 A;  4XZQ B;  5AV6 A;  3AZM C;  5CP6 A;  3C1C A;  5AVB B;  2LY8 A;  4NE6 A;  4JJN C;  3LZ0 C;  4X23 B;  3FDD A;  3X1T C;  1KX5 D;  1P3F C;  4Z5T D;  2BYK B;  5AV8 B;  1P3M A;  5DNN B;  1P3B B;  4YM6 B;  3REJ B;  5G49 A;  2HIO B;  4DQY B;  5B40 C;  3X1S C;  2NZD B;  3REH B;  3AZK B;  1P3K C;  3KUY C;  3WKJ C;  3AZI D;  2NQB A;  5E5A A;  5B2I A;  4ZUX C;  3W98 B;  4QLC B;  3KWQ C;  4XZQ C;  1JFI A;  5BT1 D;  3WTP E;  1U35 D;  1P3L A;  4LD9 B;  3A1K A;  3AZN A;  2BYM B;  4NE5 A;  4R8P B;  5AV5 B;  5AV8 C;  3AYW C;  3NQU B;  2F8N H;  3REJ C;  2CWE A;  2HIO C;  2RVQ D;  2ARO C;  2Y2M A;  5B33 C;  2NZD C;  5AVC A;  3REH C;  3C1B A;  3AZK C;  5B1M B;  2FJ7 D;  5B0Y B;  1EQZ D;  1W2E A;  1S32 A;  5B2J D;  3VH6 T;  5CPI C;  3MVD D;  3AFA B;  3WA9 D;  3W96 B;  5AV9 D;  4Z66 B;  3W98 C;  4QLC C;  1M1A D;  2CV5 B;  4H9P B;  3UTB B;  3LZ1 B;  4YS3 B;  1KX4 B;  3MNN B;  4H9Q A;  3W99 D;  3AZL D;  2F8N B;  3AV1 D;  3B6G A;  3B0C W;  3F6T A;  1ID3 D;  1KX5 A;  4R8P C;  4Z5T A;  2ZM5 A;  3AZJ B;  3AL0 C;  4H9O B;  3AZE D;  5B1M C;  5B0Y C;  2F8N G;  4J8X D;  4J8W D;  3AZI A;  5F99 C;  3B6F D;  1BH9 A;  1T3U A;  3UT9 B;  3W96 C;  2F2A C;  4Z66 C;  4H9S A;  5GT3 D;  4EO5 B;  2PYO C;  3AZG B;  1HQ3 B;  5E5A B;  5B2I B;  2CV5 C;  4J8V B;  5DNM B;  1P3I C;  2Y2H A;  3UTB C;  4YS3 C;  1KX4 C;  2Y2Q A;  2JCH A;  3KSY A;  1JFI B;  5AV6 C;  5B24 B;  1P3P D;  5KDM A;  1P3A D;  1M18 D;  5AY8 D;  3VH5 W;  3AZJ C;  4HGA B;  3IP4 C;  3AZN B;  3NQJ B;  4WU8 D;  3UTA B;  1P3G B;  3REL A;  3MVD A;  3C1B B;  4WV4 B;  3WA9 A;  5AV9 A;  3R45 A;  2NQB C;  5E5A C;  5B2I C;  3A6N D;  4CSR B;  1P3O D;  3LEL A;  4J8V C;  3REK A;  2Y2O A;  3MGS A;  4KHA B;  5B31 D;  5B24 C;  3AZM B;  4XUJ D;  4H9Q B;  3AZH D;  1P3L C;  3B6G B;  3H0R C;  4KGC D;  5B0Z A;  4HGA C;  3AZN C;  3MGR A;  3P5J B;  1P3F B;  5BNV A;  4KUD D;  3AZE A;  1P3G C;  4J8W A;  3B6F A;  5AVC C;  3C1B C;  3KUY B;  3REI A;  3WKJ B;  2ZY4 A;  1S32 C;  5JA4 B;  4ZUX B;  1KX3 D;  3MGP