4NFTA

Crystal structure of human lnkh2b-h2a.z-anp32e
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
184
Chain Sequence
MRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone H2B type 2-E, Histone H2A.Z
publication title Anp32e, a higher eukaryotic histone chaperone directs preferential recognition for H2A.Z
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 184
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4nftA00
3MGQC 4J8XB 3WAAB 3B0BA 5AV6C 3C1CB 4NE5A 3W97C 5CPJA 5DNMC 5GT0D 3REKB 3X1UB 1KX3D 1F66D 3REHA 3RELC 3LZ0D 2HUEB 3TU4A 2NZDC 4J8WD 5GXQC 5DNND 2AROB 1KX4B 3LJAA 2NZDB 4XZQA 3B6GD 3X1VD 3VH5A 3AZMD 1KX5C 3MNNB 4KUDD 3R45A 4M6BA 1M18C 5BNVA 3UTBB 3AZGC 1H3OB 1ULYA 4YS3B 1AOIB 3AZND 1A7WA 5B32C 3AFAA 1P3BA 1P3ID 3MGQA 5GT0B 5AV6A 5B31D 3AZLD 3W97A 3AZKB 5DNMA 1P3KC 3AZJD 1F66B 3C1BD 4X23C 2LY8A 5E5AD 5JRGC 3O62D 3WTPC 4DRBA 5DNNB 5BO0B 1P3OC 4ZUXD 3B6GB 2NZDA 3X1VB 5B1MB 5GXQA 3LELD 4AWLB 4KUDB 2IO5C 4Z5TD 3KWQD 3MNNA 1U35D 1P3GD 1KX5A 3W99C 2HIOD 5CHLB 5B33C 1H3OA 1M1AC 3AZGA 3AV2D 3AZNB 3AV1C 2FJ7D 5CPKD 3MGSD 5G49A 3WKJD 5BS7C 1P3IB 5B32A 3AZHC 2NQBD 4CSRA 5B31B 3AZLB 1P34C 3AZJB 3C1BB 1P3PD 4WZSB 1P3KA 5B0YC 4G92C 5E5AB 1N1JA 5AV9B 4KHAB 3VH6W 4X23A 4DRAA 4CAYA 5JRGA 1KU5A 3MGPB 4J8UB 3WTPA 4YM6C 3LELB 3AZFC 1P3OA 4Z5TB 3KWQB 1U35B 3A6NC 1P3AD 4LD9D 5B0ZC 5B24C 5B33A 1M1AA 2L5AA 5KDMB 1P3LC 5CPKB 5F99D 3KXBB 3MGSB 4WU8C 5AY8D 5C3IC 3W96C 5B40C 3AV1A 2RVQD 4WU8B 5B40B 5BS7A 3REIC 2JSSA 3AZHA 5GSUD 1P34A 4UUZA 1P3PB 4R8PD 1TZYD 3WA9D 3LZ1C 5B0YA 2F8NK 2YFWB 3AZEC 3VH6T 3UT9C 4WV4B 4YM6A 3REJD 3W98C 1ID3C 4LD9B 5B31G 4JJNC 3W98B 3B0DB 3MVDD 4H9NA 5AV5D 5B0ZA 4QLCC 5B24A 1HQ3B 5AY8B 5CP6C 1P3LA 4G91C 4WU8A 3REKC 3W96A 5B40A 5DNMD 4J8XC 3WAAC 5GSUB 3C1CC 3REIA 1ZLAD 4R8PB 4H9QB 3X1UC 3RELD 3X1SD 4NFTA 1HTAA 3LZ1A 3WTPE 3AYWD 5GXQD 2YFWA 2HUEC 3AZID 3AZEA 2AROC 1KX4C 3UTAD 3REJB 5BNXB 1M18D 3UT9A 4NE3A 5B1LD 5JA4B 3MNNC 5FUGB 1S32D 3MVDB 3W98A 3UTBC 5CPID 1ID3A 5AV5B 4JJNA 4YS3C 1HQ3A 4QLCA 2CV5D 1AOIC 5AVBC 2BYKB 2F8NA 5CP6A 5AVBB 4KGCD 3REKA 5GT0C 4J8XA 3WAAA 3NQJB 3AN2D 1KX3C 3C1CA 3V9RB 4EO5B 3X1SB 3AZKC 1F66C 3X1UA 3MGRD 1KX3B 3VH6A 3LZ0C 5B2ID 3AYWB 2YFVB 3LZ0B 3AZIB 5DNNC 3UTAB 4J8WB 3B6GC 3X1VC 3W99D 5B1MC 2AROA 4AWLC 1KX4A 4KUDC 1S32B 1M1AD 3AZMB 5FUGA 5CPIB 3UTBA 2CV5B 3AZNC 4YS3A 3B6FD 4KGCB 1AOIA 5AVBA 1P3IC 1B6WA 5B31C 3AZLC 1P3MD 3AN2B 5GT0A 3AZJC 1EQZD 3MGRB 3C1BC 1KX3A 3AZKA 1BH9B 4H9OB 5B2IB 4WU9D 3KUYD 4H9PB 1JFIB 1F66A 5E5AC 5AV9C 4YM6D 4XUJD 3LZ0A 3AZFD 3O62B 4J8UC 3MGPC 5BT1D 4ZUXC 5AVCD 3A6ND 5AV8D 5B2JD 1M19D 3LELC 1BH8B 5DNNA 5BO0A 4ZUXB 4Z5TC 3KWQC 5B0ZD 3B6GA 3X1VA 1U35C 5B1MA 1P3GC 3X1TD 5B24D 4KUDA 4H9RB 1P3GB 4J8VD 1P3FD 2HIOB 3AV2B 2PYOD 5GT3D 3B6FB 4Z66D 4NE6A 3KXBC 3MGSC 5CPKC 3AZNA 2FJ7B 3NQUB 5CPJD 3WKJB 1P3MB 1P3IA 2NQBB 1EQZB 5B31A 3AZLA 3REHD 1P3PC 3KUYB 3AZJA 3C1BA 4XUJB 3TU4D 5E5AA 5AV9A 4KHAA 5AVCB 3LJAD 1M19B 4XZQD 4J8UA 3MGPA 4ZUXA 3LELA 2BYMB 4Z5TA 3KWQA 4QLCD 4J8VB 1U35A 4LD9C 1P3GA 4ZBJC 3B0DC 1P3AB 2F8ND 2PYOB 5GT3B 1TAFB 4ZBJB 4Z66B 5F99C 1HQ3C 5AY8C 3AFAD 5KDMA 5F99B 1P3BD 5CPKA 2RVQC 3KXBA 3MGSA 3MGQD 3NQUA 5AV6D 3WKJA 5GSUC 3W97D 3REHB 4R8PC 1TZYB 3WA9B 1P3PA 2CWEA 3TU4B 4E45A 3LJAB 4XZQB 2NZDD 4HGAB 3MNND 5BNVB 3B0CW 3REJC 1KX5D 3AZGD 1WWIA 3MVDC 4LD9A 5AV5C 3AFAB 1P3BB 5F99A 5B32D 3MGQB 5AY8A 5AV6B 1F1EA 3W97B 5DNMB 3AZKD 1ZLAC 5GSUA 1P3KD 1ZLAB 3X1SC 4EO5C 4R8PA 1TZYA 4X23D 3RELB 3WA9A 4H9QA 5JRGD 3AYWC 3WTPD 5GXQB 3AZIC 1P3OD 5B1MD 3UTAC 1KX5B 4J8WC 4H9SC 1M18B 5B1LC 3AZGB 3REJA 5BNXA 1S32C 3AZMC 5B1LB 3B0CT 5CPIC 5B33D 5JA4A 3MVDA 5AV5A 5G49B 2CV5C 3AV1D 5B32B 4CSRB 4KGCC 4E44A 3AZHD 2BYKA 1P34D 1P3KB 3AN2C 1ZLAA 1N1JB 4X23B 3MGRC 5AV9D 3RELA 3NQJA 5B0YD 3V9RA 4CAYB 3X1SA 5JRGB 5B2IC 3WTPB 2F8NG 4J8UD 3MGPD 1P3OB 3AYWA 2YFVA 3O62C 3AZIA 2IO5B 3VH5W 3UTAA 1M18A 4J8WA 3W99B 4H9SA 5B33B 1M1AB 5B1LA 1S32A 3AZMA 5CPIA 2HIOC 3KXBD 1R4VA 3AV1B 1P3LD 3AV2C 4WU8D 2CV5A 2F8NH 3B6FC 3W96D 5B40D 3AZHB 2FJ7C 3KSYA 1P34B 4KGCA 4UUZB 3REID 3WKJC 1WWSA 1P3MC 2NQBC 4Z2MG 1EQZC 3LZ1D 3AN2A 5B0YB 4G92B 4WU9C 3KUYC 3MGRA 4WU9B 1BH9A 4H9OA 5B2IA 4XUJC 4H9PA 3AZED 1JFIA 4YM6B 3AZFB 5BT1C 5AVCC 5B32G 5AV8C 5B2JC 3O62A 3UT9D 1M19C 3A6NB 5AV8B 5B2JB 3W99A 4H9NB 3X1TC 1BH8A 1ID3D 3W98D 5B0ZB 3VH5T 4JJND 4J8VC 4WNNB 4Z2MH 5B24B 3X1TB 1P3FC 1HQ3D 1Q9CA 1P3AC 1P3LB 4H9RA 1P3FB 2PYOC 5GT3C 2HIOA 5C3IB 4Z66C 3W96B 5CP6D 3AV2A 3REKD 3B6FA 1B67A 3REIB 5CPJC 4J8XD 3WAAD 2FJ7A 5CPJB 3C1CD 3X1UD 3LZ1B 3REHC 1P3MA 2NQBA 1EQZA 1BFMA 1TZYC 3WA9C 4WU9A 3KUYA 3TU4C 3AZEB 4XUJA 3LJAC 3UT9B 3AZFA 4XZQC 4HGAC 2AROD 1KX4D 5AVCA 3A6NA 5AV8A 5B2JA 1M19A 1ID3B 3R45B 4JJNB 3X1TA 3UTBD 4WNNA 2BYMA 4QLCB 4J8VA 1P3FA 4YS3D 2F8NB 1P3AA 5CP6B 1AOID 2PYOA 4G91B 1TAFA 5GT3A 5AVBD 3AFAC 4Z66A 1P3BC