D;  1F66 A;  3B0B A;  3X1V A;  3AV2 D;  1P3A A;  1M18 A;  3AZF D;  4CAY B;  4H9N B;  3B6G C;  1KX5 C;  5GXQ A;  3W97 D;  3AYW B;  3KXB D;  2ARO B;  5B33 B;  5CPJ D;  5B1L B;  3AZI C;  3REL B;  1N1J A;  2YFV A;  1TZY A;  5JRG D;  1AOI D;  1P3O A;  5CPI B;  3WTP D;  4H9S C;  2Y2N A;  3R45 B;  3MGQ A;  1BH8 B;  1B6W A;  3LEL B;  3REK B;  3O62 D;  1P34 B;  3LJA A;  1TAF B;  2ZY5 A;  4XUJ A;  3EPK A;  3MGS B;  4JJN D;  3LZ0 D;  3AZH A;  3TU4 D;  5CPK A;  3X1T D;  1PZR A;  5B32 D;  5GSU D;  5B0Z B;  3X1U A;  2ZY2 A;  3MGR B;  5B40 D;  3X1S D;  4M6B A;  4WU9 A;  1P3K D;  4Z2M G;  5B1L C;  3REL C;  3KFU G;  5F99 B;  3WA9 C;  3WAA B;  3KWQ D;  3REI B;  2PYO B;  5FUG A;  4XZQ D;  3MGP A;  1H3O A;  3LEL C;  3REK C;  1P34 C;  4H9R A;  1P3I B;  3AV2 A;  5AVB D;  2Y2K A;  3EPJ A;  3MGS C;  3AZF A;  3AN2 B;  1F66 B;  4X23 D;  5AV6 B;  3X1V B;  5C3I B;  5CP6 B;  3C1C B;  1ZLA D;  4G91 C;  5DNN D;  1P3B D;  4YM6 D;  4UUZ A;  3REJ D;  5B0Z C;  3W97 A;  2HIO D;  2G5H C;  2UWX A;  3MGR C;  2NZD D;  3REH D;  5GXQ B;  3AZK D;  4UPK A;  1P3M B;  3AZE C;  5G49 B;  1M19 D;  2VQR A;  5JRG A;  1AOI A;  3WTP A;  3W98 D;  3WAA C;  3EPL A;  3REI C;  2NQB B;  1TZY B;  3VH5 A;  5BO0 A;  3O62 A;  3MGQ B;  4LD9 D;  3AN2 C;  3LJA B;  1U35 A;  1F66 C;  2XD1 A;  3TU4 A;  3X1V C;  5C3I C;  5CP6 C;  3C1C C;  4R8P D;  1P3A C;  5AV5 D;  5GT0 D;  4DRB A;  5B32 A;  1M18 C;  5CPK B;  1P3L B;  5GSU A;  5GXQ C;  1P3K A;  5B1M D;  5B0Y D;  3X1U B;  1P3M C;  2FJ7 A;  3W96 D;  3AFA D;  4WU9 B;  1EQZ A;  4Z66 D;  5B2J A;  5AVC B;  3B0D B;  2CV5 D;  1S32 B;  1TZY C;  4XZQ A;  1P3O C;  1M1A A;  3UTB D;  2F8N K;  3LZ1 D;  4YS3 D;  1KX4 D;  3MNN D;  3MGQ C;  2F8N D;  5AVB A;  3B0C T;  1H3O B;  4H9R B;  3LJA C;  4X23 A;  3AZL A;  3W99 A;  3AV1 A;  1ZLA A;  4NE3 A;  4WZS B;  1ID3 A;  3AZH C;  3AZJ D;  5DNN A;  1P3B A;  5CPK C;  4YM6 A;  3A1I A;  2G5I C;  2HIO A;  1KX5 B;  4NFT A;  4J8U D;  4WJ3 C;  4Z5T B;  3X1U C;  2BG1 A;  3UT9 D;  4WU9 C;  1Q9C A;  4J8X A;  