chains in the Genus database with same CATH superfamily
3MGQC 4J8XB 3WAAB 3B0BA 5AV6C 3C1CB 4NE5A 3W97C 5CPJA 5DNMC 5GT0D 3REKB 3X1UB 1KX3D 1F66D 2BG1A 3REHA 3RELC 3LZ0D 2HUEB 3TU4A 2F2AC 2NZDC 4J8WD 5GXQC 5DNND 2AROB 1KX4B 3LJAA 2NZDB 4XZQA 3B6GD 3X1VD 3VH5A 3AZMD 1KX5C 3MNNB 4KUDD 3R45A 4M6BA 1M18C 5BNVA 3UTBB 3AZGC 2W8SA 1H3OB 1ULYA 4YS3B 1AOIB 3AZND 1A7WA 5B32C 3AFAA 1P3BA 1P3ID 2XD1A 3MGQA 5GT0B 5AV6A 5B31D 3AZLD 3W97A 3AZKB 2ZY3A 5DNMA 3AZJD 1P3KC 1F66B 3C1BD 4X23C 2LY8A 5E5AD 5JRGC 3O62D 3WTPC 4DRBA 5DNNB 5BO0B 1P3OC 4ZUXD 3A1IA 3B6GB 3X1VB 2NZDA 5B1MB 5GXQA 3LELD 4AWLB 4KUDB 2IO5C 4Z5TD 3KWQD 3MNNA 1U35D 1P3GD 1KX5A 3W99C 2HIOD 5CHLB 5B33C 1H3OA 1M1AC 3AZGA 3AV2D 3AZNB 3AV1C 3EPJA 2FJ7D 5CPKD 3MGSD 5G49A 3WKJD 5BS7C 1P3IB 3H0LC 5B32A 3AZHC 2ZY4A 2NQBD 4CSRA 5B31B 3AZLB 1P34C 3AZJB 3C1BB 1P3PD 4WZSB 1P3KA 5B0YC 4G92C 5E5AB 1N1JA 5AV9B 4KHAB 3VH6W 4X23A 2Y2OA 4DRAA 4CAYA 5JRGA 1KU5A 3MGPB 4J8UB 3WTPA 4YM6C 3LELB 3AZFC 1P3OA 4Z5TB 3KWQB 1U35B 3A6NC 2VQRA 1P3AD 3P5JB 4LD9D 5B0ZC 5B24C 5B33A 1M1AA 2L5AA 5KDMB 1P3LC 5CPKB 1W2EA 5F99D 3KXBB 3MGSB 4WU8C 5AY8D 5C3IC 3W96C 5B40C 3AV1A 2RVQD 4WU8B 5B40B 3F6TA 5BS7A 3REIC 2JSSA 3AZHA 5GSUD 1P34A 1Z2CB 4UUZA 1P3PB 4R8PD 1TZYD 3WA9D 3LZ1C 5B0YA 4UPKA 2F8NK 3KFUG 2YFWB 3AZEC 3VH6T 2ZY5A 3UT9C 4WV4B 4YM6A 3REJD 3W98C 1ID3C 4LD9B 5B31G 4JJNC 3W98B 3B0DB 3MVDD 4H9NA 5AV5D 5B0ZA 4QLCC 5B24A 1HQ3B 5AY8B 5CP6C 1P3LA 4G91C 4WU8A 3H0RC 3REKC 3W96A 5B40A 5DNMD 4J8XC 3WAAC 5GSUB 3C1CC 3REIA 1ZLAD 4R8PB 4H9QB 3X1UC 3RELD 3X1SD 4NFTA 1HTAA 3LZ1A 3WTPE 3AYWD 5GXQD 2YFWA 2HUEC 3AZID 3AZEA 3EG5B 2AROC 1KX4C 3UTAD 3REJB 5BNXB 1M18D 3UT9A 4NE3A 5B1LD 5JA4B 3MNNC 5FUGB 1S32D 3MVDB 3W98A 3UTBC 5CPID 1ID3A 5AV5B 4JJNA 2Y2NA 4YS3C 2XD5A 1HQ3A 4QLCA 2CV5D 1AOIC 5AVBC 2BYKB 2F8NA 2DF4C 2Y2GA 5CP6A 5AVBB 4KGCD 3REKA 5GT0C 4J8XA 3WAAA 3NQJB 3AN2D 1KX3C 3C1CA 3V9RB 4EO5B 3X1SB 3AZKC 1F66C 3X1UA 3MGRD 1KX3B 3VH6A 3LZ0C 5B2ID 3AYWB 2YFVB 3LZ0B 3EPHA 3AZIB 5DNNC 3UTAB 4J8WB 3B6GC 3X1VC 3W99D 5B1MC 2AROA 4AWLC 1KX4A 4KUDC 1S32B 1M1AD 3AZMB 5FUGA 5CPIB 3IP4C 3UTBA 2CV5B 3AZNC 4YS3A 3B6FD 4KGCB 1AOIA 5AVBA 1P3IC 3H0MC 1B6WA 5B31C 3AZLC 1P3MD 3AN2B 5GT0A 3AZJC 1EQZD 3A1KA 3MGRB 2Y2PA 3C1BC 1KX3A 3AZKA 1BH9B 4H9OB 2RIQA 5B2IB 4WU9D 4H9PB 3KUYD 1JFIB 1F66A 5E5AC 5AV9C 4YM6D 4XUJD 3LZ0A 3AZFD 3O62B 4J8UC 3MGPC 5BT1D 4ZUXC 5AVCD 3A6ND 3EPKA 5AV8D 5B2JD 1M19D 3LELC 1BH8B 5DNNA 5BO0A 4ZUXB 4Z5TC 3KWQC 2Y2IA 5B0ZD 3B6GA 2UWXA 3X1VA 5B1MA 1U35C 3X1TD 1P3GC 5B24D 4KUDA 4H9RB 1P3GB 4J8VD 1P3FD 2HIOB 3AV2B 2PYOD 5GT3D 2Y2LA 3B6FB 4Z66D 4NE6A 3KXBC 3MGSC 5CPKC 3AZNA 2FJ7B 2ZY2A 3NQUB 5CPJD 3WKJB 2Y2QA 1P3MB 1P3IA 2NQBB 1EQZB 5B31A 3AZLA 3REHD 1P3PC 2DQNC 3KUYB 3AZJA 3C1BA 4XUJB 3TU4D 3AL0C 5E5AA 5AV9A 4KHAA 5AVCB 2Y2KA 3LJAD 1M19B 4XZQD 2G5HC 4J8UA 3MGPA 4ZUXA 3LELA 2BYMB 4Z5TA 3KWQA 4QLCD 4J8VB 1U35A 4LD9C 1P3GA 4ZBJC 3B0DC 1P3AB 2F8ND 2PYOB 5GT3B 1TAFB 4ZBJB 4Z66B 5F99C 1HQ3C 5AY8C 3AFAD 5KDMA 5F99B 1P3BD 5CPKA 2RVQC 3KXBA 3MGSA 3MGQD 3NQUA 2J8PA 5AV6D 3WKJA 2Y2HA 5GSUC 3W97D 3FDDA 3REHB 4R8PC 1TZYB 3WA9B 1P3PA 2CWEA 3TU4B 4E45A 3LJAB 4XZQB 2NZDD 4HGAB 3MNND 5BNVB 3B0CW 3REJC 1KX5D 2JE5A 3AZGD 1WWIA 3MVDC 4LD9A 5AV5C 3AFAB 1P3BB 5F99A 5B32D 3MGQB 5AY8A 5AV6B 1F1EA 3W97B 5DNMB 3AZKD 1ZLAC 5GSUA 2ZM5A 1P3KD 1ZLAB 3X1SC 4EO5C 4R8PA 1TZYA 4X23D 3RELB 3WA9A 4H9QA 2JCHA 5JRGD 3AYWC 3WTPD 5GXQB 3AZIC 1P3OD 5B1MD 3UTAC 1KX5B 4J8WC 4H9SC 1M18B 5B1LC 3AZGB 3REJA 5BNXA 1S32C 3AZMC 5B1LB 3B0CT 5CPIC 5B33D 5JA4A 3MVDA 5AV5A 5G49B 2CV5C 3AV1D 5B32B 4CSRB 4KGCC 4E44A 3AZHD 2BYKA 2Y2JA 1P34D 2FFFB 1P3KB 3AN2C 1ZLAA 1N1JB 4X23B 3MGRC 5AV9D 3RELA 3NQJA 5B0YD 3V9RA 4CAYB 3X1SA 5JRGB 5B2IC 3WTPB 2F8NG 4J8UD 3MGPD 2Y2MA 1P3OB 3AYWA 2YFVA 3O62C 3AZIA 2IO5B 3VH5W 3UTAA 1M18A 1T3UA 4J8WA 3W99B 4H9SA 5B33B 1M1AB 5B1LA 1S32A 3AZMA 5CPIA 2HIOC 3KXBD 1R4VA 3AV1B 1P3LD 3AV2C 4WU8D 2CV5A 2F8NH 3B6FC 3W96D 5B40D 3AZHB 2FJ7C 3KSYA 1P34B 4KGCA 4UUZB 3REID 3WKJC 1WWSA 1P3MC 2NQBC 4Z2MG 1EQZC 3LZ1D 3AN2A 5B0YB 2G5IC 4G92B 4WU9C 3KUYC 3MGRA 4WU9B 1BH9A 4H9OA 5B2IA 4XUJC 4H9PA 3AZED 1JFIA 4YM6B 3AZFB 5BT1C 5AVCC 5B32G 5AV8C 5B2JC 3O62A 3UT9D 1M19C 3A6NB 5AV8B 5B2JB 4DQYB 3W99A 4H9NB 3X1TC 1BH8A 1ID3D 3W98D 5B0ZB 3VH5T 4JJND 4J8VC 4WNNB 4Z2MH 5B24B 3X1TB 1P3FC 1HQ3D 1Q9CA 1P3AC 1P3LB 4H9RA 1P3FB 2PYOC 5GT3C 2HIOA 5C3IB 4Z66C 3W96B 5CP6D 3AV2A 4WJ3C 3REKD 3B6FA 1B67A 3REIB 5CPJC 4J8XD 3WAAD 2FJ7A 5CPJB 3C1CD 3EPLA 3X1UD 3LZ1B 3REHC 1P3MA 2NQBA 1EQZA 1BFMA 1TZYC 3WA9C 4WU9A 3KUYA 1PZRA 3TU4C 3AZEB 4XUJA 3LJAC 3UT9B 3AZFA 4XZQC 4HGAC 2AROD 1KX4D 5AVCA 3A6NA 5AV8A 5B2JA 1M19A 1ID3B 3R45B 4JJNB 3X1TA 3UTBD 4WNNA 2BYMA 4QLCB 4J8VA 1P3FA 4YS3D 2F8NB 1P3AA 5CP6B 1AOID 2PYOA 4G91B 1TAFA 5GT3A 5AVBD 3AFAC 4Z66A 1P3BC
chains in the Genus database with same CATH topology
3MGQC 4J8XB 3WAAB 3B0BA 5AV6C 3C1CB 4NE5A 3W97C 5CPJA 5DNMC 5GT0D 3REKB 3X1UB 1KX3D 1F66D 2BG1A 3REHA 3RELC 3LZ0D 2HUEB 3TU4A 2F2AC 2NZDC 4J8WD 5GXQC 5DNND 2AROB 1KX4B 3LJAA 2NZDB 4XZQA 3B6GD 3X1VD 3VH5A 3AZMD 1KX5C 3MNNB 4KUDD 3R45A 4M6BA 1M18C 5BNVA 3UTBB 3AZGC 2W8SA 1H3OB 1ULYA 4YS3B 1AOIB 3AZND 1A7WA 5B32C 3AFAA 1P3BA 1P3ID 2XD1A 3MGQA 5GT0B 5AV6A 5B31D 3AZLD 3W97A 3AZKB 2ZY3A 5DNMA 3AZJD 1P3KC 1F66B 3C1BD 4X23C 2LY8A 5E5AD 5JRGC 3O62D 3WTPC 4DRBA 5DNNB 5BO0B 1P3OC 4ZUXD 3A1IA 3B6GB 3X1VB 2NZDA 5B1MB 5GXQA 3LELD 4AWLB 4KUDB 2IO5C 4Z5TD 3KWQD 3MNNA 1U35D 1P3GD 1KX5A 3W99C 2HIOD 5CHLB 5B33C 1H3OA 1M1AC 3AZGA 3AV2D 3AZNB 3AV1C 3EPJA 2FJ7D 5CPKD 3MGSD 5G49A 3WKJD 5BS7C 1P3IB 3H0LC 5B32A 3AZHC 2ZY4A 2NQBD 4CSRA 5B31B 3AZLB 1P34C 3AZJB 3C1BB 1P3PD 4WZSB 1P3KA 5B0YC 4G92C 5E5AB 1N1JA 5AV9B 4KHAB 3VH6W 4X23A 2Y2OA 4DRAA 4CAYA 5JRGA 1KU5A 3MGPB 4J8UB 3WTPA 4YM6C 3LELB 3AZFC 1P3OA 4Z5TB 3KWQB 1U35B 3A6NC 2VQRA 1P3AD 3P5JB 4LD9D 5B0ZC 5B24C 5B33A 1M1AA 2L5AA 5KDMB 1P3LC 5CPKB 1W2EA 5F99D 3KXBB 3MGSB 4WU8C 5AY8D 5C3IC 3W96C 5B40C 3AV1A 2RVQD 4WU8B 5B40B 3F6TA 5BS7A 3REIC 2JSSA 3AZHA 5GSUD 1P34A 1Z2CB 4UUZA 1P3PB 4R8PD 1TZYD 3WA9D 3LZ1C 5B0YA 4UPKA 2F8NK 3KFUG 2YFWB 3AZEC 3VH6T 2ZY5A 3UT9C 4WV4B 4YM6A 3REJD 3W98C 1ID3C 4LD9B 5B31G 4JJNC 3W98B 3B0DB 3MVDD 4H9NA 5AV5D 5B0ZA 4QLCC 5B24A 1HQ3B 5AY8B 5CP6C 1P3LA 4G91C 4WU8A 3H0RC 3REKC 3W96A 5B40A 5DNMD 4J8XC 3WAAC 5GSUB 3C1CC 3REIA 1ZLAD 4R8PB 4H9QB 3X1UC 3RELD 3X1SD 4NFTA 1HTAA 3LZ1A 3WTPE 3AYWD 5GXQD 2YFWA 2HUEC 3AZID 3AZEA 3EG5B 2AROC 1KX4C 3UTAD 3REJB 5BNXB 1M18D 3UT9A 4NE3A 5B1LD 5JA4B 3MNNC 5FUGB 1S32D 3MVDB 3W98A 3UTBC 5CPID 1ID3A 5AV5B 4JJNA 2Y2NA 4YS3C 2XD5A 1HQ3A 4QLCA 2CV5D 1AOIC 5AVBC 2BYKB 2F8NA 2DF4C 2Y2GA 5CP6A 5AVBB 4KGCD 3REKA 5GT0C 4J8XA 3WAAA 3NQJB 3AN2D 1KX3C 3C1CA 3V9RB 4EO5B 3X1SB 3AZKC 1F66C 3X1UA 3MGRD 1KX3B 3VH6A 3LZ0C 5B2ID 3AYWB 2YFVB 3LZ0B 3EPHA 3AZIB 5DNNC 3UTAB 4J8WB 3B6GC 3X1VC 3W99D 5B1MC 2AROA 4AWLC 1KX4A 4KUDC 1S32B 1M1AD 3AZMB 5FUGA 5CPIB 3IP4C 3UTBA 2CV5B 3AZNC 4YS3A 3B6FD 4KGCB 1AOIA 5AVBA 1P3IC 3H0MC 1B6WA 5B31C 3AZLC 1P3MD 3AN2B 5GT0A 3AZJC 1EQZD 3A1KA 3MGRB 2Y2PA 3C1BC 1KX3A 3AZKA 1BH9B 4H9OB 2RIQA 5B2IB 4WU9D 4H9PB 3KUYD 1JFIB 1F66A 5E5AC 5AV9C 4YM6D 4XUJD 3LZ0A 3AZFD 3O62B 4J8UC 3MGPC 5BT1D 4ZUXC 5AVCD 3A6ND 3EPKA 5AV8D 5B2JD 1M19D 3LELC 1BH8B 5DNNA 5BO0A 4ZUXB 4Z5TC 3KWQC 2Y2IA 5B0ZD 3B6GA 2UWXA 3X1VA 5B1MA 1U35C 3X1TD 1P3GC 5B24D 4KUDA 4H9RB 1P3GB 4J8VD 1P3FD 2HIOB 3AV2B 2PYOD 5GT3D 2Y2LA 3B6FB 4Z66D 4NE6A 3KXBC 3MGSC 5CPKC 3AZNA 2FJ7B 2ZY2A 3NQUB 5CPJD 3WKJB 2Y2QA 1P3MB 1P3IA 2NQBB 1EQZB 5B31A 3AZLA 3REHD 1P3PC 2DQNC 3KUYB 3AZJA 3C1BA 4XUJB 3TU4D 3AL0C 5E5AA 5AV9A 4KHAA 5AVCB 2Y2KA 3LJAD 1M19B 4XZQD 2G5HC 4J8UA 3MGPA 4ZUXA 3LELA 2BYMB 4Z5TA 3KWQA 4QLCD 4J8VB 1U35A 4LD9C 1P3GA 4ZBJC 3B0DC 1P3AB 2F8ND 2PYOB 5GT3B 1TAFB 4ZBJB 4Z66B 5F99C 1HQ3C 5AY8C 3AFAD 5KDMA 5F99B 1P3BD 5CPKA 2RVQC 3KXBA 3MGSA 3MGQD 3NQUA 2J8PA 5AV6D 3WKJA 2Y2HA 5GSUC 3W97D 3FDDA 3REHB 4R8PC 1TZYB 3WA9B 1P3PA 2CWEA 3TU4B 4E45A 3LJAB 4XZQB 2NZDD 4HGAB 3MNND 5BNVB 3B0CW 3REJC 1KX5D 2JE5A 3AZGD 1WWIA 3MVDC 4LD9A 5AV5C 3AFAB 1P3BB 5F99A 5B32D 3MGQB 5AY8A 5AV6B 1F1EA 3W97B 5DNMB 3AZKD 1ZLAC 5GSUA 2ZM5A 1P3KD 1ZLAB 3X1SC 4EO5C 4R8PA 1TZYA 4X23D 3RELB 3WA9A 4H9QA 2JCHA 5JRGD 3AYWC 3WTPD 5GXQB 3AZIC 1P3OD 5B1MD 3UTAC 1KX5B 4J8WC 4H9SC 1M18B 5B1LC 3AZGB 3REJA 5BNXA 1S32C 3AZMC 5B1LB 3B0CT 5CPIC 5B33D 5JA4A 3MVDA 5AV5A 5G49B 2CV5C 3AV1D 5B32B 4CSRB 4KGCC 4E44A 3AZHD 2BYKA 2Y2JA 1P34D 2FFFB 1P3KB 3AN2C 1ZLAA 