1M19 A;  2Y2J A;  3B0D C;  2IO5 C;  3AZG D;  1HQ3 D;  5E5A D;  5B2I D;  3AZI B;  5GT3 A;  4J8V D;  1BH9 B;  5DNM D;  2HUE C;  5B24 D;  4LD9 A;  4G92 B;  3EG5 B;  1P3P A;  3VH5 T;  2BYM A;  4R8P A;  5AV5 A;  5GT0 A;  1B67 A;  3AZF C;  2Y2P A;  1U35 B;  3AZN D;  3NQU A;  5AY8 A;  5KDM B;  5B32 B;  4E45 A;  3UTA D;  1P3G D;  4Z5T C;  4Z2M H;  4WU8 A;  2L5A A;  2XD5 A;  1WWI A;  3AFA A;  2FJ7 B;  1EQZ B;  4H9P A;  5B2J B;  1AOI C;  3MVD B;  3WA9 B;  3A6N A;  3WTP C;  3LZ1 A;  5AV9 B;  5B32 G;  3MNN A;  1KX4 A;  1ULY A;  3VH6 W;  2F8N A;  3AZM D;  1M1A B;  4G92 C;  3O62 C;  5B31 A;  2ZY3 A;  5BS7 A;  5BT1 C;  3W99 B;  3AZL B;  1U35 C;  3AZJ A;  3TU4 C;  3B6G D;  3AV1 B;  1ZLA B;  4H9O A;  4AWL C;  4KGC A;  1P3F D;  5B32 C;  1ID3 B;  4G91 B;  4J8U A;  5GSU C;  5CHL B;  2RIQ A;  4KUD A;  3UT9 A;  1R4V A;  2RVQ C;  3KUY D;  5BNV B;  3WKJ D;  3AZG A;  3AZE B;  1HQ3 A;  2FJ7 C;  1BFM A;  4J8X B;  4J8W B;  2JSS A;  1EQZ C;  4J8V A;  5B2J C;  1M19 B;  3B6F B;  5DNM A;  4ZUX D;  5BNX A;  3MVD C;  5AV9 C;  1Z2C B;  5GT3 B;  5B24 A;  1KX3 A;  1M1A C;  2YFW A;  5AVB C;  3EPH A;  2FFF B;  3W99 C;  3AZL C;  4X23 C;  1P3P B;  3AV1 C;  1ZLA C;  3NQJ A;  1P3A B;  5GT0 B;  4ZBJ B;  1M18 B;  1ID3 C;  5DNN C;  5AV8 D;  1P3B C;  4YM6 C;  3UTA A;  5AY8 B;  3AYW D;  1P3G A;  2ARO D;  5B33 D;  3KXB A;  5B1L D;  4WU8 B;  1HTA A;  3REL D;  5CPJ A;  4J8X C;  4CSR A;  4J8W C;  5CPI D;  1M19 C;  3B6F C;  4QLC D;  3H0L C;  5GT3 C;  1N1J B;  2YFV B;  4KHA A;  3LEL D;  3REK D;  1P34 D;  3AZM A;  3A6N B;  1P3O B;  3MGS D;  4LD9 C;  5B31 B;  4JJN A;  3LZ0 A;  1P3P C;  3X1T A;  4XUJ B;  5AV5 C;  5GT0 C;  1P3F A;  4ZBJ C;  5B0Z D;  3AZH B;  5AY8 C;  3MGR D;  2Y2G A;  1WWS A;  4WNN A;  4KGC B;  3X1S A;  5B40 A;  4J8U B;  3V9R A;  3KUY A;  4WU8 C;  3WKJ A;  4KUD B;  5F99 D;  3AFA C;  5B31 G;  5JA4 A;  3WAA D;  3REI D;  4ZUX A;  2PYO D;  2IO5 B;  3KWQ A;  2DQN C;  4E44 A;  5BNX B;  3A6N C;  1P3I D;  2HUE B;  3LZ1 C;  3MNN C;  3AN2 D;  4CAY A;  5FUG