1N1JB 4X23B 3MGRC 5AV9D 3RELA 3NQJA 5B0YD 3V9RA 4CAYB 3X1SA 5JRGB 5B2IC 3WTPB 2F8NG 4J8UD 3MGPD 2Y2MA 1P3OB 3AYWA 2YFVA 3O62C 3AZIA 2IO5B 3VH5W 3UTAA 1M18A 1T3UA 4J8WA 3W99B 4H9SA 5B33B 1M1AB 5B1LA 1S32A 3AZMA 5CPIA 2HIOC 3KXBD 1R4VA 3AV1B 1P3LD 3AV2C 4WU8D 2CV5A 2F8NH 3B6FC 3W96D 5B40D 3AZHB 2FJ7C 3KSYA 1P34B 4KGCA 4UUZB 3REID 3WKJC 1WWSA 1P3MC 2NQBC 4Z2MG 1EQZC 3LZ1D 3AN2A 5B0YB 2G5IC 4G92B 4WU9C 3KUYC 3MGRA 4WU9B 1BH9A 4H9OA 5B2IA 4XUJC 4H9PA 3AZED 1JFIA 4YM6B 3AZFB 5BT1C 5AVCC 5B32G 5AV8C 5B2JC 3O62A 3UT9D 1M19C 3A6NB 5AV8B 5B2JB 4DQYB 3W99A 4H9NB 3X1TC 1BH8A 1ID3D 3W98D 5B0ZB 3VH5T 4JJND 4J8VC 4WNNB 4Z2MH 5B24B 3X1TB 1P3FC 1HQ3D 1Q9CA 1P3AC 1P3LB 4H9RA 1P3FB 2PYOC 5GT3C 2HIOA 5C3IB 4Z66C 3W96B 5CP6D 3AV2A 4WJ3C 3REKD 3B6FA 1B67A 3REIB 5CPJC 4J8XD 3WAAD 2FJ7A 5CPJB 3C1CD 3EPLA 3X1UD 3LZ1B 3REHC 1P3MA 2NQBA 1EQZA 1BFMA 1TZYC 3WA9C 4WU9A 3KUYA 1PZRA 3TU4C 3AZEB 4XUJA 3LJAC 3UT9B 3AZFA 4XZQC 4HGAC 2AROD 1KX4D 5AVCA 3A6NA 5AV8A 5B2JA 1M19A 1ID3B 3R45B 4JJNB 3X1TA 3UTBD 4WNNA 2BYMA 4QLCB 4J8VA 1P3FA 4YS3D 2F8NB 1P3AA 5CP6B 1AOID 2PYOA 4G91B 1TAFA 5GT3A 5AVBD 3AFAC 4Z66A 1P3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ C;  4J8X B;  3WAA B;  3B0B A;  5AV6 C;  3C1C B;  4NE5 A;  3W97 C;  5CPJ A;  5DNM C;  5GT0 D;  3REK B;  3X1U B;  1KX3 D;  1F66 D;  3REH A;  3REL C;  3LZ0 D;  2HUE B;  3TU4 A;  2NZD C;  4J8W D;  5GXQ C;  5DNN D;  2ARO B;  1KX4 B;  3LJA A;  2NZD B;  4XZQ A;  3B6G D;  3X1V D;  3VH5 A;  3AZM D;  1KX5 C;  3MNN B;  4KUD D;  3R45 A;  4M6B A;  1M18 C;  5BNV A;  3UTB B;  3AZG C;  1H3O B;  1ULY A;  4YS3 B;  1AOI B;  3AZN D;  1A7W A;  5B32 C;  3AFA A;  1P3B A;  1P3I D;  3MGQ A;  5GT0 B;  5AV6 A;  5B31 D;  3AZL D;  3W97 A;  3AZK B;  5DNM A;  1P3K C;  3AZJ D;  1F66 B;  3C1B D;  4X23 C;  2LY8 A;  5E5A D;  5JRG C;  3O62 D;  3WTP C;  4DRB A;  5DNN B;  5BO0 B;  1P3O C;  4ZUX D;  3B6G B;  2NZD A;  3X1V B;  5B1M B;  5GXQ A;  3LEL D;  4AWL B;  4KUD B;  2IO5 C;  4Z5T D;  3KWQ D;  3MNN A;  1U35 D;  1P3G D;  1KX5 A;  3W99 C;  2HIO D;  5CHL B;  5B33 C;  1H3O A;  1M1A C;  3AZG A;  3AV2 D;  3AZN B;  3AV1 C;  2FJ7 D;  5CPK D;  3MGS D;  5G49 A;  3WKJ D;  5BS7 C;  1P3I B;  5B32 A;  3AZH C;  2NQB D;  4CSR A;  5B31 B;  3AZL B;  1P34 C;  3AZJ B;  3C1B B;  1P3P D;  4WZS B;  1P3K A;  5B0Y C;  4G92 C;  5E5A B;  1N1J A;  5AV9 B;  4KHA B;  3VH6 W;  4X23 A;  4DRA A;  4CAY A;  5JRG A;  1KU5 A;  3MGP B;  4J8U B;  3WTP A;  4YM6 C;  3LEL B;  3AZF C;  1P3O A;  4Z5T B;  3KWQ B;  1U35 B;  3A6N C;  1P3A D;  4LD9 D;  5B0Z C;  5B24 C;  5B33 A;  1M1A A;  2L5A A;  5KDM B;  1P3L C;  5CPK B;  5F99 D;  3KXB B;  3MGS B;  4WU8 C;  5AY8 D;  5C3I C;  3W96 C;  5B40 C;  3AV1 A;  2RVQ D;  4WU8 B;  5B40 B;  5BS7 A;  3REI C;  2JSS A;  3AZH A;  5GSU D;  1P34 A;  4UUZ A;  1P3P B;  4R8P D;  1TZY D;  3WA9 D;  3LZ1 C;  5B0Y A;  2F8N K;  2YFW B;  3AZE C;  3VH6 T;  3UT9 C;  4WV4 B;  4YM6 A;  3REJ D;  3W98 C;  1ID3 C;  4LD9 B;  5B31 G;  4JJN C;  3W98 B;  3B0D B;  3MVD D;  4H9N A;  5AV5 D;  5B0Z A;  4QLC C;  5B24 A;  1HQ3 B;  5AY8 B;  5CP6 C;  1P3L A;  4G91 C;  4WU8 A;  3REK C;  3W96 A;  5B40 A;  5DNM D;  4J8X C;  3WAA C;  5GSU B;  3C1C C;  3REI A;  1ZLA D;  4R8P B;  4H9Q B;  3X1U C;  3REL D;  3X1S D;  4NFT A;  1HTA A;  3LZ1 A;  3WTP E;  3AYW D;  5GXQ D;  2YFW A;  2HUE C;  3AZI D;  3AZE A;  2ARO C;  1KX4 C;  3UTA D;  3REJ B;  5BNX B;  1M18 D;  3UT9 A;  4NE3 A;  5B1L D;  5JA4 B;  3MNN C;  5FUG B;  1S32 D;  3MVD B;  3W98 A;  3UTB C;  5CPI D;  1ID3 A;  5AV5 B;  4JJN A;  4YS3 C;  1HQ3 A;  4QLC A;  2CV5 D;  1AOI C;  5AVB C;  2BYK B;  2F8N A;  5CP6 A;  5AVB B;  4KGC D;  3REK A;  5GT0 C;  4J8X A;  3WAA A;  3NQJ B;  3AN2 D;  1KX3 C;  3C1C A;  3V9R B;  4EO5 B;  3X1S B;  3AZK C;  1F66 C;  3X1U A;  3MGR D;  1KX3 B;  3VH6 A;  3LZ0 C;  5B2I D;  3AYW B;  2YFV B;  3LZ0 B;  3AZI B;  5DNN C;  3UTA B;  4J8W B;  3B6G C;  3X1V C;  3W99 D;  5B1M C;  2ARO A;  4AWL C;  1KX4 A;  4KUD C;  1S32 B;  1M1A D;  3AZM B;  5FUG A;  5CPI B;  3UTB A;  2CV5 B;  3AZN C;  4YS3 A;  3B6F D;  4KGC B;  1AOI A;  5AVB A;  1P3I C;  1B6W A;  5B31 C;  3AZL C;  1P3M D;  3AN2 B;  5GT0 A;  3AZJ C;  1EQZ D;  3MGR B;  3C1B C;  1KX3 A;  3AZK A;  1BH9 B;  4H9O B;  5B2I B;  4WU9 D;  3KUY D;  4H9P B;  1JFI B;  1F66 A;  5E5A C;  5AV9 C;  4YM6 D;  4XUJ D;  3LZ0 A;  3AZF D;  3O62 B;  4J8U C;  3MGP C;  5BT1 D;  4ZUX C;  5AVC D;  3A6N D;  5AV8 D;  5B2J D;  1M19 D;  3LEL C;  1BH8 B;  5DNN A;  5BO0 A;  4ZUX B;  4Z5T C;  3KWQ C;  5B0Z D;  3B6G A;  3X1V A;  1U35 C;  5B1M A;  1P3G C;  3X1T D;  5B24 D;  4KUD A;  4H9R B;  1P3G B;  4J8V D;  1P3F D;  2HIO B;  3AV2 B;  2PYO D;  5GT3 D;  3B6F B;  4Z66 D;  4NE6 A;  3KXB C;  3MGS C;  5CPK C;  3AZN A;  2FJ7 B;  3NQU B;  5CPJ D;  3WKJ B;  1P3M B;  1P3I A;  2NQB B;  1EQZ B;  5B31 A;  3AZL A;  3REH D;  1P3P C;  3KUY B;  3AZJ A;  3C1B A;  4XUJ B;  3TU4 D;  5E5A A;  5AV9 A;  4KHA A;  5AVC B;  3LJA D;  1M19 B;  4XZQ D;  4J8U A;  3MGP A;  4ZUX A;  3LEL A;  2BYM B;  4Z5T A;  3KWQ A;  4QLC D;  4J8V B;  1U35 A;  4LD9 C;  1P3G A;  4ZBJ C;  3B0D C;  1P3A B;  2F8N D;  2PYO B;  5GT3 B;  1TAF B;  4ZBJ B;  4Z66 B;  5F99 C;  1HQ3 C;  5AY8 C;  3AFA D;  5KDM A;  5F99 B;  1P3B D;  5CPK A;  2RVQ C;  3KXB A;  3MGS A;  3MGQ D;  3NQU A;  5AV6 D;  3WKJ A;  5GSU C;  3W97 D;  3REH B;  4R8P C;  1TZY B;  3WA9 B;  1P3P A;  2CWE A;  3TU4 B;  4E45 A;  3LJA B;  4XZQ B;  2NZD D;  4HGA B;  3MNN D;  5BNV B;  3B0C W;  3REJ C;  1KX5 D;  3AZG D;  1WWI A;  3MVD C;  4LD9 A;  5AV5 C;  3AFA B;  1P3B B;  5F99 A;  5B32 D;  3MGQ B;  5AY8 A;  5AV6 B;  1F1E A;  3W97 B;  5DNM B;  3AZK D;  1ZLA C;  5GSU A;  1P3K D;  1ZLA B;  3X1S C;  4EO5 C;  4R8P A;  1TZY A;  4X23 D;  3REL B;  3WA9 A;  4H9Q A;  5JRG D;  3AYW C;  3WTP D;  5GXQ B;  3AZI C;  1P3O D;  5B1M D;  3UTA C;  1KX5 B;  4J8W C;  4H9S C;  1M18 B;  5B1L C;  3AZG B;  3REJ A;  5BNX A;  1S32 C;  3AZM C;  5B1L B;  3B0C T;  5CPI C;  5B33 D;  5JA4 A;  3MVD A;  5AV5 A;  5G49 B;  2CV5 C;  3AV1 D;  5B32 B;  4CSR B;  4KGC C;  4E44 A;  3AZH D;  2BYK A;  1P34 D;  1P3K B;  3AN2 C;  1ZLA A;  1N1J B;  4X23 B;  3MGR C;  5AV9 D;  3REL A;  3NQJ A;  5B0Y D;  3V9R A;  4CAY B;  3X1S A;  5JRG B;  5B2I C;  3WTP B;  2F8N G;  4J8U D;  3MGP D;  1P3O B;  3AYW A;  2YFV A;  3O62 C;  3AZI A;  2IO5 B;  3VH5 W;  3UTA A;  1M18 A;  4J8W A;  3W99 B;  4H9S A;  5B33 B;  1M1A B;  5B1L A;  1S32 A;  3AZM A;  5CPI A;  2HIO C;  3KXB D;  1R4V A;  3AV1 B;  1P3L D;  3AV2 C;  4WU8 D;  2CV5 A;  2F8N H;  3B6F C;  3W96 D;  5B40 D;  3AZH B;  2FJ7 C;  3KSY A;  1P34 B;  4KGC A;  4UUZ B;  3REI D;  3WKJ C;  1WWS A;  1P3M C;  2NQB C;  4Z2M G;  1EQZ C;  3LZ1 D;  3AN2 A;  5B0Y B;  4G92 B;  4WU9 C;  3KUY C;  3MGR A;  4WU9 B;  1BH9 A;  4H9O A;  5B2I A;  4XUJ C;  4H9P A;  3AZE D;  1JFI A;  4YM6 B;  3AZF B;  5BT1 C;  5AVC C;  5B32 G;  5AV8 C;  5B2J C;  3O62 A;  3UT9 D;  1M19 C;  3A6N B;  5AV8 B;  5B2J B;  3W99 A;  4H9N B;  3X1T C;  1BH8 A;  1ID3 D;  3W98 D;  5B0Z B;  3VH5 T;  4JJN D;  4J8V C;  4WNN B;  4Z2M H;  5B24 B;  3X1T B;  1P3F C;  1HQ3 D;  1Q9C A;  1P3A C;  1P3L B;  4H9R A;  1P3F B;  2PYO C;  5GT3 C;  2HIO A;  5C3I B;  4Z66 C;  3W96 B;  5CP6 D;  3AV2 A;  3REK D;  3B6F A;  1B67 A;  3REI B;  5CPJ C;  4J8X D;  3WAA D;  2FJ7 A;  5CPJ B;  3C1C D;  3X1U D;  3LZ1 B;  3REH C;  1P3M A;  2NQB A;  1EQZ A;  1BFM A;  1TZY C;  3WA9 C;  4WU9 A;  3KUY A;  3TU4 C;  3AZE B;  4XUJ A;  3LJA C;  3UT9 B;  3AZF A;  4XZQ C;  4HGA C;  2ARO D;  1KX4 D;  5AVC A;  3A6N A;  5AV8 A;  5B2J A;  1M19 A;  1ID3 B;  3R45 B;  4JJN B;  3X1T A;  3UTB D;  4WNN A;  2BYM A;  4QLC B;  4J8V A;  1P3F A;  4YS3 D;  2F8N B;  1P3A A;  5CP6 B;  1AOI D;  2PYO A;  4G91 B;  1TAF A;  5GT3 A;  5AVB D;  3AFA C;  4Z66 A;  1P3B C; 
#chains in the Genus database with same CATH topology
 3MGQ C;  4J8X B;  3WAA B;  3B0B A;  5AV6 C;  3C1C B;  4NE5 A;  3W97 C;  5CPJ A;  5DNM C;  5GT0 D;  3REK B;  3X1U B;  1KX3 D;  1F66 D;  2BG1 A;  3REH A;  3REL C;  3LZ0 D;  2HUE B;  3TU4 A;  2F2A C;  2NZD C;  4J8W D;  5GXQ C;  5DNN D;  2ARO B;  1KX4 B;  3LJA A;  2NZD B;  4XZQ A;  3B6G D;  3X1V D;  3VH5 A;  3AZM D;  1KX5 C;  3MNN B;  4KUD D;  3R45 A;  4M6B A;  1M18 C;  5BNV A;  3UTB B;  3AZG C;  2W8S A;  1H3O B;  1ULY A;  4YS3 B;  1AOI B;  3AZN D;  1A7W A;  5B32 C;  3AFA A;  1P3B A;  1P3I D;  2XD1 A;  3MGQ A;  5GT0 B;  5AV6 A;  5B31 D;  3AZL D;  3W97 A;  3AZK B;  2ZY3 A;  5DNM A;  3AZJ D;  1P3K C;  1F66 B;  3C1B D;  4X23 C;  2LY8 A;  5E5A D;  5JRG C;  3O62 D;  3WTP C;  4DRB A;  5DNN B;  5BO0 B;  1P3O C;  4ZUX D;  3A1I A;  3B6G B;  3X1V B;  2NZD A;  5B1M B;  5GXQ A;  3LEL D;  4AWL B;  4KUD B;  2IO5 C;  4Z5T D;  3KWQ D;  3MNN A;  1U35 D;  1P3G D;  1KX5 A;  3W99 C;  2HIO D;  5CHL B;  5B33 C;  1H3O A;  1M1A C;  3AZG A;  3AV2 D;  3AZN B;  3AV1 C;  3EPJ A;  2FJ7 D;  5CPK