B;  1F66 D;  1KX3 B;  5AV6 D;  4H9N A;  2YFW B;  3MGP B;  5B31 C;  5CP6 D;  3C1C D;  3X1V D;  5BS7 C;  2DF4 C;  4DRA A;  3AV2 B;  4XUJ C;  3AZF B;  2BYK A;  5AV8 A;  3AYW A;  5GXQ D;  3REJ A;  4KGC C;  1KU5 A;  2ARO A;  5B33 A;  1P3M D;  4J8U C;  3REH A;  2NZD A;  5B1L A;  3AZK A;  4UUZ B;  4KUD C;  3W97 B;  3UT9 C;  3KXB B;  5CPI A;  1F1E A;  4EO5 C;  1BH8 A;  3AZG C;  2NQB D;  1HQ3 C;  1TZY D;  5CPJ B;  3W98 A;  4QLC A;  2Y2L A;  1P34 A;  3MGQ D;  5DNM C;  5JRG B;  1AOI B;  1TAF A;  1A7W A;  3WTP B;  3LJA D;  1KX3 C;  3MGP C;  5BO0 B;  3O62 B;  3H0M C;  3AV2 C;  5CPK D;  1P3L D;  2W8S A;  4JJN B;  3LZ0 B;  3TU4 B;  3X1T B;  4AWL B;  3X1U D;  2J8P A;  3UTA C;  3VH6 A;  5B1M A;  5GSU B;  4WNN B;  5B0Y A;  4WU9 D;  3W97 C;  5F99 A;  2Y2I A;  5B40 B;  3X1S B;  3KXB C;  3W96 A;  2JE5 A;  5AVC D;  3C1B D;  3V9R B;  1P3K B;  3WAA A;  4Z66 A;  2PYO A;  1S32 D;  5CPJ C;  2CV5 A;  5JRG C; 
#chains in the Genus database with same CATH homology
 1P3I A;  3UTB A;  4YS3 A;  3KWQ B;  3AN2 A;  4XZQ B;  5AV6 A;  3AZM C;  5CP6 A;  3C1C A;  5AVB B;  2LY8 A;  4NE6 A;  4JJN C;  3LZ0 C;  4X23 B;  3FDD A;  3X1T C;  1KX5 D;  1P3F C;  4Z5T D;  2BYK B;  5AV8 B;  1P3M A;  5DNN B;  1P3B B;  4YM6 B;  3REJ B;  5G49 A;  2HIO B;  4DQY B;  5B40 C;  3X1S C;  2NZD B;  3REH B;  3AZK B;  1P3K C;  3KUY C;  3WKJ C;  3AZI D;  2NQB A;  5E5A A;  5B2I A;  4ZUX C;  3W98 B;  4QLC B;  3KWQ C;  4XZQ C;  1JFI A;  5BT1 D;  3WTP E;  1U35 D;  1P3L A;  4LD9 B;  3A1K A;  3AZN A;  2BYM B;  4NE5 A;  4R8P B;  5AV5 B;  5AV8 C;  3AYW C;  3NQU B;  2F8N H;  3REJ C;  2CWE A;  2HIO C;  2RVQ D;  2ARO C;  2Y2M A;  5B33 C;  2NZD C;  5AVC A;  3REH C;  3C1B A;  3AZK C;  5B1M B;  2FJ7 D;  5B0Y B;  1EQZ D;  1W2E A;  1S32 A;  5B2J D;  3VH6 T;  5CPI C;  3MVD D;  3AFA B;  3WA9 D;  3W96 B;  5AV9 D;  4Z66 B;  3W98 C;  4QLC C;  1M1A D;  2CV5 B;  4H9P B;  3UTB B;  3LZ1 B;  4YS3 B;  1KX4 B;  3MNN B;  4H9Q A;  3W99 D;  3AZL D;  2F8N B;  3AV1 D;  3B6G A;  3B0C W;  3F6T A;  1ID3 D;  1KX5 A;  4R8P C;  4Z5T A;  2ZM5 A;  3AZJ B;  3AL0 C;  4H9O B;  3AZE D;  5B1M C;  5B0Y C;  2F8N G;  4J8X D;  4J8W D;  3AZI A;  5F99 C;  3B6F D;  1BH9 A;  1T3U A;  3UT9 B;  3W96 C;  2F2A C;  4Z66 C;  4H9S A;  5GT3 D;  4EO5 B;  2PYO C;  3AZG B;  1HQ3 B;  5E5A B;  5B2I B;  2CV5 C;  4J8V B;  5DNM B;  1P3I C;  2Y2H A;  3UTB C;  4YS3 C;  1KX4 C;  2Y2Q A;  2JCH A;  3KSY A;  1JFI B;  5AV6 C;  5B24 B;  1P3P D;  5KDM A;  1P3A D;  1M18 D;  5AY8 D;  3VH5 W;  3AZJ C;  4HGA B;  3IP4 C;  3AZN B;  3NQJ B;  4WU8 D;  3UTA B;  1P3G B;  3REL A;  3MVD A;  3C1B B;  4WV4 B;  3WA9 A;  5AV9 A;  3R45 A;  2NQB C;  5E5A C;  5B2I C;  3A6N D;  4CSR B;  1P3O D;  3LEL A;  4J8V C;  3REK A;  2Y2O A;  3MGS A;  4KHA B;  5B31 D;  5B24 C;  3AZM B;  4XUJ D;  4H9Q B;  3AZH D;  1P3L C;  3B6G B;  3H0R C;  4KGC D;  5B0Z A;  4HGA C;  3AZN C;  3MGR A;  3P5J B;  1P3F B;  5BNV A;  4KUD D;  3AZE A;  1P3G C;  4J8W A;  3B6F A;  5AVC C;  3C1B C;  3KUY B;  3REI A;  3WKJ B;  2ZY4 A;  1S32 C;  5JA4 B;  4ZUX B;  1KX3 D;  3MGP D;  1F66 A;  3B0B A;  3X1V A;  3AV2 D;  1P3A A;  1M18 A;  3AZF D;  4CAY B;  4H9N B;  3B6G C;  1KX5 C;  5GXQ A;  3W97 D;  3AYW B;  3KXB D;  2ARO B;  5B33 B;  5CPJ D;  5B1L B;  3AZI C;  3REL B;  1N1J A;  2YFV A;  1TZY A;  5JRG D;  1AOI D;  1P3O A;  5CPI B;  3WTP D;  4H9S C;  2Y2N A;  3R45 B;  3MGQ A;  1BH8 B;  1B6W A;  3LEL B;  3REK B;  3O62 D;  1P34 B;  3LJA A;  1TAF B;  2ZY5 A;  4XUJ A;  3EPK A;  3MGS B;  4JJN D;  3LZ0 D;  3AZH A;  3TU4 D;  5CPK A;  3X1T D;  1PZR A;  5B32 D;  5GSU D;  5B0Z B;  3X1U A;  2ZY2 A;  3MGR B;  5B40 D;  3X1S D;  4M6B A;  4WU9 A;  1P3K D;  4Z2M G;  5B1L C;  3REL C;  3KFU G;  5F99 B;  3WA9 C;  3WAA B;  3KWQ D;  3REI B;  2PYO B;  5FUG A;  4XZQ D;  3MGP A;  1H3O A;  3LEL C;  3REK C;  1P34 C;  4H9R A;  1P3I B;  3AV2 A;  5AVB D;  2Y2K A;  3EPJ A;  3MGS C;  3AZF A;  3AN2 B;  1F66 B;  4X23 D;  5AV6 B;  3X1V B;  5C3I B;  5CP6 B;  3C1C B;  1ZLA D;  4G91 C;  5DNN D;  1P3B D;  4YM6 D;  4UUZ A;  3REJ D;  5B0Z C;  3W97 A;  