D;  3MGS D;  5G49 A;  3WKJ D;  5BS7 C;  1P3I B;  3H0L C;  5B32 A;  3AZH C;  2ZY4 A;  2NQB D;  4CSR A;  5B31 B;  3AZL B;  1P34 C;  3AZJ B;  3C1B B;  1P3P D;  4WZS B;  1P3K A;  5B0Y C;  4G92 C;  5E5A B;  1N1J A;  5AV9 B;  4KHA B;  3VH6 W;  4X23 A;  2Y2O A;  4DRA A;  4CAY A;  5JRG A;  1KU5 A;  3MGP B;  4J8U B;  3WTP A;  4YM6 C;  3LEL B;  3AZF C;  1P3O A;  4Z5T B;  3KWQ B;  1U35 B;  3A6N C;  2VQR A;  1P3A D;  3P5J B;  4LD9 D;  5B0Z C;  5B24 C;  5B33 A;  1M1A A;  2L5A A;  5KDM B;  1P3L C;  5CPK B;  1W2E A;  5F99 D;  3KXB B;  3MGS B;  4WU8 C;  5AY8 D;  5C3I C;  3W96 C;  5B40 C;  3AV1 A;  2RVQ D;  4WU8 B;  5B40 B;  3F6T A;  5BS7 A;  3REI C;  2JSS A;  3AZH A;  5GSU D;  1P34 A;  1Z2C B;  4UUZ A;  1P3P B;  4R8P D;  1TZY D;  3WA9 D;  3LZ1 C;  5B0Y A;  4UPK A;  2F8N K;  3KFU G;  2YFW B;  3AZE C;  3VH6 T;  2ZY5 A;  3UT9 C;  4WV4 B;  4YM6 A;  3REJ D;  3W98 C;  1ID3 C;  4LD9 B;  5B31 G;  4JJN C;  3W98 B;  3B0D B;  3MVD D;  4H9N A;  5AV5 D;  5B0Z A;  4QLC C;  5B24 A;  1HQ3 B;  5AY8 B;  5CP6 C;  1P3L A;  4G91 C;  4WU8 A;  3H0R C;  3REK C;  3W96 A;  5B40 A;  5DNM D;  4J8X C;  3WAA C;  5GSU B;  3C1C C;  3REI A;  1ZLA D;  4R8P B;  4H9Q B;  3X1U C;  3REL D;  3X1S D;  4NFT A;  1HTA A;  3LZ1 A;  3WTP E;  3AYW D;  5GXQ D;  2YFW A;  2HUE C;  3AZI D;  3AZE A;  3EG5 B;  2ARO C;  1KX4 C;  3UTA D;  3REJ B;  5BNX B;  1M18 D;  3UT9 A;  4NE3 A;  5B1L D;  5JA4 B;  3MNN C;  5FUG B;  1S32 D;  3MVD B;  3W98 A;  3UTB C;  5CPI D;  1ID3 A;  5AV5 B;  4JJN A;  2Y2N A;  4YS3 C;  2XD5 A;  1HQ3 A;  4QLC A;  2CV5 D;  1AOI C;  5AVB C;  2BYK B;  2F8N A;  2DF4 C;  2Y2G A;  5CP6 A;  5AVB B;  4KGC D;  3REK A;  5GT0 C;  4J8X A;  3WAA A;  3NQJ B;  3AN2 D;  1KX3 C;  3C1C A;  3V9R B;  4EO5 B;  3X1S B;  3AZK C;  1F66 C;  3X1U A;  3MGR D;  1KX3 B;  3VH6 A;  3LZ0 C;  5B2I D;  3AYW B;  2YFV B;  3LZ0 B;  3EPH A;  3AZI B;  5DNN C;  3UTA B;  4J8W B;  3B6G C;  3X1V C;  3W99 D;  5B1M C;  2ARO A;  4AWL C;  1KX4 A;  4KUD C;  1S32 B;  1M1A D;  3AZM B;  5FUG A;  5CPI B;  3IP4 C;  3UTB A;  2CV5 B;  3AZN C;  4YS3 A;  3B6F D;  4KGC B;  1AOI A;  5AVB A;  1P3I C;  3H0M C;  1B6W A;  5B31 C;  3AZL C;  1P3M D;  3AN2 B;  5GT0 A;  3AZJ C;  1EQZ D;  3A1K A;  3MGR B;  2Y2P A;  3C1B C;  1KX3 A;  3AZK A;  1BH9 B;  4H9O B;  2RIQ A;  5B2I B;  4WU9 D;  4H9P B;  3KUY D;  1JFI B;  1F66 A;  5E5A C;  5AV9 C;  4YM6 D;  4XUJ D;  3LZ0 A;  3AZF D;  3O62 B;  4J8U C;  3MGP C;  5BT1 D;  4ZUX C;  5AVC D;  3A6N D;  3EPK A;  5AV8 D;  5B2J D;  1M19 D;  3LEL C;  1BH8 B;  5DNN A;  5BO0 A;  4ZUX B;  4Z5T C;  3KWQ C;  2Y2I A;  5B0Z D;  3B6G A;  2UWX A;  3X1V A;  5B1M A;  1U35 C;  3X1T D;  1P3G C;  5B24 D;  4KUD A;  4H9R B;  1P3G B;  4J8V D;  1P3F D;  2HIO B;  3AV2 B;  2PYO D;  5GT3 D;  2Y2L A;  3B6F B;  4Z66 D;  4NE6 A;  3KXB C;  3MGS C;  5CPK C;  3AZN A;  2FJ7 B;  2ZY2 A;  3NQU B;  5CPJ D;  3WKJ B;  2Y2Q A;  1P3M B;  1P3I A;  2NQB B;  1EQZ B;  5B31 A;  3AZL A;  3REH D;  1P3P C;  2DQN C;  3KUY B;  3AZJ A;  3C1B A;  4XUJ B;  3TU4 D;  3AL0 C;  5E5A A;  5AV9 A;  4KHA A;  5AVC B;  2Y2K A;  3LJA D;  1M19 B;  4XZQ D;  2G5H C;  4J8U A;  3MGP A;  4ZUX A;  3LEL A;  2BYM B;  4Z5T A;  3KWQ A;  4QLC D;  4J8V B;  1U35 A;  4LD9 C;  1P3G A;  4ZBJ C;  3B0D C;  1P3A B;  2F8N D;  2PYO B;  5GT3 B;  1TAF B;  4ZBJ B;  4Z66 B;  5F99 C;  1HQ3 C;  5AY8 C;  3AFA D;  5KDM A;  5F99 B;  1P3B D;  5CPK A;  2RVQ C;  3KXB A;  3MGS A;  3MGQ D;  3NQU A;  2J8P A;  5AV6 D;  3WKJ A;  2Y2H A;  5GSU C;  3W97 D;  3FDD A;  3REH B;  4R8P C;  1TZY B;  3WA9 B;  1P3P A;  2CWE A;  3TU4 B;  4E45 A;  3LJA B;  4XZQ B;  2NZD D;  4HGA B;  3MNN D;  5BNV B;  3B0C W;  3REJ C;  1KX5 D;  2JE5 A;  3AZG D;  1WWI A;  3MVD C;  4LD9 A;  5AV5 C;  3AFA B;  1P3B B;  5F99 A;  5B32 D;  3MGQ B;  5AY8 A;  5AV6 B;  1F1E A;  3W97 B;  5DNM B;  3AZK D;  1ZLA C;  5GSU A;  2ZM5 A;  1P3K D;  1ZLA B;  3X1S C;  4EO5 C;  4R8P A;  1TZY A;  4X23 D;  3REL B;  3WA9 A;  4H9Q A;  2JCH A;  5JRG D;  3AYW C;  3WTP D;  5GXQ B;  3AZI C;  1P3O D;  5B1M D;  3UTA C;  1KX5 B;  4J8W C;  4H9S C;  1M18 B;  5B1L C;  3AZG B;  3REJ A;  5BNX A;  1S32 C;  3AZM C;  5B1L B;  3B0C T;  5CPI C;  5B33 D;  5JA4 A;  3MVD A;  5AV5 A;  5G49 B;  2CV5 C;  3AV1 D;  5B32 B;  4CSR B;  4KGC C;  4E44 A;  3AZH D;  2BYK A;  2Y2J A;  1P34 D;  2FFF B;  1P3K B;  3AN2 C;  1ZLA A;  1N1J B;  4X23 B;  3MGR C;  5AV9 D;  3REL A;  3NQJ A;  5B0Y D;  3V9R A;  4CAY B;  3X1S A;  5JRG B;  5B2I C;  3WTP B;  2F8N G;  4J8U D;  3MGP D;  2Y2M A;  1P3O B;  3AYW A;  2YFV A;  3O62 C;  3AZI A;  2IO5 B;  3VH5 W;  3UTA A;  1M18 A;  1T3U A;  4J8W A;  3W99 B;  4H9S A;  5B33 B;  1M1A B;  5B1L A;  1S32 A;  3AZM A;  5CPI A;  2HIO C;  3KXB D;  1R4V A;  3AV1 B;  1P3L D;  3AV2 C;  4WU8 D;  2CV5 A;  2F8N H;  3B6F C;  3W96 D;  5B40 D;  3AZH B;  2FJ7 C;  3KSY A;  1P34 B;  4KGC A;  4UUZ B;  3REI D;  3WKJ C;  1WWS A;  1P3M C;  2NQB C;  4Z2M G;  1EQZ C;  3LZ1 D;  3AN2 A;  5B0Y B;  2G5I C;  4G92 B;  4WU9 C;  3KUY C;  3MGR A;  4WU9 B;  1BH9 A;  4H9O A;  5B2I A;  4XUJ C;  4H9P A;  3AZE D;  1JFI A;  4YM6 B;  3AZF B;  5BT1 C;  5AVC C;  5B32 G;  5AV8 C;  5B2J C;  3O62 A;  3UT9 D;  1M19 C;  3A6N B;  5AV8 B;  5B2J B;  4DQY B;  3W99 A;  4H9N B;  3X1T C;  1BH8 A;  1ID3 D;  3W98 D;  5B0Z B;  3VH5 T;  4JJN D;  4J8V C;  4WNN B;  4Z2M H;  5B24 B;  3X1T B;  1P3F C;  1HQ3 D;  1Q9C A;  1P3A C;  1P3L B;  4H9R A;  1P3F B;  2PYO C;  5GT3 C;  2HIO A;  5C3I B;  4Z66 C;  3W96 B;  5CP6 D;  3AV2 A;  4WJ3 C;  3REK D;  3B6F A;  1B67 A;  3REI B;  5CPJ C;  4J8X D;  3WAA D;  2FJ7 A;  5CPJ B;  3C1C D;  3EPL A;  3X1U D;  3LZ1 B;  3REH C;  1P3M A;  2NQB A;  1EQZ A;  1BFM A;  1TZY C;  3WA9 C;  4WU9 A;  3KUY A;  1PZR A;  3TU4 C;  3AZE B;  4XUJ A;  3LJA C;  3UT9 B;  3AZF A;  4XZQ C;  4HGA C;  2ARO D;  1KX4 D;  5AVC A;  3A6N A;  5AV8 A;  5B2J A;  1M19 A;  1ID3 B;  3R45 B;  4JJN B;  3X1T A;  3UTB D;  4WNN A;  2BYM A;  4QLC B;  4J8V A;  1P3F A;  4YS3 D;  2F8N B;  1P3A A;  5CP6 B;  1AOI D;  2PYO A;  4G91 B;  1TAF A;  5GT3 A;  5AVB D;  3AFA C;  4Z66 A;  1P3B C; 
#chains in the Genus database with same CATH homology
 3MGQ C;  4J8X B;  3WAA B;  3B0B A;  5AV6 C;  3C1C B;  4NE5 A;  3W97 C;  5CPJ A;  5DNM C;  5GT0 D;  3REK B;  3X1U B;  1KX3 D;  1F66 D;  2BG1 A;  3REH A;  3REL C;  3LZ0 D;  2HUE B;  3TU4 A;  2F2A C;  2NZD C;  4J8W D;  5GXQ C;  5DNN D;  2ARO B;  1KX4 B;  3LJA A;  2NZD B;  4XZQ A;  3B6G D;  3X1V D;  3VH5 A;  3AZM D;  1KX5 C;  3MNN B;  4KUD D;  3R45 A;  4M6B A;  1M18 C;  5BNV A;  3UTB B;  3AZG C;  2W8S A;  1H3O B;  1ULY A;  4YS3 B;  1AOI B;  3AZN D;  1A7W A;  5B32 C;  3AFA A;  1P3B A;  1P3I D;  2XD1 A;  3MGQ A;  5GT0 B;  5AV6 A;  5B31 D;  3AZL D;  3W97 A;  3AZK B;  2ZY3 A;  5DNM A;  3AZJ D;  1P3K C;  1F66 B;  3C1B D;  4X23 C;  2LY8 A;  5E5A D;  5JRG C;  3O62 D;  3WTP C;  4DRB A;  5DNN B;  5BO0 B;  1P3O C;  4ZUX D;  3A1I A;  3B6G B;  3X1V B;  2NZD A;  5B1M B;  5GXQ A;  3LEL D;  4AWL B;  4KUD B;  2IO5 C;  4Z5T D;  3KWQ D;  3MNN A;  1U35 D;  1P3G D;  1KX5 A;  3W99 C;  2HIO D;  5CHL B;  5B33 C;  1H3O A;  1M1A C;  3AZG A;  3AV2 D;  3AZN B;  3AV1 C;  3EPJ A;  2FJ7 D;  5CPK D;  3MGS D;  5G49 A;  3WKJ D;  5BS7 C;  1P3I B;  3H0L C;  5B32 A;  3AZH C;  2ZY4 A;  2NQB D;  4CSR A;  5B31 B;  3AZL B;  1P34 C;  3AZJ B;  3C1B B;  1P3P D;  4WZS B;  1P3K A;  5B0Y C;  4G92 C;  5E5A B;  1N1J A;  5AV9 B;  4KHA B;  3VH6 W;  4X23 A;  2Y2O A;  4DRA A;  4CAY A;  5JRG A;  1KU5 A;  3MGP B;  4J8U B;  3WTP A;  4YM6 C;  3LEL B;  3AZF C;  1P3O A;  4Z5T B;  3KWQ B;  1U35 B;  3A6N C;  2VQR A;  1P3A D;  3P5J B;  4LD9 D;  5B0Z C;  5B24 C;  5B33 A;  1M1A A;  2L5A A;  5KDM B;  1P3L C;  5CPK B;  1W2E A;  5F99 D;  3KXB B;  3MGS B;  4WU8 C;  5AY8 D;  5C3I C;  3W96 C;  5B40 C;  3AV1 A;  2RVQ D;  4WU8 B;  5B40 B;  3F6T A;  5BS7 A;  3REI C;  2JSS A;  3AZH A;  5GSU D;  1P34 A;  1Z2C B;  4UUZ A;  1P3P B;  4R8P D;  1TZY D;  3WA9 D;  3LZ1 C;  5B0Y A;  4UPK A;  2F8N K;  3KFU G;  2YFW B;  3AZE C;  3VH6 T;  2ZY5 A;  3UT9 C;  4WV4 B;  4YM6 A;  3REJ D;  3W98 C;  1ID3 C;  4LD9 B;  5B31 G;  4JJN C;  3W98 B;  3B0D B;  3MVD D;  4H9N A;  5AV5 D;  5B0Z A;  4QLC C;  5B24 A;  1HQ3 B;  5AY8 B;  5CP6 C;  1P3L A;  4G91 C;  4WU8 A;  3H0R C;  3REK C;  3W96 A;  5B40 A;  5DNM D;  4J8X C;  3WAA C;  5GSU B;  3C1C C;  3REI A;  1ZLA D;  4R8P B;  4H9Q B;  3X1U C;  3REL D;  3X1S D;  4NFT A;  1HTA A;  3LZ1 A;  3WTP E;  3AYW D;  5GXQ D;  2YFW A;  2HUE C;  3AZI D;  3AZE A;  3EG5 B;  2ARO C;  1KX4 C;  3UTA D;  3REJ B;  5BNX B;  1M18 D;  3UT9 A;  4NE3 A;  5B1L D;  5JA4 B;  3MNN C;  5FUG B;  1S32 D;  3MVD B;  3W98 A;  3UTB C;  5CPI D;  1ID3 A;  5AV5 B;  4JJN A;  2Y2N A;  4YS3 C;  2XD5 A;  1HQ3 A;  4QLC A;  2CV5 D;  1AOI C;  5AVB C;  2BYK B;  2F8N A;  2DF4 C;  2Y2G A;  5CP6 A;  5AVB B;  4KGC D;  3REK A;  5GT0 C;  4J8X A;  3WAA