2HIO D;  2G5H C;  2UWX A;  3MGR C;  2NZD D;  3REH D;  5GXQ B;  3AZK D;  4UPK A;  1P3M B;  3AZE C;  5G49 B;  1M19 D;  2VQR A;  5JRG A;  1AOI A;  3WTP A;  3W98 D;  3WAA C;  3EPL A;  3REI C;  2NQB B;  1TZY B;  3VH5 A;  5BO0 A;  3O62 A;  3MGQ B;  4LD9 D;  3AN2 C;  3LJA B;  1U35 A;  1F66 C;  2XD1 A;  3TU4 A;  3X1V C;  5C3I C;  5CP6 C;  3C1C C;  4R8P D;  1P3A C;  5AV5 D;  5GT0 D;  4DRB A;  5B32 A;  1M18 C;  5CPK B;  1P3L B;  5GSU A;  5GXQ C;  1P3K A;  5B1M D;  5B0Y D;  3X1U B;  1P3M C;  2FJ7 A;  3W96 D;  3AFA D;  4WU9 B;  1EQZ A;  4Z66 D;  5B2J A;  5AVC B;  3B0D B;  2CV5 D;  1S32 B;  1TZY C;  4XZQ A;  1P3O C;  1M1A A;  3UTB D;  2F8N K;  3LZ1 D;  4YS3 D;  1KX4 D;  3MNN D;  3MGQ C;  2F8N D;  5AVB A;  3B0C T;  1H3O B;  4H9R B;  3LJA C;  4X23 A;  3AZL A;  3W99 A;  3AV1 A;  1ZLA A;  4NE3 A;  4WZS B;  1ID3 A;  3AZH C;  3AZJ D;  5DNN A;  1P3B A;  5CPK C;  4YM6 A;  3A1I A;  2G5I C;  2HIO A;  1KX5 B;  4NFT A;  4J8U D;  4WJ3 C;  4Z5T B;  3X1U C;  2BG1 A;  3UT9 D;  4WU9 C;  1Q9C A;  4J8X A;  1M19 A;  2Y2J A;  3B0D C;  2IO5 C;  3AZG D;  1HQ3 D;  5E5A D;  5B2I D;  3AZI B;  5GT3 A;  4J8V D;  1BH9 B;  5DNM D;  2HUE C;  5B24 D;  4LD9 A;  4G92 B;  3EG5 B;  1P3P A;  3VH5 T;  2BYM A;  4R8P A;  5AV5 A;  5GT0 A;  1B67 A;  3AZF C;  2Y2P A;  1U35 B;  3AZN D;  3NQU A;  5AY8 A;  5KDM B;  5B32 B;  4E45 A;  3UTA D;  1P3G D;  4Z5T C;  4Z2M H;  4WU8 A;  2L5A A;  2XD5 A;  1WWI A;  3AFA A;  2FJ7 B;  1EQZ B;  4H9P A;  5B2J B;  1AOI C;  3MVD B;  3WA9 B;  3A6N A;  3WTP C;  3LZ1 A;  5AV9 B;  5B32 G;  3MNN A;  1KX4 A;  1ULY A;  3VH6 W;  2F8N A;  3AZM D;  1M1A B;  4G92 C;  3O62 C;  5B31 A;  2ZY3 A;  5BS7 A;  5BT1 C;  3W99 B;  3AZL B;  1U35 C;  3AZJ A;  3TU4 C;  3B6G D;  3AV1 B;  1ZLA B;  4H9O A;  4AWL C;  4KGC A;  1P3F D;  5B32 C;  1ID3 B;  4G91 B;  4J8U A;  5GSU C;  5CHL B;  2RIQ A;  4KUD A;  3UT9 A;  1R4V A;  2RVQ C;  3KUY D;  5BNV B;  3WKJ D;  3AZG A;  3AZE B;  1HQ3 A;  2FJ7 C;  1BFM A;  4J8X B;  4J8W B;  2JSS A;  1EQZ C;  4J8V A;  5B2J C;  1M19 