A;  3NQJ B;  3AN2 D;  1KX3 C;  3C1C A;  3V9R B;  4EO5 B;  3X1S B;  3AZK C;  1F66 C;  3X1U A;  3MGR D;  1KX3 B;  3VH6 A;  3LZ0 C;  5B2I D;  3AYW B;  2YFV B;  3LZ0 B;  3EPH A;  3AZI B;  5DNN C;  3UTA B;  4J8W B;  3B6G C;  3X1V C;  3W99 D;  5B1M C;  2ARO A;  4AWL C;  1KX4 A;  4KUD C;  1S32 B;  1M1A D;  3AZM B;  5FUG A;  5CPI B;  3IP4 C;  3UTB A;  2CV5 B;  3AZN C;  4YS3 A;  3B6F D;  4KGC B;  1AOI A;  5AVB A;  1P3I C;  3H0M C;  1B6W A;  5B31 C;  3AZL C;  1P3M D;  3AN2 B;  5GT0 A;  3AZJ C;  1EQZ D;  3A1K A;  3MGR B;  2Y2P A;  3C1B C;  1KX3 A;  3AZK A;  1BH9 B;  4H9O B;  2RIQ A;  5B2I B;  4WU9 D;  4H9P B;  3KUY D;  1JFI B;  1F66 A;  5E5A C;  5AV9 C;  4YM6 D;  4XUJ D;  3LZ0 A;  3AZF D;  3O62 B;  4J8U C;  3MGP C;  5BT1 D;  4ZUX C;  5AVC D;  3A6N D;  3EPK A;  5AV8 D;  5B2J D;  1M19 D;  3LEL C;  1BH8 B;  5DNN A;  5BO0 A;  4ZUX B;  4Z5T C;  3KWQ C;  2Y2I A;  5B0Z D;  3B6G A;  2UWX A;  3X1V A;  5B1M A;  1U35 C;  3X1T D;  1P3G C;  5B24 D;  4KUD A;  4H9R B;  1P3G B;  4J8V D;  1P3F D;  2HIO B;  3AV2 B;  2PYO D;  5GT3 D;  2Y2L A;  3B6F B;  4Z66 D;  4NE6 A;  3KXB C;  3MGS C;  5CPK C;  3AZN A;  2FJ7 B;  2ZY2 A;  3NQU B;  5CPJ D;  3WKJ B;  2Y2Q A;  1P3M B;  1P3I A;  2NQB B;  1EQZ B;  5B31 A;  3AZL A;  3REH D;  1P3P C;  2DQN C;  3KUY B;  3AZJ A;  3C1B A;  4XUJ B;  3TU4 D;  3AL0 C;  5E5A A;  5AV9 A;  4KHA A;  5AVC B;  2Y2K A;  3LJA D;  1M19 B;  4XZQ D;  2G5H C;  4J8U A;  3MGP A;  4ZUX A;  3LEL A;  2BYM B;  4Z5T A;  3KWQ A;  4QLC D;  4J8V B;  1U35 A;  4LD9 C;  1P3G A;  4ZBJ C;  3B0D C;  1P3A B;  2F8N D;  2PYO B;  5GT3 B;  1TAF B;  4ZBJ B;  4Z66 B;  5F99 C;  1HQ3 C;  5AY8 C;  3AFA D;  5KDM A;  5F99 B;  1P3B D;  5CPK A;  2RVQ C;  3KXB A;  3MGS A;  3MGQ D;  3NQU A;  2J8P A;  5AV6 D;  3WKJ A;  2Y2H A;  5GSU C;  3W97 D;  3FDD A;  3REH B;  4R8P C;  1TZY B;  3WA9 B;  1P3P A;  2CWE A;  3TU4 B;  4E45 A;  3LJA B;  4XZQ B;  2NZD D;  4HGA B;  3MNN D;  5BNV B;  3B0C W;  3REJ C;  1KX5 D;  2JE5 A;  3AZG D;  1WWI A;  3MVD C;  4LD9 A;  5AV5 C;  3AFA B;  1P3B B;  5F99 A;  5B32 D;  3MGQ B;  5AY8 A;  5AV6 B;  1F1E A;  3W97 B;  5DNM B;  3AZK D;  1ZLA C;  5GSU A;  2ZM5 A;  1P3K D;  1ZLA B;  3X1S C;  4EO5 C;  4R8P A;  1TZY A;  4X23 D;  3REL B;  3WA9 A;  4H9Q A;  2JCH A;  5JRG D;  3AYW C;  3WTP D;  5GXQ B;  3AZI C;  1P3O D;  5B1M D;  3UTA C;  1KX5 B;  4J8W C;  4H9S C;  1M18 B;  5B1L C;  3AZG B;  3REJ A;  5BNX A;  1S32 C;  3AZM C;  5B1L B;  3B0C T;  5CPI C;  5B33 D;  5JA4 A;  3MVD A;  5AV5 A;  5G49 B;  2CV5 C;  3AV1 D;  5B32 B;  4CSR B;  4KGC C;  4E44 A;  3AZH D;  2BYK A;  2Y2J A;  1P34 D;  2FFF B;  1P3K B;  3AN2 C;  1ZLA A;  1N1J B;  4X23 B;  3MGR C;  5AV9 D;  3REL A;  3NQJ A;  5B0Y D;  3V9R A;  4CAY B;  3X1S A;  5JRG B;  5B2I C;  3WTP B;  2F8N G;  4J8U D;  3MGP D;  2Y2M A;  1P3O B;  3AYW A;  2YFV A;  3O62 C;  3AZI A;  2IO5 B;  3VH5 W;  3UTA A;  1M18 A;  1T3U A;  4J8W A;  3W99 B;  4H9S A;  5B33 B;  1M1A B;  5B1L A;  1S32 A;  3AZM A;  5CPI A;  2HIO C;  3KXB D;  1R4V A;  3AV1 B;  1P3L D;  3AV2 C;  4WU8 D;  2CV5 A;  2F8N H;  3B6F C;  3W96 D;  5B40 D;  3AZH B;  2FJ7 C;  3KSY A;  1P34 B;  4KGC A;  4UUZ B;  3REI D;  3WKJ C;  1WWS A;  1P3M C;  2NQB C;  4Z2M G;  1EQZ C;  3LZ1 D;  3AN2 A;  5B0Y B;  2G5I C;  4G92 B;  4WU9 C;  3KUY C;  3MGR A;  4WU9 B;  1BH9 A;  4H9O A;  5B2I A;  4XUJ C;  4H9P A;  3AZE D;  1JFI A;  4YM6 B;  3AZF B;  5BT1 C;  5AVC C;  5B32 G;  5AV8 C;  5B2J C;  3O62 A;  3UT9 D;  1M19 C;  3A6N B;  5AV8 B;  5B2J B;  4DQY B;  3W99 A;  4H9N B;  3X1T C;  1BH8 A;  1ID3 D;  3W98 D;  5B0Z B;  3VH5 T;  4JJN D;  4J8V C;  4WNN B;  4Z2M H;  5B24 B;  3X1T B;  1P3F C;  1HQ3 D;  1Q9C A;  1P3A C;  1P3L B;  4H9R A;  1P3F B;  2PYO C;  5GT3 C;  2HIO A;  5C3I B;  4Z66 C;  3W96 B;  5CP6 D;  3AV2 A;  4WJ3 C;  3REK D;  3B6F A;  1B67 A;  3REI B;  5CPJ C;  4J8X D;  3WAA D;  2FJ7 A;  5CPJ B;  3C1C D;  3EPL A;  3X1U D;  3LZ1 B;  3REH C;  1P3M A;  2NQB A;  1EQZ A;  1BFM A;  1TZY C;  3WA9 C;  4WU9 A;  3KUY A;  1PZR A;  3TU4 C;  3AZE B;  4XUJ A;  3LJA C;  3UT9 B;  3AZF A;  4XZQ C;  4HGA C;  2ARO D;  1KX4 D;  5AVC A;  3A6N A;  5AV8 A;  5B2J A;  1M19 A;  1ID3 B;  3R45 B;  4JJN B;  3X1T A;  3UTB D;  4WNN A;  2BYM A;  4QLC B;  4J8V A;  1P3F A;  4YS3 D;  2F8N B;  1P3A A;  5CP6 B;  1AOI D;  2PYO A;  4G91 B;  1TAF A;  5GT3 A;  5AVB D;  3AFA C;  4Z66 A;  1P3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...