B;  3B6F B;  5DNM A;  4ZUX D;  5BNX A;  3MVD C;  5AV9 C;  1Z2C B;  5GT3 B;  5B24 A;  1KX3 A;  1M1A C;  2YFW A;  5AVB C;  3EPH A;  2FFF B;  3W99 C;  3AZL C;  4X23 C;  1P3P B;  3AV1 C;  1ZLA C;  3NQJ A;  1P3A B;  5GT0 B;  4ZBJ B;  1M18 B;  1ID3 C;  5DNN C;  5AV8 D;  1P3B C;  4YM6 C;  3UTA A;  5AY8 B;  3AYW D;  1P3G A;  2ARO D;  5B33 D;  3KXB A;  5B1L D;  4WU8 B;  1HTA A;  3REL D;  5CPJ A;  4J8X C;  4CSR A;  4J8W C;  5CPI D;  1M19 C;  3B6F C;  4QLC D;  3H0L C;  5GT3 C;  1N1J B;  2YFV B;  4KHA A;  3LEL D;  3REK D;  1P34 D;  3AZM A;  3A6N B;  1P3O B;  3MGS D;  4LD9 C;  5B31 B;  4JJN A;  3LZ0 A;  1P3P C;  3X1T A;  4XUJ B;  5AV5 C;  5GT0 C;  1P3F A;  4ZBJ C;  5B0Z D;  3AZH B;  5AY8 C;  3MGR D;  2Y2G A;  1WWS A;  4WNN A;  4KGC B;  3X1S A;  5B40 A;  4J8U B;  3V9R A;  3KUY A;  4WU8 C;  3WKJ A;  4KUD B;  5F99 D;  3AFA C;  5B31 G;  5JA4 A;  3WAA D;  3REI D;  4ZUX A;  2PYO D;  2IO5 B;  3KWQ A;  2DQN C;  4E44 A;  5BNX B;  3A6N C;  1P3I D;  2HUE B;  3LZ1 C;  3MNN C;  3AN2 D;  4CAY A;  5FUG B;  1F66 D;  1KX3 B;  5AV6 D;  4H9N A;  2YFW B;  3MGP B;  5B31 C;  5CP6 D;  3C1C D;  3X1V D;  5BS7 C;  2DF4 C;  4DRA A;  3AV2 B;  4XUJ C;  3AZF B;  2BYK A;  5AV8 A;  3AYW A;  5GXQ D;  3REJ A;  4KGC C;  1KU5 A;  2ARO A;  5B33 A;  1P3M D;  4J8U C;  3REH A;  2NZD A;  5B1L A;  3AZK A;  4UUZ B;  4KUD C;  3W97 B;  3UT9 C;  3KXB B;  5CPI A;  1F1E A;  4EO5 C;  1BH8 A;  3AZG C;  2NQB D;  1HQ3 C;  1TZY D;  5CPJ B;  3W98 A;  4QLC A;  2Y2L A;  1P34 A;  3MGQ D;  5DNM C;  5JRG B;  1AOI B;  1TAF A;  1A7W A;  3WTP B;  3LJA D;  1KX3 C;  3MGP C;  5BO0 B;  3O62 B;  3H0M C;  3AV2 C;  5CPK D;  1P3L D;  2W8S A;  4JJN B;  3LZ0 B;  3TU4 B;  3X1T B;  4AWL B;  3X1U D;  2J8P A;  3UTA C;  3VH6 A;  5B1M A;  5GSU B;  4WNN B;  5B0Y A;  4WU9 D;  3W97 C;  5F99 A;  2Y2I A;  5B40 B;  3X1S B;  3KXB C;  3W96 A;  2JE5 A;  5AVC D;  3C1B D;  3V9R B;  1P3K B;  3WAA A;  4Z66 A;  2PYO A;  1S32 D;  5CPJ C;  2CV5 A;  5JRG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...